F484983
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 895 | 437 | 1790 | 182 |
Family's Representative Sequence
| Representative Sequence | 3300031344|Ga0265316_10207559|Ga0265316_102075593 |
| Length | 193 |
| Sequence | MSDDLVENIMIGIGQKLPAFSVVGVKPKFHFHEENGVSAFEALTEASFPGKWKVIFFYPKDFTFVCPTEIAEFARLAGEFADRDAVVMGGSTDNEHVKLAWRRDHKDLHKLPIWQFADSNGSLVDGLGVRSPDGVAYRVTVVVDPDNVVQHLYATNLNVGRAPKDTLRVLDALQTDELCACGREVGGATLKVA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 2 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 3 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 4 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 5 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 6 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 7 | 3300003162 | Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_21 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 8 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 9 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 10 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 11 | 3300003305 | Avena fatua rhizosphere microbial communities - H3_Rhizo_Litter_13 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 12 | 3300003308 | Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_20 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 13 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 14 | 3300003559 | Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_43 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 15 | 3300003568 | Avena fatua rhizosphere microbial communities - H4_Bulk_Litter_24 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 16 | 3300003574 | Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_26 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 17 | 3300003575 | Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 18 | 3300003577 | Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_32 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 19 | 3300003579 | Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_45 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 20 | 3300003693 | Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 21 | 3300003735 | Avena fatua rhizosphere microbial communities - H4_Bulk_Litter_23 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 22 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 23 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 24 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 25 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 26 | 3300003856 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz | Metagenome | Rhizosphere |
| 27 | 3300004785 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-1 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 28 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 29 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 30 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 31 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 32 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 33 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 36 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 39 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 41 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 42 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 44 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 46 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 55 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 56 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 60 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 61 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 62 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 63 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 64 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 66 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 67 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 68 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 70 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 73 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 75 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 76 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 77 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 78 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 79 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 80 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 81 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 82 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 83 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 84 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 85 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 86 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 87 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 88 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 89 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 90 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 91 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 92 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 93 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 94 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 95 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 97 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 98 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 99 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 100 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 101 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 103 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300012512 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 | Metagenome | Rhizosphere |
| 118 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 133 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 134 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 135 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 136 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 137 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 138 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 139 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 140 | 3300023304 | Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B3.ctno.R1 | Metatranscriptome | Rhizosphere |
| 141 | 3300023564 | Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRI4 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 142 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 143 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 144 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 145 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 146 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 147 | 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025290 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 150 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 151 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 152 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 153 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 154 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300027614 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 211 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 214 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 215 | 3300029285 | Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B3.stno.R1 | Metatranscriptome | Rhizosphere |
| 216 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 217 | 3300030731 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 | Metagenome | Rhizosphere |
| 218 | 3300030733 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 | Metagenome | Rhizosphere |
| 219 | 3300030735 | Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 | Metagenome | Rhizosphere |
| 220 | 3300030736 | Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 | Metagenome | Rhizosphere |
| 221 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 222 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 223 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 224 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 225 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 226 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 227 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 228 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 229 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 230 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 231 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 232 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 233 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 234 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 235 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 236 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 237 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 238 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 239 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 240 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 241 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 242 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 243 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 244 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 245 | 3300033541 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 246 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 247 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 248 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 249 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 250 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 251 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 252 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 253 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 254 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 255 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 256 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 257 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 258 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 259 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 260 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 261 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 262 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 263 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 264 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 265 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 266 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 267 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 268 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 269 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 270 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 271 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 272 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 273 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 274 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 275 | 3300042130 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 | Metagenome | Rhizosphere |
| 276 | 3300042135 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 | Metagenome | Rhizosphere |
| 277 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 278 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 279 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 280 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 281 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 282 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 283 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 284 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 285 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 286 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 287 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 288 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 289 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 290 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 291 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 292 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 315 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 316 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 317 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 318 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 319 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 320 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 321 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 322 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 323 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 324 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 325 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 326 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 327 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 328 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 329 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 330 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 331 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 332 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 333 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 334 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 335 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 336 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 337 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 338 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 339 | 3300049127 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 340 | 3300049128 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 341 | 3300049129 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 342 | 3300049130 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 343 | 3300049131 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 344 | 3300049160 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 345 | 3300049161 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 346 | 3300049162 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 347 | 3300049528 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 348 | 3300049529 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 349 | 3300049530 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 350 | 3300049531 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 351 | 3300049532 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 352 | 3300049533 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 353 | 3300049534 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 354 | 3300049536 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 355 | 3300049539 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 356 | 3300049540 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 357 | 3300049551 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 358 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 359 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 360 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 361 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 362 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 363 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 364 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 365 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 366 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 367 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 368 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 369 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 370 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 371 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 372 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 373 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 374 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 375 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 376 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 377 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 378 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 379 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 380 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 381 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 382 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 383 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 384 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 385 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 386 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 387 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 388 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 389 | 3300053149 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere | Metagenome | Endosphere |
| 390 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 391 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 392 | 3300060344 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 393 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 394 | 2508501128 | Bradyrhizobium sp. ARR65 | Isolate | Nodule |
| 395 | 2519103095 | Burkholderia sp. KJ006 | Isolate | Nodule |
| 396 | 2582581311 | Burkholderia sp. WP42 | Isolate | Rhizosphere |
| 397 | 2599185239 | Burkholderia sp. NFACC38-1 | Isolate | Rhizoplane |
| 398 | 2599185240 | Burkholderia sp. NFPP32 | Isolate | Rhizoplane |
| 399 | 2599185292 | Achromobacter sp. NFACC18-2 | Isolate | Rhizoplane |
| 400 | 2599185355 | Burkholderia sp. NFACC33-1 | Isolate | Rhizoplane |
| 401 | 2643221569 | Achromobacter sp. Root565 | Isolate | Unclassified |
| 402 | 2643221594 | Achromobacter sp. Root170 | Isolate | Unclassified |
| 403 | 2643221621 | Achromobacter sp. Root83 | Isolate | Unclassified |
| 404 | 2675903129 | Burkholderia pyrrocinia NFIX32 | Isolate | Rhizoplane |
| 405 | 2734482258 | Glomeribacter sp. phylotype 3 | Isolate | Unclassified |
| 406 | 2808606395 | Achromobacter sp. SLBN-14 | Isolate | Unclassified |
| 407 | 2816332253 | Burkholderia vietnamiensis HI2297 | Isolate | Unclassified |
| 408 | 2816332256 | Burkholderia vietnamiensis MSMB608WGS | Isolate | Unclassified |
| 409 | 2816332286 | Burkholderia vietnamiensis HI2221 | Isolate | Rhizosphere |
| 410 | 2818991452 | Burkholderia cepacia 561 | Isolate | Unclassified |
| 411 | 2855730933 | Achromobacter sp. HZ28 | Isolate | Nodule |
| 412 | 2855767633 | Achromobacter sp. HZ34 | Isolate | Nodule |
| 413 | 2857537821 | Achromobacter sp. R-71975 | Isolate | Unclassified |
| 414 | 2857542790 | Achromobacter sp. R-72367 | Isolate | Unclassified |
| 415 | 2858950400 | Achromobacter sp. K91 | Isolate | Unclassified |
| 416 | 2863421361 | Burkholderia cenocepacia CACua-24 | Isolate | Rhizosphere |
| 417 | 2870068957 | Burkholderia sp. JP2-270 | Isolate | Unclassified |
| 418 | 2881412998 | Achromobacter aloeverae AVA-1 | Isolate | Unclassified |
| 419 | 2904564687 | Burkholderia sp. 571 | Isolate | Unclassified |
| 420 | 2904571731 | Burkholderia cenocepacia 574 | Isolate | Unclassified |
| 421 | 2928157003 | Burkholderia ambifaria 566 | Isolate | Unclassified |
| 422 | 2928163908 | Burkholderia sp. 567 | Isolate | Unclassified |
| 423 | 2928170801 | Burkholderia sp. 572 | Isolate | Unclassified |
| 424 | 2928536128 | Burkholderia sola 565 | Isolate | Unclassified |
| 425 | 2941479691 | |||
| 426 | 2981990288 | Burkholderia sp. PvR073 | Isolate | Rhizosphere |
| 427 | 641522639 | Methylobacterium sp. 4-46 | Isolate | Nodule |
| 428 | 641736154 | Burkholderia ambifaria IOP40-10 | Isolate | Rhizosphere |
| 429 | 643348564 | Methylobacterium nodulans ORS 2060 | Isolate | Nodule |
| 430 | 8018845410 | Burkholderia reimsis BE51 | Isolate | Rhizosphere |
| 431 | 8020807995 | Burkholderia sp. B10 | Isolate | Rhizosphere |
| 432 | 8020938398 | Burkholderia sp. BE12 | Isolate | Rhizosphere |
| 433 | 8020953355 | Burkholderia sp. BE24 | Isolate | Rhizosphere |
| 434 | 8021120328 | Burkholderia sp. LS-044 | Isolate | Rhizosphere |
| 435 | 8039098773 | Burkholderia multivorans MSMB612WGS | Isolate | Unclassified |
| 436 | 8040167225 | Burkholderia vietnamiensis RS1 | Isolate | Unclassified |
| 437 | 8040173305 | Burkholderia vietnamiensis BE10 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 88.16 |
| Metatranscriptomes | 6.93 |
| Isolates | 4.92 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 4.58 |
| Nodule | 0.67 |
| Rhizoplane | 4.13 |
| Rhizosphere | 84.25 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0265316_10207559 | 3300031344 | Bacteria | 1450 |
| 2 | JGI24741J21665_1025326 | 3300001915 | Bacteria | 907 |
| 3 | JGI24740J21852_10019934 | 3300001979 | Bacteria | 2351 |
| 4 | JGI24737J22298_10051115 | 3300001990 | Bacteria | 1255 |
| 5 | JGI24735J21928_10021101 | 3300002067 | Bacteria | 1991 |
| 6 | JGI25156J39149_1029015 | 3300002705 | Bacteria | 848 |
| 7 | Ga0006778J45830_1005071 | 3300003162 | Bacteria | 631 |
| 8 | Ga0006778J45830_1054358 | 3300003162 | Bacteria | 659 |
| 9 | JGI25151J46595_10000252 | 3300003187 | Bacteria | 62814 |
| 10 | JGI25406J46586_10000483 | 3300003203 | Bacteria | 18575 |
| 11 | JGI25406J46586_10000556 | 3300003203 | Bacteria | 17608 |
| 12 | JGI25153J46596_10005152 | 3300003215 | Bacteria | 6887 |
| 13 | Ga0006770J48903_1010095 | 3300003305 | Bacteria | 681 |
| 14 | Ga0006777J48905_1005390 | 3300003308 | Bacteria | 729 |
| 15 | Ga0006777J48905_1060873 | 3300003308 | Bacteria | 606 |
| 16 | rootH1_10030144 | 3300003316 | Bacteria | 1624 |
| 17 | Ga0007427J51700_113419 | 3300003559 | Bacteria | 768 |
| 18 | Ga0006781J51513_1004106 | 3300003568 | Bacteria | 619 |
| 19 | Ga0007410J51695_1054394 | 3300003574 | Bacteria | 607 |
| 20 | Ga0007409J51694_1036348 | 3300003575 | Bacteria | 646 |
| 21 | Ga0007409J51694_1087169 | 3300003575 | Bacteria | 702 |
| 22 | Ga0007416J51690_1047561 | 3300003577 | Bacteria | 695 |
| 23 | Ga0007416J51690_1051877 | 3300003577 | Bacteria | 679 |
| 24 | Ga0007429J51699_1005545 | 3300003579 | Bacteria | 619 |
| 25 | Ga0007429J51699_1034423 | 3300003579 | Bacteria | 610 |
| 26 | Ga0007429J51699_1039295 | 3300003579 | Bacteria | 604 |
| 27 | Ga0007429J51699_1049319 | 3300003579 | Bacteria | 609 |
| 28 | Ga0007429J51699_1095865 | 3300003579 | Bacteria | 618 |
| 29 | Ga0032354_1002485 | 3300003693 | Bacteria | 626 |
| 30 | Ga0032354_1007551 | 3300003693 | Bacteria | 593 |
| 31 | Ga0032354_1010142 | 3300003693 | Bacteria | 599 |
| 32 | Ga0032354_1041181 | 3300003693 | Bacteria | 872 |
| 33 | Ga0032354_1052527 | 3300003693 | Bacteria | 609 |
| 34 | Ga0032354_1078728 | 3300003693 | Bacteria | 850 |
| 35 | Ga0006780_1032026 | 3300003735 | Bacteria | 741 |
| 36 | Ga0055529_1000760 | 3300003763 | Bacteria | 20474 |
| 37 | Ga0055528_1002190 | 3300003790 | Bacteria | 10681 |
| 38 | Ga0055540_1042696 | 3300003792 | Bacteria | 970 |
| 39 | Ga0055541_1010071 | 3300003841 | Bacteria | 1437 |
| 40 | Ga0058692_1005445 | 3300003856 | Bacteria | 3627 |
| 41 | Ga0058858_1380169 | 3300004785 | Bacteria | 651 |
| 42 | Ga0065714_10162327 | 3300005288 | Bacteria | 1020 |
| 43 | Ga0065704_10274630 | 3300005289 | Bacteria | 935 |
| 44 | Ga0065712_10241509 | 3300005290 | Bacteria | 983 |
| 45 | Ga0065715_10228715 | 3300005293 | Bacteria | 1242 |
| 46 | Ga0065707_10087162 | 3300005295 | Bacteria | 5129 |
| 47 | Ga0065707_10381186 | 3300005295 | Bacteria | 877 |
| 48 | Ga0065707_10486204 | 3300005295 | Bacteria | 769 |
| 49 | Ga0070658_10017497 | 3300005327 | Bacteria | 5735 |
| 50 | Ga0070658_10052963 | 3300005327 | Bacteria | 3292 |
| 51 | Ga0070676_10071535 | 3300005328 | Bacteria | 2083 |
| 52 | Ga0070676_10663991 | 3300005328 | Bacteria | 758 |
| 53 | Ga0070683_100020025 | 3300005329 | Bacteria | 5949 |
| 54 | Ga0070683_100049798 | 3300005329 | Bacteria | 3875 |
| 55 | Ga0070683_100266805 | 3300005329 | Bacteria | 1628 |
| 56 | Ga0070670_100008493 | 3300005331 | Bacteria | 8760 |
| 57 | Ga0070670_100021601 | 3300005331 | Bacteria | 5536 |
| 58 | Ga0070670_100172507 | 3300005331 | Bacteria | 1876 |
| 59 | Ga0070670_100181465 | 3300005331 | Bacteria | 1828 |
| 60 | Ga0070670_100231741 | 3300005331 | Bacteria | 1607 |
| 61 | Ga0070677_10177982 | 3300005333 | Bacteria | 1010 |
| 62 | Ga0068869_100002295 | 3300005334 | Bacteria | 11503 |
| 63 | Ga0068869_100005456 | 3300005334 | Bacteria | 8000 |
| 64 | Ga0068869_100434426 | 3300005334 | Bacteria | 1085 |
| 65 | Ga0068869_100664316 | 3300005334 | Bacteria | 886 |
| 66 | Ga0068869_100780806 | 3300005334 | Bacteria | 820 |
| 67 | Ga0068869_101156786 | 3300005334 | Bacteria | 679 |
| 68 | Ga0070666_10005229 | 3300005335 | Bacteria | 7948 |
| 69 | Ga0070666_10094163 | 3300005335 | Bacteria | 2060 |
| 70 | Ga0070666_10231707 | 3300005335 | Bacteria | 1304 |
| 71 | Ga0070666_10522232 | 3300005335 | Bacteria | 862 |
| 72 | Ga0070680_100011280 | 3300005336 | Bacteria | 6912 |
| 73 | Ga0068868_100003743 | 3300005338 | Bacteria | 10621 |
| 74 | Ga0068868_100119105 | 3300005338 | Bacteria | 2152 |
| 75 | Ga0068868_101011170 | 3300005338 | Bacteria | 761 |
| 76 | Ga0070660_100004671 | 3300005339 | Bacteria | 9483 |
| 77 | Ga0070660_100027436 | 3300005339 | Bacteria | 4250 |
| 78 | Ga0070660_100556875 | 3300005339 | Bacteria | 957 |
| 79 | Ga0070687_100039596 | 3300005343 | Bacteria | 2369 |
| 80 | Ga0070687_100202489 | 3300005343 | Bacteria | 1204 |
| 81 | Ga0070687_100385005 | 3300005343 | Bacteria | 915 |
| 82 | Ga0070661_100044368 | 3300005344 | Bacteria | 3248 |
| 83 | Ga0070661_100277392 | 3300005344 | Bacteria | 1299 |
| 84 | Ga0070661_100611446 | 3300005344 | Bacteria | 882 |
| 85 | Ga0070661_100666316 | 3300005344 | Bacteria | 846 |
| 86 | Ga0070692_10163683 | 3300005345 | Bacteria | 1276 |
| 87 | Ga0070692_10176681 | 3300005345 | Bacteria | 1234 |
| 88 | Ga0070668_100017520 | 3300005347 | Bacteria | 5371 |
| 89 | Ga0070668_100042023 | 3300005347 | Bacteria | 3503 |
| 90 | Ga0070668_100429836 | 3300005347 | Bacteria | 1132 |
| 91 | Ga0070669_100000561 | 3300005353 | Bacteria | 27642 |
| 92 | Ga0070669_100006960 | 3300005353 | Bacteria | 8124 |
| 93 | Ga0070669_100025095 | 3300005353 | Bacteria | 4280 |
| 94 | Ga0070669_100143709 | 3300005353 | Bacteria | 1841 |
| 95 | Ga0070669_100158397 | 3300005353 | Bacteria | 1757 |
| 96 | Ga0070675_100004493 | 3300005354 | Bacteria | 10651 |
| 97 | Ga0070675_100007406 | 3300005354 | Bacteria | 8478 |
| 98 | Ga0070675_100126523 | 3300005354 | Bacteria | 2174 |
| 99 | Ga0070675_100136078 | 3300005354 | Bacteria | 2097 |
| 100 | Ga0070671_100002656 | 3300005355 | Bacteria | 13846 |
| 101 | Ga0070671_100041050 | 3300005355 | Bacteria | 3844 |
| 102 | Ga0070671_100129202 | 3300005355 | Bacteria | 2127 |
| 103 | Ga0070671_100309441 | 3300005355 | Bacteria | 1345 |
| 104 | Ga0070674_100016652 | 3300005356 | Bacteria | 4611 |
| 105 | Ga0070673_100047958 | 3300005364 | Bacteria | 3327 |
| 106 | Ga0070673_100079275 | 3300005364 | Bacteria | 2658 |
| 107 | Ga0070673_100083159 | 3300005364 | Bacteria | 2600 |
| 108 | Ga0070673_100367516 | 3300005364 | Bacteria | 1280 |
| 109 | Ga0070673_100705222 | 3300005364 | Bacteria | 927 |
| 110 | Ga0070673_101194366 | 3300005364 | Bacteria | 712 |
| 111 | Ga0070659_100000788 | 3300005366 | Bacteria | 23095 |
| 112 | Ga0070659_100078029 | 3300005366 | Bacteria | 2642 |
| 113 | Ga0070659_100335204 | 3300005366 | Bacteria | 1267 |
| 114 | Ga0070667_100005438 | 3300005367 | Bacteria | 10641 |
| 115 | Ga0070667_100013482 | 3300005367 | Bacteria | 6754 |
| 116 | Ga0070667_100102468 | 3300005367 | Bacteria | 2473 |
| 117 | Ga0070667_101614593 | 3300005367 | Bacteria | 609 |
| 118 | Ga0070701_10165088 | 3300005438 | Bacteria | 1285 |
| 119 | Ga0070700_100015319 | 3300005441 | Bacteria | 4346 |
| 120 | Ga0070700_100397168 | 3300005441 | Bacteria | 1036 |
| 121 | Ga0070663_100001963 | 3300005455 | Bacteria | 11490 |
| 122 | Ga0070663_100222906 | 3300005455 | Bacteria | 1481 |
| 123 | Ga0070663_100250060 | 3300005455 | Bacteria | 1403 |
| 124 | Ga0070663_100316089 | 3300005455 | Bacteria | 1254 |
| 125 | Ga0070678_100003443 | 3300005456 | Bacteria | 8823 |
| 126 | Ga0070678_100281442 | 3300005456 | Bacteria | 1407 |
| 127 | Ga0070678_100307547 | 3300005456 | Bacteria | 1349 |
| 128 | Ga0070662_100060438 | 3300005457 | Bacteria | 2763 |
| 129 | Ga0070662_100074424 | 3300005457 | Bacteria | 2512 |
| 130 | Ga0070662_100091245 | 3300005457 | Bacteria | 2288 |
| 131 | Ga0070662_100270655 | 3300005457 | Bacteria | 1371 |
| 132 | Ga0070662_100309251 | 3300005457 | Bacteria | 1286 |
| 133 | Ga0070681_10002686 | 3300005458 | Bacteria | 16352 |
| 134 | Ga0070681_10083560 | 3300005458 | Bacteria | 3146 |
| 135 | Ga0068867_100001675 | 3300005459 | Bacteria | 15435 |
| 136 | Ga0068867_100002388 | 3300005459 | Bacteria | 13206 |
| 137 | Ga0068867_100027566 | 3300005459 | Bacteria | 4084 |
| 138 | Ga0068867_100036868 | 3300005459 | Bacteria | 3552 |
| 139 | Ga0068867_100053604 | 3300005459 | Bacteria | 2979 |
| 140 | Ga0070706_100003915 | 3300005467 | Bacteria | 14517 |
| 141 | Ga0070706_100853571 | 3300005467 | Bacteria | 842 |
| 142 | Ga0070707_100921136 | 3300005468 | Bacteria | 839 |
| 143 | Ga0070698_100054506 | 3300005471 | Bacteria | 4059 |
| 144 | Ga0070699_100101193 | 3300005518 | Bacteria | 2526 |
| 145 | Ga0070679_100001227 | 3300005530 | Bacteria | 22510 |
| 146 | Ga0070679_100001401 | 3300005530 | Bacteria | 21267 |
| 147 | Ga0070684_100025198 | 3300005535 | Bacteria | 4997 |
| 148 | Ga0070684_100186704 | 3300005535 | Bacteria | 1885 |
| 149 | Ga0068853_100002964 | 3300005539 | Bacteria | 12925 |
| 150 | Ga0068853_100073742 | 3300005539 | Bacteria | 2976 |
| 151 | Ga0068853_100118985 | 3300005539 | Bacteria | 2354 |
| 152 | Ga0070672_100016642 | 3300005543 | Bacteria | 5271 |
| 153 | Ga0070672_100023346 | 3300005543 | Bacteria | 4558 |
| 154 | Ga0070672_100069074 | 3300005543 | Bacteria | 2804 |
| 155 | Ga0070672_100185138 | 3300005543 | Bacteria | 1736 |
| 156 | Ga0070672_100818949 | 3300005543 | Bacteria | 820 |
| 157 | Ga0070686_100565306 | 3300005544 | Bacteria | 891 |
| 158 | Ga0070686_100577371 | 3300005544 | Bacteria | 883 |
| 159 | Ga0070693_100092541 | 3300005547 | Bacteria | 1826 |
| 160 | Ga0070665_100081042 | 3300005548 | Bacteria | 3251 |
| 161 | Ga0070665_100723248 | 3300005548 | Bacteria | 1008 |
| 162 | Ga0068855_100082482 | 3300005563 | Bacteria | 3726 |
| 163 | Ga0068855_100232936 | 3300005563 | Bacteria | 2061 |
| 164 | Ga0068855_100532184 | 3300005563 | Bacteria | 1274 |
| 165 | Ga0070664_100026844 | 3300005564 | Bacteria | 4782 |
| 166 | Ga0068857_100016245 | 3300005577 | Bacteria | 6521 |
| 167 | Ga0068857_100042621 | 3300005577 | Bacteria | 4027 |
| 168 | Ga0068857_100134094 | 3300005577 | Bacteria | 2236 |
| 169 | Ga0068857_100463114 | 3300005577 | Bacteria | 1187 |
| 170 | Ga0068857_101185464 | 3300005577 | Bacteria | 739 |
| 171 | Ga0068854_100153131 | 3300005578 | Bacteria | 1779 |
| 172 | Ga0068854_100290641 | 3300005578 | Bacteria | 1319 |
| 173 | Ga0068856_100009521 | 3300005614 | Bacteria | 9438 |
| 174 | Ga0068856_100111688 | 3300005614 | Bacteria | 2730 |
| 175 | Ga0068856_100192484 | 3300005614 | Bacteria | 2053 |
| 176 | Ga0068856_100589334 | 3300005614 | Bacteria | 1133 |
| 177 | Ga0070702_100147969 | 3300005615 | Bacteria | 1504 |
| 178 | Ga0070702_100324246 | 3300005615 | Bacteria | 1074 |
| 179 | Ga0070702_100953848 | 3300005615 | Bacteria | 676 |
| 180 | Ga0068852_100066971 | 3300005616 | Bacteria | 3138 |
| 181 | Ga0068852_100070537 | 3300005616 | Bacteria | 3066 |
| 182 | Ga0068852_100195045 | 3300005616 | Bacteria | 1913 |
| 183 | Ga0068852_100519903 | 3300005616 | Bacteria | 1187 |
| 184 | Ga0068852_101350774 | 3300005616 | Bacteria | 734 |
| 185 | Ga0068859_100000492 | 3300005617 | Bacteria | 38877 |
| 186 | Ga0068859_100035271 | 3300005617 | Bacteria | 5019 |
| 187 | Ga0068859_100044039 | 3300005617 | Bacteria | 4485 |
| 188 | Ga0068859_100122926 | 3300005617 | Bacteria | 2663 |
| 189 | Ga0068859_100258966 | 3300005617 | Bacteria | 1830 |
| 190 | Ga0068864_100008810 | 3300005618 | Bacteria | 8318 |
| 191 | Ga0068864_100009812 | 3300005618 | Bacteria | 7895 |
| 192 | Ga0068864_100055448 | 3300005618 | Bacteria | 3422 |
| 193 | Ga0068864_100234674 | 3300005618 | Bacteria | 1697 |
| 194 | Ga0068864_100660156 | 3300005618 | Bacteria | 1019 |
| 195 | Ga0068866_10019671 | 3300005718 | Bacteria | 3079 |
| 196 | Ga0068866_10224851 | 3300005718 | Bacteria | 1135 |
| 197 | Ga0068861_100005884 | 3300005719 | Bacteria | 8336 |
| 198 | Ga0068861_100025591 | 3300005719 | Bacteria | 4281 |
| 199 | Ga0068861_100523654 | 3300005719 | Bacteria | 1076 |
| 200 | Ga0068851_10029564 | 3300005834 | Bacteria | 2713 |
| 201 | Ga0068851_10307003 | 3300005834 | Bacteria | 913 |
| 202 | Ga0068870_10008062 | 3300005840 | Bacteria | 4720 |
| 203 | Ga0068863_100001897 | 3300005841 | Bacteria | 20747 |
| 204 | Ga0068863_100073129 | 3300005841 | Bacteria | 3243 |
| 205 | Ga0068863_100213027 | 3300005841 | Bacteria | 1860 |
| 206 | Ga0068863_100272170 | 3300005841 | Bacteria | 1639 |
| 207 | Ga0068863_100399698 | 3300005841 | Bacteria | 1344 |
| 208 | Ga0068863_100954618 | 3300005841 | Bacteria | 859 |
| 209 | Ga0068858_100003285 | 3300005842 | Bacteria | 16104 |
| 210 | Ga0068858_100009299 | 3300005842 | Bacteria | 9380 |
| 211 | Ga0068858_100012259 | 3300005842 | Bacteria | 8082 |
| 212 | Ga0068858_100209000 | 3300005842 | Bacteria | 1847 |
| 213 | Ga0068858_100335267 | 3300005842 | Bacteria | 1447 |
| 214 | Ga0068858_100342647 | 3300005842 | Bacteria | 1431 |
| 215 | Ga0068860_100004697 | 3300005843 | Bacteria | 13938 |
| 216 | Ga0068860_100005057 | 3300005843 | Bacteria | 13411 |
| 217 | Ga0068860_100010416 | 3300005843 | Bacteria | 9196 |
| 218 | Ga0068860_100018447 | 3300005843 | Bacteria | 6787 |
| 219 | Ga0068860_100129423 | 3300005843 | Bacteria | 2421 |
| 220 | Ga0068860_100369273 | 3300005843 | Bacteria | 1415 |
| 221 | Ga0068860_100736246 | 3300005843 | Bacteria | 997 |
| 222 | Ga0068860_100912406 | 3300005843 | Bacteria | 895 |
| 223 | Ga0068862_100004059 | 3300005844 | Bacteria | 12410 |
| 224 | Ga0068862_100023545 | 3300005844 | Bacteria | 5161 |
| 225 | Ga0068862_100029113 | 3300005844 | Bacteria | 4651 |
| 226 | Ga0068862_100030077 | 3300005844 | Bacteria | 4576 |
| 227 | Ga0068862_100062324 | 3300005844 | Bacteria | 3207 |
| 228 | Ga0068862_100259621 | 3300005844 | Bacteria | 1586 |
| 229 | Ga0081455_10373288 | 3300005937 | Bacteria | 999 |
| 230 | Ga0081539_10225780 | 3300005985 | Bacteria | 849 |
| 231 | Ga0075363_100289387 | 3300006048 | Bacteria | 949 |
| 232 | Ga0075364_10000343 | 3300006051 | Bacteria | 23165 |
| 233 | Ga0075364_10002779 | 3300006051 | Bacteria | 9836 |
| 234 | Ga0075367_10019588 | 3300006178 | Bacteria | 3754 |
| 235 | Ga0075366_10000330 | 3300006195 | Bacteria | 21707 |
| 236 | Ga0075366_10082965 | 3300006195 | Bacteria | 1915 |
| 237 | Ga0075366_10085229 | 3300006195 | Bacteria | 1890 |
| 238 | Ga0075366_10123563 | 3300006195 | Bacteria | 1560 |
| 239 | Ga0075366_10166668 | 3300006195 | Bacteria | 1336 |
| 240 | Ga0075366_10188906 | 3300006195 | Bacteria | 1252 |
| 241 | Ga0075366_10214212 | 3300006195 | Bacteria | 1173 |
| 242 | Ga0097621_100042279 | 3300006237 | Bacteria | 3670 |
| 243 | Ga0097621_100045675 | 3300006237 | Bacteria | 3539 |
| 244 | Ga0097621_100373789 | 3300006237 | Bacteria | 1272 |
| 245 | Ga0097621_100867935 | 3300006237 | Bacteria | 839 |
| 246 | Ga0075370_10006605 | 3300006353 | Bacteria | 5845 |
| 247 | Ga0068871_100032664 | 3300006358 | Bacteria | 4113 |
| 248 | Ga0068871_100051867 | 3300006358 | Bacteria | 3321 |
| 249 | Ga0068871_100852912 | 3300006358 | Bacteria | 842 |
| 250 | Ga0075433_10122757 | 3300006852 | Bacteria | 2307 |
| 251 | Ga0075434_100129275 | 3300006871 | Bacteria | 2544 |
| 252 | Ga0075434_101191422 | 3300006871 | Bacteria | 774 |
| 253 | Ga0068865_100002375 | 3300006881 | Bacteria | 11095 |
| 254 | Ga0068865_100025220 | 3300006881 | Bacteria | 3908 |
| 255 | Ga0068865_100031584 | 3300006881 | Bacteria | 3532 |
| 256 | Ga0068865_101269648 | 3300006881 | Bacteria | 654 |
| 257 | Ga0097620_100000492 | 3300006931 | Bacteria | 38877 |
| 258 | Ga0097620_100035270 | 3300006931 | Bacteria | 5019 |
| 259 | Ga0097620_100044041 | 3300006931 | Bacteria | 4485 |
| 260 | Ga0097620_100122919 | 3300006931 | Bacteria | 2663 |
| 261 | Ga0097620_100258961 | 3300006931 | Bacteria | 1830 |
| 262 | Ga0075435_100122314 | 3300007076 | Bacteria | 2173 |
| 263 | Ga0075435_100859090 | 3300007076 | Bacteria | 791 |
| 264 | Ga0105244_10022984 | 3300009036 | Bacteria | 3426 |
| 265 | Ga0105240_11224141 | 3300009093 | Bacteria | 794 |
| 266 | Ga0111539_10044921 | 3300009094 | Bacteria | 5290 |
| 267 | Ga0111539_11418774 | 3300009094 | Bacteria | 805 |
| 268 | Ga0111539_11844850 | 3300009094 | Bacteria | 701 |
| 269 | Ga0105245_10038984 | 3300009098 | Bacteria | 4228 |
| 270 | Ga0105245_10182459 | 3300009098 | Bacteria | 2006 |
| 271 | Ga0105247_10083595 | 3300009101 | Bacteria | 2016 |
| 272 | Ga0105247_10128077 | 3300009101 | Bacteria | 1652 |
| 273 | Ga0105247_10198228 | 3300009101 | Bacteria | 1347 |
| 274 | Ga0105247_10198909 | 3300009101 | Bacteria | 1345 |
| 275 | Ga0114129_12075118 | 3300009147 | Bacteria | 686 |
| 276 | Ga0105243_10191622 | 3300009148 | Bacteria | 1786 |
| 277 | Ga0105243_10251606 | 3300009148 | Bacteria | 1578 |
| 278 | Ga0105242_10055147 | 3300009176 | Bacteria | 3252 |
| 279 | Ga0105242_10190974 | 3300009176 | Bacteria | 1813 |
| 280 | Ga0105242_10246862 | 3300009176 | Bacteria | 1607 |
| 281 | Ga0105248_10000981 | 3300009177 | Bacteria | 31678 |
| 282 | Ga0105248_10058293 | 3300009177 | Bacteria | 4336 |
| 283 | Ga0105248_10097212 | 3300009177 | Bacteria | 3318 |
| 284 | Ga0105248_10418900 | 3300009177 | Bacteria | 1508 |
| 285 | Ga0105248_10538343 | 3300009177 | Bacteria | 1317 |
| 286 | Ga0105248_10934944 | 3300009177 | Bacteria | 979 |
| 287 | Ga0105237_10116774 | 3300009545 | Bacteria | 2662 |
| 288 | Ga0105237_10505369 | 3300009545 | Bacteria | 1215 |
| 289 | Ga0105238_10011761 | 3300009551 | Bacteria | 8821 |
| 290 | Ga0105238_10142452 | 3300009551 | Bacteria | 2374 |
| 291 | Ga0105238_10523006 | 3300009551 | Bacteria | 1189 |
| 292 | Ga0105249_10029828 | 3300009553 | Bacteria | 4928 |
| 293 | Ga0105249_10179131 | 3300009553 | Bacteria | 2061 |
| 294 | Ga0105249_10548653 | 3300009553 | Bacteria | 1206 |
| 295 | Ga0105249_11147881 | 3300009553 | Bacteria | 847 |
| 296 | Ga0105239_10019206 | 3300010375 | Bacteria | 7550 |
| 297 | Ga0105239_10126659 | 3300010375 | Bacteria | 2839 |
| 298 | Ga0105246_10535315 | 3300011119 | Bacteria | 1001 |
| 299 | Ga0157327_1004078 | 3300012512 | Bacteria | 1113 |
| 300 | Ga0157373_10016456 | 3300013100 | Bacteria | 5393 |
| 301 | Ga0157373_10033207 | 3300013100 | Bacteria | 3713 |
| 302 | Ga0157373_10179896 | 3300013100 | Bacteria | 1489 |
| 303 | Ga0157371_10030892 | 3300013102 | Bacteria | 3861 |
| 304 | Ga0157371_10035498 | 3300013102 | Bacteria | 3572 |
| 305 | Ga0157371_10052063 | 3300013102 | Bacteria | 2908 |
| 306 | Ga0157370_10003769 | 3300013104 | Bacteria | 17697 |
| 307 | Ga0157370_10408776 | 3300013104 | Bacteria | 1249 |
| 308 | Ga0157369_10025592 | 3300013105 | Bacteria | 6548 |
| 309 | Ga0157369_10710050 | 3300013105 | Bacteria | 1035 |
| 310 | Ga0157374_10000479 | 3300013296 | Bacteria | 36298 |
| 311 | Ga0157374_10109605 | 3300013296 | Bacteria | 2654 |
| 312 | Ga0157374_10357158 | 3300013296 | Bacteria | 1452 |
| 313 | Ga0157374_10374905 | 3300013296 | Bacteria | 1417 |
| 314 | Ga0157374_10587083 | 3300013296 | Bacteria | 1123 |
| 315 | Ga0157374_10833237 | 3300013296 | Bacteria | 939 |
| 316 | Ga0157378_10093011 | 3300013297 | Bacteria | 2744 |
| 317 | Ga0157378_10243172 | 3300013297 | Bacteria | 1720 |
| 318 | Ga0157378_10337459 | 3300013297 | Bacteria | 1468 |
| 319 | Ga0157378_10536443 | 3300013297 | Bacteria | 1174 |
| 320 | Ga0157378_10645474 | 3300013297 | Bacteria | 1074 |
| 321 | Ga0163162_10007760 | 3300013306 | Bacteria | 10456 |
| 322 | Ga0163162_10016605 | 3300013306 | Bacteria | 7195 |
| 323 | Ga0163162_10036293 | 3300013306 | Bacteria | 4911 |
| 324 | Ga0163162_10068824 | 3300013306 | Bacteria | 3592 |
| 325 | Ga0163162_10105166 | 3300013306 | Bacteria | 2917 |
| 326 | Ga0163162_10478705 | 3300013306 | Bacteria | 1376 |
| 327 | Ga0163162_10727019 | 3300013306 | Bacteria | 1113 |
| 328 | Ga0157372_10020411 | 3300013307 | Bacteria | 7147 |
| 329 | Ga0157372_10053129 | 3300013307 | Bacteria | 4514 |
| 330 | Ga0157372_10711932 | 3300013307 | Bacteria | 1168 |
| 331 | Ga0157375_10061404 | 3300013308 | Bacteria | 3731 |
| 332 | Ga0157375_10064258 | 3300013308 | Bacteria | 3653 |
| 333 | Ga0157375_10100791 | 3300013308 | Bacteria | 2969 |
| 334 | Ga0157375_10145286 | 3300013308 | Bacteria | 2502 |
| 335 | Ga0157375_10175521 | 3300013308 | Bacteria | 2292 |
| 336 | Ga0163163_10001648 | 3300014325 | Bacteria | 18800 |
| 337 | Ga0163163_10008141 | 3300014325 | Bacteria | 9296 |
| 338 | Ga0157380_10032185 | 3300014326 | Bacteria | 4033 |
| 339 | Ga0157380_10043304 | 3300014326 | Bacteria | 3524 |
| 340 | Ga0157380_10078162 | 3300014326 | Bacteria | 2698 |
| 341 | Ga0157380_10092375 | 3300014326 | Bacteria | 2501 |
| 342 | Ga0157380_10233033 | 3300014326 | Bacteria | 1655 |
| 343 | Ga0157380_10413186 | 3300014326 | Bacteria | 1284 |
| 344 | Ga0157380_10546190 | 3300014326 | Bacteria | 1136 |
| 345 | Ga0157377_10028343 | 3300014745 | Bacteria | 3014 |
| 346 | Ga0157379_10000044 | 3300014968 | Bacteria | 75399 |
| 347 | Ga0157379_10012842 | 3300014968 | Bacteria | 7325 |
| 348 | Ga0157379_10017358 | 3300014968 | Bacteria | 6341 |
| 349 | Ga0157379_10035925 | 3300014968 | Bacteria | 4419 |
| 350 | Ga0157379_10197672 | 3300014968 | Bacteria | 1818 |
| 351 | Ga0157376_10017980 | 3300014969 | Bacteria | 5408 |
| 352 | Ga0157376_10267144 | 3300014969 | Bacteria | 1605 |
| 353 | Ga0157376_10557933 | 3300014969 | Bacteria | 1134 |
| 354 | Ga0157376_11236724 | 3300014969 | Bacteria | 776 |
| 355 | Ga0157376_11492675 | 3300014969 | Bacteria | 709 |
| 356 | Ga0182006_1028834 | 3300015261 | Bacteria | 2254 |
| 357 | Ga0182006_1151549 | 3300015261 | Bacteria | 786 |
| 358 | Ga0182007_10013438 | 3300015262 | Bacteria | 3122 |
| 359 | Ga0182005_1013970 | 3300015265 | Bacteria | 2252 |
| 360 | Ga0182005_1167486 | 3300015265 | Bacteria | 647 |
| 361 | Ga0197907_10694566 | 3300020069 | Bacteria | 951 |
| 362 | Ga0206352_10998807 | 3300020078 | Bacteria | 713 |
| 363 | Ga0206354_11408214 | 3300020081 | Bacteria | 761 |
| 364 | Ga0206353_11600254 | 3300020082 | Bacteria | 988 |
| 365 | Ga0213876_10010872 | 3300021384 | Bacteria | 4875 |
| 366 | Ga0256714_106396 | 3300023304 | Bacteria | 602 |
| 367 | Ga0247515_117421 | 3300023564 | Bacteria | 655 |
| 368 | Ga0209672_100023 | 3300025228 | Bacteria | 371758 |
| 369 | Ga0209147_100094 | 3300025229 | Bacteria | 167145 |
| 370 | Ga0209147_100346 | 3300025229 | Bacteria | 34091 |
| 371 | Ga0209258_100142 | 3300025242 | Bacteria | 165865 |
| 372 | Ga0209148_1000980 | 3300025254 | Bacteria | 18450 |
| 373 | Ga0209759_1001922 | 3300025256 | Bacteria | 10157 |
| 374 | Ga0207666_1018265 | 3300025271 | Bacteria | 1018 |
| 375 | Ga0207673_1008960 | 3300025290 | Bacteria | 1273 |
| 376 | Ga0209676_1003152 | 3300025292 | Bacteria | 10531 |
| 377 | Ga0209025_1000193 | 3300025294 | Bacteria | 149339 |
| 378 | Ga0209758_1000146 | 3300025297 | Bacteria | 169246 |
| 379 | Ga0209050_1005244 | 3300025298 | Bacteria | 8264 |
| 380 | Ga0209051_1002762 | 3300025303 | Bacteria | 12121 |
| 381 | Ga0209051_1043552 | 3300025303 | Bacteria | 1574 |
| 382 | Ga0207697_10041901 | 3300025315 | Bacteria | 1880 |
| 383 | Ga0207656_10149474 | 3300025321 | Bacteria | 1105 |
| 384 | Ga0207642_10012616 | 3300025899 | Bacteria | 3057 |
| 385 | Ga0207710_10058023 | 3300025900 | Bacteria | 1749 |
| 386 | Ga0207710_10062583 | 3300025900 | Bacteria | 1691 |
| 387 | Ga0207688_10070684 | 3300025901 | Bacteria | 1980 |
| 388 | Ga0207680_10038581 | 3300025903 | Bacteria | 2766 |
| 389 | Ga0207680_10129007 | 3300025903 | Bacteria | 1664 |
| 390 | Ga0207680_10534113 | 3300025903 | Bacteria | 837 |
| 391 | Ga0207680_10566635 | 3300025903 | Bacteria | 811 |
| 392 | Ga0207645_10008397 | 3300025907 | Bacteria | 7205 |
| 393 | Ga0207645_10010092 | 3300025907 | Bacteria | 6501 |
| 394 | Ga0207645_10044335 | 3300025907 | Bacteria | 2846 |
| 395 | Ga0207645_10745628 | 3300025907 | Bacteria | 666 |
| 396 | Ga0207643_10007114 | 3300025908 | Bacteria | 6002 |
| 397 | Ga0207643_10044671 | 3300025908 | Bacteria | 2501 |
| 398 | Ga0207705_10013924 | 3300025909 | Bacteria | 5800 |
| 399 | Ga0207705_10582527 | 3300025909 | Bacteria | 870 |
| 400 | Ga0207684_10026369 | 3300025910 | Bacteria | 4954 |
| 401 | Ga0207654_10276438 | 3300025911 | Bacteria | 1135 |
| 402 | Ga0207707_10018532 | 3300025912 | Bacteria | 6068 |
| 403 | Ga0207707_10067023 | 3300025912 | Bacteria | 3127 |
| 404 | Ga0207695_10021818 | 3300025913 | Bacteria | 7294 |
| 405 | Ga0207695_10397903 | 3300025913 | Bacteria | 1262 |
| 406 | Ga0207660_10000960 | 3300025917 | Bacteria | 19093 |
| 407 | Ga0207662_10000851 | 3300025918 | Bacteria | 14075 |
| 408 | Ga0207657_10290288 | 3300025919 | Bacteria | 1297 |
| 409 | Ga0207657_10464038 | 3300025919 | Bacteria | 993 |
| 410 | Ga0207649_10020123 | 3300025920 | Bacteria | 3822 |
| 411 | Ga0207649_10334501 | 3300025920 | Bacteria | 1116 |
| 412 | Ga0207649_10646897 | 3300025920 | Bacteria | 817 |
| 413 | Ga0207652_10008631 | 3300025921 | Bacteria | 8200 |
| 414 | Ga0207681_10002084 | 3300025923 | Bacteria | 12817 |
| 415 | Ga0207681_10003433 | 3300025923 | Bacteria | 9897 |
| 416 | Ga0207681_10123218 | 3300025923 | Bacteria | 1904 |
| 417 | Ga0207681_10251909 | 3300025923 | Bacteria | 1379 |
| 418 | Ga0207681_10506628 | 3300025923 | Bacteria | 989 |
| 419 | Ga0207694_10292713 | 3300025924 | Bacteria | 1339 |
| 420 | Ga0207694_10386466 | 3300025924 | Bacteria | 1162 |
| 421 | Ga0207694_10792695 | 3300025924 | Bacteria | 800 |
| 422 | Ga0207650_10002436 | 3300025925 | Bacteria | 12957 |
| 423 | Ga0207650_10029441 | 3300025925 | Bacteria | 3948 |
| 424 | Ga0207650_10251106 | 3300025925 | Bacteria | 1432 |
| 425 | Ga0207650_10345837 | 3300025925 | Bacteria | 1222 |
| 426 | Ga0207659_10011752 | 3300025926 | Bacteria | 5541 |
| 427 | Ga0207659_10031206 | 3300025926 | Bacteria | 3646 |
| 428 | Ga0207659_10566947 | 3300025926 | Bacteria | 966 |
| 429 | Ga0207659_10621510 | 3300025926 | Bacteria | 922 |
| 430 | Ga0207687_10101750 | 3300025927 | Bacteria | 2115 |
| 431 | Ga0207687_10136645 | 3300025927 | Bacteria | 1855 |
| 432 | Ga0207687_10438232 | 3300025927 | Bacteria | 1082 |
| 433 | Ga0207644_10007085 | 3300025931 | Bacteria | 7310 |
| 434 | Ga0207644_10030146 | 3300025931 | Bacteria | 3768 |
| 435 | Ga0207644_10566240 | 3300025931 | Bacteria | 941 |
| 436 | Ga0207644_10881406 | 3300025931 | Bacteria | 750 |
| 437 | Ga0207690_10201532 | 3300025932 | Bacteria | 1512 |
| 438 | Ga0207690_10437986 | 3300025932 | Bacteria | 1048 |
| 439 | Ga0207690_10461576 | 3300025932 | Bacteria | 1022 |
| 440 | Ga0207706_10128513 | 3300025933 | Bacteria | 2228 |
| 441 | Ga0207706_10144831 | 3300025933 | Bacteria | 2090 |
| 442 | Ga0207706_10417036 | 3300025933 | Bacteria | 1163 |
| 443 | Ga0207706_10719061 | 3300025933 | Bacteria | 852 |
| 444 | Ga0207686_10222484 | 3300025934 | Bacteria | 1364 |
| 445 | Ga0207686_10342039 | 3300025934 | Bacteria | 1124 |
| 446 | Ga0207709_10037754 | 3300025935 | Bacteria | 2872 |
| 447 | Ga0207709_10157888 | 3300025935 | Bacteria | 1578 |
| 448 | Ga0207709_10193674 | 3300025935 | Bacteria | 1446 |
| 449 | Ga0207669_10056591 | 3300025937 | Bacteria | 2382 |
| 450 | Ga0207669_10067225 | 3300025937 | Bacteria | 2232 |
| 451 | Ga0207669_10075932 | 3300025937 | Bacteria | 2131 |
| 452 | Ga0207669_10112167 | 3300025937 | Bacteria | 1830 |
| 453 | Ga0207669_10241495 | 3300025937 | Bacteria | 1339 |
| 454 | Ga0207669_10383830 | 3300025937 | Bacteria | 1095 |
| 455 | Ga0207704_10032106 | 3300025938 | Bacteria | 2967 |
| 456 | Ga0207704_10062348 | 3300025938 | Bacteria | 2318 |
| 457 | Ga0207704_10361359 | 3300025938 | Bacteria | 1134 |
| 458 | Ga0207704_10477655 | 3300025938 | Bacteria | 1000 |
| 459 | Ga0207704_10522094 | 3300025938 | Bacteria | 960 |
| 460 | Ga0207704_11052424 | 3300025938 | Bacteria | 690 |
| 461 | Ga0207691_10004198 | 3300025940 | Bacteria | 13986 |
| 462 | Ga0207691_10049890 | 3300025940 | Bacteria | 3834 |
| 463 | Ga0207691_10455102 | 3300025940 | Bacteria | 1089 |
| 464 | Ga0207691_10645742 | 3300025940 | Bacteria | 894 |
| 465 | Ga0207691_10902305 | 3300025940 | Bacteria | 740 |
| 466 | Ga0207711_10004815 | 3300025941 | Bacteria | 11468 |
| 467 | Ga0207711_10016097 | 3300025941 | Bacteria | 6207 |
| 468 | Ga0207711_10092684 | 3300025941 | Bacteria | 2659 |
| 469 | Ga0207711_10150914 | 3300025941 | Bacteria | 2097 |
| 470 | Ga0207711_10158844 | 3300025941 | Bacteria | 2045 |
| 471 | Ga0207711_10242066 | 3300025941 | Bacteria | 1654 |
| 472 | Ga0207711_10582678 | 3300025941 | Bacteria | 1044 |
| 473 | Ga0207689_10000381 | 3300025942 | Bacteria | 41638 |
| 474 | Ga0207689_10001763 | 3300025942 | Bacteria | 20417 |
| 475 | Ga0207689_10004159 | 3300025942 | Bacteria | 13161 |
| 476 | Ga0207689_10038960 | 3300025942 | Bacteria | 3935 |
| 477 | Ga0207689_10586165 | 3300025942 | Bacteria | 938 |
| 478 | Ga0207679_10120124 | 3300025945 | Bacteria | 2090 |
| 479 | Ga0207667_10257880 | 3300025949 | Bacteria | 1783 |
| 480 | Ga0207667_10645488 | 3300025949 | Bacteria | 1064 |
| 481 | Ga0207667_10656854 | 3300025949 | Bacteria | 1054 |
| 482 | Ga0207651_10050867 | 3300025960 | Bacteria | 2816 |
| 483 | Ga0207651_10178149 | 3300025960 | Bacteria | 1683 |
| 484 | Ga0207651_11032582 | 3300025960 | Bacteria | 735 |
| 485 | Ga0207712_10317224 | 3300025961 | Bacteria | 1285 |
| 486 | Ga0207712_10618049 | 3300025961 | Bacteria | 939 |
| 487 | Ga0207712_11137312 | 3300025961 | Bacteria | 696 |
| 488 | Ga0207712_11267843 | 3300025961 | Bacteria | 658 |
| 489 | Ga0207668_10019037 | 3300025972 | Bacteria | 4331 |
| 490 | Ga0207668_10086520 | 3300025972 | Bacteria | 2290 |
| 491 | Ga0207668_10146762 | 3300025972 | Bacteria | 1821 |
| 492 | Ga0207668_10231357 | 3300025972 | Bacteria | 1490 |
| 493 | Ga0207668_10438955 | 3300025972 | Bacteria | 1111 |
| 494 | Ga0207640_10066634 | 3300025981 | Bacteria | 2406 |
| 495 | Ga0207658_10014427 | 3300025986 | Bacteria | 5409 |
| 496 | Ga0207658_10015619 | 3300025986 | Bacteria | 5211 |
| 497 | Ga0207658_10217088 | 3300025986 | Bacteria | 1606 |
| 498 | Ga0207658_10653295 | 3300025986 | Bacteria | 948 |
| 499 | Ga0207677_10009039 | 3300026023 | Bacteria | 5591 |
| 500 | Ga0207677_10016608 | 3300026023 | Bacteria | 4365 |
| 501 | Ga0207677_10054496 | 3300026023 | Bacteria | 2730 |
| 502 | Ga0207677_10060330 | 3300026023 | Bacteria | 2621 |
| 503 | Ga0207677_10432812 | 3300026023 | Bacteria | 1123 |
| 504 | Ga0207703_10000382 | 3300026035 | Bacteria | 47374 |
| 505 | Ga0207703_10005576 | 3300026035 | Bacteria | 10102 |
| 506 | Ga0207703_10034181 | 3300026035 | Bacteria | 4034 |
| 507 | Ga0207703_10304417 | 3300026035 | Bacteria | 1455 |
| 508 | Ga0207703_10860349 | 3300026035 | Bacteria | 867 |
| 509 | Ga0207703_11249204 | 3300026035 | Bacteria | 714 |
| 510 | Ga0207639_10017592 | 3300026041 | Bacteria | 5068 |
| 511 | Ga0207639_10076238 | 3300026041 | Bacteria | 2639 |
| 512 | Ga0207639_10104080 | 3300026041 | Bacteria | 2301 |
| 513 | Ga0207678_10019182 | 3300026067 | Bacteria | 6004 |
| 514 | Ga0207678_10255743 | 3300026067 | Bacteria | 1500 |
| 515 | Ga0207678_10495743 | 3300026067 | Bacteria | 1064 |
| 516 | Ga0207678_11465874 | 3300026067 | Bacteria | 603 |
| 517 | Ga0207708_10033887 | 3300026075 | Bacteria | 3883 |
| 518 | Ga0207708_10184567 | 3300026075 | Bacteria | 1657 |
| 519 | Ga0207708_10211272 | 3300026075 | Bacteria | 1551 |
| 520 | Ga0207708_10231927 | 3300026075 | Bacteria | 1482 |
| 521 | Ga0207702_10036140 | 3300026078 | Bacteria | 4131 |
| 522 | Ga0207702_10228504 | 3300026078 | Bacteria | 1738 |
| 523 | Ga0207641_10012349 | 3300026088 | Bacteria | 7006 |
| 524 | Ga0207641_10064209 | 3300026088 | Bacteria | 3137 |
| 525 | Ga0207641_10092237 | 3300026088 | Bacteria | 2652 |
| 526 | Ga0207641_10205838 | 3300026088 | Bacteria | 1817 |
| 527 | Ga0207641_10270211 | 3300026088 | Bacteria | 1595 |
| 528 | Ga0207641_10407552 | 3300026088 | Bacteria | 1306 |
| 529 | Ga0207641_10460299 | 3300026088 | Bacteria | 1230 |
| 530 | Ga0207641_10706028 | 3300026088 | Bacteria | 993 |
| 531 | Ga0207648_10001132 | 3300026089 | Bacteria | 29960 |
| 532 | Ga0207648_10002487 | 3300026089 | Bacteria | 19785 |
| 533 | Ga0207648_10063373 | 3300026089 | Bacteria | 3222 |
| 534 | Ga0207648_10118589 | 3300026089 | Bacteria | 2326 |
| 535 | Ga0207648_10232836 | 3300026089 | Bacteria | 1639 |
| 536 | Ga0207648_10253162 | 3300026089 | Bacteria | 1570 |
| 537 | Ga0207648_10273316 | 3300026089 | Bacteria | 1510 |
| 538 | Ga0207648_10694598 | 3300026089 | Bacteria | 943 |
| 539 | Ga0207676_10002468 | 3300026095 | Bacteria | 13194 |
| 540 | Ga0207676_10014782 | 3300026095 | Bacteria | 5622 |
| 541 | Ga0207676_10081159 | 3300026095 | Bacteria | 2634 |
| 542 | Ga0207676_10436529 | 3300026095 | Bacteria | 1231 |
| 543 | Ga0207676_10440257 | 3300026095 | Bacteria | 1226 |
| 544 | Ga0207674_10005048 | 3300026116 | Bacteria | 15751 |
| 545 | Ga0207674_10017042 | 3300026116 | Bacteria | 7930 |
| 546 | Ga0207674_10042386 | 3300026116 | Bacteria | 4701 |
| 547 | Ga0207674_10069277 | 3300026116 | Bacteria | 3549 |
| 548 | Ga0207674_10984967 | 3300026116 | Bacteria | 812 |
| 549 | Ga0207675_100016342 | 3300026118 | Bacteria | 6928 |
| 550 | Ga0207675_100029454 | 3300026118 | Bacteria | 5115 |
| 551 | Ga0207675_100171143 | 3300026118 | Bacteria | 2076 |
| 552 | Ga0207675_100281702 | 3300026118 | Bacteria | 1615 |
| 553 | Ga0207675_100360427 | 3300026118 | Bacteria | 1426 |
| 554 | Ga0207675_101063257 | 3300026118 | Bacteria | 828 |
| 555 | Ga0207683_10001803 | 3300026121 | Bacteria | 18967 |
| 556 | Ga0207683_10034065 | 3300026121 | Bacteria | 4425 |
| 557 | Ga0207683_10412044 | 3300026121 | Bacteria | 1244 |
| 558 | Ga0207683_10435615 | 3300026121 | Bacteria | 1208 |
| 559 | Ga0207698_10008316 | 3300026142 | Bacteria | 6554 |
| 560 | Ga0207698_10081738 | 3300026142 | Bacteria | 2609 |
| 561 | Ga0207698_10112065 | 3300026142 | Bacteria | 2289 |
| 562 | Ga0207698_10205466 | 3300026142 | Bacteria | 1767 |
| 563 | Ga0207698_10728837 | 3300026142 | Bacteria | 988 |
| 564 | Ga0207698_10871509 | 3300026142 | Bacteria | 906 |
| 565 | Ga0207698_11603660 | 3300026142 | Bacteria | 666 |
| 566 | Ga0209371_1044904 | 3300027312 | Bacteria | 876 |
| 567 | Ga0209970_1039028 | 3300027614 | Bacteria | 841 |
| 568 | Ga0209974_10020354 | 3300027876 | Bacteria | 2199 |
| 569 | Ga0209974_10229949 | 3300027876 | Bacteria | 693 |
| 570 | Ga0207428_10594050 | 3300027907 | Bacteria | 798 |
| 571 | Ga0268265_10003515 | 3300028380 | Bacteria | 11217 |
| 572 | Ga0268265_10060496 | 3300028380 | Bacteria | 2903 |
| 573 | Ga0268265_10229867 | 3300028380 | Bacteria | 1629 |
| 574 | Ga0268265_10347830 | 3300028380 | Bacteria | 1352 |
| 575 | Ga0268265_10549413 | 3300028380 | Bacteria | 1096 |
| 576 | Ga0268265_10589771 | 3300028380 | Bacteria | 1060 |
| 577 | Ga0268264_10002678 | 3300028381 | Bacteria | 15551 |
| 578 | Ga0268264_10005258 | 3300028381 | Bacteria | 10956 |
| 579 | Ga0268264_10030467 | 3300028381 | Bacteria | 4422 |
| 580 | Ga0268264_10123127 | 3300028381 | Bacteria | 2288 |
| 581 | Ga0268264_10215530 | 3300028381 | Bacteria | 1765 |
| 582 | Ga0268264_11146467 | 3300028381 | Bacteria | 786 |
| 583 | Ga0307515_10000188 | 3300028794 | Bacteria | 151439 |
| 584 | Ga0307515_10174518 | 3300028794 | Bacteria | 2126 |
| 585 | Ga0307515_10530406 | 3300028794 | Bacteria | 787 |
| 586 | Ga0265338_10000373 | 3300028800 | Bacteria | 80312 |
| 587 | Ga0310981_1066224 | 3300029285 | Bacteria | 672 |
| 588 | Ga0268256_1024210 | 3300030500 | Bacteria | 1561 |
| 589 | Ga0268256_1062112 | 3300030500 | Bacteria | 746 |
| 590 | Ga0316177_1219224 | 3300030731 | Bacteria | 1867 |
| 591 | Ga0314311_1195695 | 3300030733 | Bacteria | 797 |
| 592 | Ga0316178_1077292 | 3300030735 | Bacteria | 2304 |
| 593 | Ga0316180_1107170 | 3300030736 | Bacteria | 2671 |
| 594 | Ga0316181_1028793 | 3300030744 | Bacteria | 1565 |
| 595 | Ga0265330_10145925 | 3300031235 | Bacteria | 1006 |
| 596 | Ga0265330_10151763 | 3300031235 | Bacteria | 984 |
| 597 | Ga0265328_10024128 | 3300031239 | Bacteria | 2300 |
| 598 | Ga0265325_10009259 | 3300031241 | Bacteria | 5758 |
| 599 | Ga0265339_10032780 | 3300031249 | Bacteria | 2929 |
| 600 | Ga0265339_10227890 | 3300031249 | Bacteria | 909 |
| 601 | Ga0265339_10235833 | 3300031249 | Bacteria | 890 |
| 602 | Ga0265327_10000184 | 3300031251 | Bacteria | 133023 |
| 603 | Ga0265316_10000115 | 3300031344 | Bacteria | 86934 |
| 604 | Ga0307513_10018328 | 3300031456 | Bacteria | 8369 |
| 605 | Ga0307509_10017037 | 3300031507 | Bacteria | 8377 |
| 606 | Ga0307408_100567156 | 3300031548 | Bacteria | 1004 |
| 607 | Ga0307408_100887115 | 3300031548 | Bacteria | 815 |
| 608 | Ga0307508_10443012 | 3300031616 | Bacteria | 891 |
| 609 | Ga0265314_10057739 | 3300031711 | Bacteria | 2663 |
| 610 | Ga0265342_10086877 | 3300031712 | Bacteria | 1798 |
| 611 | Ga0307516_10594001 | 3300031730 | Bacteria | 761 |
| 612 | Ga0307405_10588718 | 3300031731 | Bacteria | 906 |
| 613 | Ga0307405_11067963 | 3300031731 | Bacteria | 692 |
| 614 | Ga0307413_10361711 | 3300031824 | Bacteria | 1124 |
| 615 | Ga0307413_10752232 | 3300031824 | Bacteria | 815 |
| 616 | Ga0307413_10967690 | 3300031824 | Bacteria | 727 |
| 617 | Ga0307410_10112394 | 3300031852 | Bacteria | 1973 |
| 618 | Ga0307410_10113174 | 3300031852 | Bacteria | 1967 |
| 619 | Ga0307410_10293351 | 3300031852 | Bacteria | 1281 |
| 620 | Ga0307406_10227457 | 3300031901 | Bacteria | 1391 |
| 621 | Ga0307406_10241896 | 3300031901 | Bacteria | 1354 |
| 622 | Ga0307406_10960577 | 3300031901 | Bacteria | 731 |
| 623 | Ga0307407_10485632 | 3300031903 | Bacteria | 903 |
| 624 | Ga0307412_10000436 | 3300031911 | Bacteria | 25202 |
| 625 | Ga0307409_100031775 | 3300031995 | Bacteria | 3816 |
| 626 | Ga0307409_101224808 | 3300031995 | Bacteria | 774 |
| 627 | Ga0307416_100000641 | 3300032002 | Bacteria | 18021 |
| 628 | Ga0307414_10621875 | 3300032004 | Bacteria | 971 |
| 629 | Ga0307414_11017016 | 3300032004 | Bacteria | 763 |
| 630 | Ga0307411_10367253 | 3300032005 | Bacteria | 1179 |
| 631 | Ga0307415_100033810 | 3300032126 | Bacteria | 3321 |
| 632 | Ga0307415_100801215 | 3300032126 | Bacteria | 860 |
| 633 | Ga0307415_101877135 | 3300032126 | Bacteria | 581 |
| 634 | Ga0316596_1081991 | 3300033541 | Bacteria | 867 |
| 635 | Ga0373930_0014689 | 3300034816 | Bacteria | 1462 |
| 636 | Ga0373929_0009966 | 3300035085 | Bacteria | 1768 |
| 637 | Ga0373940_0009612 | 3300035088 | Bacteria | 2252 |
| 638 | Ga0373952_0011208 | 3300035092 | Bacteria | 1745 |
| 639 | Ga0373939_0034028 | 3300035114 | Bacteria | 1493 |
| 640 | Ga0373941_0003998 | 3300035115 | Bacteria | 3378 |
| 641 | Ga0373945_0089197 | 3300035116 | Bacteria | 1192 |
| 642 | Ga0373957_0111795 | 3300035120 | Bacteria | 1101 |
| 643 | Ga0373955_0591360 | 3300035172 | Bacteria | 679 |
| 644 | Ga0373961_0094681 | 3300035241 | Bacteria | 959 |
| 645 | Ga0373931_0002799 | 3300035691 | Bacteria | 7766 |
| 646 | Ga0373935_0333651 | 3300035692 | Bacteria | 1078 |
| 647 | Ga0373927_0106349 | 3300035695 | Bacteria | 1827 |
| 648 | Ga0373933_0262987 | 3300035724 | Bacteria | 1113 |
| 649 | Ga0373937_0094357 | 3300036401 | Bacteria | 2774 |
| 650 | Ga0373925_0016673 | 3300037068 | Bacteria | 5320 |
| 651 | Ga0395900_0001281 | 3300037418 | Bacteria | 30694 |
| 652 | Ga0395898_0004206 | 3300037466 | Bacteria | 15775 |
| 653 | Ga0395905_0001475 | 3300037471 | Bacteria | 28210 |
| 654 | Ga0395905_0021001 | 3300037471 | Bacteria | 6182 |
| 655 | Ga0395905_0164293 | 3300037471 | Bacteria | 2086 |
| 656 | Ga0395905_0233822 | 3300037471 | Bacteria | 1718 |
| 657 | Ga0395905_0653539 | 3300037471 | Bacteria | 953 |
| 658 | Ga0395901_0330433 | 3300038443 | Bacteria | 1576 |
| 659 | Ga0436365_1919084 | 3300039437 | Bacteria | 6964 |
| 660 | Ga0436363_0343017 | 3300039450 | Bacteria | 749 |
| 661 | Ga0439439_0052166 | 3300041406 | Bacteria | 1074 |
| 662 | Ga0451802_0133075 | 3300041460 | Bacteria | 836 |
| 663 | Ga0451833_0343808 | 3300041491 | Bacteria | 685 |
| 664 | Ga0451853_3267339 | 3300041512 | Bacteria | 930 |
| 665 | Ga0439433_0024319 | 3300041999 | Bacteria | 1364 |
| 666 | Ga0439449_0153051 | 3300042007 | Bacteria | 860 |
| 667 | Ga0439455_0120482 | 3300042012 | Bacteria | 735 |
| 668 | Ga0450892_009012 | 3300042130 | Bacteria | 859 |
| 669 | Ga0450899_020806 | 3300042135 | Bacteria | 766 |
| 670 | Ga0439464_0030579 | 3300042439 | Bacteria | 1508 |
| 671 | Ga0439460_0058076 | 3300042461 | Bacteria | 1175 |
| 672 | Ga0466969_0000005 | 3300044656 | Bacteria | 167170 |
| 673 | Ga0466972_0013360 | 3300044658 | Bacteria | 4123 |
| 674 | Ga0466966_0004215 | 3300044684 | Bacteria | 9489 |
| 675 | Ga0466961_0018631 | 3300044693 | Bacteria | 4466 |
| 676 | Ga0466961_0058653 | 3300044693 | Bacteria | 2448 |
| 677 | Ga0466961_0308254 | 3300044693 | Bacteria | 966 |
| 678 | Ga0466963_0008752 | 3300044694 | Bacteria | 6078 |
| 679 | Ga0466964_0003562 | 3300044706 | Bacteria | 5690 |
| 680 | Ga0466971_0004644 | 3300044719 | Bacteria | 5934 |
| 681 | Ga0466971_0061028 | 3300044719 | Bacteria | 1704 |
| 682 | Ga0466957_0062353 | 3300044842 | Bacteria | 2289 |
| 683 | Ga0466957_0068258 | 3300044842 | Bacteria | 2194 |
| 684 | Ga0466960_0016310 | 3300044901 | Bacteria | 3219 |
| 685 | Ga0466959_0000564 | 3300045049 | Bacteria | 21549 |
| 686 | Ga0466959_0009599 | 3300045049 | Bacteria | 6884 |
| 687 | Ga0466959_0099384 | 3300045049 | Bacteria | 2083 |
| 688 | Ga0451576_0073537 | 3300045051 | Bacteria | 3557 |
| 689 | Ga0451576_0820751 | 3300045051 | Bacteria | 976 |
| 690 | Ga0451576_0887336 | 3300045051 | Bacteria | 936 |
| 691 | Ga0466958_0738040 | 3300045836 | Bacteria | 642 |
| 692 | Ga0466967_0133762 | 3300045976 | Bacteria | 2304 |
| 693 | Ga0495603_0121663 | 3300046455 | Bacteria | 1521 |
| 694 | Ga0495653_0599013 | 3300046463 | Bacteria | 678 |
| 695 | Ga0495650_0007895 | 3300046471 | Bacteria | 6317 |
| 696 | Ga0495580_0277350 | 3300046472 | Bacteria | 1144 |
| 697 | Ga0495583_0000068 | 3300046506 | Bacteria | 188922 |
| 698 | Ga0495583_0018710 | 3300046506 | Bacteria | 3640 |
| 699 | Ga0495583_0027207 | 3300046506 | Bacteria | 2825 |
| 700 | Ga0495644_0196225 | 3300046523 | Bacteria | 778 |
| 701 | Ga0495648_0047663 | 3300046524 | Bacteria | 2646 |
| 702 | Ga0495663_0174786 | 3300046525 | Bacteria | 742 |
| 703 | Ga0495598_0010810 | 3300046537 | Bacteria | 2197 |
| 704 | Ga0495598_0057099 | 3300046537 | Bacteria | 1193 |
| 705 | Ga0495621_0002408 | 3300046539 | Bacteria | 5041 |
| 706 | Ga0495597_0093110 | 3300046542 | Bacteria | 1277 |
| 707 | Ga0495645_0217641 | 3300046543 | Bacteria | 1286 |
| 708 | Ga0495645_0283961 | 3300046543 | Bacteria | 1087 |
| 709 | Ga0495645_0374576 | 3300046543 | Bacteria | 912 |
| 710 | Ga0495633_0335350 | 3300046558 | Bacteria | 686 |
| 711 | Ga0495656_0028681 | 3300046615 | Bacteria | 2234 |
| 712 | Ga0495656_0363350 | 3300046615 | Bacteria | 752 |
| 713 | Ga0495588_0038490 | 3300046674 | Bacteria | 2433 |
| 714 | Ga0495647_0132125 | 3300046681 | Bacteria | 1058 |
| 715 | Ga0495671_0232242 | 3300046692 | Bacteria | 892 |
| 716 | Ga0495636_0009413 | 3300047318 | Bacteria | 3847 |
| 717 | Ga0495636_0091688 | 3300047318 | Bacteria | 1319 |
| 718 | Ga0495675_0254468 | 3300047444 | Bacteria | 1054 |
| 719 | Ga0495685_147382 | 3300047447 | Bacteria | 765 |
| 720 | Ga0495686_0000966 | 3300047472 | Bacteria | 35392 |
| 721 | Ga0495686_0229440 | 3300047472 | Bacteria | 1052 |
| 722 | Ga0495615_0002005 | 3300048090 | Bacteria | 3166 |
| 723 | Ga0495615_0193523 | 3300048090 | Bacteria | 625 |
| 724 | Ga0496100_0103680 | 3300048903 | Bacteria | 1964 |
| 725 | Ga0496100_0324819 | 3300048903 | Bacteria | 1157 |
| 726 | Ga0496101_0083441 | 3300048904 | Bacteria | 2365 |
| 727 | Ga0496101_0350098 | 3300048904 | Bacteria | 1161 |
| 728 | Ga0496102_0000216 | 3300048905 | Bacteria | 76017 |
| 729 | Ga0496102_0052125 | 3300048905 | Bacteria | 3727 |
| 730 | Ga0496103_0015874 | 3300048906 | Bacteria | 4490 |
| 731 | Ga0496104_0082388 | 3300048907 | Bacteria | 3068 |
| 732 | Ga0496104_0130275 | 3300048907 | Bacteria | 2416 |
| 733 | Ga0496104_0414213 | 3300048907 | Bacteria | 1260 |
| 734 | Ga0496104_0882855 | 3300048907 | Bacteria | 799 |
| 735 | Ga0496105_0048545 | 3300048908 | Bacteria | 3504 |
| 736 | Ga0496105_0142303 | 3300048908 | Bacteria | 1974 |
| 737 | Ga0496106_0000057 | 3300048909 | Bacteria | 90192 |
| 738 | Ga0496106_0011505 | 3300048909 | Bacteria | 6543 |
| 739 | Ga0496107_0005426 | 3300048910 | Bacteria | 8730 |
| 740 | Ga0496108_0057358 | 3300048911 | Bacteria | 3272 |
| 741 | Ga0496108_0239564 | 3300048911 | Bacteria | 1578 |
| 742 | Ga0496109_0435561 | 3300048912 | Bacteria | 1238 |
| 743 | Ga0496109_0897725 | 3300048912 | Bacteria | 824 |
| 744 | Ga0496109_1026064 | 3300048912 | Bacteria | 762 |
| 745 | Ga0496110_0011826 | 3300048913 | Bacteria | 7166 |
| 746 | Ga0496110_0175512 | 3300048913 | Bacteria | 1945 |
| 747 | Ga0496110_0897203 | 3300048913 | Bacteria | 792 |
| 748 | Ga0496111_0087142 | 3300048914 | Bacteria | 2285 |
| 749 | Ga0496112_0016366 | 3300048915 | Bacteria | 6945 |
| 750 | Ga0496112_0429701 | 3300048915 | Bacteria | 1259 |
| 751 | Ga0496113_0110383 | 3300048916 | Bacteria | 2140 |
| 752 | Ga0496114_0178506 | 3300048917 | Bacteria | 1853 |
| 753 | Ga0496114_0224626 | 3300048917 | Bacteria | 1649 |
| 754 | Ga0496115_0081281 | 3300048918 | Bacteria | 2639 |
| 755 | Ga0496116_0019804 | 3300048919 | Bacteria | 5138 |
| 756 | Ga0496118_0013944 | 3300048921 | Bacteria | 7559 |
| 757 | Ga0496118_0025276 | 3300048921 | Bacteria | 5098 |
| 758 | Ga0496119_0012281 | 3300048922 | Bacteria | 6979 |
| 759 | Ga0496120_0011376 | 3300048923 | Bacteria | 6121 |
| 760 | Ga0496121_0003909 | 3300048924 | Bacteria | 20667 |
| 761 | Ga0496121_0004489 | 3300048924 | Bacteria | 18712 |
| 762 | Ga0496121_0016560 | 3300048924 | Bacteria | 7603 |
| 763 | Ga0496123_0002852 | 3300048926 | Bacteria | 20402 |
| 764 | Ga0496124_0000046 | 3300048927 | Bacteria | 287043 |
| 765 | Ga0496124_0000317 | 3300048927 | Bacteria | 89188 |
| 766 | Ga0496125_0000011 | 3300048928 | Bacteria | 655895 |
| 767 | Ga0496125_0011492 | 3300048928 | Bacteria | 8850 |
| 768 | Ga0496125_0062439 | 3300048928 | Bacteria | 2979 |
| 769 | Ga0496125_0067841 | 3300048928 | Bacteria | 2808 |
| 770 | Ga0496125_0267706 | 3300048928 | Bacteria | 1067 |
| 771 | Ga0496126_0116147 | 3300048929 | Bacteria | 2326 |
| 772 | Ga0496126_0365992 | 3300048929 | Bacteria | 1177 |
| 773 | Ga0501306_012385 | 3300049127 | Bacteria | 1099 |
| 774 | Ga0501306_015377 | 3300049127 | Bacteria | 1018 |
| 775 | Ga0501308_010486 | 3300049128 | Bacteria | 1030 |
| 776 | Ga0501308_044307 | 3300049128 | Bacteria | 635 |
| 777 | Ga0501309_009865 | 3300049129 | Bacteria | 1224 |
| 778 | Ga0501309_057578 | 3300049129 | Bacteria | 620 |
| 779 | Ga0501310_010296 | 3300049130 | Bacteria | 1041 |
| 780 | Ga0501310_018450 | 3300049130 | Bacteria | 852 |
| 781 | Ga0501341_08531 | 3300049131 | Bacteria | 654 |
| 782 | Ga0501304_003734 | 3300049160 | Bacteria | 1128 |
| 783 | Ga0501305_066624 | 3300049161 | Bacteria | 628 |
| 784 | Ga0501307_014905 | 3300049162 | Bacteria | 955 |
| 785 | Ga0501307_032704 | 3300049162 | Bacteria | 728 |
| 786 | Ga0501307_041728 | 3300049162 | Bacteria | 668 |
| 787 | Ga0501312_031289 | 3300049528 | Bacteria | 835 |
| 788 | Ga0501313_037758 | 3300049529 | Bacteria | 642 |
| 789 | Ga0501314_019718 | 3300049530 | Bacteria | 694 |
| 790 | Ga0501314_027688 | 3300049530 | Bacteria | 618 |
| 791 | Ga0501315_018203 | 3300049531 | Bacteria | 925 |
| 792 | Ga0501315_039350 | 3300049531 | Bacteria | 710 |
| 793 | Ga0501316_012293 | 3300049532 | Bacteria | 999 |
| 794 | Ga0501316_025816 | 3300049532 | Bacteria | 766 |
| 795 | Ga0501317_037470 | 3300049533 | Bacteria | 728 |
| 796 | Ga0501318_039302 | 3300049534 | Bacteria | 671 |
| 797 | Ga0501320_008672 | 3300049536 | Bacteria | 1004 |
| 798 | Ga0501323_058235 | 3300049539 | Bacteria | 599 |
| 799 | Ga0501324_014023 | 3300049540 | Bacteria | 765 |
| 800 | Ga0501335_028727 | 3300049551 | Bacteria | 621 |
| 801 | Ga0501031_0002920 | 3300049568 | Bacteria | 10934 |
| 802 | Ga0501031_0452293 | 3300049568 | Bacteria | 829 |
| 803 | Ga0501032_0006582 | 3300049569 | Bacteria | 8530 |
| 804 | Ga0501032_0250476 | 3300049569 | Bacteria | 1150 |
| 805 | Ga0501033_0001825 | 3300049570 | Bacteria | 18567 |
| 806 | Ga0501034_0540609 | 3300049571 | Bacteria | 1075 |
| 807 | Ga0501036_0000327 | 3300049572 | Bacteria | 33144 |
| 808 | Ga0501036_0108969 | 3300049572 | Bacteria | 2341 |
| 809 | Ga0501037_0002561 | 3300049573 | Bacteria | 13135 |
| 810 | Ga0501037_0219305 | 3300049573 | Bacteria | 1339 |
| 811 | Ga0501038_0010326 | 3300049574 | Bacteria | 8541 |
| 812 | Ga0501043_0000828 | 3300049579 | Bacteria | 27461 |
| 813 | Ga0501043_0097392 | 3300049579 | Bacteria | 2313 |
| 814 | Ga0501046_0008109 | 3300049580 | Bacteria | 9178 |
| 815 | Ga0501047_0014543 | 3300049581 | Bacteria | 7486 |
| 816 | Ga0501047_0578013 | 3300049581 | Bacteria | 947 |
| 817 | Ga0501068_0815439 | 3300049584 | Bacteria | 612 |
| 818 | Ga0501070_0927865 | 3300049586 | Bacteria | 678 |
| 819 | Ga0501072_0025009 | 3300049588 | Bacteria | 4649 |
| 820 | Ga0501072_0091224 | 3300049588 | Bacteria | 2419 |
| 821 | Ga0501073_0004765 | 3300049589 | Bacteria | 10180 |
| 822 | Ga0501074_0217964 | 3300049590 | Bacteria | 1359 |
| 823 | Ga0501225_0058038 | 3300049705 | Bacteria | 1086 |
| 824 | Ga0501079_0576896 | 3300049741 | Bacteria | 885 |
| 825 | Ga0501080_0007643 | 3300049742 | Bacteria | 9775 |
| 826 | Ga0501083_0682433 | 3300049744 | Bacteria | 668 |
| 827 | Ga0501035_0000973 | 3300049822 | Bacteria | 30267 |
| 828 | Ga0501035_0032407 | 3300049822 | Bacteria | 4754 |
| 829 | Ga0501035_0044855 | 3300049822 | Bacteria | 3979 |
| 830 | Ga0501035_0143807 | 3300049822 | Bacteria | 2072 |
| 831 | Ga0501044_0002872 | 3300049823 | Bacteria | 19620 |
| 832 | Ga0501044_0003960 | 3300049823 | Bacteria | 16586 |
| 833 | nmdc:mga00v17_44138_c1 | 3300050491 | Bacteria | 2687 |
| 834 | nmdc:mga00v17_654_c1 | 3300050491 | Bacteria | 19164 |
| 835 | nmdc:mga0k408_105052_c1 | 3300050493 | Bacteria | 1667 |
| 836 | nmdc:mga0k408_215_c1 | 3300050493 | Bacteria | 31065 |
| 837 | nmdc:mga0k408_99758_c1 | 3300050493 | Bacteria | 1712 |
| 838 | nmdc:mga06z11_192670_c1 | 3300050494 | Bacteria | 1181 |
| 839 | nmdc:mga07m45_34541_c1 | 3300050496 | Bacteria | 2811 |
| 840 | nmdc:mga08y16_1403757_c1 | 3300050511 | Bacteria | 661 |
| 841 | nmdc:mga08y16_387748_c1 | 3300050511 | Bacteria | 1431 |
| 842 | nmdc:mga0n895_384868_c1 | 3300050512 | Bacteria | 1419 |
| 843 | nmdc:mga0rr50_247297_c1 | 3300050513 | Bacteria | 1480 |
| 844 | nmdc:mga0a205_237857_c1 | 3300050515 | Bacteria | 1702 |
| 845 | Ga0500618_006297 | 3300053125 | Bacteria | 3503 |
| 846 | Ga0500590_070224 | 3300053148 | Bacteria | 1742 |
| 847 | Ga0500600_0268815 | 3300053149 | Bacteria | 751 |
| 848 | Ga0500633_0097174 | 3300053160 | Bacteria | 1081 |
| 849 | Ga0500634_0048967 | 3300053161 | Bacteria | 2279 |
| 850 | Ga0587071_065308 | 3300060344 | Bacteria | 781 |
| 851 | Ga0466962_0036635 | 3300061719 | Bacteria | 2348 |
| 852 | 2509153378 | 2508501128 | Bacteria | 8613869 |
| 853 | 2519458999 | 2519103095 | Bacteria | 6629912 |
| 854 | 2585291478 | 2582581311 | Bacteria | 6763856 |
| 855 | 2599736590 | 2599185239 | Bacteria | 8686614 |
| 856 | 2599744649 | 2599185240 | Bacteria | 7968121 |
| 857 | 2599903149 | 2599185292 | Bacteria | 6290804 |
| 858 | 2600205990 | 2599185355 | Bacteria | 7968906 |
| 859 | 2643862358 | 2643221569 | Bacteria | 6064337 |
| 860 | 2643980636 | 2643221594 | Bacteria | 5811388 |
| 861 | 2644122063 | 2643221621 | Bacteria | 6212786 |
| 862 | 2676742775 | 2675903129 | Bacteria | 7964495 |
| 863 | 2735818041 | 2734482258 | Unclassified | 2930739 |
| 864 | 2809032047 | 2808606395 | Bacteria | 6020352 |
| 865 | 2817261294 | 2816332253 | Bacteria | 6764532 |
| 866 | 2817278971 | 2816332256 | Bacteria | 6891714 |
| 867 | 2817451305 | 2816332286 | Bacteria | 6853759 |
| 868 | 2819631074 | 2818991452 | Bacteria | 8442785 |
| 869 | 2855737111 | 2855730933 | Bacteria | 7047938 |
| 870 | 2855767821 | 2855767633 | Bacteria | 7049357 |
| 871 | 2857538547 | 2857537821 | Bacteria | 5248181 |
| 872 | 2857546576 | 2857542790 | Bacteria | 5326616 |
| 873 | 2858955804 | 2858950400 | Bacteria | 6783797 |
| 874 | 2863424822 | 2863421361 | Bacteria | 7300805 |
| 875 | 2870071086 | 2870068957 | Bacteria | 8925310 |
| 876 | 2881416652 | 2881412998 | Bacteria | 6492157 |
| 877 | 2904571050 | 2904564687 | Bacteria | 7609577 |
| 878 | 2904575900 | 2904571731 | Bacteria | 7608790 |
| 879 | 2928160113 | 2928157003 | Bacteria | 7522202 |
| 880 | 2928168554 | 2928163908 | Bacteria | 7561269 |
| 881 | 2928171810 | 2928170801 | Bacteria | 8785406 |
| 882 | 2928539963 | 2928536128 | Bacteria | 7657547 |
| 883 | 2941481873 | |||
| 884 | 2981994732 | 2981990288 | Bacteria | 7590678 |
| 885 | 641643700 | 641522639 | Bacteria | 7737025 |
| 886 | 642416746 | 641736154 | Bacteria | 7689995 |
| 887 | 643601660 | 643348564 | Bacteria | 8839022 |
| 888 | 8018851450 | 8018845410 | Bacteria | 8933938 |
| 889 | 8020811731 | 8020807995 | Bacteria | 6801506 |
| 890 | 8020945101 | 8020938398 | Bacteria | 7472757 |
| 891 | 8020956862 | 8020953355 | Bacteria | 7439080 |
| 892 | 8021122285 | 8021120328 | Bacteria | 8782274 |
| 893 | 8039102471 | 8039098773 | Bacteria | 6602928 |
| 894 | 8040168858 | 8040167225 | Bacteria | 6542727 |
| 895 | 8040174784 | 8040173305 | Bacteria | 6827067 |
| 896 | Ga0265316_10207559 | |||
| 897 | JGI24741J21665_1025326 | |||
| 898 | JGI24740J21852_10019934 | |||
| 899 | JGI24737J22298_10051115 | |||
| 900 | JGI24735J21928_10021101 | |||
| 901 | JGI25156J39149_1029015 | |||
| 902 | Ga0006778J45830_1005071 | |||
| 903 | Ga0006778J45830_1054358 | |||
| 904 | JGI25151J46595_10000252 | |||
| 905 | JGI25406J46586_10000483 | |||
| 906 | JGI25406J46586_10000556 | |||
| 907 | JGI25153J46596_10005152 | |||
| 908 | Ga0006770J48903_1010095 | |||
| 909 | Ga0006777J48905_1005390 | |||
| 910 | Ga0006777J48905_1060873 | |||
| 911 | rootH1_10030144 | |||
| 912 | Ga0007427J51700_113419 | |||
| 913 | Ga0006781J51513_1004106 | |||
| 914 | Ga0007410J51695_1054394 | |||
| 915 | Ga0007409J51694_1036348 | |||
| 916 | Ga0007409J51694_1087169 | |||
| 917 | Ga0007416J51690_1047561 | |||
| 918 | Ga0007416J51690_1051877 | |||
| 919 | Ga0007429J51699_1005545 | |||
| 920 | Ga0007429J51699_1034423 | |||
| 921 | Ga0007429J51699_1039295 | |||
| 922 | Ga0007429J51699_1049319 | |||
| 923 | Ga0007429J51699_1095865 | |||
| 924 | Ga0032354_1002485 | |||
| 925 | Ga0032354_1007551 | |||
| 926 | Ga0032354_1010142 | |||
| 927 | Ga0032354_1041181 | |||
| 928 | Ga0032354_1052527 | |||
| 929 | Ga0032354_1078728 | |||
| 930 | Ga0006780_1032026 | |||
| 931 | Ga0055529_1000760 | |||
| 932 | Ga0055528_1002190 | |||
| 933 | Ga0055540_1042696 | |||
| 934 | Ga0055541_1010071 | |||
| 935 | Ga0058692_1005445 | |||
| 936 | Ga0058858_1380169 | |||
| 937 | Ga0065714_10162327 | |||
| 938 | Ga0065704_10274630 | |||
| 939 | Ga0065712_10241509 | |||
| 940 | Ga0065715_10228715 | |||
| 941 | Ga0065707_10087162 | |||
| 942 | Ga0065707_10381186 | |||
| 943 | Ga0065707_10486204 | |||
| 944 | Ga0070658_10017497 | |||
| 945 | Ga0070658_10052963 | |||
| 946 | Ga0070676_10071535 | |||
| 947 | Ga0070676_10663991 | |||
| 948 | Ga0070683_100020025 | |||
| 949 | Ga0070683_100049798 | |||
| 950 | Ga0070683_100266805 | |||
| 951 | Ga0070670_100008493 | |||
| 952 | Ga0070670_100021601 | |||
| 953 | Ga0070670_100172507 | |||
| 954 | Ga0070670_100181465 | |||
| 955 | Ga0070670_100231741 | |||
| 956 | Ga0070677_10177982 | |||
| 957 | Ga0068869_100002295 | |||
| 958 | Ga0068869_100005456 | |||
| 959 | Ga0068869_100434426 | |||
| 960 | Ga0068869_100664316 | |||
| 961 | Ga0068869_100780806 | |||
| 962 | Ga0068869_101156786 | |||
| 963 | Ga0070666_10005229 | |||
| 964 | Ga0070666_10094163 | |||
| 965 | Ga0070666_10231707 | |||
| 966 | Ga0070666_10522232 | |||
| 967 | Ga0070680_100011280 | |||
| 968 | Ga0068868_100003743 | |||
| 969 | Ga0068868_100119105 | |||
| 970 | Ga0068868_101011170 | |||
| 971 | Ga0070660_100004671 | |||
| 972 | Ga0070660_100027436 | |||
| 973 | Ga0070660_100556875 | |||
| 974 | Ga0070687_100039596 | |||
| 975 | Ga0070687_100202489 | |||
| 976 | Ga0070687_100385005 | |||
| 977 | Ga0070661_100044368 | |||
| 978 | Ga0070661_100277392 | |||
| 979 | Ga0070661_100611446 | |||
| 980 | Ga0070661_100666316 | |||
| 981 | Ga0070692_10163683 | |||
| 982 | Ga0070692_10176681 | |||
| 983 | Ga0070668_100017520 | |||
| 984 | Ga0070668_100042023 | |||
| 985 | Ga0070668_100429836 | |||
| 986 | Ga0070669_100000561 | |||
| 987 | Ga0070669_100006960 | |||
| 988 | Ga0070669_100025095 | |||
| 989 | Ga0070669_100143709 | |||
| 990 | Ga0070669_100158397 | |||
| 991 | Ga0070675_100004493 | |||
| 992 | Ga0070675_100007406 | |||
| 993 | Ga0070675_100126523 | |||
| 994 | Ga0070675_100136078 | |||
| 995 | Ga0070671_100002656 | |||
| 996 | Ga0070671_100041050 | |||
| 997 | Ga0070671_100129202 | |||
| 998 | Ga0070671_100309441 | |||
| 999 | Ga0070674_100016652 | |||
| 1000 | Ga0070673_100047958 | |||
| 1001 | Ga0070673_100079275 | |||
| 1002 | Ga0070673_100083159 | |||
| 1003 | Ga0070673_100367516 | |||
| 1004 | Ga0070673_100705222 | |||
| 1005 | Ga0070673_101194366 | |||
| 1006 | Ga0070659_100000788 | |||
| 1007 | Ga0070659_100078029 | |||
| 1008 | Ga0070659_100335204 | |||
| 1009 | Ga0070667_100005438 | |||
| 1010 | Ga0070667_100013482 | |||
| 1011 | Ga0070667_100102468 | |||
| 1012 | Ga0070667_101614593 | |||
| 1013 | Ga0070701_10165088 | |||
| 1014 | Ga0070700_100015319 | |||
| 1015 | Ga0070700_100397168 | |||
| 1016 | Ga0070663_100001963 | |||
| 1017 | Ga0070663_100222906 | |||
| 1018 | Ga0070663_100250060 | |||
| 1019 | Ga0070663_100316089 | |||
| 1020 | Ga0070678_100003443 | |||
| 1021 | Ga0070678_100281442 | |||
| 1022 | Ga0070678_100307547 | |||
| 1023 | Ga0070662_100060438 | |||
| 1024 | Ga0070662_100074424 | |||
| 1025 | Ga0070662_100091245 | |||
| 1026 | Ga0070662_100270655 | |||
| 1027 | Ga0070662_100309251 | |||
| 1028 | Ga0070681_10002686 | |||
| 1029 | Ga0070681_10083560 | |||
| 1030 | Ga0068867_100001675 | |||
| 1031 | Ga0068867_100002388 | |||
| 1032 | Ga0068867_100027566 | |||
| 1033 | Ga0068867_100036868 | |||
| 1034 | Ga0068867_100053604 | |||
| 1035 | Ga0070706_100003915 | |||
| 1036 | Ga0070706_100853571 | |||
| 1037 | Ga0070707_100921136 | |||
| 1038 | Ga0070698_100054506 | |||
| 1039 | Ga0070699_100101193 | |||
| 1040 | Ga0070679_100001227 | |||
| 1041 | Ga0070679_100001401 | |||
| 1042 | Ga0070684_100025198 | |||
| 1043 | Ga0070684_100186704 | |||
| 1044 | Ga0068853_100002964 | |||
| 1045 | Ga0068853_100073742 | |||
| 1046 | Ga0068853_100118985 | |||
| 1047 | Ga0070672_100016642 | |||
| 1048 | Ga0070672_100023346 | |||
| 1049 | Ga0070672_100069074 | |||
| 1050 | Ga0070672_100185138 | |||
| 1051 | Ga0070672_100818949 | |||
| 1052 | Ga0070686_100565306 | |||
| 1053 | Ga0070686_100577371 | |||
| 1054 | Ga0070693_100092541 | |||
| 1055 | Ga0070665_100081042 | |||
| 1056 | Ga0070665_100723248 | |||
| 1057 | Ga0068855_100082482 | |||
| 1058 | Ga0068855_100232936 | |||
| 1059 | Ga0068855_100532184 | |||
| 1060 | Ga0070664_100026844 | |||
| 1061 | Ga0068857_100016245 | |||
| 1062 | Ga0068857_100042621 | |||
| 1063 | Ga0068857_100134094 | |||
| 1064 | Ga0068857_100463114 | |||
| 1065 | Ga0068857_101185464 | |||
| 1066 | Ga0068854_100153131 | |||
| 1067 | Ga0068854_100290641 | |||
| 1068 | Ga0068856_100009521 | |||
| 1069 | Ga0068856_100111688 | |||
| 1070 | Ga0068856_100192484 | |||
| 1071 | Ga0068856_100589334 | |||
| 1072 | Ga0070702_100147969 | |||
| 1073 | Ga0070702_100324246 | |||
| 1074 | Ga0070702_100953848 | |||
| 1075 | Ga0068852_100066971 | |||
| 1076 | Ga0068852_100070537 | |||
| 1077 | Ga0068852_100195045 | |||
| 1078 | Ga0068852_100519903 | |||
| 1079 | Ga0068852_101350774 | |||
| 1080 | Ga0068859_100000492 | |||
| 1081 | Ga0068859_100035271 | |||
| 1082 | Ga0068859_100044039 | |||
| 1083 | Ga0068859_100122926 | |||
| 1084 | Ga0068859_100258966 | |||
| 1085 | Ga0068864_100008810 | |||
| 1086 | Ga0068864_100009812 | |||
| 1087 | Ga0068864_100055448 | |||
| 1088 | Ga0068864_100234674 | |||
| 1089 | Ga0068864_100660156 | |||
| 1090 | Ga0068866_10019671 | |||
| 1091 | Ga0068866_10224851 | |||
| 1092 | Ga0068861_100005884 | |||
| 1093 | Ga0068861_100025591 | |||
| 1094 | Ga0068861_100523654 | |||
| 1095 | Ga0068851_10029564 | |||
| 1096 | Ga0068851_10307003 | |||
| 1097 | Ga0068870_10008062 | |||
| 1098 | Ga0068863_100001897 | |||
| 1099 | Ga0068863_100073129 | |||
| 1100 | Ga0068863_100213027 | |||
| 1101 | Ga0068863_100272170 | |||
| 1102 | Ga0068863_100399698 | |||
| 1103 | Ga0068863_100954618 | |||
| 1104 | Ga0068858_100003285 | |||
| 1105 | Ga0068858_100009299 | |||
| 1106 | Ga0068858_100012259 | |||
| 1107 | Ga0068858_100209000 | |||
| 1108 | Ga0068858_100335267 | |||
| 1109 | Ga0068858_100342647 | |||
| 1110 | Ga0068860_100004697 | |||
| 1111 | Ga0068860_100005057 | |||
| 1112 | Ga0068860_100010416 | |||
| 1113 | Ga0068860_100018447 | |||
| 1114 | Ga0068860_100129423 | |||
| 1115 | Ga0068860_100369273 | |||
| 1116 | Ga0068860_100736246 | |||
| 1117 | Ga0068860_100912406 | |||
| 1118 | Ga0068862_100004059 | |||
| 1119 | Ga0068862_100023545 | |||
| 1120 | Ga0068862_100029113 | |||
| 1121 | Ga0068862_100030077 | |||
| 1122 | Ga0068862_100062324 | |||
| 1123 | Ga0068862_100259621 | |||
| 1124 | Ga0081455_10373288 | |||
| 1125 | Ga0081539_10225780 | |||
| 1126 | Ga0075363_100289387 | |||
| 1127 | Ga0075364_10000343 | |||
| 1128 | Ga0075364_10002779 | |||
| 1129 | Ga0075367_10019588 | |||
| 1130 | Ga0075366_10000330 | |||
| 1131 | Ga0075366_10082965 | |||
| 1132 | Ga0075366_10085229 | |||
| 1133 | Ga0075366_10123563 | |||
| 1134 | Ga0075366_10166668 | |||
| 1135 | Ga0075366_10188906 | |||
| 1136 | Ga0075366_10214212 | |||
| 1137 | Ga0097621_100042279 | |||
| 1138 | Ga0097621_100045675 | |||
| 1139 | Ga0097621_100373789 | |||
| 1140 | Ga0097621_100867935 | |||
| 1141 | Ga0075370_10006605 | |||
| 1142 | Ga0068871_100032664 | |||
| 1143 | Ga0068871_100051867 | |||
| 1144 | Ga0068871_100852912 | |||
| 1145 | Ga0075433_10122757 | |||
| 1146 | Ga0075434_100129275 | |||
| 1147 | Ga0075434_101191422 | |||
| 1148 | Ga0068865_100002375 | |||
| 1149 | Ga0068865_100025220 | |||
| 1150 | Ga0068865_100031584 | |||
| 1151 | Ga0068865_101269648 | |||
| 1152 | Ga0097620_100000492 | |||
| 1153 | Ga0097620_100035270 | |||
| 1154 | Ga0097620_100044041 | |||
| 1155 | Ga0097620_100122919 | |||
| 1156 | Ga0097620_100258961 | |||
| 1157 | Ga0075435_100122314 | |||
| 1158 | Ga0075435_100859090 | |||
| 1159 | Ga0105244_10022984 | |||
| 1160 | Ga0105240_11224141 | |||
| 1161 | Ga0111539_10044921 | |||
| 1162 | Ga0111539_11418774 | |||
| 1163 | Ga0111539_11844850 | |||
| 1164 | Ga0105245_10038984 | |||
| 1165 | Ga0105245_10182459 | |||
| 1166 | Ga0105247_10083595 | |||
| 1167 | Ga0105247_10128077 | |||
| 1168 | Ga0105247_10198228 | |||
| 1169 | Ga0105247_10198909 | |||
| 1170 | Ga0114129_12075118 | |||
| 1171 | Ga0105243_10191622 | |||
| 1172 | Ga0105243_10251606 | |||
| 1173 | Ga0105242_10055147 | |||
| 1174 | Ga0105242_10190974 | |||
| 1175 | Ga0105242_10246862 | |||
| 1176 | Ga0105248_10000981 | |||
| 1177 | Ga0105248_10058293 | |||
| 1178 | Ga0105248_10097212 | |||
| 1179 | Ga0105248_10418900 | |||
| 1180 | Ga0105248_10538343 | |||
| 1181 | Ga0105248_10934944 | |||
| 1182 | Ga0105237_10116774 | |||
| 1183 | Ga0105237_10505369 | |||
| 1184 | Ga0105238_10011761 | |||
| 1185 | Ga0105238_10142452 | |||
| 1186 | Ga0105238_10523006 | |||
| 1187 | Ga0105249_10029828 | |||
| 1188 | Ga0105249_10179131 | |||
| 1189 | Ga0105249_10548653 | |||
| 1190 | Ga0105249_11147881 | |||
| 1191 | Ga0105239_10019206 | |||
| 1192 | Ga0105239_10126659 | |||
| 1193 | Ga0105246_10535315 | |||
| 1194 | Ga0157327_1004078 | |||
| 1195 | Ga0157373_10016456 | |||
| 1196 | Ga0157373_10033207 | |||
| 1197 | Ga0157373_10179896 | |||
| 1198 | Ga0157371_10030892 | |||
| 1199 | Ga0157371_10035498 | |||
| 1200 | Ga0157371_10052063 | |||
| 1201 | Ga0157370_10003769 | |||
| 1202 | Ga0157370_10408776 | |||
| 1203 | Ga0157369_10025592 | |||
| 1204 | Ga0157369_10710050 | |||
| 1205 | Ga0157374_10000479 | |||
| 1206 | Ga0157374_10109605 | |||
| 1207 | Ga0157374_10357158 | |||
| 1208 | Ga0157374_10374905 | |||
| 1209 | Ga0157374_10587083 | |||
| 1210 | Ga0157374_10833237 | |||
| 1211 | Ga0157378_10093011 | |||
| 1212 | Ga0157378_10243172 | |||
| 1213 | Ga0157378_10337459 | |||
| 1214 | Ga0157378_10536443 | |||
| 1215 | Ga0157378_10645474 | |||
| 1216 | Ga0163162_10007760 | |||
| 1217 | Ga0163162_10016605 | |||
| 1218 | Ga0163162_10036293 | |||
| 1219 | Ga0163162_10068824 | |||
| 1220 | Ga0163162_10105166 | |||
| 1221 | Ga0163162_10478705 | |||
| 1222 | Ga0163162_10727019 | |||
| 1223 | Ga0157372_10020411 | |||
| 1224 | Ga0157372_10053129 | |||
| 1225 | Ga0157372_10711932 | |||
| 1226 | Ga0157375_10061404 | |||
| 1227 | Ga0157375_10064258 | |||
| 1228 | Ga0157375_10100791 | |||
| 1229 | Ga0157375_10145286 | |||
| 1230 | Ga0157375_10175521 | |||
| 1231 | Ga0163163_10001648 | |||
| 1232 | Ga0163163_10008141 | |||
| 1233 | Ga0157380_10032185 | |||
| 1234 | Ga0157380_10043304 | |||
| 1235 | Ga0157380_10078162 | |||
| 1236 | Ga0157380_10092375 | |||
| 1237 | Ga0157380_10233033 | |||
| 1238 | Ga0157380_10413186 | |||
| 1239 | Ga0157380_10546190 | |||
| 1240 | Ga0157377_10028343 | |||
| 1241 | Ga0157379_10000044 | |||
| 1242 | Ga0157379_10012842 | |||
| 1243 | Ga0157379_10017358 | |||
| 1244 | Ga0157379_10035925 | |||
| 1245 | Ga0157379_10197672 | |||
| 1246 | Ga0157376_10017980 | |||
| 1247 | Ga0157376_10267144 | |||
| 1248 | Ga0157376_10557933 | |||
| 1249 | Ga0157376_11236724 | |||
| 1250 | Ga0157376_11492675 | |||
| 1251 | Ga0182006_1028834 | |||
| 1252 | Ga0182006_1151549 | |||
| 1253 | Ga0182007_10013438 | |||
| 1254 | Ga0182005_1013970 | |||
| 1255 | Ga0182005_1167486 | |||
| 1256 | Ga0197907_10694566 | |||
| 1257 | Ga0206352_10998807 | |||
| 1258 | Ga0206354_11408214 | |||
| 1259 | Ga0206353_11600254 | |||
| 1260 | Ga0213876_10010872 | |||
| 1261 | Ga0256714_106396 | |||
| 1262 | Ga0247515_117421 | |||
| 1263 | Ga0209672_100023 | |||
| 1264 | Ga0209147_100094 | |||
| 1265 | Ga0209147_100346 | |||
| 1266 | Ga0209258_100142 | |||
| 1267 | Ga0209148_1000980 | |||
| 1268 | Ga0209759_1001922 | |||
| 1269 | Ga0207666_1018265 | |||
| 1270 | Ga0207673_1008960 | |||
| 1271 | Ga0209676_1003152 | |||
| 1272 | Ga0209025_1000193 | |||
| 1273 | Ga0209758_1000146 | |||
| 1274 | Ga0209050_1005244 | |||
| 1275 | Ga0209051_1002762 | |||
| 1276 | Ga0209051_1043552 | |||
| 1277 | Ga0207697_10041901 | |||
| 1278 | Ga0207656_10149474 | |||
| 1279 | Ga0207642_10012616 | |||
| 1280 | Ga0207710_10058023 | |||
| 1281 | Ga0207710_10062583 | |||
| 1282 | Ga0207688_10070684 | |||
| 1283 | Ga0207680_10038581 | |||
| 1284 | Ga0207680_10129007 | |||
| 1285 | Ga0207680_10534113 | |||
| 1286 | Ga0207680_10566635 | |||
| 1287 | Ga0207645_10008397 | |||
| 1288 | Ga0207645_10010092 | |||
| 1289 | Ga0207645_10044335 | |||
| 1290 | Ga0207645_10745628 | |||
| 1291 | Ga0207643_10007114 | |||
| 1292 | Ga0207643_10044671 | |||
| 1293 | Ga0207705_10013924 | |||
| 1294 | Ga0207705_10582527 | |||
| 1295 | Ga0207684_10026369 | |||
| 1296 | Ga0207654_10276438 | |||
| 1297 | Ga0207707_10018532 | |||
| 1298 | Ga0207707_10067023 | |||
| 1299 | Ga0207695_10021818 | |||
| 1300 | Ga0207695_10397903 | |||
| 1301 | Ga0207660_10000960 | |||
| 1302 | Ga0207662_10000851 | |||
| 1303 | Ga0207657_10290288 | |||
| 1304 | Ga0207657_10464038 | |||
| 1305 | Ga0207649_10020123 | |||
| 1306 | Ga0207649_10334501 | |||
| 1307 | Ga0207649_10646897 | |||
| 1308 | Ga0207652_10008631 | |||
| 1309 | Ga0207681_10002084 | |||
| 1310 | Ga0207681_10003433 | |||
| 1311 | Ga0207681_10123218 | |||
| 1312 | Ga0207681_10251909 | |||
| 1313 | Ga0207681_10506628 | |||
| 1314 | Ga0207694_10292713 | |||
| 1315 | Ga0207694_10386466 | |||
| 1316 | Ga0207694_10792695 | |||
| 1317 | Ga0207650_10002436 | |||
| 1318 | Ga0207650_10029441 | |||
| 1319 | Ga0207650_10251106 | |||
| 1320 | Ga0207650_10345837 | |||
| 1321 | Ga0207659_10011752 | |||
| 1322 | Ga0207659_10031206 | |||
| 1323 | Ga0207659_10566947 | |||
| 1324 | Ga0207659_10621510 | |||
| 1325 | Ga0207687_10101750 | |||
| 1326 | Ga0207687_10136645 | |||
| 1327 | Ga0207687_10438232 | |||
| 1328 | Ga0207644_10007085 | |||
| 1329 | Ga0207644_10030146 | |||
| 1330 | Ga0207644_10566240 | |||
| 1331 | Ga0207644_10881406 | |||
| 1332 | Ga0207690_10201532 | |||
| 1333 | Ga0207690_10437986 | |||
| 1334 | Ga0207690_10461576 | |||
| 1335 | Ga0207706_10128513 | |||
| 1336 | Ga0207706_10144831 | |||
| 1337 | Ga0207706_10417036 | |||
| 1338 | Ga0207706_10719061 | |||
| 1339 | Ga0207686_10222484 | |||
| 1340 | Ga0207686_10342039 | |||
| 1341 | Ga0207709_10037754 | |||
| 1342 | Ga0207709_10157888 | |||
| 1343 | Ga0207709_10193674 | |||
| 1344 | Ga0207669_10056591 | |||
| 1345 | Ga0207669_10067225 | |||
| 1346 | Ga0207669_10075932 | |||
| 1347 | Ga0207669_10112167 | |||
| 1348 | Ga0207669_10241495 | |||
| 1349 | Ga0207669_10383830 | |||
| 1350 | Ga0207704_10032106 | |||
| 1351 | Ga0207704_10062348 | |||
| 1352 | Ga0207704_10361359 | |||
| 1353 | Ga0207704_10477655 | |||
| 1354 | Ga0207704_10522094 | |||
| 1355 | Ga0207704_11052424 | |||
| 1356 | Ga0207691_10004198 | |||
| 1357 | Ga0207691_10049890 | |||
| 1358 | Ga0207691_10455102 | |||
| 1359 | Ga0207691_10645742 | |||
| 1360 | Ga0207691_10902305 | |||
| 1361 | Ga0207711_10004815 | |||
| 1362 | Ga0207711_10016097 | |||
| 1363 | Ga0207711_10092684 | |||
| 1364 | Ga0207711_10150914 | |||
| 1365 | Ga0207711_10158844 | |||
| 1366 | Ga0207711_10242066 | |||
| 1367 | Ga0207711_10582678 | |||
| 1368 | Ga0207689_10000381 | |||
| 1369 | Ga0207689_10001763 | |||
| 1370 | Ga0207689_10004159 | |||
| 1371 | Ga0207689_10038960 | |||
| 1372 | Ga0207689_10586165 | |||
| 1373 | Ga0207679_10120124 | |||
| 1374 | Ga0207667_10257880 | |||
| 1375 | Ga0207667_10645488 | |||
| 1376 | Ga0207667_10656854 | |||
| 1377 | Ga0207651_10050867 | |||
| 1378 | Ga0207651_10178149 | |||
| 1379 | Ga0207651_11032582 | |||
| 1380 | Ga0207712_10317224 | |||
| 1381 | Ga0207712_10618049 | |||
| 1382 | Ga0207712_11137312 | |||
| 1383 | Ga0207712_11267843 | |||
| 1384 | Ga0207668_10019037 | |||
| 1385 | Ga0207668_10086520 | |||
| 1386 | Ga0207668_10146762 | |||
| 1387 | Ga0207668_10231357 | |||
| 1388 | Ga0207668_10438955 | |||
| 1389 | Ga0207640_10066634 | |||
| 1390 | Ga0207658_10014427 | |||
| 1391 | Ga0207658_10015619 | |||
| 1392 | Ga0207658_10217088 | |||
| 1393 | Ga0207658_10653295 | |||
| 1394 | Ga0207677_10009039 | |||
| 1395 | Ga0207677_10016608 | |||
| 1396 | Ga0207677_10054496 | |||
| 1397 | Ga0207677_10060330 | |||
| 1398 | Ga0207677_10432812 | |||
| 1399 | Ga0207703_10000382 | |||
| 1400 | Ga0207703_10005576 | |||
| 1401 | Ga0207703_10034181 | |||
| 1402 | Ga0207703_10304417 | |||
| 1403 | Ga0207703_10860349 | |||
| 1404 | Ga0207703_11249204 | |||
| 1405 | Ga0207639_10017592 | |||
| 1406 | Ga0207639_10076238 | |||
| 1407 | Ga0207639_10104080 | |||
| 1408 | Ga0207678_10019182 | |||
| 1409 | Ga0207678_10255743 | |||
| 1410 | Ga0207678_10495743 | |||
| 1411 | Ga0207678_11465874 | |||
| 1412 | Ga0207708_10033887 | |||
| 1413 | Ga0207708_10184567 | |||
| 1414 | Ga0207708_10211272 | |||
| 1415 | Ga0207708_10231927 | |||
| 1416 | Ga0207702_10036140 | |||
| 1417 | Ga0207702_10228504 | |||
| 1418 | Ga0207641_10012349 | |||
| 1419 | Ga0207641_10064209 | |||
| 1420 | Ga0207641_10092237 | |||
| 1421 | Ga0207641_10205838 | |||
| 1422 | Ga0207641_10270211 | |||
| 1423 | Ga0207641_10407552 | |||
| 1424 | Ga0207641_10460299 | |||
| 1425 | Ga0207641_10706028 | |||
| 1426 | Ga0207648_10001132 | |||
| 1427 | Ga0207648_10002487 | |||
| 1428 | Ga0207648_10063373 | |||
| 1429 | Ga0207648_10118589 | |||
| 1430 | Ga0207648_10232836 | |||
| 1431 | Ga0207648_10253162 | |||
| 1432 | Ga0207648_10273316 | |||
| 1433 | Ga0207648_10694598 | |||
| 1434 | Ga0207676_10002468 | |||
| 1435 | Ga0207676_10014782 | |||
| 1436 | Ga0207676_10081159 | |||
| 1437 | Ga0207676_10436529 | |||
| 1438 | Ga0207676_10440257 | |||
| 1439 | Ga0207674_10005048 | |||
| 1440 | Ga0207674_10017042 | |||
| 1441 | Ga0207674_10042386 | |||
| 1442 | Ga0207674_10069277 | |||
| 1443 | Ga0207674_10984967 | |||
| 1444 | Ga0207675_100016342 | |||
| 1445 | Ga0207675_100029454 | |||
| 1446 | Ga0207675_100171143 | |||
| 1447 | Ga0207675_100281702 | |||
| 1448 | Ga0207675_100360427 | |||
| 1449 | Ga0207675_101063257 | |||
| 1450 | Ga0207683_10001803 | |||
| 1451 | Ga0207683_10034065 | |||
| 1452 | Ga0207683_10412044 | |||
| 1453 | Ga0207683_10435615 | |||
| 1454 | Ga0207698_10008316 | |||
| 1455 | Ga0207698_10081738 | |||
| 1456 | Ga0207698_10112065 | |||
| 1457 | Ga0207698_10205466 | |||
| 1458 | Ga0207698_10728837 | |||
| 1459 | Ga0207698_10871509 | |||
| 1460 | Ga0207698_11603660 | |||
| 1461 | Ga0209371_1044904 | |||
| 1462 | Ga0209970_1039028 | |||
| 1463 | Ga0209974_10020354 | |||
| 1464 | Ga0209974_10229949 | |||
| 1465 | Ga0207428_10594050 | |||
| 1466 | Ga0268265_10003515 | |||
| 1467 | Ga0268265_10060496 | |||
| 1468 | Ga0268265_10229867 | |||
| 1469 | Ga0268265_10347830 | |||
| 1470 | Ga0268265_10549413 | |||
| 1471 | Ga0268265_10589771 | |||
| 1472 | Ga0268264_10002678 | |||
| 1473 | Ga0268264_10005258 | |||
| 1474 | Ga0268264_10030467 | |||
| 1475 | Ga0268264_10123127 | |||
| 1476 | Ga0268264_10215530 | |||
| 1477 | Ga0268264_11146467 | |||
| 1478 | Ga0307515_10000188 | |||
| 1479 | Ga0307515_10174518 | |||
| 1480 | Ga0307515_10530406 | |||
| 1481 | Ga0265338_10000373 | |||
| 1482 | Ga0310981_1066224 | |||
| 1483 | Ga0268256_1024210 | |||
| 1484 | Ga0268256_1062112 | |||
| 1485 | Ga0316177_1219224 | |||
| 1486 | Ga0314311_1195695 | |||
| 1487 | Ga0316178_1077292 | |||
| 1488 | Ga0316180_1107170 | |||
| 1489 | Ga0316181_1028793 | |||
| 1490 | Ga0265330_10145925 | |||
| 1491 | Ga0265330_10151763 | |||
| 1492 | Ga0265328_10024128 | |||
| 1493 | Ga0265325_10009259 | |||
| 1494 | Ga0265339_10032780 | |||
| 1495 | Ga0265339_10227890 | |||
| 1496 | Ga0265339_10235833 | |||
| 1497 | Ga0265327_10000184 | |||
| 1498 | Ga0265316_10000115 | |||
| 1499 | Ga0307513_10018328 | |||
| 1500 | Ga0307509_10017037 | |||
| 1501 | Ga0307408_100567156 | |||
| 1502 | Ga0307408_100887115 | |||
| 1503 | Ga0307508_10443012 | |||
| 1504 | Ga0265314_10057739 | |||
| 1505 | Ga0265342_10086877 | |||
| 1506 | Ga0307516_10594001 | |||
| 1507 | Ga0307405_10588718 | |||
| 1508 | Ga0307405_11067963 | |||
| 1509 | Ga0307413_10361711 | |||
| 1510 | Ga0307413_10752232 | |||
| 1511 | Ga0307413_10967690 | |||
| 1512 | Ga0307410_10112394 | |||
| 1513 | Ga0307410_10113174 | |||
| 1514 | Ga0307410_10293351 | |||
| 1515 | Ga0307406_10227457 | |||
| 1516 | Ga0307406_10241896 | |||
| 1517 | Ga0307406_10960577 | |||
| 1518 | Ga0307407_10485632 | |||
| 1519 | Ga0307412_10000436 | |||
| 1520 | Ga0307409_100031775 | |||
| 1521 | Ga0307409_101224808 | |||
| 1522 | Ga0307416_100000641 | |||
| 1523 | Ga0307414_10621875 | |||
| 1524 | Ga0307414_11017016 | |||
| 1525 | Ga0307411_10367253 | |||
| 1526 | Ga0307415_100033810 | |||
| 1527 | Ga0307415_100801215 | |||
| 1528 | Ga0307415_101877135 | |||
| 1529 | Ga0316596_1081991 | |||
| 1530 | Ga0373930_0014689 | |||
| 1531 | Ga0373929_0009966 | |||
| 1532 | Ga0373940_0009612 | |||
| 1533 | Ga0373952_0011208 | |||
| 1534 | Ga0373939_0034028 | |||
| 1535 | Ga0373941_0003998 | |||
| 1536 | Ga0373945_0089197 | |||
| 1537 | Ga0373957_0111795 | |||
| 1538 | Ga0373955_0591360 | |||
| 1539 | Ga0373961_0094681 | |||
| 1540 | Ga0373931_0002799 | |||
| 1541 | Ga0373935_0333651 | |||
| 1542 | Ga0373927_0106349 | |||
| 1543 | Ga0373933_0262987 | |||
| 1544 | Ga0373937_0094357 | |||
| 1545 | Ga0373925_0016673 | |||
| 1546 | Ga0395900_0001281 | |||
| 1547 | Ga0395898_0004206 | |||
| 1548 | Ga0395905_0001475 | |||
| 1549 | Ga0395905_0021001 | |||
| 1550 | Ga0395905_0164293 | |||
| 1551 | Ga0395905_0233822 | |||
| 1552 | Ga0395905_0653539 | |||
| 1553 | Ga0395901_0330433 | |||
| 1554 | Ga0436365_1919084 | |||
| 1555 | Ga0436363_0343017 | |||
| 1556 | Ga0439439_0052166 | |||
| 1557 | Ga0451802_0133075 | |||
| 1558 | Ga0451833_0343808 | |||
| 1559 | Ga0451853_3267339 | |||
| 1560 | Ga0439433_0024319 | |||
| 1561 | Ga0439449_0153051 | |||
| 1562 | Ga0439455_0120482 | |||
| 1563 | Ga0450892_009012 | |||
| 1564 | Ga0450899_020806 | |||
| 1565 | Ga0439464_0030579 | |||
| 1566 | Ga0439460_0058076 | |||
| 1567 | Ga0466969_0000005 | |||
| 1568 | Ga0466972_0013360 | |||
| 1569 | Ga0466966_0004215 | |||
| 1570 | Ga0466961_0018631 | |||
| 1571 | Ga0466961_0058653 | |||
| 1572 | Ga0466961_0308254 | |||
| 1573 | Ga0466963_0008752 | |||
| 1574 | Ga0466964_0003562 | |||
| 1575 | Ga0466971_0004644 | |||
| 1576 | Ga0466971_0061028 | |||
| 1577 | Ga0466957_0062353 | |||
| 1578 | Ga0466957_0068258 | |||
| 1579 | Ga0466960_0016310 | |||
| 1580 | Ga0466959_0000564 | |||
| 1581 | Ga0466959_0009599 | |||
| 1582 | Ga0466959_0099384 | |||
| 1583 | Ga0451576_0073537 | |||
| 1584 | Ga0451576_0820751 | |||
| 1585 | Ga0451576_0887336 | |||
| 1586 | Ga0466958_0738040 | |||
| 1587 | Ga0466967_0133762 | |||
| 1588 | Ga0495603_0121663 | |||
| 1589 | Ga0495653_0599013 | |||
| 1590 | Ga0495650_0007895 | |||
| 1591 | Ga0495580_0277350 | |||
| 1592 | Ga0495583_0000068 | |||
| 1593 | Ga0495583_0018710 | |||
| 1594 | Ga0495583_0027207 | |||
| 1595 | Ga0495644_0196225 | |||
| 1596 | Ga0495648_0047663 | |||
| 1597 | Ga0495663_0174786 | |||
| 1598 | Ga0495598_0010810 | |||
| 1599 | Ga0495598_0057099 | |||
| 1600 | Ga0495621_0002408 | |||
| 1601 | Ga0495597_0093110 | |||
| 1602 | Ga0495645_0217641 | |||
| 1603 | Ga0495645_0283961 | |||
| 1604 | Ga0495645_0374576 | |||
| 1605 | Ga0495633_0335350 | |||
| 1606 | Ga0495656_0028681 | |||
| 1607 | Ga0495656_0363350 | |||
| 1608 | Ga0495588_0038490 | |||
| 1609 | Ga0495647_0132125 | |||
| 1610 | Ga0495671_0232242 | |||
| 1611 | Ga0495636_0009413 | |||
| 1612 | Ga0495636_0091688 | |||
| 1613 | Ga0495675_0254468 | |||
| 1614 | Ga0495685_147382 | |||
| 1615 | Ga0495686_0000966 | |||
| 1616 | Ga0495686_0229440 | |||
| 1617 | Ga0495615_0002005 | |||
| 1618 | Ga0495615_0193523 | |||
| 1619 | Ga0496100_0103680 | |||
| 1620 | Ga0496100_0324819 | |||
| 1621 | Ga0496101_0083441 | |||
| 1622 | Ga0496101_0350098 | |||
| 1623 | Ga0496102_0000216 | |||
| 1624 | Ga0496102_0052125 | |||
| 1625 | Ga0496103_0015874 | |||
| 1626 | Ga0496104_0082388 | |||
| 1627 | Ga0496104_0130275 | |||
| 1628 | Ga0496104_0414213 | |||
| 1629 | Ga0496104_0882855 | |||
| 1630 | Ga0496105_0048545 | |||
| 1631 | Ga0496105_0142303 | |||
| 1632 | Ga0496106_0000057 | |||
| 1633 | Ga0496106_0011505 | |||
| 1634 | Ga0496107_0005426 | |||
| 1635 | Ga0496108_0057358 | |||
| 1636 | Ga0496108_0239564 | |||
| 1637 | Ga0496109_0435561 | |||
| 1638 | Ga0496109_0897725 | |||
| 1639 | Ga0496109_1026064 | |||
| 1640 | Ga0496110_0011826 | |||
| 1641 | Ga0496110_0175512 | |||
| 1642 | Ga0496110_0897203 | |||
| 1643 | Ga0496111_0087142 | |||
| 1644 | Ga0496112_0016366 | |||
| 1645 | Ga0496112_0429701 | |||
| 1646 | Ga0496113_0110383 | |||
| 1647 | Ga0496114_0178506 | |||
| 1648 | Ga0496114_0224626 | |||
| 1649 | Ga0496115_0081281 | |||
| 1650 | Ga0496116_0019804 | |||
| 1651 | Ga0496118_0013944 | |||
| 1652 | Ga0496118_0025276 | |||
| 1653 | Ga0496119_0012281 | |||
| 1654 | Ga0496120_0011376 | |||
| 1655 | Ga0496121_0003909 | |||
| 1656 | Ga0496121_0004489 | |||
| 1657 | Ga0496121_0016560 | |||
| 1658 | Ga0496123_0002852 | |||
| 1659 | Ga0496124_0000046 | |||
| 1660 | Ga0496124_0000317 | |||
| 1661 | Ga0496125_0000011 | |||
| 1662 | Ga0496125_0011492 | |||
| 1663 | Ga0496125_0062439 | |||
| 1664 | Ga0496125_0067841 | |||
| 1665 | Ga0496125_0267706 | |||
| 1666 | Ga0496126_0116147 | |||
| 1667 | Ga0496126_0365992 | |||
| 1668 | Ga0501306_012385 | |||
| 1669 | Ga0501306_015377 | |||
| 1670 | Ga0501308_010486 | |||
| 1671 | Ga0501308_044307 | |||
| 1672 | Ga0501309_009865 | |||
| 1673 | Ga0501309_057578 | |||
| 1674 | Ga0501310_010296 | |||
| 1675 | Ga0501310_018450 | |||
| 1676 | Ga0501341_08531 | |||
| 1677 | Ga0501304_003734 | |||
| 1678 | Ga0501305_066624 | |||
| 1679 | Ga0501307_014905 | |||
| 1680 | Ga0501307_032704 | |||
| 1681 | Ga0501307_041728 | |||
| 1682 | Ga0501312_031289 | |||
| 1683 | Ga0501313_037758 | |||
| 1684 | Ga0501314_019718 | |||
| 1685 | Ga0501314_027688 | |||
| 1686 | Ga0501315_018203 | |||
| 1687 | Ga0501315_039350 | |||
| 1688 | Ga0501316_012293 | |||
| 1689 | Ga0501316_025816 | |||
| 1690 | Ga0501317_037470 | |||
| 1691 | Ga0501318_039302 | |||
| 1692 | Ga0501320_008672 | |||
| 1693 | Ga0501323_058235 | |||
| 1694 | Ga0501324_014023 | |||
| 1695 | Ga0501335_028727 | |||
| 1696 | Ga0501031_0002920 | |||
| 1697 | Ga0501031_0452293 | |||
| 1698 | Ga0501032_0006582 | |||
| 1699 | Ga0501032_0250476 | |||
| 1700 | Ga0501033_0001825 | |||
| 1701 | Ga0501034_0540609 | |||
| 1702 | Ga0501036_0000327 | |||
| 1703 | Ga0501036_0108969 | |||
| 1704 | Ga0501037_0002561 | |||
| 1705 | Ga0501037_0219305 | |||
| 1706 | Ga0501038_0010326 | |||
| 1707 | Ga0501043_0000828 | |||
| 1708 | Ga0501043_0097392 | |||
| 1709 | Ga0501046_0008109 | |||
| 1710 | Ga0501047_0014543 | |||
| 1711 | Ga0501047_0578013 | |||
| 1712 | Ga0501068_0815439 | |||
| 1713 | Ga0501070_0927865 | |||
| 1714 | Ga0501072_0025009 | |||
| 1715 | Ga0501072_0091224 | |||
| 1716 | Ga0501073_0004765 | |||
| 1717 | Ga0501074_0217964 | |||
| 1718 | Ga0501225_0058038 | |||
| 1719 | Ga0501079_0576896 | |||
| 1720 | Ga0501080_0007643 | |||
| 1721 | Ga0501083_0682433 | |||
| 1722 | Ga0501035_0000973 | |||
| 1723 | Ga0501035_0032407 | |||
| 1724 | Ga0501035_0044855 | |||
| 1725 | Ga0501035_0143807 | |||
| 1726 | Ga0501044_0002872 | |||
| 1727 | Ga0501044_0003960 | |||
| 1728 | nmdc:mga00v17_44138_c1 | |||
| 1729 | nmdc:mga00v17_654_c1 | |||
| 1730 | nmdc:mga0k408_105052_c1 | |||
| 1731 | nmdc:mga0k408_215_c1 | |||
| 1732 | nmdc:mga0k408_99758_c1 | |||
| 1733 | nmdc:mga06z11_192670_c1 | |||
| 1734 | nmdc:mga07m45_34541_c1 | |||
| 1735 | nmdc:mga08y16_1403757_c1 | |||
| 1736 | nmdc:mga08y16_387748_c1 | |||
| 1737 | nmdc:mga0n895_384868_c1 | |||
| 1738 | nmdc:mga0rr50_247297_c1 | |||
| 1739 | nmdc:mga0a205_237857_c1 | |||
| 1740 | Ga0500618_006297 | |||
| 1741 | Ga0500590_070224 | |||
| 1742 | Ga0500600_0268815 | |||
| 1743 | Ga0500633_0097174 | |||
| 1744 | Ga0500634_0048967 | |||
| 1745 | Ga0587071_065308 | |||
| 1746 | Ga0466962_0036635 | |||
| 1747 | 2509153378 | |||
| 1748 | 2519458999 | |||
| 1749 | 2585291478 | |||
| 1750 | 2599736590 | |||
| 1751 | 2599744649 | |||
| 1752 | 2599903149 | |||
| 1753 | 2600205990 | |||
| 1754 | 2643862358 | |||
| 1755 | 2643980636 | |||
| 1756 | 2644122063 | |||
| 1757 | 2676742775 | |||
| 1758 | 2735818041 | |||
| 1759 | 2809032047 | |||
| 1760 | 2817261294 | |||
| 1761 | 2817278971 | |||
| 1762 | 2817451305 | |||
| 1763 | 2819631074 | |||
| 1764 | 2855737111 | |||
| 1765 | 2855767821 | |||
| 1766 | 2857538547 | |||
| 1767 | 2857546576 | |||
| 1768 | 2858955804 | |||
| 1769 | 2863424822 | |||
| 1770 | 2870071086 | |||
| 1771 | 2881416652 | |||
| 1772 | 2904571050 | |||
| 1773 | 2904575900 | |||
| 1774 | 2928160113 | |||
| 1775 | 2928168554 | |||
| 1776 | 2928171810 | |||
| 1777 | 2928539963 | |||
| 1778 | 2941481873 | |||
| 1779 | 2981994732 | |||
| 1780 | 641643700 | |||
| 1781 | 642416746 | |||
| 1782 | 643601660 | |||
| 1783 | 8018851450 | |||
| 1784 | 8020811731 | |||
| 1785 | 8020945101 | |||
| 1786 | 8020956862 | |||
| 1787 | 8021122285 | |||
| 1788 | 8039102471 | |||
| 1789 | 8040168858 | |||
| 1790 | 8040174784 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5y63-assembly1.cif.gz_A | crystal structure of enterococcus faecalis ahpc | 0.9577 | 1 | 167 |
| 4xts-assembly2.cif.gz_T | salmonella typhimurium ahpc t43a mutant | 0.9477 | 4 | 168 |
| 3emp-assembly1.cif.gz_D-2 | crystal structure of the s-acetanilide modified form of c165s ahpc | 0.947 | 4 | 167 |
| 4xs6-assembly1.cif.gz_E-2 | salmonella typhimurium ahpc w81f mutant | 0.9465 | 2 | 166 |
| 4xrd-assembly1.cif.gz_C-2 | salmonella typhimurium ahpc w169f mutant | 0.9451 | 2 | 167 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2bmxC00 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.9086 | 1 | 166 | 3.40.30.10 |
| 5ijtA00 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.9049 | 4 | 167 | 3.40.30.10 |
| af_A0A0R4J2P7_61_260_3.40.30.10 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.902 | 1 | 167 | 3.40.30.10 |
| 2bmxC00 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.8931 | 1 | 166 | 3.40.30.10 |
| af_P9WQB7_4_193_3.40.30.10 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.8872 | 2 | 182 | 3.40.30.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7X6U2E3-F1-model_v4 | Alkyl hydroperoxide reductase C (EC 1.11.1.26) (Peroxiredoxin) | 0.9895 | 1 | 140 |
GO:0005829
GO:0006979 GO:0008379 GO:0033554 GO:0042744 GO:0045454 |
| AF-A0A519K0P7-F1-model_v4 | Alkyl hydroperoxide reductase C (EC 1.11.1.26) (Peroxiredoxin) | 0.987 | 1 | 105 |
GO:0005829
GO:0006979 GO:0008379 GO:0033554 GO:0042744 GO:0045454 |
| AF-A0A7X6U2E3-F1-model_v4 | Alkyl hydroperoxide reductase C (EC 1.11.1.26) (Peroxiredoxin) | 0.9825 | 1 | 140 |
GO:0005829
GO:0006979 GO:0008379 GO:0033554 GO:0042744 GO:0045454 |
| AF-A0A3C2E313-F1-model_v4 | Alkyl hydroperoxide reductase C (EC 1.11.1.26) (Peroxiredoxin) | 0.9702 | 66 | 170 |
GO:0005829
GO:0006979 GO:0008379 GO:0033554 GO:0042744 GO:0045454 |
| AF-A0A519K0P7-F1-model_v4 | Alkyl hydroperoxide reductase C (EC 1.11.1.26) (Peroxiredoxin) | 0.9687 | 1 | 105 |
GO:0005829
GO:0006979 GO:0008379 GO:0033554 GO:0042744 GO:0045454 |