F484982

General Info

Members Datasets Scaffolds Average Seq Length
895 275 889 163

Family's Representative Sequence

Representative Sequence 3300025945|Ga0207679_10051060|Ga0207679_100510603
Length 185
Sequence LANFVLWQHVLHNVALFFDGNGMAKKEHISETPATQFLRKHGIAFSEHPYEYEEHGGTAVSSRELGVDEHHVVKTLIMQDEAAKPLIVLMHGDRKVSTKNLARQIGCKSVEPCKPEIANRHSGYLVGGTSPFGTRKAMPVYVEESILALDRIYINGGRRGYLVGIDPQILQDVLPIKAVHCALEE

Samples

Sample ID Description Type Environment
1 2643221556 Massilia sp. Root1485 Isolate Unclassified
2 2643221603 Noviherbaspirillum sp. Root189 Isolate Unclassified
3 2643221684 Massilia sp. Root133 Isolate Unclassified
4 2808606418 Herbaspirillum sp. SJZ107 Isolate Rhizosphere
5 2818991436 Collimonas arenae 515 Isolate Unclassified
6 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
7 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
8 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
9 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
10 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
11 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
12 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
13 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
14 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
15 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
16 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
17 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
18 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
19 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
20 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
21 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
22 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
23 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
24 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
25 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
26 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
27 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
28 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
29 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
30 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
31 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
32 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
33 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
34 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
35 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
36 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
37 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
38 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
39 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
40 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
41 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
42 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
43 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
44 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
45 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
46 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
47 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
48 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
49 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
50 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
51 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
52 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
53 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
54 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
55 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
56 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
57 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
58 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
59 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
60 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
61 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
62 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
63 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
64 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
65 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
66 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
67 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
68 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
69 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
70 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
71 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
72 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
73 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
74 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
75 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
76 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
77 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
78 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
79 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
80 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
81 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
82 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
83 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
84 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
85 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
86 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
87 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
88 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
89 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
90 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
91 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
92 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
93 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
94 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
95 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
96 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
97 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
98 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
115 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
116 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
117 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
118 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
119 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
120 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
121 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
122 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
123 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
124 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
125 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
126 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
127 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
128 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
129 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
130 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
131 3300044669 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2E Metagenome Unclassified
132 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
133 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
134 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
135 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
136 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
137 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
138 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
139 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
140 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
141 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
142 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
143 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
144 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
145 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
146 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
147 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
148 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
149 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
150 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
151 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
152 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
153 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
154 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
155 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
156 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
157 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
158 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
159 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
160 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
161 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
162 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
163 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
164 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
165 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
166 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
167 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
168 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
169 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
170 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
171 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
172 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
173 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
174 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
175 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
176 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
177 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
178 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
179 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
180 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
181 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
182 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
183 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
184 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
185 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
186 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
187 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
188 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
189 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
190 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
191 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
192 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
193 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
194 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
195 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
196 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
197 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
198 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
199 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
200 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
201 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
202 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
203 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
204 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
205 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
206 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
207 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
208 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
209 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
210 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
211 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
212 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
213 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
214 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
215 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
216 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
217 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
218 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
219 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
220 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
221 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
222 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
223 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
224 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
225 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
226 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
227 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
228 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
229 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
230 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
231 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
232 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
233 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
234 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
235 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
236 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
237 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
238 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
239 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
240 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
241 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
242 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
243 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
244 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
245 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
246 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
247 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
248 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
249 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
250 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
251 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
252 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
253 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
254 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
255 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
256 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
257 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
258 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
259 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
260 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
261 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
262 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
263 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
264 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
265 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
266 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
267 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
268 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
269 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
270 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
271 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
272 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
273 3300053141 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere Metagenome Endosphere
274 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
275 8047673197 Telluria mixta LMG 11547 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.33
Metatranscriptomes 0
Isolates 0.67

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.17
Nodule 0
Rhizoplane 5.47
Rhizosphere 81.68
Stem 0
Stem Tuber 0
Unclassified 2.68

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25162J39368_1000025 3300002737 Bacteria 228879
2 JGI25152J39213_1000113 3300002773 Bacteria 56427
3 JGI25159J45721_1001183 3300002987 Bacteria 11139
4 JGI25165J46597_1000054 3300003214 Bacteria 228891
5 JGI25153J46596_10003648 3300003215 Bacteria 8524
6 rootH1_10115141 3300003323 Bacteria 1609
7 JGI25160J50197_1025236 3300003354 Bacteria 1667
8 Ga0055538_1000026 3300003751 Bacteria 228891
9 Ga0055539_1000033 3300003752 Bacteria 228891
10 Ga0055533_1000044 3300003756 Bacteria 228891
11 Ga0055525_1000052 3300003759 Bacteria 228891
12 Ga0055542_1035252 3300003762 Bacteria 615
13 Ga0055529_1000559 3300003763 Bacteria 30993
14 Ga0055526_1002342 3300003771 Bacteria 12875
15 Ga0055537_1000156 3300003773 Bacteria 51559
16 Ga0055537_1000223 3300003773 Bacteria 41876
17 Ga0055524_1000029 3300003775 Bacteria 201332
18 Ga0055524_1000911 3300003775 Bacteria 19092
19 Ga0055524_1001937 3300003775 Bacteria 11143
20 Ga0055524_1014405 3300003775 Bacteria 2931
21 Ga0055534_1000059 3300003784 Bacteria 84386
22 Ga0055528_1000341 3300003790 Bacteria 38736
23 Ga0055530_10000982 3300003791 Bacteria 22949
24 Ga0055540_1000011 3300003792 Bacteria 282927
25 Ga0055531_10005065 3300003794 Bacteria 7796
26 Ga0055541_1000049 3300003841 Bacteria 134251
27 Ga0055543_1007213 3300004625 Bacteria 2594
28 Ga0065165_1000050 3300005262 Bacteria 195237
29 Ga0065165_1123139 3300005262 Bacteria 627
30 Ga0070658_10065773 3300005327 Bacteria 2960
31 Ga0070658_11010069 3300005327 Bacteria 723
32 Ga0070682_100226048 3300005337 Bacteria 1335
33 Ga0070660_100087360 3300005339 Bacteria 2454
34 Ga0070660_100455637 3300005339 Bacteria 1061
35 Ga0070661_100159617 3300005344 Bacteria 1707
36 Ga0070674_100812915 3300005356 Bacteria 808
37 Ga0070659_100001171 3300005366 Bacteria 19137
38 Ga0070659_100171919 3300005366 Bacteria 1775
39 Ga0070659_100517452 3300005366 Bacteria 1018
40 Ga0070662_100985157 3300005457 Bacteria 721
41 Ga0070662_101254675 3300005457 Bacteria 637
42 Ga0070681_11741806 3300005458 Bacteria 550
43 Ga0070664_100107001 3300005564 Bacteria 2437
44 Ga0070664_100599259 3300005564 Bacteria 1022
45 Ga0068857_100164580 3300005577 Bacteria 2014
46 Ga0068856_100608498 3300005614 Bacteria 1114
47 Ga0068852_101327083 3300005616 Bacteria 741
48 Ga0075365_10343833 3300006038 Bacteria 1051
49 Ga0075368_10001821 3300006042 Bacteria 6850
50 Ga0075363_100593302 3300006048 Bacteria 663
51 Ga0075363_100656208 3300006048 Bacteria 631
52 Ga0075362_10215775 3300006177 Bacteria 937
53 Ga0075362_10655318 3300006177 Bacteria 545
54 Ga0075367_10207317 3300006178 Bacteria 1225
55 Ga0075367_10336151 3300006178 Bacteria 952
56 Ga0075366_10036417 3300006195 Bacteria 2901
57 Ga0075370_10038901 3300006353 Bacteria 2678
58 Ga0068871_100143560 3300006358 Bacteria 2031
59 Ga0105244_10000480 3300009036 Bacteria 36191
60 Ga0105244_10134345 3300009036 Bacteria 1193
61 Ga0105240_10568606 3300009093 Bacteria 1252
62 Ga0105245_10053253 3300009098 Bacteria 3632
63 Ga0105245_10123486 3300009098 Bacteria 2421
64 Ga0105243_10022107 3300009148 Bacteria 4833
65 Ga0105243_12511276 3300009148 Bacteria 554
66 Ga0105241_10055559 3300009174 Bacteria 3033
67 Ga0105242_10007522 3300009176 Bacteria 8382
68 Ga0105242_10066580 3300009176 Bacteria 2976
69 Ga0105242_10095195 3300009176 Bacteria 2513
70 Ga0105237_10321740 3300009545 Bacteria 1550
71 Ga0105238_10487451 3300009551 Bacteria 1232
72 Ga0105239_11033339 3300010375 Bacteria 945
73 Ga0105246_10601402 3300011119 Bacteria 950
74 Ga0157373_10176431 3300013100 Bacteria 1504
75 Ga0157373_10738372 3300013100 Bacteria 723
76 Ga0157371_10000001 3300013102 Bacteria 1162285
77 Ga0157370_10295736 3300013104 Bacteria 1495
78 Ga0157370_10694636 3300013104 Bacteria 929
79 Ga0157374_10353200 3300013296 Bacteria 1461
80 Ga0157372_11493346 3300013307 Bacteria 779
81 Ga0157372_12176394 3300013307 Bacteria 637
82 Ga0182008_10020723 3300014497 Bacteria 3381
83 Ga0182008_10326811 3300014497 Bacteria 808
84 Ga0157377_10294195 3300014745 Bacteria 1069
85 Ga0157376_10688789 3300014969 Bacteria 1026
86 Ga0182006_1001667 3300015261 Bacteria 13062
87 Ga0182007_10000938 3300015262 Bacteria 16060
88 Ga0182007_10022023 3300015262 Bacteria 2254
89 Ga0182005_1063825 3300015265 Bacteria 1007
90 Ga0213872_10000002 3300021361 Bacteria 554092
91 Ga0213872_10001708 3300021361 Bacteria 13825
92 Ga0213872_10002383 3300021361 Bacteria 11110
93 Ga0213872_10011383 3300021361 Bacteria 4207
94 Ga0209760_103509 3300025207 Bacteria 1388
95 Ga0209436_100207 3300025208 Bacteria 27286
96 Ga0209436_123378 3300025208 Bacteria 776
97 Ga0209784_100020 3300025224 Bacteria 412353
98 Ga0209566_100020 3300025225 Bacteria 412353
99 Ga0209674_100035 3300025226 Bacteria 412353
100 Ga0209563_100015 3300025230 Bacteria 879901
101 Ga0209563_100038 3300025230 Bacteria 412353
102 Ga0207427_105041 3300025231 Bacteria 1978
103 Ga0209437_100066 3300025233 Bacteria 327883
104 Ga0209437_109794 3300025233 Bacteria 1483
105 Ga0207425_1000006 3300025245 Bacteria 808854
106 Ga0207425_1000136 3300025245 Bacteria 65594
107 Ga0207425_1000533 3300025245 Bacteria 23036
108 Ga0209026_1010283 3300025250 Bacteria 1757
109 Ga0209677_100031 3300025253 Bacteria 329719
110 Ga0209148_1000708 3300025254 Bacteria 26773
111 Ga0209129_1000090 3300025258 Bacteria 175755
112 Ga0209129_1000921 3300025258 Bacteria 17923
113 Ga0209233_1000060 3300025261 Bacteria 412379
114 Ga0209565_1000006 3300025263 Bacteria 897294
115 Ga0209565_1000382 3300025263 Bacteria 37853
116 Ga0209565_1004283 3300025263 Bacteria 4393
117 Ga0209565_1007626 3300025263 Bacteria 2901
118 Ga0209455_1000051 3300025272 Bacteria 369818
119 Ga0209673_1000004 3300025273 Bacteria 896155
120 Ga0209673_1019827 3300025273 Bacteria 2402
121 Ga0209130_1000065 3300025284 Bacteria 195251
122 Ga0209130_1002373 3300025284 Bacteria 9546
123 Ga0209675_1000006 3300025291 Bacteria 732267
124 Ga0209675_1000410 3300025291 Bacteria 35247
125 Ga0209675_1016205 3300025291 Bacteria 2179
126 Ga0209675_1018709 3300025291 Bacteria 1930
127 Ga0209564_1000064 3300025295 Bacteria 316431
128 Ga0209564_1000639 3300025295 Bacteria 53129
129 Ga0209564_1000888 3300025295 Bacteria 39497
130 Ga0209758_1000047 3300025297 Bacteria 360971
131 Ga0209050_1000469 3300025298 Bacteria 71511
132 Ga0209050_1000532 3300025298 Bacteria 63063
133 Ga0209050_1002061 3300025298 Bacteria 18514
134 Ga0209050_1019780 3300025298 Bacteria 2540
135 Ga0209256_1000113 3300025299 Bacteria 175296
136 Ga0209256_1001427 3300025299 Bacteria 24751
137 Ga0209256_1001603 3300025299 Bacteria 22130
138 Ga0209256_1001909 3300025299 Bacteria 19072
139 Ga0207426_1001538 3300025302 Bacteria 18766
140 Ga0209051_1000020 3300025303 Bacteria 508628
141 Ga0209051_1020254 3300025303 Bacteria 2871
142 Ga0209257_1000010 3300025304 Bacteria 1158682
143 Ga0209257_1000085 3300025304 Bacteria 291117
144 Ga0207655_1003539 3300025728 Bacteria 11572
145 Ga0207705_10002897 3300025909 Bacteria 13128
146 Ga0207654_10032195 3300025911 Bacteria 2895
147 Ga0207671_10912285 3300025914 Bacteria 694
148 Ga0207657_10061945 3300025919 Bacteria 3204
149 Ga0207652_10211589 3300025921 Bacteria 1746
150 Ga0207694_10882180 3300025924 Bacteria 756
151 Ga0207690_10002213 3300025932 Bacteria 11851
152 Ga0207690_10002750 3300025932 Bacteria 10627
153 Ga0207690_10490810 3300025932 Bacteria 992
154 Ga0207706_10629088 3300025933 Bacteria 920
155 Ga0207706_10784069 3300025933 Bacteria 810
156 Ga0207686_10293704 3300025934 Bacteria 1204
157 Ga0207686_10546229 3300025934 Bacteria 905
158 Ga0207709_10029335 3300025935 Bacteria 3190
159 Ga0207679_10051060 3300025945 Bacteria 3025
160 Ga0207679_10450296 3300025945 Bacteria 1141
161 Ga0207679_10614763 3300025945 Bacteria 980
162 Ga0207703_10632528 3300026035 Bacteria 1014
163 Ga0207678_10704551 3300026067 Bacteria 889
164 Ga0207674_10078354 3300026116 Bacteria 3309
165 Ga0207698_11142473 3300026142 Bacteria 792
166 Ga0316181_1128485 3300030744 Bacteria 1742
167 Ga0307408_100004035 3300031548 Bacteria 10009
168 Ga0265314_10010190 3300031711 Bacteria 7872
169 Ga0307416_100119364 3300032002 Bacteria 2345
170 Ga0307416_102129875 3300032002 Bacteria 663
171 Ga0395899_0000166 3300037312 Bacteria 101803
172 Ga0395899_0001136 3300037312 Bacteria 23550
173 Ga0395899_0001535 3300037312 Bacteria 19501
174 Ga0395899_0017193 3300037312 Bacteria 5509
175 Ga0395899_0044535 3300037312 Bacteria 3306
176 Ga0395899_0056524 3300037312 Bacteria 2900
177 Ga0395899_0370675 3300037312 Bacteria 953
178 Ga0395899_0383572 3300037312 Bacteria 933
179 Ga0395900_0001738 3300037418 Bacteria 25108
180 Ga0395900_0004042 3300037418 Bacteria 15653
181 Ga0395900_0007959 3300037418 Bacteria 10910
182 Ga0395900_0411485 3300037418 Bacteria 1314
183 Ga0395900_0654947 3300037418 Bacteria 986
184 Ga0395898_0188585 3300037466 Bacteria 1970
185 Ga0395898_1198604 3300037466 Bacteria 690
186 Ga0395905_0001136 3300037471 Bacteria 33276
187 Ga0395905_0008938 3300037471 Bacteria 9836
188 Ga0395905_0011248 3300037471 Bacteria 8651
189 Ga0395905_0038162 3300037471 Bacteria 4506
190 Ga0395905_0077263 3300037471 Bacteria 3119
191 Ga0395905_0083009 3300037471 Bacteria 3002
192 Ga0395905_0154855 3300037471 Bacteria 2155
193 Ga0395905_0196949 3300037471 Bacteria 1889
194 Ga0395905_0552876 3300037471 Bacteria 1052
195 Ga0395905_0559830 3300037471 Bacteria 1044
196 Ga0395901_0000073 3300038443 Bacteria 139769
197 Ga0395901_0000839 3300038443 Bacteria 33897
198 Ga0395901_0004488 3300038443 Bacteria 14071
199 Ga0395901_0334639 3300038443 Bacteria 1564
200 Ga0395901_0355453 3300038443 Bacteria 1511
201 Ga0395901_0398003 3300038443 Bacteria 1415
202 Ga0395901_1200475 3300038443 Bacteria 724
203 Ga0395901_1960837 3300038443 Bacteria 532
204 Ga0436361_0001263 3300039447 Bacteria 13847
205 Ga0436361_0040499 3300039447 Bacteria 2929
206 Ga0436361_0101333 3300039447 Bacteria 28993
207 Ga0436361_0372384 3300039447 Bacteria 12311
208 Ga0436361_1014017 3300039447 Bacteria 2442
209 Ga0439450_008166 3300042008 Bacteria 1945
210 Ga0439450_018941 3300042008 Bacteria 1452
211 Ga0439455_0005979 3300042012 Bacteria 2501
212 Ga0439455_0101225 3300042012 Bacteria 796
213 Ga0450898_069776 3300042134 Bacteria 703
214 Ga0450904_000596 3300042139 Bacteria 6715
215 Ga0439458_0014933 3300042157 Bacteria 1755
216 Ga0466969_0149345 3300044656 Bacteria 1077
217 Ga0466969_0196228 3300044656 Bacteria 921
218 Ga0466969_0467318 3300044656 Bacteria 574
219 Ga0466972_0000106 3300044658 Bacteria 72246
220 Ga0466972_0002922 3300044658 Bacteria 8466
221 Ga0466972_0136530 3300044658 Bacteria 1154
222 Ga0466972_0145132 3300044658 Bacteria 1117
223 Ga0466972_0158515 3300044658 Bacteria 1063
224 Ga0466972_0306808 3300044658 Bacteria 742
225 Ga0466972_0457693 3300044658 Bacteria 599
226 Ga0466981_0339809 3300044669 Bacteria 922
227 Ga0466965_0004505 3300044683 Bacteria 6202
228 Ga0466965_0033512 3300044683 Bacteria 2510
229 Ga0466965_0066663 3300044683 Bacteria 1805
230 Ga0466965_0330600 3300044683 Bacteria 831
231 Ga0466966_0071099 3300044684 Bacteria 2180
232 Ga0466966_0105636 3300044684 Bacteria 1738
233 Ga0466966_0262599 3300044684 Bacteria 1039
234 Ga0466966_0519125 3300044684 Bacteria 716
235 Ga0466961_0132724 3300044693 Bacteria 1560
236 Ga0466961_0402583 3300044693 Bacteria 830
237 Ga0466963_0073422 3300044694 Bacteria 2306
238 Ga0466963_0320258 3300044694 Bacteria 1091
239 Ga0466964_0000728 3300044706 Bacteria 10682
240 Ga0466964_0003729 3300044706 Bacteria 5581
241 Ga0466964_0010785 3300044706 Bacteria 3449
242 Ga0466964_0012676 3300044706 Bacteria 3192
243 Ga0466964_0025493 3300044706 Bacteria 2309
244 Ga0466964_0341631 3300044706 Bacteria 766
245 Ga0466971_0140645 3300044719 Bacteria 1123
246 Ga0466971_0148782 3300044719 Bacteria 1092
247 Ga0466971_0559341 3300044719 Bacteria 568
248 Ga0466968_0000386 3300044735 Bacteria 14481
249 Ga0466968_0003278 3300044735 Bacteria 5964
250 Ga0466970_0051282 3300044765 Bacteria 2201
251 Ga0466970_0064029 3300044765 Bacteria 1971
252 Ga0466970_0333178 3300044765 Bacteria 859
253 Ga0466970_0392132 3300044765 Bacteria 791
254 Ga0466970_0404496 3300044765 Bacteria 779
255 Ga0466957_0002985 3300044842 Bacteria 9183
256 Ga0466957_0034651 3300044842 Bacteria 3028
257 Ga0466957_0341388 3300044842 Bacteria 1014
258 Ga0466960_0068056 3300044901 Bacteria 1765
259 Ga0466960_0168931 3300044901 Bacteria 1179
260 Ga0466959_0022516 3300045049 Bacteria 4659
261 Ga0466959_0026664 3300045049 Bacteria 4283
262 Ga0466959_0027535 3300045049 Bacteria 4215
263 Ga0466959_0264386 3300045049 Bacteria 1184
264 Ga0466959_0572825 3300045049 Bacteria 760
265 Ga0466959_0616215 3300045049 Bacteria 729
266 Ga0466958_0188162 3300045836 Bacteria 1311
267 Ga0466958_0556574 3300045836 Bacteria 745
268 Ga0466967_0375580 3300045976 Bacteria 1379
269 Ga0495617_000098 3300046452 Bacteria 62441
270 Ga0495627_000339 3300046453 Bacteria 44178
271 Ga0495627_037169 3300046453 Bacteria 1510
272 Ga0495603_0009020 3300046455 Bacteria 6033
273 Ga0495603_0094476 3300046455 Bacteria 1747
274 Ga0495590_0000007 3300046457 Bacteria 331108
275 Ga0495590_0000548 3300046457 Bacteria 17938
276 Ga0495590_0004462 3300046457 Bacteria 5644
277 Ga0495590_0024909 3300046457 Bacteria 2106
278 Ga0495590_0046620 3300046457 Bacteria 1512
279 Ga0495591_000039 3300046458 Bacteria 156460
280 Ga0495591_011723 3300046458 Bacteria 3300
281 Ga0495629_0006747 3300046459 Bacteria 8488
282 Ga0495629_0007531 3300046459 Bacteria 8024
283 Ga0495629_0026369 3300046459 Bacteria 4128
284 Ga0495629_0048157 3300046459 Bacteria 2988
285 Ga0495638_0008378 3300046460 Bacteria 7332
286 Ga0495638_0060292 3300046460 Bacteria 2347
287 Ga0495638_0067333 3300046460 Bacteria 2199
288 Ga0495638_0093161 3300046460 Bacteria 1812
289 Ga0495651_0008683 3300046462 Bacteria 7797
290 Ga0495651_0052325 3300046462 Bacteria 3145
291 Ga0495653_0020617 3300046463 Bacteria 5341
292 Ga0495653_0098763 3300046463 Bacteria 2119
293 Ga0495653_0288474 3300046463 Bacteria 1074
294 Ga0495650_0000215 3300046471 Bacteria 122533
295 Ga0495650_0000399 3300046471 Bacteria 72364
296 Ga0495650_0004623 3300046471 Bacteria 9341
297 Ga0495650_0158811 3300046471 Bacteria 807
298 Ga0495580_0097687 3300046472 Bacteria 2042
299 Ga0495582_0002580 3300046473 Bacteria 10077
300 Ga0495582_0009872 3300046473 Bacteria 5254
301 Ga0495582_0041250 3300046473 Bacteria 2543
302 Ga0495605_0000085 3300046474 Bacteria 121011
303 Ga0495605_0000108 3300046474 Bacteria 104865
304 Ga0495605_0016345 3300046474 Bacteria 4017
305 Ga0495605_0040365 3300046474 Bacteria 2331
306 Ga0495605_0066671 3300046474 Bacteria 1709
307 Ga0495605_0073320 3300046474 Bacteria 1612
308 Ga0495584_0000022 3300046491 Bacteria 128471
309 Ga0495584_0000282 3300046491 Bacteria 35813
310 Ga0495584_0000712 3300046491 Bacteria 21938
311 Ga0495584_0005119 3300046491 Bacteria 6963
312 Ga0495584_0005545 3300046491 Bacteria 6680
313 Ga0495584_0005748 3300046491 Bacteria 6547
314 Ga0495584_0009279 3300046491 Bacteria 5071
315 Ga0495584_0012573 3300046491 Bacteria 4321
316 Ga0495584_0018562 3300046491 Bacteria 3535
317 Ga0495584_0021684 3300046491 Bacteria 3261
318 Ga0495584_0025629 3300046491 Bacteria 2989
319 Ga0495584_0086379 3300046491 Bacteria 1580
320 Ga0495584_0180271 3300046491 Bacteria 1073
321 Ga0495584_0251467 3300046491 Bacteria 898
322 Ga0495585_0000004 3300046492 Bacteria 348260
323 Ga0495585_0000511 3300046492 Bacteria 36704
324 Ga0495585_0001726 3300046492 Bacteria 16648
325 Ga0495585_0005383 3300046492 Bacteria 8075
326 Ga0495585_0030054 3300046492 Bacteria 3091
327 Ga0495585_0034170 3300046492 Bacteria 2874
328 Ga0495585_0041943 3300046492 Bacteria 2565
329 Ga0495585_0042715 3300046492 Bacteria 2537
330 Ga0495585_0067397 3300046492 Bacteria 1957
331 Ga0495585_0072426 3300046492 Bacteria 1877
332 Ga0495585_0131902 3300046492 Bacteria 1314
333 Ga0495585_0152878 3300046492 Bacteria 1202
334 Ga0495594_0001773 3300046499 Bacteria 11200
335 Ga0495594_0010527 3300046499 Bacteria 4797
336 Ga0495594_0049169 3300046499 Bacteria 2317
337 Ga0495594_0117322 3300046499 Bacteria 1503
338 Ga0495594_0325154 3300046499 Bacteria 876
339 Ga0495594_0339412 3300046499 Bacteria 855
340 Ga0495596_0000949 3300046500 Bacteria 17280
341 Ga0495596_0001624 3300046500 Bacteria 12773
342 Ga0495596_0003214 3300046500 Bacteria 8393
343 Ga0495596_0011020 3300046500 Bacteria 3914
344 Ga0495596_0011412 3300046500 Bacteria 3835
345 Ga0495596_0016268 3300046500 Bacteria 3092
346 Ga0495596_0046084 3300046500 Bacteria 1713
347 Ga0495596_0065053 3300046500 Bacteria 1418
348 Ga0495596_0122694 3300046500 Bacteria 1008
349 Ga0495596_0183052 3300046500 Bacteria 814
350 Ga0495596_0183896 3300046500 Bacteria 812
351 Ga0495607_0001375 3300046501 Bacteria 21626
352 Ga0495607_0002838 3300046501 Bacteria 13749
353 Ga0495607_0010459 3300046501 Bacteria 6237
354 Ga0495607_0016161 3300046501 Bacteria 4819
355 Ga0495607_0025669 3300046501 Bacteria 3662
356 Ga0495607_0032432 3300046501 Bacteria 3188
357 Ga0495607_0038363 3300046501 Bacteria 2870
358 Ga0495607_0052612 3300046501 Bacteria 2357
359 Ga0495607_0054161 3300046501 Bacteria 2312
360 Ga0495607_0054816 3300046501 Bacteria 2296
361 Ga0495607_0084522 3300046501 Bacteria 1735
362 Ga0495607_0089364 3300046501 Bacteria 1672
363 Ga0495607_0196973 3300046501 Bacteria 999
364 Ga0495607_0477580 3300046501 Bacteria 556
365 Ga0495583_0000205 3300046506 Bacteria 99711
366 Ga0495583_0000503 3300046506 Bacteria 56256
367 Ga0495583_0001311 3300046506 Bacteria 25872
368 Ga0495583_0001962 3300046506 Bacteria 18882
369 Ga0495583_0009479 3300046506 Bacteria 5810
370 Ga0495583_0012515 3300046506 Bacteria 4793
371 Ga0495583_0014697 3300046506 Bacteria 4302
372 Ga0495583_0018943 3300046506 Bacteria 3607
373 Ga0495583_0038775 3300046506 Bacteria 2249
374 Ga0495583_0051683 3300046506 Bacteria 1872
375 Ga0495583_0078726 3300046506 Bacteria 1435
376 Ga0495583_0126685 3300046506 Bacteria 1071
377 Ga0495606_0003514 3300046507 Bacteria 16554
378 Ga0495606_0009080 3300046507 Bacteria 8474
379 Ga0495606_0020159 3300046507 Bacteria 4928
380 Ga0495606_0035319 3300046507 Bacteria 3418
381 Ga0495606_0095915 3300046507 Bacteria 1815
382 Ga0495606_0108112 3300046507 Bacteria 1681
383 Ga0495606_0130524 3300046507 Bacteria 1494
384 Ga0495606_0203397 3300046507 Bacteria 1127
385 Ga0495608_0005174 3300046511 Bacteria 9322
386 Ga0495608_0235526 3300046511 Bacteria 1145
387 Ga0495610_0002370 3300046512 Bacteria 15919
388 Ga0495616_0000145 3300046513 Bacteria 62415
389 Ga0495616_0006111 3300046513 Bacteria 7334
390 Ga0495616_0019651 3300046513 Bacteria 3684
391 Ga0495616_0023073 3300046513 Bacteria 3352
392 Ga0495616_0023467 3300046513 Bacteria 3318
393 Ga0495616_0023937 3300046513 Bacteria 3281
394 Ga0495616_0026826 3300046513 Bacteria 3060
395 Ga0495616_0030132 3300046513 Bacteria 2854
396 Ga0495616_0030640 3300046513 Bacteria 2824
397 Ga0495616_0050009 3300046513 Bacteria 2092
398 Ga0495616_0254969 3300046513 Bacteria 752
399 Ga0495616_0315242 3300046513 Bacteria 657
400 Ga0495618_0048774 3300046514 Bacteria 2674
401 Ga0495628_0075644 3300046516 Bacteria 2622
402 Ga0495628_0196522 3300046516 Bacteria 1521
403 Ga0495630_0112698 3300046517 Bacteria 2060
404 Ga0495631_0000109 3300046518 Bacteria 54778
405 Ga0495631_0003940 3300046518 Bacteria 8019
406 Ga0495631_0005545 3300046518 Bacteria 6598
407 Ga0495631_0012615 3300046518 Bacteria 4124
408 Ga0495631_0016316 3300046518 Bacteria 3544
409 Ga0495631_0034041 3300046518 Bacteria 2285
410 Ga0495631_0042379 3300046518 Bacteria 2011
411 Ga0495631_0065948 3300046518 Bacteria 1566
412 Ga0495631_0070867 3300046518 Bacteria 1506
413 Ga0495631_0078332 3300046518 Bacteria 1426
414 Ga0495631_0208358 3300046518 Bacteria 835
415 Ga0495632_0000374 3300046519 Bacteria 42607
416 Ga0495632_0000837 3300046519 Bacteria 27084
417 Ga0495632_0000878 3300046519 Bacteria 26434
418 Ga0495632_0008595 3300046519 Bacteria 6240
419 Ga0495632_0034059 3300046519 Bacteria 2609
420 Ga0495632_0160272 3300046519 Bacteria 1036
421 Ga0495637_0000006 3300046520 Bacteria 435763
422 Ga0495637_0020548 3300046520 Bacteria 3038
423 Ga0495637_0079433 3300046520 Bacteria 1310
424 Ga0495643_0004391 3300046522 Bacteria 9879
425 Ga0495643_0009053 3300046522 Bacteria 6243
426 Ga0495643_0016438 3300046522 Bacteria 4345
427 Ga0495643_0023678 3300046522 Bacteria 3488
428 Ga0495643_0033446 3300046522 Bacteria 2844
429 Ga0495643_0082257 3300046522 Bacteria 1673
430 Ga0495643_0194769 3300046522 Bacteria 976
431 Ga0495644_0003513 3300046523 Bacteria 6201
432 Ga0495644_0014229 3300046523 Bacteria 3047
433 Ga0495644_0015622 3300046523 Bacteria 2909
434 Ga0495644_0020393 3300046523 Bacteria 2529
435 Ga0495644_0034899 3300046523 Bacteria 1898
436 Ga0495644_0059359 3300046523 Bacteria 1438
437 Ga0495644_0063171 3300046523 Bacteria 1391
438 Ga0495644_0087356 3300046523 Bacteria 1175
439 Ga0495648_0000044 3300046524 Bacteria 175587
440 Ga0495648_0000220 3300046524 Bacteria 65480
441 Ga0495648_0001128 3300046524 Bacteria 27039
442 Ga0495648_0005380 3300046524 Bacteria 10646
443 Ga0495648_0023328 3300046524 Bacteria 4240
444 Ga0495648_0058840 3300046524 Bacteria 2295
445 Ga0495648_0151096 3300046524 Bacteria 1211
446 Ga0495663_0001768 3300046525 Bacteria 6701
447 Ga0495663_0062026 3300046525 Bacteria 1177
448 Ga0495666_0002219 3300046526 Bacteria 9680
449 Ga0495666_0016526 3300046526 Bacteria 3676
450 Ga0495666_0072657 3300046526 Bacteria 1633
451 Ga0495666_0105640 3300046526 Bacteria 1325
452 Ga0495666_0204699 3300046526 Bacteria 906
453 Ga0495642_0000345 3300046528 Bacteria 25250
454 Ga0495642_0000855 3300046528 Bacteria 14486
455 Ga0495642_0000973 3300046528 Bacteria 13340
456 Ga0495642_0005659 3300046528 Bacteria 4797
457 Ga0495642_0006545 3300046528 Bacteria 4470
458 Ga0495642_0013267 3300046528 Bacteria 3185
459 Ga0495642_0014029 3300046528 Bacteria 3105
460 Ga0495642_0016151 3300046528 Bacteria 2908
461 Ga0495642_0035100 3300046528 Bacteria 2022
462 Ga0495642_0042052 3300046528 Bacteria 1860
463 Ga0495642_0055708 3300046528 Bacteria 1632
464 Ga0495642_0072036 3300046528 Bacteria 1446
465 Ga0495642_0119843 3300046528 Bacteria 1128
466 Ga0495642_0134824 3300046528 Bacteria 1064
467 Ga0495642_0192829 3300046528 Bacteria 887
468 Ga0495642_0207926 3300046528 Bacteria 853
469 Ga0495642_0315299 3300046528 Bacteria 686
470 Ga0495642_0407922 3300046528 Bacteria 599
471 Ga0495642_0412970 3300046528 Bacteria 595
472 Ga0495642_0451145 3300046528 Bacteria 568
473 Ga0495642_0463556 3300046528 Bacteria 560
474 Ga0495652_0040140 3300046529 Bacteria 4045
475 Ga0495652_0100237 3300046529 Bacteria 2350
476 Ga0495652_0133839 3300046529 Bacteria 1958
477 Ga0495652_0462056 3300046529 Bacteria 887
478 Ga0495654_0055220 3300046530 Bacteria 1923
479 Ga0495654_0058293 3300046530 Bacteria 1863
480 Ga0495654_0242222 3300046530 Bacteria 754
481 Ga0495665_0016817 3300046531 Bacteria 3937
482 Ga0495665_0035373 3300046531 Bacteria 2668
483 Ga0495665_0036847 3300046531 Bacteria 2610
484 Ga0495665_0069956 3300046531 Bacteria 1849
485 Ga0495665_0095622 3300046531 Bacteria 1560
486 Ga0495665_0123045 3300046531 Bacteria 1358
487 Ga0495665_0156093 3300046531 Bacteria 1190
488 Ga0495640_0098849 3300046533 Bacteria 1918
489 Ga0495586_0001597 3300046535 Bacteria 12462
490 Ga0495586_0025338 3300046535 Bacteria 3173
491 Ga0495586_0250564 3300046535 Bacteria 1010
492 Ga0495587_0045984 3300046536 Bacteria 2592
493 Ga0495587_0048486 3300046536 Bacteria 2515
494 Ga0495587_0120294 3300046536 Bacteria 1504
495 Ga0495609_0000002 3300046538 Bacteria 739816
496 Ga0495609_0003491 3300046538 Bacteria 8983
497 Ga0495609_0005062 3300046538 Bacteria 7033
498 Ga0495609_0009241 3300046538 Bacteria 4776
499 Ga0495609_0026878 3300046538 Bacteria 2632
500 Ga0495609_0056646 3300046538 Bacteria 1736
501 Ga0495609_0131357 3300046538 Bacteria 1072
502 Ga0495609_0189319 3300046538 Bacteria 864
503 Ga0495597_0000728 3300046542 Bacteria 26264
504 Ga0495597_0003368 3300046542 Bacteria 9389
505 Ga0495597_0005788 3300046542 Bacteria 6480
506 Ga0495597_0008812 3300046542 Bacteria 5034
507 Ga0495597_0009769 3300046542 Bacteria 4724
508 Ga0495597_0012372 3300046542 Bacteria 4117
509 Ga0495597_0013875 3300046542 Bacteria 3851
510 Ga0495597_0016128 3300046542 Bacteria 3531
511 Ga0495597_0052554 3300046542 Bacteria 1794
512 Ga0495597_0053597 3300046542 Bacteria 1773
513 Ga0495597_0069081 3300046542 Bacteria 1525
514 Ga0495597_0125493 3300046542 Bacteria 1067
515 Ga0495597_0170657 3300046542 Bacteria 883
516 Ga0495597_0290279 3300046542 Bacteria 636
517 Ga0495645_0130814 3300046543 Bacteria 1759
518 Ga0495645_0167613 3300046543 Bacteria 1514
519 Ga0495622_0011236 3300046557 Bacteria 4134
520 Ga0495622_0015781 3300046557 Bacteria 3512
521 Ga0495622_0018729 3300046557 Bacteria 3224
522 Ga0495622_0025647 3300046557 Bacteria 2753
523 Ga0495622_0055709 3300046557 Bacteria 1833
524 Ga0495622_0086760 3300046557 Bacteria 1439
525 Ga0495633_0002136 3300046558 Bacteria 14168
526 Ga0495633_0006080 3300046558 Bacteria 7234
527 Ga0495633_0008371 3300046558 Bacteria 5835
528 Ga0495633_0011681 3300046558 Bacteria 4716
529 Ga0495633_0012418 3300046558 Bacteria 4531
530 Ga0495633_0016582 3300046558 Bacteria 3793
531 Ga0495633_0037601 3300046558 Bacteria 2315
532 Ga0495633_0104849 3300046558 Bacteria 1311
533 Ga0495633_0235768 3300046558 Bacteria 836
534 Ga0495633_0247122 3300046558 Bacteria 814
535 Ga0495633_0275002 3300046558 Bacteria 766
536 Ga0495667_0231925 3300046559 Bacteria 1177
537 Ga0495667_0496383 3300046559 Bacteria 765
538 Ga0495656_0020973 3300046615 Bacteria 2539
539 Ga0495656_0050622 3300046615 Bacteria 1774
540 Ga0495656_0165156 3300046615 Bacteria 1078
541 Ga0495656_0174703 3300046615 Bacteria 1052
542 Ga0495656_0340762 3300046615 Bacteria 775
543 Ga0495656_0367891 3300046615 Bacteria 747
544 Ga0495656_0409324 3300046615 Bacteria 710
545 Ga0495656_0560493 3300046615 Bacteria 609
546 Ga0495668_0000049 3300046616 Bacteria 217657
547 Ga0495668_0000381 3300046616 Bacteria 58825
548 Ga0495668_0003532 3300046616 Bacteria 11642
549 Ga0495668_0006731 3300046616 Bacteria 7479
550 Ga0495668_0009144 3300046616 Bacteria 6105
551 Ga0495668_0013569 3300046616 Bacteria 4800
552 Ga0495668_0013747 3300046616 Bacteria 4763
553 Ga0495668_0016302 3300046616 Bacteria 4318
554 Ga0495668_0054690 3300046616 Bacteria 2205
555 Ga0495668_0056907 3300046616 Bacteria 2157
556 Ga0495668_0071128 3300046616 Bacteria 1912
557 Ga0495668_0124885 3300046616 Bacteria 1408
558 Ga0495668_0185474 3300046616 Bacteria 1139
559 Ga0495668_0224537 3300046616 Bacteria 1028
560 Ga0495634_0021797 3300046642 Bacteria 4522
561 Ga0495634_0357407 3300046642 Bacteria 874
562 Ga0495611_0000792 3300046648 Bacteria 17558
563 Ga0495611_0006401 3300046648 Bacteria 5018
564 Ga0495611_0014135 3300046648 Bacteria 3406
565 Ga0495611_0015201 3300046648 Bacteria 3290
566 Ga0495611_0034654 3300046648 Bacteria 2232
567 Ga0495611_0069724 3300046648 Bacteria 1606
568 Ga0495611_0069744 3300046648 Bacteria 1606
569 Ga0495611_0186576 3300046648 Bacteria 968
570 Ga0495611_0282512 3300046648 Bacteria 766
571 Ga0495625_0002502 3300046660 Bacteria 19799
572 Ga0495625_0012924 3300046660 Bacteria 6741
573 Ga0495625_0014139 3300046660 Bacteria 6387
574 Ga0495625_0015696 3300046660 Bacteria 5984
575 Ga0495625_0032646 3300046660 Bacteria 3858
576 Ga0495625_0046840 3300046660 Bacteria 3118
577 Ga0495625_0267637 3300046660 Bacteria 1104
578 Ga0495625_0365009 3300046660 Bacteria 909
579 Ga0495625_0399264 3300046660 Bacteria 859
580 Ga0495635_0000550 3300046663 Bacteria 23878
581 Ga0495635_0033671 3300046663 Bacteria 3554
582 Ga0495635_0276034 3300046663 Bacteria 1130
583 Ga0495659_0001108 3300046664 Bacteria 9381
584 Ga0495661_0000271 3300046665 Bacteria 59543
585 Ga0495661_0000669 3300046665 Bacteria 34300
586 Ga0495661_0001851 3300046665 Bacteria 16899
587 Ga0495661_0002553 3300046665 Bacteria 13961
588 Ga0495661_0006640 3300046665 Bacteria 8122
589 Ga0495661_0013647 3300046665 Bacteria 5454
590 Ga0495661_0020472 3300046665 Bacteria 4318
591 Ga0495661_0022888 3300046665 Bacteria 4061
592 Ga0495661_0033698 3300046665 Bacteria 3228
593 Ga0495661_0033979 3300046665 Bacteria 3212
594 Ga0495661_0049028 3300046665 Bacteria 2563
595 Ga0495661_0049935 3300046665 Bacteria 2534
596 Ga0495661_0053205 3300046665 Bacteria 2435
597 Ga0495661_0059717 3300046665 Bacteria 2268
598 Ga0495661_0081566 3300046665 Bacteria 1863
599 Ga0495661_0097590 3300046665 Bacteria 1659
600 Ga0495661_0100325 3300046665 Bacteria 1630
601 Ga0495661_0134822 3300046665 Bacteria 1349
602 Ga0495661_0153844 3300046665 Bacteria 1240
603 Ga0495661_0210562 3300046665 Bacteria 1012
604 Ga0495661_0356154 3300046665 Bacteria 719
605 Ga0495661_0365770 3300046665 Bacteria 707
606 Ga0495588_0000135 3300046674 Bacteria 117387
607 Ga0495588_0012486 3300046674 Bacteria 4016
608 Ga0495588_0031315 3300046674 Bacteria 2676
609 Ga0495588_0058779 3300046674 Bacteria 1987
610 Ga0495588_0066330 3300046674 Bacteria 1873
611 Ga0495588_0126933 3300046674 Bacteria 1345
612 Ga0495588_0338219 3300046674 Bacteria 791
613 Ga0495657_0234066 3300046675 Bacteria 1110
614 Ga0495657_0426633 3300046675 Bacteria 778
615 Ga0495599_0063568 3300046678 Bacteria 2306
616 Ga0495623_0001059 3300046679 Bacteria 18646
617 Ga0495623_0008133 3300046679 Bacteria 6817
618 Ga0495623_0070013 3300046679 Bacteria 2185
619 Ga0495623_0235427 3300046679 Bacteria 1036
620 Ga0495623_0506636 3300046679 Bacteria 636
621 Ga0495646_0022937 3300046680 Bacteria 3932
622 Ga0495646_0154871 3300046680 Bacteria 1272
623 Ga0495646_0398296 3300046680 Bacteria 716
624 Ga0495669_0000305 3300046684 Bacteria 27179
625 Ga0495669_0000799 3300046684 Bacteria 13449
626 Ga0495669_0002838 3300046684 Bacteria 7112
627 Ga0495669_0017143 3300046684 Bacteria 3105
628 Ga0495669_0122123 3300046684 Bacteria 1221
629 Ga0495669_0320044 3300046684 Bacteria 748
630 Ga0495613_0286659 3300046689 Bacteria 1142
631 Ga0495613_0379778 3300046689 Bacteria 966
632 Ga0495624_0014318 3300046690 Bacteria 5385
633 Ga0495624_0252561 3300046690 Bacteria 1066
634 Ga0495670_0000228 3300046691 Bacteria 25521
635 Ga0495670_0003938 3300046691 Bacteria 7289
636 Ga0495670_0015923 3300046691 Bacteria 3695
637 Ga0495670_0020451 3300046691 Bacteria 3264
638 Ga0495670_0031767 3300046691 Bacteria 2624
639 Ga0495670_0037133 3300046691 Bacteria 2428
640 Ga0495670_0067354 3300046691 Bacteria 1807
641 Ga0495670_0141631 3300046691 Bacteria 1257
642 Ga0495670_0149249 3300046691 Bacteria 1225
643 Ga0495670_0253442 3300046691 Bacteria 938
644 Ga0495670_0305143 3300046691 Bacteria 853
645 Ga0495671_0003333 3300046692 Bacteria 9922
646 Ga0495671_0013975 3300046692 Bacteria 4329
647 Ga0495671_0055395 3300046692 Bacteria 1964
648 Ga0495671_0102502 3300046692 Bacteria 1398
649 Ga0495671_0117980 3300046692 Bacteria 1295
650 Ga0495671_0173295 3300046692 Bacteria 1048
651 Ga0495649_0000183 3300046694 Bacteria 54730
652 Ga0495649_0007999 3300046694 Bacteria 6391
653 Ga0495649_0020647 3300046694 Bacteria 3692
654 Ga0495649_0031590 3300046694 Bacteria 2919
655 Ga0495649_0032307 3300046694 Bacteria 2883
656 Ga0495649_0112774 3300046694 Bacteria 1441
657 Ga0495649_0136722 3300046694 Bacteria 1291
658 Ga0495649_0151027 3300046694 Bacteria 1220
659 Ga0495649_0164796 3300046694 Bacteria 1161
660 Ga0495649_0197656 3300046694 Bacteria 1045
661 Ga0495649_0284466 3300046694 Bacteria 844
662 Ga0495589_0000030 3300046794 Bacteria 170254
663 Ga0495589_0000569 3300046794 Bacteria 25465
664 Ga0495589_0000651 3300046794 Bacteria 22766
665 Ga0495589_0001070 3300046794 Bacteria 16432
666 Ga0495589_0005293 3300046794 Bacteria 6818
667 Ga0495589_0008207 3300046794 Bacteria 5460
668 Ga0495589_0119183 3300046794 Bacteria 1271
669 Ga0495589_0199644 3300046794 Bacteria 944
670 Ga0495600_0002426 3300046809 Bacteria 10699
671 Ga0495600_0006351 3300046809 Bacteria 7191
672 Ga0495600_0022603 3300046809 Bacteria 4039
673 Ga0495660_0000423 3300046810 Bacteria 35820
674 Ga0495660_0006880 3300046810 Bacteria 6696
675 Ga0495660_0007415 3300046810 Bacteria 6439
676 Ga0495660_0021905 3300046810 Bacteria 3654
677 Ga0495660_0040808 3300046810 Bacteria 2571
678 Ga0495660_0118332 3300046810 Bacteria 1343
679 Ga0495660_0130794 3300046810 Bacteria 1259
680 Ga0495581_0011916 3300047315 Bacteria 5031
681 Ga0495581_0032783 3300047315 Bacteria 3007
682 Ga0495581_0120996 3300047315 Bacteria 1523
683 Ga0495581_0190603 3300047315 Bacteria 1199
684 Ga0495604_0003344 3300047317 Bacteria 12784
685 Ga0495604_0019754 3300047317 Bacteria 5391
686 Ga0495604_0088429 3300047317 Bacteria 2304
687 Ga0495604_0189198 3300047317 Bacteria 1435
688 Ga0495604_0314912 3300047317 Bacteria 1047
689 Ga0495604_0438072 3300047317 Bacteria 855
690 Ga0495636_0004778 3300047318 Bacteria 5309
691 Ga0495636_0011362 3300047318 Bacteria 3524
692 Ga0495636_0011720 3300047318 Bacteria 3473
693 Ga0495636_0121647 3300047318 Bacteria 1155
694 Ga0495674_0010531 3300047319 Bacteria 8752
695 Ga0495672_0000118 3300047320 Bacteria 124396
696 Ga0495672_0000833 3300047320 Bacteria 32978
697 Ga0495672_0002309 3300047320 Bacteria 17689
698 Ga0495672_0007939 3300047320 Bacteria 7912
699 Ga0495672_0027983 3300047320 Bacteria 3574
700 Ga0495676_0000014 3300047321 Bacteria 203356
701 Ga0495676_0010619 3300047321 Bacteria 8340
702 Ga0495676_0345336 3300047321 Bacteria 996
703 Ga0495680_0004551 3300047322 Bacteria 13247
704 Ga0495680_0007141 3300047322 Bacteria 10289
705 Ga0495683_0001362 3300047323 Bacteria 16270
706 Ga0495683_0010467 3300047323 Bacteria 4903
707 Ga0495683_0012774 3300047323 Bacteria 4405
708 Ga0495683_0017254 3300047323 Bacteria 3743
709 Ga0495683_0054023 3300047323 Bacteria 2003
710 Ga0495683_0079870 3300047323 Bacteria 1597
711 Ga0495683_0094389 3300047323 Bacteria 1445
712 Ga0495683_0108924 3300047323 Bacteria 1324
713 Ga0495683_0201756 3300047323 Bacteria 896
714 Ga0495687_000047 3300047443 Bacteria 206452
715 Ga0495687_000088 3300047443 Bacteria 142499
716 Ga0495687_000112 3300047443 Bacteria 124725
717 Ga0495687_001101 3300047443 Bacteria 26384
718 Ga0495687_004364 3300047443 Bacteria 9619
719 Ga0495687_023192 3300047443 Bacteria 2967
720 Ga0495675_0002690 3300047444 Bacteria 10648
721 Ga0495675_0005401 3300047444 Bacteria 7787
722 Ga0495675_0093817 3300047444 Bacteria 1882
723 Ga0495675_0152454 3300047444 Bacteria 1427
724 Ga0495677_0000044 3300047445 Bacteria 74340
725 Ga0495677_0000267 3300047445 Bacteria 22920
726 Ga0495677_0000597 3300047445 Bacteria 14827
727 Ga0495677_0002482 3300047445 Bacteria 7240
728 Ga0495677_0008179 3300047445 Bacteria 3885
729 Ga0495677_0009695 3300047445 Bacteria 3550
730 Ga0495677_0044776 3300047445 Bacteria 1622
731 Ga0495677_0061427 3300047445 Bacteria 1393
732 Ga0495677_0100954 3300047445 Bacteria 1092
733 Ga0495677_0126804 3300047445 Bacteria 975
734 Ga0495677_0142204 3300047445 Bacteria 921
735 Ga0495677_0156893 3300047445 Bacteria 877
736 Ga0495679_002450 3300047446 Bacteria 9451
737 Ga0495679_017633 3300047446 Bacteria 2552
738 Ga0495679_021483 3300047446 Bacteria 2227
739 Ga0495679_033387 3300047446 Bacteria 1644
740 Ga0495679_054268 3300047446 Bacteria 1194
741 Ga0495679_056614 3300047446 Bacteria 1161
742 Ga0495685_005376 3300047447 Bacteria 4178
743 Ga0495685_013729 3300047447 Bacteria 2749
744 Ga0495685_048782 3300047447 Bacteria 1439
745 Ga0495685_129590 3300047447 Bacteria 825
746 Ga0495673_0003502 3300047469 Bacteria 10329
747 Ga0495673_0017617 3300047469 Bacteria 3620
748 Ga0495673_0084524 3300047469 Bacteria 1308
749 Ga0495673_0280506 3300047469 Bacteria 601
750 Ga0495681_0000494 3300047470 Bacteria 30235
751 Ga0495681_0001608 3300047470 Bacteria 16816
752 Ga0495681_0002931 3300047470 Bacteria 12061
753 Ga0495681_0034546 3300047470 Bacteria 2518
754 Ga0495681_0053828 3300047470 Bacteria 1882
755 Ga0495681_0078548 3300047470 Bacteria 1478
756 Ga0495681_0088986 3300047470 Bacteria 1366
757 Ga0495681_0093686 3300047470 Bacteria 1322
758 Ga0495681_0100073 3300047470 Bacteria 1268
759 Ga0495681_0102027 3300047470 Bacteria 1253
760 Ga0495681_0256654 3300047470 Bacteria 688
761 Ga0495686_0000140 3300047472 Bacteria 144956
762 Ga0495686_0000334 3300047472 Bacteria 77666
763 Ga0495686_0002406 3300047472 Bacteria 17757
764 Ga0495686_0111925 3300047472 Bacteria 1636
765 Ga0495686_0529686 3300047472 Bacteria 617
766 Ga0495593_0000527 3300047673 Bacteria 21657
767 Ga0495593_0003264 3300047673 Bacteria 9729
768 Ga0495593_0149577 3300047673 Bacteria 1181
769 Ga0495602_0025977 3300048088 Bacteria 5658
770 Ga0495602_0986329 3300048088 Bacteria 556
771 Ga0495614_0000102 3300048089 Bacteria 29128
772 Ga0495614_0023379 3300048089 Bacteria 2666
773 Ga0495614_0054397 3300048089 Bacteria 1717
774 Ga0495626_0000006 3300048091 Bacteria 284977
775 Ga0495626_0000034 3300048091 Bacteria 183391
776 Ga0495626_0000266 3300048091 Bacteria 59029
777 Ga0495626_0005480 3300048091 Bacteria 7405
778 Ga0495626_0007513 3300048091 Bacteria 6056
779 Ga0495626_0013767 3300048091 Bacteria 4195
780 Ga0495626_0016227 3300048091 Bacteria 3787
781 Ga0495626_0017401 3300048091 Bacteria 3630
782 Ga0495626_0020154 3300048091 Bacteria 3326
783 Ga0495626_0023074 3300048091 Bacteria 3067
784 Ga0495626_0029639 3300048091 Bacteria 2646
785 Ga0495626_0030999 3300048091 Bacteria 2576
786 Ga0495626_0074522 3300048091 Bacteria 1518
787 Ga0495626_0106096 3300048091 Bacteria 1220
788 Ga0495626_0176967 3300048091 Bacteria 886
789 Ga0495626_0256161 3300048091 Bacteria 700
790 Ga0495626_0348276 3300048091 Bacteria 578
791 Ga0496100_0243847 3300048903 Bacteria 1327
792 Ga0496100_0454562 3300048903 Bacteria 982
793 Ga0496101_0022215 3300048904 Bacteria 4366
794 Ga0496101_0244705 3300048904 Bacteria 1396
795 Ga0496102_0000098 3300048905 Bacteria 123789
796 Ga0496102_0094865 3300048905 Bacteria 2764
797 Ga0496102_0179741 3300048905 Bacteria 1993
798 Ga0496102_0309568 3300048905 Bacteria 1488
799 Ga0496103_0008363 3300048906 Bacteria 6147
800 Ga0496103_0041731 3300048906 Bacteria 2821
801 Ga0496103_0046056 3300048906 Bacteria 2692
802 Ga0496103_0121085 3300048906 Bacteria 1666
803 Ga0496103_0375428 3300048906 Bacteria 914
804 Ga0496104_0589002 3300048907 Bacteria 1022
805 Ga0496105_0040708 3300048908 Bacteria 3832
806 Ga0496105_0166624 3300048908 Bacteria 1808
807 Ga0496106_0013411 3300048909 Bacteria 6050
808 Ga0496106_0062533 3300048909 Bacteria 2827
809 Ga0496106_0815295 3300048909 Bacteria 740
810 Ga0496107_0225263 3300048910 Bacteria 1395
811 Ga0496107_0410892 3300048910 Bacteria 1006
812 Ga0496107_0542586 3300048910 Bacteria 861
813 Ga0496108_1108740 3300048911 Bacteria 672
814 Ga0496109_0092957 3300048912 Bacteria 2790
815 Ga0496109_0211166 3300048912 Bacteria 1825
816 Ga0496110_0002669 3300048913 Bacteria 13468
817 Ga0496110_0045966 3300048913 Bacteria 3818
818 Ga0496110_0249326 3300048913 Bacteria 1616
819 Ga0496111_0208352 3300048914 Bacteria 1452
820 Ga0496111_0252607 3300048914 Bacteria 1308
821 Ga0496111_0457807 3300048914 Bacteria 941
822 Ga0496111_0657642 3300048914 Bacteria 764
823 Ga0496112_0139260 3300048915 Bacteria 2396
824 Ga0496112_0437897 3300048915 Bacteria 1245
825 Ga0496112_0607054 3300048915 Bacteria 1026
826 Ga0496112_0713615 3300048915 Bacteria 930
827 Ga0496112_0990347 3300048915 Bacteria 761
828 Ga0496113_0008438 3300048916 Bacteria 6713
829 Ga0496113_0017843 3300048916 Bacteria 4934
830 Ga0496113_0017975 3300048916 Bacteria 4917
831 Ga0496113_0237182 3300048916 Bacteria 1455
832 Ga0496113_0589497 3300048916 Bacteria 890
833 Ga0496114_0040237 3300048917 Bacteria 3869
834 Ga0496114_0425640 3300048917 Bacteria 1176
835 Ga0496114_0478765 3300048917 Bacteria 1101
836 Ga0496114_0948190 3300048917 Bacteria 743
837 Ga0496115_0040128 3300048918 Bacteria 3720
838 Ga0496115_0194577 3300048918 Bacteria 1675
839 Ga0496115_0362040 3300048918 Bacteria 1182
840 Ga0496121_0076420 3300048924 Bacteria 2670
841 Ga0496122_0000169 3300048925 Bacteria 155380
842 Ga0496122_0023062 3300048925 Bacteria 5506
843 Ga0496122_0026183 3300048925 Bacteria 5039
844 Ga0496122_0265768 3300048925 Bacteria 949
845 Ga0496123_0005792 3300048926 Bacteria 12268
846 Ga0496123_0008550 3300048926 Bacteria 9385
847 Ga0496123_0085025 3300048926 Bacteria 1905
848 Ga0496124_0004722 3300048927 Bacteria 15731
849 Ga0496124_0009352 3300048927 Bacteria 10098
850 Ga0496124_0046015 3300048927 Bacteria 3739
851 Ga0496124_0131246 3300048927 Bacteria 1990
852 Ga0496124_0253910 3300048927 Bacteria 1298
853 Ga0496125_0006783 3300048928 Bacteria 12294
854 Ga0496125_0111082 3300048928 Bacteria 1985
855 Ga0496125_0222682 3300048928 Bacteria 1214
856 Ga0496126_0227525 3300048929 Bacteria 1564
857 Ga0495678_000056 3300049459 Bacteria 149598
858 Ga0495678_000079 3300049459 Bacteria 122038
859 Ga0495678_001101 3300049459 Bacteria 22735
860 Ga0495678_002357 3300049459 Bacteria 12968
861 Ga0495678_003821 3300049459 Bacteria 9067
862 Ga0495678_006752 3300049459 Bacteria 6046
863 Ga0495678_025528 3300049459 Bacteria 2535
864 Ga0495682_0000448 3300049460 Bacteria 28585
865 Ga0495682_0001431 3300049460 Bacteria 12906
866 Ga0495682_0005202 3300049460 Bacteria 5433
867 Ga0495682_0012758 3300049460 Bacteria 3214
868 Ga0495682_0251141 3300049460 Bacteria 625
869 Ga0501034_0171781 3300049571 Bacteria 2135
870 Ga0501036_0507640 3300049572 Bacteria 1003
871 Ga0501047_0349107 3300049581 Bacteria 1316
872 Ga0501222_015788 3300049662 Bacteria 998
873 Ga0501227_002385 3300049665 Bacteria 4149
874 Ga0501238_000845 3300049671 Bacteria 3484
875 Ga0501263_035316 3300049760 Bacteria 719
876 Ga0501279_001228 3300049775 Bacteria 3364
877 Ga0501035_0001651 3300049822 Bacteria 22551
878 Ga0501035_0002736 3300049822 Bacteria 17098
879 Ga0501044_0001803 3300049823 Bacteria 24994
880 Ga0501044_0117837 3300049823 Bacteria 2659
881 Ga0501044_0830805 3300049823 Bacteria 802
882 nmdc:mga03n38_429648_c1 3300050490 Bacteria 732
883 Ga0495601_0010336 3300053077 Bacteria 5552
884 Ga0495619_0956198 3300053085 Bacteria 574
885 Ga0500595_004294 3300053119 Bacteria 6423
886 Ga0500618_038892 3300053125 Bacteria 1097
887 Ga0500574_027913 3300053141 Bacteria 1492
888 Ga0466962_0225335 3300061719 Bacteria 918
889 Ga0466962_0533699 3300061719 Bacteria 595

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300038443 Ga0395901_1960837 Ga0395901_1960837_76_522 148
2 3300044684 Ga0466966_0519125 Ga0466966_0519125_243_689 148
3 3300046675 Ga0495657_0426633 Ga0495657_0426633_299_745 148
4 3300046501 Ga0495607_0054161 Ga0495607_0054161_34_483 149
5 3300009098 Ga0105245_10053253 Ga0105245_100532532 157
6 3300009176 Ga0105242_10007522 Ga0105242_100075224 157
7 3300025934 Ga0207686_10546229 Ga0207686_105462292 157
8 3300026035 Ga0207703_10632528 Ga0207703_106325281 157
9 3300047317 Ga0495604_0314912 Ga0495604_0314912_483_956 157
10 3300047447 Ga0495685_129590 Ga0495685_129590_22_531 157
11 iso_pu_bacteria 2818991436 2819542987 157
12 3300006048 Ga0075363_100593302 Ga0075363_1005933021 158
13 iso_pu_bacteria 2643221556 2643797863 158
14 iso_pu_bacteria 2643221603 2644027891 158
15 iso_pu_bacteria 2643221684 2644473043 158
16 iso_pu_bacteria 2808606418 2809144352 158
17 iso_pu_bacteria 8047673197 8047677865 158
18 3300032002 Ga0307416_102129875 Ga0307416_1021298751 160
19 3300042134 Ga0450898_069776 Ga0450898_069776_172_660 160
20 3300046452 Ga0495617_000098 Ga0495617_000098_21448_21936 160
21 3300046460 Ga0495638_0060292 Ga0495638_0060292_84_572 160
22 3300046491 Ga0495584_0000022 Ga0495584_0000022_110595_111083 160
23 3300046492 Ga0495585_0000004 Ga0495585_0000004_167535_168023 160
24 3300046492 Ga0495585_0067397 Ga0495585_0067397_76_564 160
25 3300046500 Ga0495596_0000949 Ga0495596_0000949_10883_11371 160
26 3300046506 Ga0495583_0000205 Ga0495583_0000205_88602_89090 160
27 3300046506 Ga0495583_0038775 Ga0495583_0038775_909_1397 160
28 3300046513 Ga0495616_0050009 Ga0495616_0050009_221_709 160
29 3300046523 Ga0495644_0003513 Ga0495644_0003513_3239_3727 160
30 3300046523 Ga0495644_0059359 Ga0495644_0059359_178_666 160
31 3300046524 Ga0495648_0000044 Ga0495648_0000044_114683_115171 160
32 3300046558 Ga0495633_0008371 Ga0495633_0008371_4892_5380 160
33 3300046558 Ga0495633_0012418 Ga0495633_0012418_3941_4429 160
34 3300046558 Ga0495633_0037601 Ga0495633_0037601_108_596 160
35 3300046615 Ga0495656_0409324 Ga0495656_0409324_146_634 160
36 3300046665 Ga0495661_0013647 Ga0495661_0013647_1451_1939 160
37 3300046684 Ga0495669_0002838 Ga0495669_0002838_531_1019 160
38 3300046691 Ga0495670_0003938 Ga0495670_0003938_3575_4063 160
39 3300046691 Ga0495670_0305143 Ga0495670_0305143_70_558 160
40 3300047318 Ga0495636_0011720 Ga0495636_0011720_2624_3112 160
41 3300047445 Ga0495677_0156893 Ga0495677_0156893_75_563 160
42 3300048905 Ga0496102_0179741 Ga0496102_0179741_1239_1727 160
43 3300048906 Ga0496103_0046056 Ga0496103_0046056_779_1267 160
44 3300049822 Ga0501035_0002736 Ga0501035_0002736_16378_16866 160
45 3300049823 Ga0501044_0001803 Ga0501044_0001803_16595_17083 160
46 3300002737 JGI25162J39368_1000025 JGI25162J39368_1000025139 161
47 3300002773 JGI25152J39213_1000113 JGI25152J39213_100011319 161
48 3300002987 JGI25159J45721_1001183 JGI25159J45721_10011833 161
49 3300003214 JGI25165J46597_1000054 JGI25165J46597_1000054140 161
50 3300003215 JGI25153J46596_10003648 JGI25153J46596_100036488 161
51 3300003323 rootH1_10115141 rootH1_101151413 161
52 3300003354 JGI25160J50197_1025236 JGI25160J50197_10252362 161
53 3300003751 Ga0055538_1000026 Ga0055538_100002686 161
54 3300003752 Ga0055539_1000033 Ga0055539_100003386 161
55 3300003756 Ga0055533_1000044 Ga0055533_100004486 161
56 3300003759 Ga0055525_1000052 Ga0055525_100005286 161
57 3300003762 Ga0055542_1035252 Ga0055542_10352521 161
58 3300003763 Ga0055529_1000559 Ga0055529_10005599 161
59 3300003771 Ga0055526_1002342 Ga0055526_10023427 161
60 3300003773 Ga0055537_1000156 Ga0055537_100015630 161
61 3300003773 Ga0055537_1000223 Ga0055537_100022314 161
62 3300003775 Ga0055524_1000029 Ga0055524_1000029126 161
63 3300003775 Ga0055524_1000911 Ga0055524_10009113 161
64 3300003775 Ga0055524_1001937 Ga0055524_10019376 161
65 3300003775 Ga0055524_1014405 Ga0055524_10144052 161
66 3300003784 Ga0055534_1000059 Ga0055534_100005978 161
67 3300003790 Ga0055528_1000341 Ga0055528_100034122 161
68 3300003791 Ga0055530_10000982 Ga0055530_100009825 161
69 3300003792 Ga0055540_1000011 Ga0055540_100001192 161
70 3300003794 Ga0055531_10005065 Ga0055531_100050658 161
71 3300003841 Ga0055541_1000049 Ga0055541_100004954 161
72 3300004625 Ga0055543_1007213 Ga0055543_10072133 161
73 3300005262 Ga0065165_1000050 Ga0065165_100005057 161
74 3300005262 Ga0065165_1123139 Ga0065165_11231391 161
75 3300005327 Ga0070658_10065773 Ga0070658_100657731 161
76 3300005327 Ga0070658_11010069 Ga0070658_110100691 161
77 3300005337 Ga0070682_100226048 Ga0070682_1002260482 161
78 3300005339 Ga0070660_100087360 Ga0070660_1000873604 161
79 3300005339 Ga0070660_100455637 Ga0070660_1004556371 161
80 3300005344 Ga0070661_100159617 Ga0070661_1001596172 161
81 3300005356 Ga0070674_100812915 Ga0070674_1008129151 161
82 3300005366 Ga0070659_100001171 Ga0070659_1000011718 161
83 3300005366 Ga0070659_100171919 Ga0070659_1001719191 161
84 3300005366 Ga0070659_100517452 Ga0070659_1005174521 161
85 3300005457 Ga0070662_100985157 Ga0070662_1009851572 161
86 3300005457 Ga0070662_101254675 Ga0070662_1012546751 161
87 3300005458 Ga0070681_11741806 Ga0070681_117418061 161
88 3300005564 Ga0070664_100107001 Ga0070664_1001070013 161
89 3300005564 Ga0070664_100599259 Ga0070664_1005992592 161
90 3300005577 Ga0068857_100164580 Ga0068857_1001645802 161
91 3300005614 Ga0068856_100608498 Ga0068856_1006084982 161
92 3300005616 Ga0068852_101327083 Ga0068852_1013270831 161
93 3300006038 Ga0075365_10343833 Ga0075365_103438331 161
94 3300006042 Ga0075368_10001821 Ga0075368_100018214 161
95 3300006048 Ga0075363_100656208 Ga0075363_1006562082 161
96 3300006177 Ga0075362_10215775 Ga0075362_102157752 161
97 3300006177 Ga0075362_10655318 Ga0075362_106553181 161
98 3300006178 Ga0075367_10207317 Ga0075367_102073173 161
99 3300006178 Ga0075367_10336151 Ga0075367_103361511 161
100 3300006195 Ga0075366_10036417 Ga0075366_100364174 161
101 3300006353 Ga0075370_10038901 Ga0075370_100389013 161
102 3300006358 Ga0068871_100143560 Ga0068871_1001435602 161
103 3300009036 Ga0105244_10000480 Ga0105244_1000048023 161
104 3300009036 Ga0105244_10134345 Ga0105244_101343452 161
105 3300009093 Ga0105240_10568606 Ga0105240_105686062 161
106 3300009098 Ga0105245_10123486 Ga0105245_101234862 161
107 3300009148 Ga0105243_10022107 Ga0105243_100221073 161
108 3300009148 Ga0105243_12511276 Ga0105243_125112761 161
109 3300009174 Ga0105241_10055559 Ga0105241_100555592 161
110 3300009176 Ga0105242_10066580 Ga0105242_100665804 161
111 3300009176 Ga0105242_10095195 Ga0105242_100951953 161
112 3300009545 Ga0105237_10321740 Ga0105237_103217402 161
113 3300009551 Ga0105238_10487451 Ga0105238_104874512 161
114 3300010375 Ga0105239_11033339 Ga0105239_110333391 161
115 3300011119 Ga0105246_10601402 Ga0105246_106014021 161
116 3300013100 Ga0157373_10176431 Ga0157373_101764312 161
117 3300013100 Ga0157373_10738372 Ga0157373_107383722 161
118 3300013102 Ga0157371_10000001 Ga0157371_10000001825 161
119 3300013104 Ga0157370_10295736 Ga0157370_102957362 161
120 3300013104 Ga0157370_10694636 Ga0157370_106946362 161
121 3300013296 Ga0157374_10353200 Ga0157374_103532002 161
122 3300013307 Ga0157372_11493346 Ga0157372_114933462 161
123 3300013307 Ga0157372_12176394 Ga0157372_121763941 161
124 3300014497 Ga0182008_10020723 Ga0182008_100207232 161
125 3300014497 Ga0182008_10326811 Ga0182008_103268112 161
126 3300014745 Ga0157377_10294195 Ga0157377_102941952 161
127 3300014969 Ga0157376_10688789 Ga0157376_106887891 161
128 3300015261 Ga0182006_1001667 Ga0182006_10016677 161
129 3300015262 Ga0182007_10000938 Ga0182007_100009387 161
130 3300015262 Ga0182007_10022023 Ga0182007_100220232 161
131 3300015265 Ga0182005_1063825 Ga0182005_10638251 161
132 3300021361 Ga0213872_10000002 Ga0213872_10000002467 161
133 3300021361 Ga0213872_10001708 Ga0213872_1000170811 161
134 3300021361 Ga0213872_10002383 Ga0213872_1000238310 161
135 3300021361 Ga0213872_10011383 Ga0213872_100113832 161
136 3300025207 Ga0209760_103509 Ga0209760_1035091 161
137 3300025208 Ga0209436_100207 Ga0209436_1002076 161
138 3300025208 Ga0209436_123378 Ga0209436_1233782 161
139 3300025224 Ga0209784_100020 Ga0209784_100020204 161
140 3300025225 Ga0209566_100020 Ga0209566_100020204 161
141 3300025226 Ga0209674_100035 Ga0209674_100035204 161
142 3300025230 Ga0209563_100015 Ga0209563_100015355 161
143 3300025230 Ga0209563_100038 Ga0209563_100038204 161
144 3300025231 Ga0207427_105041 Ga0207427_1050412 161
145 3300025233 Ga0209437_100066 Ga0209437_100066177 161
146 3300025233 Ga0209437_109794 Ga0209437_1097943 161
147 3300025245 Ga0207425_1000006 Ga0207425_1000006128 161
148 3300025245 Ga0207425_1000136 Ga0207425_100013650 161
149 3300025245 Ga0207425_1000533 Ga0207425_100053319 161
150 3300025250 Ga0209026_1010283 Ga0209026_10102834 161
151 3300025253 Ga0209677_100031 Ga0209677_100031144 161
152 3300025254 Ga0209148_1000708 Ga0209148_100070817 161
153 3300025258 Ga0209129_1000090 Ga0209129_1000090128 161
154 3300025258 Ga0209129_1000921 Ga0209129_100092115 161
155 3300025261 Ga0209233_1000060 Ga0209233_1000060204 161
156 3300025263 Ga0209565_1000006 Ga0209565_1000006191 161
157 3300025263 Ga0209565_1000382 Ga0209565_10003826 161
158 3300025263 Ga0209565_1004283 Ga0209565_10042831 161
159 3300025263 Ga0209565_1007626 Ga0209565_10076264 161
160 3300025272 Ga0209455_1000051 Ga0209455_1000051229 161
161 3300025273 Ga0209673_1000004 Ga0209673_1000004638 161
162 3300025273 Ga0209673_1019827 Ga0209673_10198272 161
163 3300025284 Ga0209130_1000065 Ga0209130_100006557 161
164 3300025284 Ga0209130_1002373 Ga0209130_10023731 161
165 3300025291 Ga0209675_1000006 Ga0209675_1000006190 161
166 3300025291 Ga0209675_1000410 Ga0209675_100041012 161
167 3300025291 Ga0209675_1016205 Ga0209675_10162054 161
168 3300025291 Ga0209675_1018709 Ga0209675_10187092 161
169 3300025295 Ga0209564_1000064 Ga0209564_100006487 161
170 3300025295 Ga0209564_1000639 Ga0209564_100063929 161
171 3300025295 Ga0209564_1000888 Ga0209564_10008888 161
172 3300025297 Ga0209758_1000047 Ga0209758_1000047212 161
173 3300025298 Ga0209050_1000469 Ga0209050_100046957 161
174 3300025298 Ga0209050_1000532 Ga0209050_100053239 161
175 3300025298 Ga0209050_1002061 Ga0209050_10020614 161
176 3300025298 Ga0209050_1019780 Ga0209050_10197801 161
177 3300025299 Ga0209256_1000113 Ga0209256_1000113107 161
178 3300025299 Ga0209256_1001427 Ga0209256_10014276 161
179 3300025299 Ga0209256_1001603 Ga0209256_10016038 161
180 3300025299 Ga0209256_1001909 Ga0209256_10019095 161
181 3300025302 Ga0207426_1001538 Ga0207426_100153812 161
182 3300025303 Ga0209051_1000020 Ga0209051_100002091 161
183 3300025303 Ga0209051_1020254 Ga0209051_10202542 161
184 3300025304 Ga0209257_1000010 Ga0209257_1000010702 161
185 3300025304 Ga0209257_1000085 Ga0209257_100008591 161
186 3300025728 Ga0207655_1003539 Ga0207655_100353912 161
187 3300025909 Ga0207705_10002897 Ga0207705_1000289710 161
188 3300025911 Ga0207654_10032195 Ga0207654_100321952 161
189 3300025914 Ga0207671_10912285 Ga0207671_109122852 161
190 3300025919 Ga0207657_10061945 Ga0207657_100619451 161
191 3300025921 Ga0207652_10211589 Ga0207652_102115892 161
192 3300025924 Ga0207694_10882180 Ga0207694_108821802 161
193 3300025932 Ga0207690_10002213 Ga0207690_100022139 161
194 3300025932 Ga0207690_10002750 Ga0207690_100027507 161
195 3300025932 Ga0207690_10490810 Ga0207690_104908102 161
196 3300025933 Ga0207706_10629088 Ga0207706_106290881 161
197 3300025933 Ga0207706_10784069 Ga0207706_107840691 161
198 3300025934 Ga0207686_10293704 Ga0207686_102937042 161
199 3300025935 Ga0207709_10029335 Ga0207709_100293352 161
200 3300025945 Ga0207679_10051060 Ga0207679_100510603 161
201 3300025945 Ga0207679_10450296 Ga0207679_104502961 161
202 3300025945 Ga0207679_10614763 Ga0207679_106147632 161
203 3300026067 Ga0207678_10704551 Ga0207678_107045512 161
204 3300026116 Ga0207674_10078354 Ga0207674_100783543 161
205 3300026142 Ga0207698_11142473 Ga0207698_111424732 161
206 3300030744 Ga0316181_1128485 Ga0316181_11284852 161
207 3300031548 Ga0307408_100004035 Ga0307408_1000040355 161
208 3300031711 Ga0265314_10010190 Ga0265314_100101905 161
209 3300032002 Ga0307416_100119364 Ga0307416_1001193642 161
210 3300037312 Ga0395899_0000166 Ga0395899_0000166_16155_16646 161
211 3300037312 Ga0395899_0001136 Ga0395899_0001136_18866_19357 161
212 3300037312 Ga0395899_0001535 Ga0395899_0001535_6830_7321 161
213 3300037312 Ga0395899_0017193 Ga0395899_0017193_4950_5441 161
214 3300037312 Ga0395899_0044535 Ga0395899_0044535_1159_1650 161
215 3300037312 Ga0395899_0056524 Ga0395899_0056524_1784_2275 161
216 3300037312 Ga0395899_0370675 Ga0395899_0370675_278_769 161
217 3300037312 Ga0395899_0383572 Ga0395899_0383572_395_886 161
218 3300037418 Ga0395900_0001738 Ga0395900_0001738_16564_17055 161
219 3300037418 Ga0395900_0004042 Ga0395900_0004042_14891_15382 161
220 3300037418 Ga0395900_0007959 Ga0395900_0007959_9901_10392 161
221 3300037418 Ga0395900_0411485 Ga0395900_0411485_713_1204 161
222 3300037418 Ga0395900_0654947 Ga0395900_0654947_435_926 161
223 3300037466 Ga0395898_0188585 Ga0395898_0188585_63_554 161
224 3300037466 Ga0395898_1198604 Ga0395898_1198604_140_631 161
225 3300037471 Ga0395905_0001136 Ga0395905_0001136_16844_17335 161
226 3300037471 Ga0395905_0008938 Ga0395905_0008938_1190_1681 161
227 3300037471 Ga0395905_0011248 Ga0395905_0011248_3504_3995 161
228 3300037471 Ga0395905_0038162 Ga0395905_0038162_3817_4308 161
229 3300037471 Ga0395905_0077263 Ga0395905_0077263_1290_1781 161
230 3300037471 Ga0395905_0083009 Ga0395905_0083009_365_856 161
231 3300037471 Ga0395905_0154855 Ga0395905_0154855_399_890 161
232 3300037471 Ga0395905_0196949 Ga0395905_0196949_60_551 161
233 3300037471 Ga0395905_0552876 Ga0395905_0552876_382_873 161
234 3300037471 Ga0395905_0559830 Ga0395905_0559830_165_656 161
235 3300038443 Ga0395901_0000073 Ga0395901_0000073_113348_113839 161
236 3300038443 Ga0395901_0000839 Ga0395901_0000839_3882_4376 161
237 3300038443 Ga0395901_0004488 Ga0395901_0004488_10717_11238 161
238 3300038443 Ga0395901_0334639 Ga0395901_0334639_361_852 161
239 3300038443 Ga0395901_0355453 Ga0395901_0355453_704_1195 161
240 3300038443 Ga0395901_0398003 Ga0395901_0398003_264_755 161
241 3300038443 Ga0395901_1200475 Ga0395901_1200475_165_656 161
242 3300039447 Ga0436361_0001263 Ga0436361_0001263_2982_3467 161
243 3300039447 Ga0436361_0040499 Ga0436361_0040499_723_1214 161
244 3300039447 Ga0436361_0101333 Ga0436361_0101333_16252_16743 161
245 3300039447 Ga0436361_0372384 Ga0436361_0372384_8398_8889 161
246 3300039447 Ga0436361_1014017 Ga0436361_1014017_542_1027 161
247 3300042008 Ga0439450_008166 Ga0439450_008166_271_762 161
248 3300042008 Ga0439450_018941 Ga0439450_018941_458_949 161
249 3300042012 Ga0439455_0005979 Ga0439455_0005979_103_594 161
250 3300042012 Ga0439455_0101225 Ga0439455_0101225_93_584 161
251 3300042139 Ga0450904_000596 Ga0450904_000596_3524_4015 161
252 3300042157 Ga0439458_0014933 Ga0439458_0014933_812_1303 161
253 3300044656 Ga0466969_0149345 Ga0466969_0149345_222_713 161
254 3300044656 Ga0466969_0196228 Ga0466969_0196228_139_630 161
255 3300044656 Ga0466969_0467318 Ga0466969_0467318_46_537 161
256 3300044658 Ga0466972_0000106 Ga0466972_0000106_47257_47748 161
257 3300044658 Ga0466972_0002922 Ga0466972_0002922_6355_6846 161
258 3300044658 Ga0466972_0136530 Ga0466972_0136530_556_1047 161
259 3300044658 Ga0466972_0145132 Ga0466972_0145132_371_862 161
260 3300044658 Ga0466972_0158515 Ga0466972_0158515_180_671 161
261 3300044658 Ga0466972_0306808 Ga0466972_0306808_62_553 161
262 3300044658 Ga0466972_0457693 Ga0466972_0457693_26_517 161
263 3300044669 Ga0466981_0339809 Ga0466981_0339809_81_572 161
264 3300044683 Ga0466965_0004505 Ga0466965_0004505_4091_4582 161
265 3300044683 Ga0466965_0033512 Ga0466965_0033512_28_519 161
266 3300044683 Ga0466965_0066663 Ga0466965_0066663_234_725 161
267 3300044683 Ga0466965_0330600 Ga0466965_0330600_93_584 161
268 3300044684 Ga0466966_0071099 Ga0466966_0071099_93_584 161
269 3300044684 Ga0466966_0105636 Ga0466966_0105636_134_625 161
270 3300044684 Ga0466966_0262599 Ga0466966_0262599_93_584 161
271 3300044693 Ga0466961_0132724 Ga0466961_0132724_808_1299 161
272 3300044693 Ga0466961_0402583 Ga0466961_0402583_271_762 161
273 3300044694 Ga0466963_0073422 Ga0466963_0073422_1474_1965 161
274 3300044694 Ga0466963_0320258 Ga0466963_0320258_184_675 161
275 3300044706 Ga0466964_0000728 Ga0466964_0000728_354_845 161
276 3300044706 Ga0466964_0003729 Ga0466964_0003729_3571_4062 161
277 3300044706 Ga0466964_0010785 Ga0466964_0010785_2869_3360 161
278 3300044706 Ga0466964_0012676 Ga0466964_0012676_705_1196 161
279 3300044706 Ga0466964_0025493 Ga0466964_0025493_1708_2199 161
280 3300044706 Ga0466964_0341631 Ga0466964_0341631_225_716 161
281 3300044719 Ga0466971_0140645 Ga0466971_0140645_611_1102 161
282 3300044719 Ga0466971_0148782 Ga0466971_0148782_81_572 161
283 3300044719 Ga0466971_0559341 Ga0466971_0559341_47_538 161
284 3300044735 Ga0466968_0000386 Ga0466968_0000386_7700_8191 161
285 3300044735 Ga0466968_0003278 Ga0466968_0003278_2863_3354 161
286 3300044765 Ga0466970_0051282 Ga0466970_0051282_1235_1726 161
287 3300044765 Ga0466970_0064029 Ga0466970_0064029_1271_1762 161
288 3300044765 Ga0466970_0333178 Ga0466970_0333178_31_522 161
289 3300044765 Ga0466970_0392132 Ga0466970_0392132_208_699 161
290 3300044765 Ga0466970_0404496 Ga0466970_0404496_56_547 161
291 3300044842 Ga0466957_0002985 Ga0466957_0002985_6918_7409 161
292 3300044842 Ga0466957_0034651 Ga0466957_0034651_425_916 161
293 3300044842 Ga0466957_0341388 Ga0466957_0341388_355_846 161
294 3300044901 Ga0466960_0068056 Ga0466960_0068056_509_1000 161
295 3300044901 Ga0466960_0168931 Ga0466960_0168931_632_1123 161
296 3300045049 Ga0466959_0022516 Ga0466959_0022516_23_514 161
297 3300045049 Ga0466959_0026664 Ga0466959_0026664_93_584 161
298 3300045049 Ga0466959_0027535 Ga0466959_0027535_2400_2891 161
299 3300045049 Ga0466959_0264386 Ga0466959_0264386_399_890 161
300 3300045049 Ga0466959_0572825 Ga0466959_0572825_143_634 161
301 3300045049 Ga0466959_0616215 Ga0466959_0616215_192_683 161
302 3300045836 Ga0466958_0188162 Ga0466958_0188162_726_1217 161
303 3300045836 Ga0466958_0556574 Ga0466958_0556574_219_710 161
304 3300045976 Ga0466967_0375580 Ga0466967_0375580_821_1312 161
305 3300046453 Ga0495627_000339 Ga0495627_000339_31539_32030 161
306 3300046453 Ga0495627_037169 Ga0495627_037169_781_1272 161
307 3300046455 Ga0495603_0009020 Ga0495603_0009020_2141_2632 161
308 3300046455 Ga0495603_0094476 Ga0495603_0094476_1027_1518 161
309 3300046457 Ga0495590_0000007 Ga0495590_0000007_106870_107361 161
310 3300046457 Ga0495590_0000548 Ga0495590_0000548_8749_9240 161
311 3300046457 Ga0495590_0004462 Ga0495590_0004462_1875_2366 161
312 3300046457 Ga0495590_0024909 Ga0495590_0024909_684_1175 161
313 3300046457 Ga0495590_0046620 Ga0495590_0046620_891_1382 161
314 3300046458 Ga0495591_000039 Ga0495591_000039_47257_47748 161
315 3300046458 Ga0495591_011723 Ga0495591_011723_2700_3191 161
316 3300046459 Ga0495629_0006747 Ga0495629_0006747_7241_7732 161
317 3300046459 Ga0495629_0007531 Ga0495629_0007531_2730_3221 161
318 3300046459 Ga0495629_0026369 Ga0495629_0026369_159_650 161
319 3300046459 Ga0495629_0048157 Ga0495629_0048157_2327_2818 161
320 3300046460 Ga0495638_0008378 Ga0495638_0008378_1073_1564 161
321 3300046460 Ga0495638_0067333 Ga0495638_0067333_483_974 161
322 3300046460 Ga0495638_0093161 Ga0495638_0093161_103_594 161
323 3300046462 Ga0495651_0008683 Ga0495651_0008683_5292_5777 161
324 3300046462 Ga0495651_0052325 Ga0495651_0052325_1335_1820 161
325 3300046463 Ga0495653_0020617 Ga0495653_0020617_2603_3094 161
326 3300046463 Ga0495653_0098763 Ga0495653_0098763_1175_1666 161
327 3300046463 Ga0495653_0288474 Ga0495653_0288474_200_691 161
328 3300046471 Ga0495650_0000215 Ga0495650_0000215_84655_85146 161
329 3300046471 Ga0495650_0000399 Ga0495650_0000399_68090_68581 161
330 3300046471 Ga0495650_0004623 Ga0495650_0004623_4137_4628 161
331 3300046471 Ga0495650_0158811 Ga0495650_0158811_175_666 161
332 3300046472 Ga0495580_0097687 Ga0495580_0097687_1394_1885 161
333 3300046473 Ga0495582_0002580 Ga0495582_0002580_4543_5034 161
334 3300046473 Ga0495582_0009872 Ga0495582_0009872_1949_2440 161
335 3300046473 Ga0495582_0041250 Ga0495582_0041250_18_509 161
336 3300046474 Ga0495605_0000085 Ga0495605_0000085_109976_110467 161
337 3300046474 Ga0495605_0000108 Ga0495605_0000108_89222_89713 161
338 3300046474 Ga0495605_0016345 Ga0495605_0016345_76_567 161
339 3300046474 Ga0495605_0040365 Ga0495605_0040365_842_1333 161
340 3300046474 Ga0495605_0066671 Ga0495605_0066671_41_532 161
341 3300046474 Ga0495605_0073320 Ga0495605_0073320_614_1105 161
342 3300046491 Ga0495584_0000282 Ga0495584_0000282_31243_31734 161
343 3300046491 Ga0495584_0000712 Ga0495584_0000712_11311_11802 161
344 3300046491 Ga0495584_0005119 Ga0495584_0005119_4801_5292 161
345 3300046491 Ga0495584_0005545 Ga0495584_0005545_967_1458 161
346 3300046491 Ga0495584_0005748 Ga0495584_0005748_218_709 161
347 3300046491 Ga0495584_0009279 Ga0495584_0009279_2831_3322 161
348 3300046491 Ga0495584_0012573 Ga0495584_0012573_418_909 161
349 3300046491 Ga0495584_0018562 Ga0495584_0018562_1412_1903 161
350 3300046491 Ga0495584_0021684 Ga0495584_0021684_1982_2473 161
351 3300046491 Ga0495584_0025629 Ga0495584_0025629_1749_2240 161
352 3300046491 Ga0495584_0086379 Ga0495584_0086379_360_851 161
353 3300046491 Ga0495584_0180271 Ga0495584_0180271_328_819 161
354 3300046491 Ga0495584_0251467 Ga0495584_0251467_41_532 161
355 3300046492 Ga0495585_0000511 Ga0495585_0000511_25367_25858 161
356 3300046492 Ga0495585_0001726 Ga0495585_0001726_3618_4109 161
357 3300046492 Ga0495585_0005383 Ga0495585_0005383_7015_7506 161
358 3300046492 Ga0495585_0030054 Ga0495585_0030054_1820_2311 161
359 3300046492 Ga0495585_0034170 Ga0495585_0034170_1707_2198 161
360 3300046492 Ga0495585_0041943 Ga0495585_0041943_961_1452 161
361 3300046492 Ga0495585_0042715 Ga0495585_0042715_62_553 161
362 3300046492 Ga0495585_0072426 Ga0495585_0072426_925_1416 161
363 3300046492 Ga0495585_0131902 Ga0495585_0131902_657_1148 161
364 3300046492 Ga0495585_0152878 Ga0495585_0152878_401_892 161
365 3300046499 Ga0495594_0001773 Ga0495594_0001773_10270_10761 161
366 3300046499 Ga0495594_0010527 Ga0495594_0010527_2436_2927 161
367 3300046499 Ga0495594_0049169 Ga0495594_0049169_66_557 161
368 3300046499 Ga0495594_0117322 Ga0495594_0117322_215_706 161
369 3300046499 Ga0495594_0325154 Ga0495594_0325154_317_808 161
370 3300046499 Ga0495594_0339412 Ga0495594_0339412_15_509 161
371 3300046500 Ga0495596_0001624 Ga0495596_0001624_5010_5501 161
372 3300046500 Ga0495596_0003214 Ga0495596_0003214_3847_4338 161
373 3300046500 Ga0495596_0011020 Ga0495596_0011020_421_912 161
374 3300046500 Ga0495596_0011412 Ga0495596_0011412_642_1133 161
375 3300046500 Ga0495596_0016268 Ga0495596_0016268_2081_2572 161
376 3300046500 Ga0495596_0046084 Ga0495596_0046084_742_1233 161
377 3300046500 Ga0495596_0065053 Ga0495596_0065053_901_1392 161
378 3300046500 Ga0495596_0122694 Ga0495596_0122694_432_923 161
379 3300046500 Ga0495596_0183052 Ga0495596_0183052_282_773 161
380 3300046500 Ga0495596_0183896 Ga0495596_0183896_47_538 161
381 3300046501 Ga0495607_0001375 Ga0495607_0001375_11131_11622 161
382 3300046501 Ga0495607_0002838 Ga0495607_0002838_1110_1601 161
383 3300046501 Ga0495607_0010459 Ga0495607_0010459_4382_4873 161
384 3300046501 Ga0495607_0016161 Ga0495607_0016161_3176_3667 161
385 3300046501 Ga0495607_0025669 Ga0495607_0025669_3062_3553 161
386 3300046501 Ga0495607_0032432 Ga0495607_0032432_2604_3095 161
387 3300046501 Ga0495607_0038363 Ga0495607_0038363_2314_2805 161
388 3300046501 Ga0495607_0052612 Ga0495607_0052612_1653_2144 161
389 3300046501 Ga0495607_0054816 Ga0495607_0054816_284_775 161
390 3300046501 Ga0495607_0084522 Ga0495607_0084522_1152_1643 161
391 3300046501 Ga0495607_0089364 Ga0495607_0089364_798_1289 161
392 3300046501 Ga0495607_0196973 Ga0495607_0196973_214_705 161
393 3300046501 Ga0495607_0477580 Ga0495607_0477580_51_542 161
394 3300046506 Ga0495583_0000503 Ga0495583_0000503_8479_8970 161
395 3300046506 Ga0495583_0001311 Ga0495583_0001311_16443_16934 161
396 3300046506 Ga0495583_0001962 Ga0495583_0001962_2990_3481 161
397 3300046506 Ga0495583_0009479 Ga0495583_0009479_2941_3432 161
398 3300046506 Ga0495583_0012515 Ga0495583_0012515_1242_1733 161
399 3300046506 Ga0495583_0014697 Ga0495583_0014697_1747_2238 161
400 3300046506 Ga0495583_0018943 Ga0495583_0018943_231_722 161
401 3300046506 Ga0495583_0051683 Ga0495583_0051683_497_988 161
402 3300046506 Ga0495583_0078726 Ga0495583_0078726_267_758 161
403 3300046506 Ga0495583_0126685 Ga0495583_0126685_553_1044 161
404 3300046507 Ga0495606_0003514 Ga0495606_0003514_12514_13005 161
405 3300046507 Ga0495606_0009080 Ga0495606_0009080_6212_6703 161
406 3300046507 Ga0495606_0020159 Ga0495606_0020159_193_684 161
407 3300046507 Ga0495606_0035319 Ga0495606_0035319_1993_2484 161
408 3300046507 Ga0495606_0095915 Ga0495606_0095915_1298_1789 161
409 3300046507 Ga0495606_0108112 Ga0495606_0108112_168_659 161
410 3300046507 Ga0495606_0130524 Ga0495606_0130524_465_956 161
411 3300046507 Ga0495606_0203397 Ga0495606_0203397_89_580 161
412 3300046511 Ga0495608_0005174 Ga0495608_0005174_3991_4476 161
413 3300046511 Ga0495608_0235526 Ga0495608_0235526_180_665 161
414 3300046512 Ga0495610_0002370 Ga0495610_0002370_2936_3427 161
415 3300046513 Ga0495616_0000145 Ga0495616_0000145_41236_41727 161
416 3300046513 Ga0495616_0006111 Ga0495616_0006111_3473_3964 161
417 3300046513 Ga0495616_0019651 Ga0495616_0019651_71_562 161
418 3300046513 Ga0495616_0023073 Ga0495616_0023073_1809_2300 161
419 3300046513 Ga0495616_0023467 Ga0495616_0023467_1094_1585 161
420 3300046513 Ga0495616_0023937 Ga0495616_0023937_1493_1984 161
421 3300046513 Ga0495616_0026826 Ga0495616_0026826_2194_2685 161
422 3300046513 Ga0495616_0030132 Ga0495616_0030132_1707_2198 161
423 3300046513 Ga0495616_0030640 Ga0495616_0030640_119_610 161
424 3300046513 Ga0495616_0254969 Ga0495616_0254969_189_680 161
425 3300046513 Ga0495616_0315242 Ga0495616_0315242_114_605 161
426 3300046514 Ga0495618_0048774 Ga0495618_0048774_851_1336 161
427 3300046516 Ga0495628_0075644 Ga0495628_0075644_1523_2008 161
428 3300046516 Ga0495628_0196522 Ga0495628_0196522_72_557 161
429 3300046517 Ga0495630_0112698 Ga0495630_0112698_84_575 161
430 3300046518 Ga0495631_0000109 Ga0495631_0000109_12075_12566 161
431 3300046518 Ga0495631_0003940 Ga0495631_0003940_3643_4134 161
432 3300046518 Ga0495631_0005545 Ga0495631_0005545_2989_3480 161
433 3300046518 Ga0495631_0012615 Ga0495631_0012615_2919_3410 161
434 3300046518 Ga0495631_0016316 Ga0495631_0016316_2459_2950 161
435 3300046518 Ga0495631_0034041 Ga0495631_0034041_827_1318 161
436 3300046518 Ga0495631_0042379 Ga0495631_0042379_802_1293 161
437 3300046518 Ga0495631_0065948 Ga0495631_0065948_325_816 161
438 3300046518 Ga0495631_0070867 Ga0495631_0070867_636_1127 161
439 3300046518 Ga0495631_0078332 Ga0495631_0078332_474_965 161
440 3300046518 Ga0495631_0208358 Ga0495631_0208358_252_743 161
441 3300046519 Ga0495632_0000374 Ga0495632_0000374_28918_29409 161
442 3300046519 Ga0495632_0000837 Ga0495632_0000837_16713_17204 161
443 3300046519 Ga0495632_0000878 Ga0495632_0000878_15741_16232 161
444 3300046519 Ga0495632_0008595 Ga0495632_0008595_4586_5077 161
445 3300046519 Ga0495632_0034059 Ga0495632_0034059_102_593 161
446 3300046519 Ga0495632_0160272 Ga0495632_0160272_462_953 161
447 3300046520 Ga0495637_0000006 Ga0495637_0000006_358627_359118 161
448 3300046520 Ga0495637_0020548 Ga0495637_0020548_256_747 161
449 3300046520 Ga0495637_0079433 Ga0495637_0079433_200_691 161
450 3300046522 Ga0495643_0004391 Ga0495643_0004391_5537_6028 161
451 3300046522 Ga0495643_0009053 Ga0495643_0009053_3605_4096 161
452 3300046522 Ga0495643_0016438 Ga0495643_0016438_1032_1523 161
453 3300046522 Ga0495643_0023678 Ga0495643_0023678_645_1136 161
454 3300046522 Ga0495643_0033446 Ga0495643_0033446_2244_2735 161
455 3300046522 Ga0495643_0082257 Ga0495643_0082257_587_1078 161
456 3300046522 Ga0495643_0194769 Ga0495643_0194769_230_721 161
457 3300046523 Ga0495644_0014229 Ga0495644_0014229_1987_2478 161
458 3300046523 Ga0495644_0015622 Ga0495644_0015622_332_823 161
459 3300046523 Ga0495644_0020393 Ga0495644_0020393_1952_2443 161
460 3300046523 Ga0495644_0034899 Ga0495644_0034899_763_1254 161
461 3300046523 Ga0495644_0063171 Ga0495644_0063171_87_578 161
462 3300046523 Ga0495644_0087356 Ga0495644_0087356_19_510 161
463 3300046524 Ga0495648_0000220 Ga0495648_0000220_52856_53347 161
464 3300046524 Ga0495648_0001128 Ga0495648_0001128_22891_23382 161
465 3300046524 Ga0495648_0005380 Ga0495648_0005380_219_710 161
466 3300046524 Ga0495648_0023328 Ga0495648_0023328_3381_3872 161
467 3300046524 Ga0495648_0058840 Ga0495648_0058840_207_698 161
468 3300046524 Ga0495648_0151096 Ga0495648_0151096_316_807 161
469 3300046525 Ga0495663_0001768 Ga0495663_0001768_5722_6213 161
470 3300046525 Ga0495663_0062026 Ga0495663_0062026_311_805 161
471 3300046526 Ga0495666_0002219 Ga0495666_0002219_5765_6256 161
472 3300046526 Ga0495666_0016526 Ga0495666_0016526_1543_2037 161
473 3300046526 Ga0495666_0072657 Ga0495666_0072657_250_741 161
474 3300046526 Ga0495666_0105640 Ga0495666_0105640_132_623 161
475 3300046526 Ga0495666_0204699 Ga0495666_0204699_310_801 161
476 3300046528 Ga0495642_0000345 Ga0495642_0000345_9964_10455 161
477 3300046528 Ga0495642_0000855 Ga0495642_0000855_13949_14440 161
478 3300046528 Ga0495642_0000973 Ga0495642_0000973_10247_10738 161
479 3300046528 Ga0495642_0005659 Ga0495642_0005659_532_1023 161
480 3300046528 Ga0495642_0006545 Ga0495642_0006545_1987_2478 161
481 3300046528 Ga0495642_0013267 Ga0495642_0013267_1165_1656 161
482 3300046528 Ga0495642_0014029 Ga0495642_0014029_1610_2101 161
483 3300046528 Ga0495642_0016151 Ga0495642_0016151_564_1055 161
484 3300046528 Ga0495642_0035100 Ga0495642_0035100_30_521 161
485 3300046528 Ga0495642_0042052 Ga0495642_0042052_801_1292 161
486 3300046528 Ga0495642_0055708 Ga0495642_0055708_863_1354 161
487 3300046528 Ga0495642_0072036 Ga0495642_0072036_142_633 161
488 3300046528 Ga0495642_0119843 Ga0495642_0119843_342_833 161
489 3300046528 Ga0495642_0134824 Ga0495642_0134824_544_1035 161
490 3300046528 Ga0495642_0192829 Ga0495642_0192829_119_610 161
491 3300046528 Ga0495642_0207926 Ga0495642_0207926_62_553 161
492 3300046528 Ga0495642_0315299 Ga0495642_0315299_86_577 161
493 3300046528 Ga0495642_0407922 Ga0495642_0407922_68_559 161
494 3300046528 Ga0495642_0412970 Ga0495642_0412970_10_501 161
495 3300046528 Ga0495642_0451145 Ga0495642_0451145_62_553 161
496 3300046528 Ga0495642_0463556 Ga0495642_0463556_52_543 161
497 3300046529 Ga0495652_0040140 Ga0495652_0040140_1142_1633 161
498 3300046529 Ga0495652_0100237 Ga0495652_0100237_252_743 161
499 3300046529 Ga0495652_0133839 Ga0495652_0133839_73_558 161
500 3300046529 Ga0495652_0462056 Ga0495652_0462056_344_835 161
501 3300046530 Ga0495654_0055220 Ga0495654_0055220_1305_1796 161
502 3300046530 Ga0495654_0058293 Ga0495654_0058293_682_1173 161
503 3300046530 Ga0495654_0242222 Ga0495654_0242222_186_677 161
504 3300046531 Ga0495665_0016817 Ga0495665_0016817_1706_2197 161
505 3300046531 Ga0495665_0035373 Ga0495665_0035373_819_1313 161
506 3300046531 Ga0495665_0036847 Ga0495665_0036847_353_844 161
507 3300046531 Ga0495665_0069956 Ga0495665_0069956_817_1308 161
508 3300046531 Ga0495665_0095622 Ga0495665_0095622_488_979 161
509 3300046531 Ga0495665_0123045 Ga0495665_0123045_644_1135 161
510 3300046531 Ga0495665_0156093 Ga0495665_0156093_247_738 161
511 3300046533 Ga0495640_0098849 Ga0495640_0098849_823_1314 161
512 3300046535 Ga0495586_0001597 Ga0495586_0001597_3265_3756 161
513 3300046535 Ga0495586_0025338 Ga0495586_0025338_2568_3059 161
514 3300046535 Ga0495586_0250564 Ga0495586_0250564_351_842 161
515 3300046536 Ga0495587_0045984 Ga0495587_0045984_1368_1859 161
516 3300046536 Ga0495587_0048486 Ga0495587_0048486_407_898 161
517 3300046536 Ga0495587_0120294 Ga0495587_0120294_158_649 161
518 3300046538 Ga0495609_0000002 Ga0495609_0000002_111945_112436 161
519 3300046538 Ga0495609_0003491 Ga0495609_0003491_2703_3194 161
520 3300046538 Ga0495609_0005062 Ga0495609_0005062_5154_5645 161
521 3300046538 Ga0495609_0009241 Ga0495609_0009241_2810_3301 161
522 3300046538 Ga0495609_0026878 Ga0495609_0026878_1521_2012 161
523 3300046538 Ga0495609_0056646 Ga0495609_0056646_767_1258 161
524 3300046538 Ga0495609_0131357 Ga0495609_0131357_54_545 161
525 3300046538 Ga0495609_0189319 Ga0495609_0189319_129_620 161
526 3300046542 Ga0495597_0000728 Ga0495597_0000728_10030_10521 161
527 3300046542 Ga0495597_0003368 Ga0495597_0003368_3232_3723 161
528 3300046542 Ga0495597_0005788 Ga0495597_0005788_5259_5750 161
529 3300046542 Ga0495597_0008812 Ga0495597_0008812_3450_3941 161
530 3300046542 Ga0495597_0009769 Ga0495597_0009769_2125_2616 161
531 3300046542 Ga0495597_0012372 Ga0495597_0012372_2680_3171 161
532 3300046542 Ga0495597_0013875 Ga0495597_0013875_2441_2932 161
533 3300046542 Ga0495597_0016128 Ga0495597_0016128_1921_2412 161
534 3300046542 Ga0495597_0052554 Ga0495597_0052554_649_1140 161
535 3300046542 Ga0495597_0053597 Ga0495597_0053597_1175_1666 161
536 3300046542 Ga0495597_0069081 Ga0495597_0069081_256_747 161
537 3300046542 Ga0495597_0125493 Ga0495597_0125493_96_587 161
538 3300046542 Ga0495597_0170657 Ga0495597_0170657_96_587 161
539 3300046542 Ga0495597_0290279 Ga0495597_0290279_115_606 161
540 3300046543 Ga0495645_0130814 Ga0495645_0130814_550_1035 161
541 3300046543 Ga0495645_0167613 Ga0495645_0167613_985_1476 161
542 3300046557 Ga0495622_0011236 Ga0495622_0011236_1479_1970 161
543 3300046557 Ga0495622_0015781 Ga0495622_0015781_2945_3436 161
544 3300046557 Ga0495622_0018729 Ga0495622_0018729_1199_1690 161
545 3300046557 Ga0495622_0025647 Ga0495622_0025647_803_1294 161
546 3300046557 Ga0495622_0055709 Ga0495622_0055709_1252_1746 161
547 3300046557 Ga0495622_0086760 Ga0495622_0086760_881_1372 161
548 3300046558 Ga0495633_0002136 Ga0495633_0002136_3480_3971 161
549 3300046558 Ga0495633_0006080 Ga0495633_0006080_549_1040 161
550 3300046558 Ga0495633_0011681 Ga0495633_0011681_3139_3630 161
551 3300046558 Ga0495633_0016582 Ga0495633_0016582_762_1253 161
552 3300046558 Ga0495633_0104849 Ga0495633_0104849_321_812 161
553 3300046558 Ga0495633_0235768 Ga0495633_0235768_163_654 161
554 3300046558 Ga0495633_0247122 Ga0495633_0247122_276_767 161
555 3300046558 Ga0495633_0275002 Ga0495633_0275002_242_733 161
556 3300046559 Ga0495667_0231925 Ga0495667_0231925_319_810 161
557 3300046559 Ga0495667_0496383 Ga0495667_0496383_248_739 161
558 3300046615 Ga0495656_0020973 Ga0495656_0020973_1937_2428 161
559 3300046615 Ga0495656_0050622 Ga0495656_0050622_605_1096 161
560 3300046615 Ga0495656_0165156 Ga0495656_0165156_268_759 161
561 3300046615 Ga0495656_0174703 Ga0495656_0174703_475_966 161
562 3300046615 Ga0495656_0340762 Ga0495656_0340762_116_607 161
563 3300046615 Ga0495656_0367891 Ga0495656_0367891_42_533 161
564 3300046615 Ga0495656_0560493 Ga0495656_0560493_73_564 161
565 3300046616 Ga0495668_0000049 Ga0495668_0000049_100371_100862 161
566 3300046616 Ga0495668_0000381 Ga0495668_0000381_3692_4183 161
567 3300046616 Ga0495668_0003532 Ga0495668_0003532_3157_3648 161
568 3300046616 Ga0495668_0006731 Ga0495668_0006731_3347_3838 161
569 3300046616 Ga0495668_0009144 Ga0495668_0009144_2132_2623 161
570 3300046616 Ga0495668_0013569 Ga0495668_0013569_1294_1785 161
571 3300046616 Ga0495668_0013747 Ga0495668_0013747_1703_2194 161
572 3300046616 Ga0495668_0016302 Ga0495668_0016302_2363_2854 161
573 3300046616 Ga0495668_0054690 Ga0495668_0054690_1667_2158 161
574 3300046616 Ga0495668_0056907 Ga0495668_0056907_668_1159 161
575 3300046616 Ga0495668_0071128 Ga0495668_0071128_49_540 161
576 3300046616 Ga0495668_0124885 Ga0495668_0124885_842_1333 161
577 3300046616 Ga0495668_0185474 Ga0495668_0185474_193_684 161
578 3300046616 Ga0495668_0224537 Ga0495668_0224537_384_875 161
579 3300046642 Ga0495634_0021797 Ga0495634_0021797_3790_4281 161
580 3300046642 Ga0495634_0357407 Ga0495634_0357407_346_837 161
581 3300046648 Ga0495611_0000792 Ga0495611_0000792_2990_3481 161
582 3300046648 Ga0495611_0006401 Ga0495611_0006401_3578_4069 161
583 3300046648 Ga0495611_0014135 Ga0495611_0014135_429_920 161
584 3300046648 Ga0495611_0015201 Ga0495611_0015201_65_556 161
585 3300046648 Ga0495611_0034654 Ga0495611_0034654_1673_2164 161
586 3300046648 Ga0495611_0069724 Ga0495611_0069724_175_666 161
587 3300046648 Ga0495611_0069744 Ga0495611_0069744_659_1150 161
588 3300046648 Ga0495611_0186576 Ga0495611_0186576_59_550 161
589 3300046648 Ga0495611_0282512 Ga0495611_0282512_256_747 161
590 3300046660 Ga0495625_0002502 Ga0495625_0002502_3683_4174 161
591 3300046660 Ga0495625_0012924 Ga0495625_0012924_1256_1747 161
592 3300046660 Ga0495625_0014139 Ga0495625_0014139_4176_4667 161
593 3300046660 Ga0495625_0015696 Ga0495625_0015696_5349_5840 161
594 3300046660 Ga0495625_0032646 Ga0495625_0032646_89_580 161
595 3300046660 Ga0495625_0046840 Ga0495625_0046840_2074_2565 161
596 3300046660 Ga0495625_0267637 Ga0495625_0267637_58_549 161
597 3300046660 Ga0495625_0365009 Ga0495625_0365009_399_890 161
598 3300046660 Ga0495625_0399264 Ga0495625_0399264_248_739 161
599 3300046663 Ga0495635_0000550 Ga0495635_0000550_5627_6118 161
600 3300046663 Ga0495635_0033671 Ga0495635_0033671_333_818 161
601 3300046663 Ga0495635_0276034 Ga0495635_0276034_41_532 161
602 3300046664 Ga0495659_0001108 Ga0495659_0001108_2656_3147 161
603 3300046665 Ga0495661_0000271 Ga0495661_0000271_11046_11537 161
604 3300046665 Ga0495661_0000669 Ga0495661_0000669_14482_14973 161
605 3300046665 Ga0495661_0001851 Ga0495661_0001851_3866_4357 161
606 3300046665 Ga0495661_0002553 Ga0495661_0002553_9023_9514 161
607 3300046665 Ga0495661_0006640 Ga0495661_0006640_7567_8058 161
608 3300046665 Ga0495661_0020472 Ga0495661_0020472_327_818 161
609 3300046665 Ga0495661_0022888 Ga0495661_0022888_2005_2496 161
610 3300046665 Ga0495661_0033698 Ga0495661_0033698_96_587 161
611 3300046665 Ga0495661_0033979 Ga0495661_0033979_1511_2002 161
612 3300046665 Ga0495661_0049028 Ga0495661_0049028_1515_2006 161
613 3300046665 Ga0495661_0049935 Ga0495661_0049935_542_1033 161
614 3300046665 Ga0495661_0053205 Ga0495661_0053205_128_619 161
615 3300046665 Ga0495661_0059717 Ga0495661_0059717_730_1221 161
616 3300046665 Ga0495661_0081566 Ga0495661_0081566_852_1343 161
617 3300046665 Ga0495661_0097590 Ga0495661_0097590_685_1176 161
618 3300046665 Ga0495661_0100325 Ga0495661_0100325_493_984 161
619 3300046665 Ga0495661_0134822 Ga0495661_0134822_165_656 161
620 3300046665 Ga0495661_0153844 Ga0495661_0153844_68_559 161
621 3300046665 Ga0495661_0210562 Ga0495661_0210562_399_890 161
622 3300046665 Ga0495661_0356154 Ga0495661_0356154_216_707 161
623 3300046665 Ga0495661_0365770 Ga0495661_0365770_59_550 161
624 3300046674 Ga0495588_0000135 Ga0495588_0000135_17814_18305 161
625 3300046674 Ga0495588_0012486 Ga0495588_0012486_2490_2981 161
626 3300046674 Ga0495588_0031315 Ga0495588_0031315_1323_1814 161
627 3300046674 Ga0495588_0058779 Ga0495588_0058779_1165_1656 161
628 3300046674 Ga0495588_0066330 Ga0495588_0066330_226_717 161
629 3300046674 Ga0495588_0126933 Ga0495588_0126933_804_1295 161
630 3300046674 Ga0495588_0338219 Ga0495588_0338219_209_700 161
631 3300046675 Ga0495657_0234066 Ga0495657_0234066_164_649 161
632 3300046678 Ga0495599_0063568 Ga0495599_0063568_1250_1735 161
633 3300046679 Ga0495623_0001059 Ga0495623_0001059_1324_1815 161
634 3300046679 Ga0495623_0008133 Ga0495623_0008133_2936_3427 161
635 3300046679 Ga0495623_0070013 Ga0495623_0070013_1204_1695 161
636 3300046679 Ga0495623_0235427 Ga0495623_0235427_356_841 161
637 3300046679 Ga0495623_0506636 Ga0495623_0506636_41_526 161
638 3300046680 Ga0495646_0022937 Ga0495646_0022937_1855_2340 161
639 3300046680 Ga0495646_0154871 Ga0495646_0154871_713_1204 161
640 3300046680 Ga0495646_0398296 Ga0495646_0398296_16_501 161
641 3300046684 Ga0495669_0000305 Ga0495669_0000305_23169_23660 161
642 3300046684 Ga0495669_0000799 Ga0495669_0000799_11904_12395 161
643 3300046684 Ga0495669_0017143 Ga0495669_0017143_197_688 161
644 3300046684 Ga0495669_0122123 Ga0495669_0122123_698_1189 161
645 3300046684 Ga0495669_0320044 Ga0495669_0320044_172_663 161
646 3300046689 Ga0495613_0286659 Ga0495613_0286659_547_1038 161
647 3300046689 Ga0495613_0379778 Ga0495613_0379778_121_612 161
648 3300046690 Ga0495624_0014318 Ga0495624_0014318_4800_5294 161
649 3300046690 Ga0495624_0252561 Ga0495624_0252561_464_955 161
650 3300046691 Ga0495670_0000228 Ga0495670_0000228_8329_8820 161
651 3300046691 Ga0495670_0015923 Ga0495670_0015923_467_958 161
652 3300046691 Ga0495670_0020451 Ga0495670_0020451_323_814 161
653 3300046691 Ga0495670_0031767 Ga0495670_0031767_535_1026 161
654 3300046691 Ga0495670_0037133 Ga0495670_0037133_88_579 161
655 3300046691 Ga0495670_0067354 Ga0495670_0067354_465_956 161
656 3300046691 Ga0495670_0141631 Ga0495670_0141631_42_533 161
657 3300046691 Ga0495670_0149249 Ga0495670_0149249_99_590 161
658 3300046691 Ga0495670_0253442 Ga0495670_0253442_265_756 161
659 3300046692 Ga0495671_0003333 Ga0495671_0003333_5884_6375 161
660 3300046692 Ga0495671_0013975 Ga0495671_0013975_3564_4055 161
661 3300046692 Ga0495671_0055395 Ga0495671_0055395_1219_1710 161
662 3300046692 Ga0495671_0102502 Ga0495671_0102502_708_1199 161
663 3300046692 Ga0495671_0117980 Ga0495671_0117980_794_1285 161
664 3300046692 Ga0495671_0173295 Ga0495671_0173295_255_746 161
665 3300046694 Ga0495649_0000183 Ga0495649_0000183_50202_50693 161
666 3300046694 Ga0495649_0007999 Ga0495649_0007999_3198_3689 161
667 3300046694 Ga0495649_0020647 Ga0495649_0020647_3133_3624 161
668 3300046694 Ga0495649_0031590 Ga0495649_0031590_1206_1697 161
669 3300046694 Ga0495649_0032307 Ga0495649_0032307_2312_2803 161
670 3300046694 Ga0495649_0112774 Ga0495649_0112774_748_1239 161
671 3300046694 Ga0495649_0136722 Ga0495649_0136722_204_695 161
672 3300046694 Ga0495649_0151027 Ga0495649_0151027_181_672 161
673 3300046694 Ga0495649_0164796 Ga0495649_0164796_392_883 161
674 3300046694 Ga0495649_0197656 Ga0495649_0197656_491_982 161
675 3300046694 Ga0495649_0284466 Ga0495649_0284466_289_780 161
676 3300046794 Ga0495589_0000030 Ga0495589_0000030_106354_106845 161
677 3300046794 Ga0495589_0000569 Ga0495589_0000569_7860_8351 161
678 3300046794 Ga0495589_0000651 Ga0495589_0000651_12121_12612 161
679 3300046794 Ga0495589_0001070 Ga0495589_0001070_15832_16323 161
680 3300046794 Ga0495589_0005293 Ga0495589_0005293_732_1223 161
681 3300046794 Ga0495589_0008207 Ga0495589_0008207_2936_3427 161
682 3300046794 Ga0495589_0119183 Ga0495589_0119183_215_706 161
683 3300046794 Ga0495589_0199644 Ga0495589_0199644_127_618 161
684 3300046809 Ga0495600_0002426 Ga0495600_0002426_2626_3117 161
685 3300046809 Ga0495600_0006351 Ga0495600_0006351_6695_7180 161
686 3300046809 Ga0495600_0022603 Ga0495600_0022603_1031_1522 161
687 3300046810 Ga0495660_0000423 Ga0495660_0000423_15829_16320 161
688 3300046810 Ga0495660_0006880 Ga0495660_0006880_3102_3593 161
689 3300046810 Ga0495660_0007415 Ga0495660_0007415_4604_5095 161
690 3300046810 Ga0495660_0021905 Ga0495660_0021905_2681_3172 161
691 3300046810 Ga0495660_0040808 Ga0495660_0040808_2052_2543 161
692 3300046810 Ga0495660_0118332 Ga0495660_0118332_67_558 161
693 3300046810 Ga0495660_0130794 Ga0495660_0130794_725_1216 161
694 3300047315 Ga0495581_0011916 Ga0495581_0011916_1273_1764 161
695 3300047315 Ga0495581_0032783 Ga0495581_0032783_494_985 161
696 3300047315 Ga0495581_0120996 Ga0495581_0120996_208_699 161
697 3300047315 Ga0495581_0190603 Ga0495581_0190603_627_1118 161
698 3300047317 Ga0495604_0003344 Ga0495604_0003344_4032_4523 161
699 3300047317 Ga0495604_0019754 Ga0495604_0019754_326_817 161
700 3300047317 Ga0495604_0088429 Ga0495604_0088429_93_587 161
701 3300047317 Ga0495604_0189198 Ga0495604_0189198_308_799 161
702 3300047317 Ga0495604_0438072 Ga0495604_0438072_332_817 161
703 3300047318 Ga0495636_0004778 Ga0495636_0004778_1876_2367 161
704 3300047318 Ga0495636_0011362 Ga0495636_0011362_1128_1619 161
705 3300047318 Ga0495636_0121647 Ga0495636_0121647_139_630 161
706 3300047319 Ga0495674_0010531 Ga0495674_0010531_1716_2207 161
707 3300047320 Ga0495672_0000118 Ga0495672_0000118_112532_113023 161
708 3300047320 Ga0495672_0000833 Ga0495672_0000833_16845_17336 161
709 3300047320 Ga0495672_0002309 Ga0495672_0002309_7202_7693 161
710 3300047320 Ga0495672_0007939 Ga0495672_0007939_3692_4183 161
711 3300047320 Ga0495672_0027983 Ga0495672_0027983_560_1051 161
712 3300047321 Ga0495676_0000014 Ga0495676_0000014_192872_193363 161
713 3300047321 Ga0495676_0010619 Ga0495676_0010619_1863_2354 161
714 3300047321 Ga0495676_0345336 Ga0495676_0345336_305_796 161
715 3300047322 Ga0495680_0004551 Ga0495680_0004551_9626_10117 161
716 3300047322 Ga0495680_0007141 Ga0495680_0007141_1283_1774 161
717 3300047323 Ga0495683_0001362 Ga0495683_0001362_12116_12607 161
718 3300047323 Ga0495683_0010467 Ga0495683_0010467_3130_3621 161
719 3300047323 Ga0495683_0012774 Ga0495683_0012774_2829_3320 161
720 3300047323 Ga0495683_0017254 Ga0495683_0017254_987_1478 161
721 3300047323 Ga0495683_0054023 Ga0495683_0054023_259_750 161
722 3300047323 Ga0495683_0079870 Ga0495683_0079870_794_1285 161
723 3300047323 Ga0495683_0094389 Ga0495683_0094389_379_870 161
724 3300047323 Ga0495683_0108924 Ga0495683_0108924_473_964 161
725 3300047323 Ga0495683_0201756 Ga0495683_0201756_119_610 161
726 3300047443 Ga0495687_000047 Ga0495687_000047_106356_106847 161
727 3300047443 Ga0495687_000088 Ga0495687_000088_22011_22502 161
728 3300047443 Ga0495687_000112 Ga0495687_000112_41213_41704 161
729 3300047443 Ga0495687_001101 Ga0495687_001101_5589_6080 161
730 3300047443 Ga0495687_004364 Ga0495687_004364_8294_8785 161
731 3300047443 Ga0495687_023192 Ga0495687_023192_1508_1999 161
732 3300047444 Ga0495675_0002690 Ga0495675_0002690_1342_1833 161
733 3300047444 Ga0495675_0005401 Ga0495675_0005401_3014_3505 161
734 3300047444 Ga0495675_0093817 Ga0495675_0093817_226_717 161
735 3300047444 Ga0495675_0152454 Ga0495675_0152454_215_706 161
736 3300047445 Ga0495677_0000044 Ga0495677_0000044_62804_63295 161
737 3300047445 Ga0495677_0000267 Ga0495677_0000267_9997_10488 161
738 3300047445 Ga0495677_0000597 Ga0495677_0000597_2493_2984 161
739 3300047445 Ga0495677_0002482 Ga0495677_0002482_3604_4095 161
740 3300047445 Ga0495677_0008179 Ga0495677_0008179_3198_3689 161
741 3300047445 Ga0495677_0009695 Ga0495677_0009695_465_956 161
742 3300047445 Ga0495677_0044776 Ga0495677_0044776_278_769 161
743 3300047445 Ga0495677_0061427 Ga0495677_0061427_595_1086 161
744 3300047445 Ga0495677_0100954 Ga0495677_0100954_85_576 161
745 3300047445 Ga0495677_0126804 Ga0495677_0126804_310_801 161
746 3300047445 Ga0495677_0142204 Ga0495677_0142204_131_622 161
747 3300047446 Ga0495679_002450 Ga0495679_002450_7930_8421 161
748 3300047446 Ga0495679_017633 Ga0495679_017633_1268_1759 161
749 3300047446 Ga0495679_021483 Ga0495679_021483_1150_1641 161
750 3300047446 Ga0495679_033387 Ga0495679_033387_922_1413 161
751 3300047446 Ga0495679_054268 Ga0495679_054268_249_740 161
752 3300047446 Ga0495679_056614 Ga0495679_056614_469_960 161
753 3300047447 Ga0495685_005376 Ga0495685_005376_1697_2188 161
754 3300047447 Ga0495685_013729 Ga0495685_013729_95_586 161
755 3300047447 Ga0495685_048782 Ga0495685_048782_778_1269 161
756 3300047469 Ga0495673_0003502 Ga0495673_0003502_5488_5979 161
757 3300047469 Ga0495673_0017617 Ga0495673_0017617_2077_2568 161
758 3300047469 Ga0495673_0084524 Ga0495673_0084524_735_1226 161
759 3300047469 Ga0495673_0280506 Ga0495673_0280506_59_550 161
760 3300047470 Ga0495681_0000494 Ga0495681_0000494_9742_10233 161
761 3300047470 Ga0495681_0001608 Ga0495681_0001608_1502_1993 161
762 3300047470 Ga0495681_0002931 Ga0495681_0002931_8428_8919 161
763 3300047470 Ga0495681_0034546 Ga0495681_0034546_663_1154 161
764 3300047470 Ga0495681_0053828 Ga0495681_0053828_864_1355 161
765 3300047470 Ga0495681_0078548 Ga0495681_0078548_133_624 161
766 3300047470 Ga0495681_0088986 Ga0495681_0088986_17_508 161
767 3300047470 Ga0495681_0093686 Ga0495681_0093686_59_550 161
768 3300047470 Ga0495681_0100073 Ga0495681_0100073_683_1174 161
769 3300047470 Ga0495681_0102027 Ga0495681_0102027_84_575 161
770 3300047470 Ga0495681_0256654 Ga0495681_0256654_146_637 161
771 3300047472 Ga0495686_0000140 Ga0495686_0000140_45208_45699 161
772 3300047472 Ga0495686_0000334 Ga0495686_0000334_29057_29548 161
773 3300047472 Ga0495686_0002406 Ga0495686_0002406_9698_10189 161
774 3300047472 Ga0495686_0111925 Ga0495686_0111925_585_1076 161
775 3300047472 Ga0495686_0529686 Ga0495686_0529686_40_531 161
776 3300047673 Ga0495593_0000527 Ga0495593_0000527_8533_9024 161
777 3300047673 Ga0495593_0003264 Ga0495593_0003264_8902_9393 161
778 3300047673 Ga0495593_0149577 Ga0495593_0149577_290_781 161
779 3300048088 Ga0495602_0025977 Ga0495602_0025977_814_1305 161
780 3300048088 Ga0495602_0986329 Ga0495602_0986329_12_497 161
781 3300048089 Ga0495614_0000102 Ga0495614_0000102_9476_9967 161
782 3300048089 Ga0495614_0023379 Ga0495614_0023379_1706_2197 161
783 3300048089 Ga0495614_0054397 Ga0495614_0054397_252_743 161
784 3300048091 Ga0495626_0000006 Ga0495626_0000006_259720_260211 161
785 3300048091 Ga0495626_0000034 Ga0495626_0000034_114379_114870 161
786 3300048091 Ga0495626_0000266 Ga0495626_0000266_11046_11537 161
787 3300048091 Ga0495626_0005480 Ga0495626_0005480_5253_5744 161
788 3300048091 Ga0495626_0007513 Ga0495626_0007513_4028_4519 161
789 3300048091 Ga0495626_0013767 Ga0495626_0013767_3633_4124 161
790 3300048091 Ga0495626_0016227 Ga0495626_0016227_1369_1860 161
791 3300048091 Ga0495626_0017401 Ga0495626_0017401_1633_2124 161
792 3300048091 Ga0495626_0020154 Ga0495626_0020154_615_1106 161
793 3300048091 Ga0495626_0023074 Ga0495626_0023074_2203_2694 161
794 3300048091 Ga0495626_0029639 Ga0495626_0029639_1108_1599 161
795 3300048091 Ga0495626_0030999 Ga0495626_0030999_1110_1601 161
796 3300048091 Ga0495626_0074522 Ga0495626_0074522_65_556 161
797 3300048091 Ga0495626_0106096 Ga0495626_0106096_704_1195 161
798 3300048091 Ga0495626_0176967 Ga0495626_0176967_71_562 161
799 3300048091 Ga0495626_0256161 Ga0495626_0256161_138_629 161
800 3300048091 Ga0495626_0348276 Ga0495626_0348276_36_527 161
801 3300048903 Ga0496100_0243847 Ga0496100_0243847_615_1106 161
802 3300048903 Ga0496100_0454562 Ga0496100_0454562_338_829 161
803 3300048904 Ga0496101_0022215 Ga0496101_0022215_1296_1787 161
804 3300048904 Ga0496101_0244705 Ga0496101_0244705_368_859 161
805 3300048905 Ga0496102_0000098 Ga0496102_0000098_12528_13019 161
806 3300048905 Ga0496102_0094865 Ga0496102_0094865_1747_2238 161
807 3300048905 Ga0496102_0309568 Ga0496102_0309568_265_756 161
808 3300048906 Ga0496103_0008363 Ga0496103_0008363_4615_5106 161
809 3300048906 Ga0496103_0041731 Ga0496103_0041731_955_1446 161
810 3300048906 Ga0496103_0121085 Ga0496103_0121085_1072_1563 161
811 3300048906 Ga0496103_0375428 Ga0496103_0375428_82_573 161
812 3300048907 Ga0496104_0589002 Ga0496104_0589002_111_602 161
813 3300048908 Ga0496105_0040708 Ga0496105_0040708_1338_1829 161
814 3300048908 Ga0496105_0166624 Ga0496105_0166624_705_1196 161
815 3300048909 Ga0496106_0013411 Ga0496106_0013411_1025_1516 161
816 3300048909 Ga0496106_0062533 Ga0496106_0062533_1364_1855 161
817 3300048909 Ga0496106_0815295 Ga0496106_0815295_123_614 161
818 3300048910 Ga0496107_0225263 Ga0496107_0225263_468_959 161
819 3300048910 Ga0496107_0410892 Ga0496107_0410892_80_571 161
820 3300048910 Ga0496107_0542586 Ga0496107_0542586_210_701 161
821 3300048911 Ga0496108_1108740 Ga0496108_1108740_147_638 161
822 3300048912 Ga0496109_0092957 Ga0496109_0092957_1839_2330 161
823 3300048912 Ga0496109_0211166 Ga0496109_0211166_1186_1677 161
824 3300048913 Ga0496110_0002669 Ga0496110_0002669_12914_13405 161
825 3300048913 Ga0496110_0045966 Ga0496110_0045966_64_555 161
826 3300048913 Ga0496110_0249326 Ga0496110_0249326_39_530 161
827 3300048914 Ga0496111_0208352 Ga0496111_0208352_119_610 161
828 3300048914 Ga0496111_0252607 Ga0496111_0252607_191_682 161
829 3300048914 Ga0496111_0457807 Ga0496111_0457807_432_923 161
830 3300048914 Ga0496111_0657642 Ga0496111_0657642_95_586 161
831 3300048915 Ga0496112_0139260 Ga0496112_0139260_661_1152 161
832 3300048915 Ga0496112_0437897 Ga0496112_0437897_214_705 161
833 3300048915 Ga0496112_0607054 Ga0496112_0607054_463_954 161
834 3300048915 Ga0496112_0713615 Ga0496112_0713615_271_762 161
835 3300048915 Ga0496112_0990347 Ga0496112_0990347_124_615 161
836 3300048916 Ga0496113_0008438 Ga0496113_0008438_300_791 161
837 3300048916 Ga0496113_0017843 Ga0496113_0017843_29_520 161
838 3300048916 Ga0496113_0017975 Ga0496113_0017975_266_757 161
839 3300048916 Ga0496113_0237182 Ga0496113_0237182_80_571 161
840 3300048916 Ga0496113_0589497 Ga0496113_0589497_189_680 161
841 3300048917 Ga0496114_0040237 Ga0496114_0040237_1359_1850 161
842 3300048917 Ga0496114_0425640 Ga0496114_0425640_210_701 161
843 3300048917 Ga0496114_0478765 Ga0496114_0478765_83_574 161
844 3300048917 Ga0496114_0948190 Ga0496114_0948190_146_637 161
845 3300048918 Ga0496115_0040128 Ga0496115_0040128_2315_2809 161
846 3300048918 Ga0496115_0194577 Ga0496115_0194577_1088_1579 161
847 3300048918 Ga0496115_0362040 Ga0496115_0362040_38_529 161
848 3300048924 Ga0496121_0076420 Ga0496121_0076420_1742_2233 161
849 3300048925 Ga0496122_0000169 Ga0496122_0000169_8409_8900 161
850 3300048925 Ga0496122_0023062 Ga0496122_0023062_3682_4173 161
851 3300048925 Ga0496122_0026183 Ga0496122_0026183_3936_4427 161
852 3300048925 Ga0496122_0265768 Ga0496122_0265768_139_630 161
853 3300048926 Ga0496123_0005792 Ga0496123_0005792_7483_7974 161
854 3300048926 Ga0496123_0008550 Ga0496123_0008550_5575_6066 161
855 3300048926 Ga0496123_0085025 Ga0496123_0085025_1002_1493 161
856 3300048927 Ga0496124_0004722 Ga0496124_0004722_8329_8820 161
857 3300048927 Ga0496124_0009352 Ga0496124_0009352_2939_3430 161
858 3300048927 Ga0496124_0046015 Ga0496124_0046015_2453_2944 161
859 3300048927 Ga0496124_0131246 Ga0496124_0131246_1407_1898 161
860 3300048927 Ga0496124_0253910 Ga0496124_0253910_168_659 161
861 3300048928 Ga0496125_0006783 Ga0496125_0006783_1283_1774 161
862 3300048928 Ga0496125_0111082 Ga0496125_0111082_111_602 161
863 3300048928 Ga0496125_0222682 Ga0496125_0222682_111_602 161
864 3300048929 Ga0496126_0227525 Ga0496126_0227525_701_1192 161
865 3300049459 Ga0495678_000056 Ga0495678_000056_10093_10584 161
866 3300049459 Ga0495678_000079 Ga0495678_000079_112379_112870 161
867 3300049459 Ga0495678_001101 Ga0495678_001101_8273_8764 161
868 3300049459 Ga0495678_002357 Ga0495678_002357_8597_9088 161
869 3300049459 Ga0495678_003821 Ga0495678_003821_5135_5626 161
870 3300049459 Ga0495678_006752 Ga0495678_006752_3329_3820 161
871 3300049459 Ga0495678_025528 Ga0495678_025528_418_909 161
872 3300049460 Ga0495682_0000448 Ga0495682_0000448_11549_12040 161
873 3300049460 Ga0495682_0001431 Ga0495682_0001431_7702_8193 161
874 3300049460 Ga0495682_0005202 Ga0495682_0005202_1063_1554 161
875 3300049460 Ga0495682_0012758 Ga0495682_0012758_785_1276 161
876 3300049460 Ga0495682_0251141 Ga0495682_0251141_66_557 161
877 3300049571 Ga0501034_0171781 Ga0501034_0171781_1232_1723 161
878 3300049572 Ga0501036_0507640 Ga0501036_0507640_313_804 161
879 3300049581 Ga0501047_0349107 Ga0501047_0349107_118_609 161
880 3300049662 Ga0501222_015788 Ga0501222_015788_285_770 161
881 3300049665 Ga0501227_002385 Ga0501227_002385_1230_1715 161
882 3300049671 Ga0501238_000845 Ga0501238_000845_861_1352 161
883 3300049760 Ga0501263_035316 Ga0501263_035316_198_689 161
884 3300049775 Ga0501279_001228 Ga0501279_001228_2535_3026 161
885 3300049822 Ga0501035_0001651 Ga0501035_0001651_11507_11998 161
886 3300049823 Ga0501044_0117837 Ga0501044_0117837_968_1459 161
887 3300049823 Ga0501044_0830805 Ga0501044_0830805_14_505 161
888 3300050490 nmdc:mga03n38_429648_c1 nmdc:mga03n38_429648_c1_101_592 161
889 3300053077 Ga0495601_0010336 Ga0495601_0010336_4736_5221 161
890 3300053085 Ga0495619_0956198 Ga0495619_0956198_41_526 161
891 3300053119 Ga0500595_004294 Ga0500595_004294_4083_4568 161
892 3300053125 Ga0500618_038892 Ga0500618_038892_110_601 161
893 3300053141 Ga0500574_027913 Ga0500574_027913_487_972 161
894 3300061719 Ga0466962_0225335 Ga0466962_0225335_220_711 161
895 3300061719 Ga0466962_0533699 Ga0466962_0533699_93_584 161

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04073

tRNA_edit

Aminoacyl-tRNA editing domain

54

173

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
1dbx-assembly2.cif.gz_B crystal structure of cysteinyl-trna(pro) deacylase from h. influenzae (hi1434) 0.9441 8 160
2dxa-assembly1.cif.gz_A crystal structure of trans editing enzyme prox from e.coli 0.9408 8 160
1dbx-assembly2.cif.gz_B crystal structure of cysteinyl-trna(pro) deacylase from h. influenzae (hi1434) 0.9381 8 160
1dbu-assembly1.cif.gz_A crystal structure of cysteinyl-trna(pro) deacylase protein from h. influenzae (hi1434) 0.9358 8 160
1wdv-assembly2.cif.gz_B crystal structure of hypothetical protein ape2540 0.9318 9 159
ID Description Score Start End Superfamily
af_Q2G0A0_1_158_3.90.960.10 Alpha Beta;Alpha-Beta Complex;YbaK protein;YbaK/aminoacyl-tRNA synthetase-associated domain 0.9453 1 157 3.90.960.10
1dbxB00 Alpha Beta;Alpha-Beta Complex;YbaK protein;YbaK/aminoacyl-tRNA synthetase-associated domain 0.9406 8 160 3.90.960.10
1wdvB00 Alpha Beta;Alpha-Beta Complex;YbaK protein;YbaK/aminoacyl-tRNA synthetase-associated domain 0.9356 9 159 3.90.960.10
1dbxB00 Alpha Beta;Alpha-Beta Complex;YbaK protein;YbaK/aminoacyl-tRNA synthetase-associated domain 0.9346 8 160 3.90.960.10
af_Q2G0A0_1_158_3.90.960.10 Alpha Beta;Alpha-Beta Complex;YbaK protein;YbaK/aminoacyl-tRNA synthetase-associated domain 0.9338 1 157 3.90.960.10
ID Description Score Start End GO Terms
AF-A2SJH6-F1-model_v4 Cys-tRNA(Pro)/Cys-tRNA(Cys) deacylase (EC 4.2.-.-) 0.9989 2 159 GO:0002161
GO:0006412
GO:0016829
AF-A0A258P7J9-F1-model_v4 Cys-tRNA(Pro)/Cys-tRNA(Cys) deacylase (EC 4.2.-.-) 0.9962 14 161 GO:0002161
GO:0006412
GO:0016829
AF-A0A2N2HB54-F1-model_v4 Cys-tRNA(Pro)/Cys-tRNA(Cys) deacylase (EC 4.2.-.-) 0.9942 8 159 GO:0002161
GO:0006412
GO:0016829
AF-A0A2N2HKZ1-F1-model_v4 Cys-tRNA(Pro) deacylase 0.993 18 159 GO:0002161
GO:0006412
GO:0016829
AF-A0A5E5B0W4-F1-model_v4 Cys-tRNA(Pro)/Cys-tRNA(Cys) deacylase (EC 4.2.-.-) 0.9927 6 161 GO:0002161
GO:0006412
GO:0016829

Feature Viewer

pLDDT pTM Quality
94.86 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map