F484996

General Info

Members Datasets Scaffolds Average Seq Length
896 402 847 282

Family's Representative Sequence

Representative Sequence 3300002737|JGI25162J39368_1000584|JGI25162J39368_10005846
Length 277
Sequence MKLCGFEVGLDKPLFLIAGPCVVESEQLQMDTAGKLKEITSKLGINFIFKSSFDKANRSSGTSFRGPGMEAGLKILAEVKRQLGVPVLTDVHEYTPMNEVAAVVDVLQTPAFLCRQTDFIQNVARAGKPVNIKKGQFLAPWDMKNVVEKAKAVGNDDIMVCERGASFGYNNLVSDMRSISVMRDTGCPVVFDATHSVQLPGGQGTSSGGQREFVPVLARAAVAVGVAGLFAETHPDPSKALSDGPNAWPLDKMEALLETLLELDQVTKRHQFLEHTL

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2511231002 Polaromonas sp. CF318 Isolate Rhizosphere
3 2547132374 Acidovorax radicis N35 Isolate Unclassified
4 2585428062 Methylibium sp. CF059 Isolate Rhizosphere
5 2588253510 Rhizobacter sp. OV335 Isolate Rhizosphere
6 2643221544 Pelomonas sp. Root1444 Isolate Unclassified
7 2643221570 Acidovorax sp. Root568 Isolate Unclassified
8 2643221585 Pelomonas sp. Root662 Isolate Unclassified
9 2643221596 Acidovorax sp. Root70 Isolate Unclassified
10 2643221609 Acidovorax sp. Root217 Isolate Unclassified
11 2643221611 Acidovorax sp. Root219 Isolate Unclassified
12 2643221628 Variovorax sp. Root318D1 Isolate Unclassified
13 2643221639 Pelomonas sp. Root1217 Isolate Unclassified
14 2643221644 Rhizobacter sp. Root1221 Isolate Unclassified
15 2643221646 Pelomonas sp. Root1237 Isolate Unclassified
16 2643221652 Acidovorax sp. Root402 Isolate Unclassified
17 2643221656 Pelomonas sp. Root405 Isolate Unclassified
18 2643221660 Methylibium sp. Root1272 Isolate Unclassified
19 2643221683 Variovorax sp. Root473 Isolate Unclassified
20 2643221717 Acidovorax sp. Root267 Isolate Unclassified
21 2721755523 Delftia sp. HK171 Isolate Unclassified
22 2738541337 Pelomonas sp. BT06 Isolate Unclassified
23 2738543012 Acidovorax sp. CF301 Isolate Unclassified
24 2738543013 Variovorax sp. BT01 Isolate Unclassified
25 2808606418 Herbaspirillum sp. SJZ107 Isolate Rhizosphere
26 2816332133 Acidovorax radicis 2721A Isolate Unclassified
27 2834641062 Cupriavidus gilardii JZ4 Isolate Unclassified
28 2839138175 Delftia acidovorans B15 Isolate Rhizosphere
29 2842677519 Variovorax sp. R-72495 Isolate Unclassified
30 2842718218 Acidovorax sp. R-73343 Isolate Unclassified
31 2842733646 Variovorax sp. R-72446 Isolate Unclassified
32 2842747753 Variovorax sp. R-72060 Isolate Unclassified
33 2885192300 Variovorax sp. MHTC-1 Isolate Rhizosphere
34 2894023352 Diaphorobacter ruginosibacter DSM 27467 Isolate Nodule
35 2904434214 Robbsia andropogonis 1567 Isolate Rhizosphere
36 2904449895 Variovorax sp. 1763 Isolate Rhizosphere
37 2904456579 Variovorax sp. 2002 Isolate Unclassified
38 2919462493 Variovorax sp. 3319 Isolate Rhizosphere
39 2919704043 Hydrogenophaga palleronii 4249 Isolate Unclassified
40 2928115317 Pseudacidovorax sp. 1753 Isolate Rhizosphere
41 2929520902 Variovorax beijingensis 502 Isolate Unclassified
42 2932422444 Comamonas sp. 4034 Isolate Rhizosphere
43 2939631187 Ottowia thiooxydans 2709 Isolate Rhizosphere
44 2945909444 Variovorax sp. CRF3-Va-1 W1I1 Isolate Rhizosphere
45 2945945610 Variovorax paradoxus W1I18 Isolate Rhizosphere
46 2945972063 Variovorax paradoxus W2I8 Isolate Rhizosphere
47 2945984333 Variovorax sp. W2I14 Isolate Rhizosphere
48 2954767861 Variovorax sp. TBS-050B Isolate Rhizosphere
49 2990710928 Acidovorax delafieldii SLBN-75 Isolate Rhizosphere
50 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
51 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
52 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
53 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
54 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
55 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
56 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
57 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
58 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
59 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
60 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
61 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
62 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
63 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
64 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
65 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
66 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
67 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
68 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
69 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
70 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
71 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
72 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
73 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
74 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
75 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
76 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
77 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
78 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
79 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
80 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
81 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
82 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
83 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
84 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
85 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
86 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
87 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
88 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
89 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
90 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
91 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
92 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
93 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
94 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
95 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
96 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
97 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
98 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
99 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
100 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
101 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
102 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
103 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
104 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
105 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
106 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
107 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
108 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
109 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
110 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
111 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
112 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
113 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
114 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
115 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
116 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
117 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
118 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
119 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
120 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
121 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
122 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
123 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
124 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
125 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
126 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
127 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
128 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
129 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
130 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
131 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
132 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
133 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
134 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
135 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
136 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
137 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
138 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
139 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
140 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
141 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
142 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
143 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
144 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
145 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
146 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
147 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
148 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
149 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
150 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
151 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
152 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
153 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
154 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
155 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
156 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
157 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
158 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
159 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
160 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
161 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
162 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
163 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
164 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
165 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
166 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
167 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
168 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
169 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
170 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
171 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
172 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
173 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
174 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
175 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
176 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
177 3300015683 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 Metagenome Rhizosphere
178 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
179 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
180 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
181 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
182 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
183 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
184 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
185 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
186 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
187 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
188 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
189 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
190 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
191 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
192 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
193 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
194 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
195 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
196 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
197 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
198 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
199 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
200 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
201 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
223 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
224 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
225 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
226 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
227 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
228 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
229 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
230 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
231 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
232 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
233 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
234 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
235 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
236 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
237 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
238 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
239 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
240 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
241 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
242 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
243 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
244 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
245 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
246 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
247 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
248 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
249 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
250 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
251 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
252 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
253 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
254 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
255 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
256 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
257 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
258 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
259 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
260 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
261 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
262 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
263 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
264 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
265 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
266 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
267 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
268 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
269 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
270 3300030734 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 Metagenome Rhizosphere
271 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
272 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
273 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
274 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
275 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
276 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
277 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
278 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
279 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
280 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
281 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
282 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
283 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
284 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
285 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
286 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
287 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
288 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
289 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
290 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
291 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
292 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
293 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
294 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
295 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
296 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
297 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
298 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
299 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
300 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
301 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
302 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
303 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
304 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
305 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
306 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
307 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
308 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
309 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
310 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
311 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
312 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
313 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
314 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
315 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
316 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
317 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
318 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
319 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
320 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
321 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
322 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
323 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
324 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
325 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
326 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
327 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
328 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
329 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
330 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
331 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
332 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
333 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
334 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
335 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
336 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
337 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
338 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
339 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
340 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
341 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
342 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
343 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
344 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
345 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
346 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
347 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
348 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
349 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
350 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
351 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
352 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
353 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
354 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
355 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
356 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
357 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
358 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
359 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
360 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
361 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
362 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
363 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
364 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
365 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
366 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
367 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
368 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
369 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
370 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
371 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
372 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
373 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
374 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
375 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
376 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
377 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
378 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
379 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
380 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
381 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
382 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
383 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
384 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
385 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
386 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
387 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
388 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
389 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
390 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
391 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
392 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
393 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
394 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
395 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
396 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
397 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
398 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
399 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
400 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
401 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
402 8003400568 Cupriavidus gilardii USM5 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.42
Metatranscriptomes 0.11
Isolates 5.47

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 15.96
Nodule 1
Rhizoplane 2.57
Rhizosphere 69.75
Stem 0
Stem Tuber 0
Unclassified 10.71

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_2165666 2162886007 Bacteria 1478
2 JGI24739J22299_10013960 3300001989 Bacteria 2925
3 JGI25155J39150_1000079 3300002704 Bacteria 56287
4 JGI25156J39149_1000125 3300002705 Bacteria 56308
5 JGI25162J39368_1000584 3300002737 Bacteria 26712
6 JGI25154J39366_1000141 3300002738 Bacteria 56305
7 JGI25157J39369_1000159 3300002741 Bacteria 56308
8 JGI25157J39369_1001620 3300002741 Bacteria 7791
9 JGI25163J39215_1000159 3300002771 Bacteria 26694
10 JGI25164J39214_1000028 3300002772 Bacteria 150310
11 JGI25150J39212_1001816 3300002774 Bacteria 5662
12 JGI25159J45721_1000098 3300002987 Bacteria 41673
13 JGI25159J45721_1006959 3300002987 Bacteria 3306
14 JGI25151J46595_10015062 3300003187 Bacteria 3427
15 JGI25151J46595_10017307 3300003187 Bacteria 3130
16 JGI25151J46595_10021076 3300003187 Bacteria 2735
17 JGI25151J46595_10026635 3300003187 Bacteria 2329
18 JGI25165J46597_1000108 3300003214 Bacteria 150310
19 rootL2_10017768 3300003322 Bacteria 1581
20 JGI25160J50197_1000067 3300003354 Bacteria 113436
21 JGI25161J50226_1000035 3300003374 Bacteria 133666
22 Ga0006562J51391_1072863 3300003578 Bacteria 3470
23 Ga0055538_1001470 3300003751 Bacteria 4493
24 Ga0055525_1000011 3300003759 Bacteria 503124
25 Ga0055535_1000976 3300003761 Bacteria 18665
26 Ga0055542_1000691 3300003762 Bacteria 26712
27 Ga0055529_1000078 3300003763 Bacteria 150310
28 Ga0055526_1012424 3300003771 Bacteria 3717
29 Ga0055526_1014166 3300003771 Bacteria 3304
30 Ga0055537_1000490 3300003773 Bacteria 24227
31 Ga0055537_1001225 3300003773 Bacteria 10779
32 Ga0055537_1008939 3300003773 Bacteria 2258
33 Ga0055524_1000006 3300003775 Bacteria 324702
34 Ga0055524_1000080 3300003775 Bacteria 120203
35 Ga0055536_1000447 3300003781 Bacteria 29029
36 Ga0055536_1011365 3300003781 Bacteria 3421
37 Ga0055534_1000042 3300003784 Bacteria 99433
38 Ga0055534_1007760 3300003784 Bacteria 2513
39 Ga0055528_1000242 3300003790 Bacteria 45905
40 Ga0055528_1025062 3300003790 Bacteria 1766
41 Ga0055530_10000154 3300003791 Bacteria 61878
42 Ga0055530_10018003 3300003791 Bacteria 2194
43 Ga0055540_1000002 3300003792 Bacteria 436954
44 Ga0055540_1000005 3300003792 Bacteria 378126
45 Ga0055540_1002002 3300003792 Bacteria 11371
46 Ga0055540_1009923 3300003792 Bacteria 3221
47 Ga0055531_10000607 3300003794 Bacteria 31111
48 Ga0055531_10004641 3300003794 Bacteria 8250
49 Ga0055543_1001234 3300004625 Bacteria 10671
50 Ga0065165_1018365 3300005262 Bacteria 2533
51 Ga0065165_1025665 3300005262 Bacteria 1954
52 Ga0065165_1034706 3300005262 Bacteria 1557
53 Ga0065165_1038846 3300005262 Bacteria 1431
54 Ga0065714_10005692 3300005288 Bacteria 5083
55 Ga0065714_10009585 3300005288 Bacteria 3638
56 Ga0065704_10078204 3300005289 Bacteria 4499
57 Ga0065712_10096751 3300005290 Bacteria 2173
58 Ga0070658_10295950 3300005327 Bacteria 1380
59 Ga0070676_10051123 3300005328 Bacteria 2425
60 Ga0070676_10074266 3300005328 Bacteria 2047
61 Ga0070676_10230831 3300005328 Bacteria 1227
62 Ga0070683_100144544 3300005329 Bacteria 2253
63 Ga0070683_100195668 3300005329 Bacteria 1919
64 Ga0070670_100001820 3300005331 Bacteria 17371
65 Ga0070670_100016116 3300005331 Bacteria 6414
66 Ga0070670_100133748 3300005331 Bacteria 2142
67 Ga0070670_100182630 3300005331 Bacteria 1821
68 Ga0070670_100203386 3300005331 Bacteria 1721
69 Ga0070670_100428261 3300005331 Bacteria 1170
70 Ga0070677_10001548 3300005333 Bacteria 7279
71 Ga0070677_10064149 3300005333 Bacteria 1524
72 Ga0070677_10162993 3300005333 Bacteria 1048
73 Ga0068869_100004736 3300005334 Bacteria 8487
74 Ga0068869_100094453 3300005334 Bacteria 2254
75 Ga0068869_100099494 3300005334 Bacteria 2198
76 Ga0068869_100184867 3300005334 Bacteria 1635
77 Ga0068869_100224294 3300005334 Bacteria 1491
78 Ga0068869_100230330 3300005334 Bacteria 1472
79 Ga0070666_10043187 3300005335 Bacteria 3018
80 Ga0070680_100001873 3300005336 Bacteria 15421
81 Ga0070680_100098893 3300005336 Bacteria 2421
82 Ga0070682_100013288 3300005337 Bacteria 4735
83 Ga0068868_100019821 3300005338 Bacteria 5045
84 Ga0068868_100038602 3300005338 Bacteria 3707
85 Ga0068868_100044804 3300005338 Bacteria 3459
86 Ga0068868_100223448 3300005338 Bacteria 1577
87 Ga0070660_100087926 3300005339 Bacteria 2446
88 Ga0070689_100034512 3300005340 Bacteria 3860
89 Ga0070661_100001206 3300005344 Bacteria 18196
90 Ga0070661_100070089 3300005344 Bacteria 2578
91 Ga0070661_100134856 3300005344 Bacteria 1857
92 Ga0070661_100141366 3300005344 Bacteria 1814
93 Ga0070668_100009291 3300005347 Bacteria 7292
94 Ga0070668_100152483 3300005347 Bacteria 1870
95 Ga0070669_100021681 3300005353 Bacteria 4591
96 Ga0070669_100035355 3300005353 Bacteria 3619
97 Ga0070669_100056517 3300005353 Bacteria 2877
98 Ga0070669_100074542 3300005353 Bacteria 2516
99 Ga0070669_100248588 3300005353 Bacteria 1415
100 Ga0070669_100304978 3300005353 Bacteria 1282
101 Ga0070675_100005184 3300005354 Bacteria 9937
102 Ga0070675_100017625 3300005354 Bacteria 5678
103 Ga0070675_100019867 3300005354 Bacteria 5359
104 Ga0070675_100047712 3300005354 Bacteria 3510
105 Ga0070675_100140465 3300005354 Bacteria 2064
106 Ga0070675_100240952 3300005354 Bacteria 1580
107 Ga0070671_100020104 3300005355 Bacteria 5441
108 Ga0070671_100021133 3300005355 Bacteria 5314
109 Ga0070671_100032037 3300005355 Bacteria 4346
110 Ga0070671_100051569 3300005355 Bacteria 3422
111 Ga0070671_100104371 3300005355 Bacteria 2378
112 Ga0070671_100250238 3300005355 Bacteria 1505
113 Ga0070671_100256485 3300005355 Bacteria 1486
114 Ga0070674_100047523 3300005356 Bacteria 2941
115 Ga0070674_100052925 3300005356 Bacteria 2801
116 Ga0070674_100332420 3300005356 Bacteria 1222
117 Ga0070673_100016137 3300005364 Bacteria 5271
118 Ga0070673_100101542 3300005364 Bacteria 2370
119 Ga0070673_100118033 3300005364 Bacteria 2209
120 Ga0070673_100125705 3300005364 Bacteria 2145
121 Ga0070659_100105331 3300005366 Bacteria 2272
122 Ga0070659_100167311 3300005366 Bacteria 1799
123 Ga0070667_100001171 3300005367 Bacteria 23847
124 Ga0070667_100003010 3300005367 Bacteria 14476
125 Ga0070667_100070593 3300005367 Bacteria 2973
126 Ga0070667_100202497 3300005367 Bacteria 1762
127 Ga0070667_100244654 3300005367 Bacteria 1603
128 Ga0070667_100253932 3300005367 Bacteria 1572
129 Ga0070700_100121960 3300005441 Bacteria 1748
130 Ga0070663_100043641 3300005455 Bacteria 3156
131 Ga0070663_100288266 3300005455 Bacteria 1310
132 Ga0070663_100395556 3300005455 Bacteria 1128
133 Ga0070678_100001334 3300005456 Bacteria 13117
134 Ga0070678_100009607 3300005456 Bacteria 5871
135 Ga0070678_100119544 3300005456 Bacteria 2075
136 Ga0070678_100376883 3300005456 Bacteria 1227
137 Ga0070662_100010471 3300005457 Bacteria 6087
138 Ga0070662_100026458 3300005457 Bacteria 4018
139 Ga0070662_100042844 3300005457 Bacteria 3235
140 Ga0070662_100057864 3300005457 Bacteria 2818
141 Ga0070662_100118656 3300005457 Bacteria 2025
142 Ga0070662_100177172 3300005457 Bacteria 1679
143 Ga0070662_100264095 3300005457 Bacteria 1388
144 Ga0068867_100000815 3300005459 Bacteria 21046
145 Ga0068867_100002971 3300005459 Bacteria 11946
146 Ga0068867_100019006 3300005459 Bacteria 4892
147 Ga0068867_100025400 3300005459 Bacteria 4250
148 Ga0068867_100030023 3300005459 Bacteria 3920
149 Ga0068867_100157367 3300005459 Bacteria 1790
150 Ga0068867_100382539 3300005459 Bacteria 1182
151 Ga0070706_100003926 3300005467 Bacteria 14492
152 Ga0070707_100206103 3300005468 Bacteria 1916
153 Ga0070679_100032769 3300005530 Bacteria 5142
154 Ga0070679_100257989 3300005530 Bacteria 1698
155 Ga0070684_100077908 3300005535 Bacteria 2928
156 Ga0068853_100046481 3300005539 Bacteria 3722
157 Ga0068853_100108827 3300005539 Bacteria 2459
158 Ga0070672_100002062 3300005543 Bacteria 12665
159 Ga0070672_100010713 3300005543 Bacteria 6369
160 Ga0070672_100055349 3300005543 Bacteria 3107
161 Ga0070672_100094795 3300005543 Bacteria 2413
162 Ga0070672_100127067 3300005543 Bacteria 2092
163 Ga0070672_100208158 3300005543 Bacteria 1637
164 Ga0070693_100135876 3300005547 Bacteria 1542
165 Ga0068855_100010968 3300005563 Bacteria 10935
166 Ga0068855_100242662 3300005563 Bacteria 2012
167 Ga0068855_100245701 3300005563 Bacteria 1998
168 Ga0070664_100071398 3300005564 Bacteria 2975
169 Ga0070664_100133510 3300005564 Bacteria 2181
170 Ga0070664_100311042 3300005564 Bacteria 1425
171 Ga0070664_100444546 3300005564 Bacteria 1189
172 Ga0068857_100123879 3300005577 Bacteria 2329
173 Ga0068857_100190795 3300005577 Bacteria 1866
174 Ga0068857_100200631 3300005577 Bacteria 1818
175 Ga0068854_100043894 3300005578 Bacteria 3171
176 Ga0068856_100034780 3300005614 Bacteria 4936
177 Ga0068856_100298390 3300005614 Bacteria 1629
178 Ga0068856_100553496 3300005614 Bacteria 1171
179 Ga0070702_100097362 3300005615 Bacteria 1797
180 Ga0070702_100271548 3300005615 Bacteria 1160
181 Ga0068852_100012899 3300005616 Bacteria 6371
182 Ga0068852_100096174 3300005616 Bacteria 2661
183 Ga0068852_100102065 3300005616 Bacteria 2591
184 Ga0068852_100222779 3300005616 Bacteria 1794
185 Ga0068852_100348988 3300005616 Bacteria 1444
186 Ga0068852_100514681 3300005616 Bacteria 1193
187 Ga0068859_100002636 3300005617 Bacteria 18245
188 Ga0068859_100094634 3300005617 Bacteria 3040
189 Ga0068859_100187823 3300005617 Bacteria 2150
190 Ga0068864_100020879 3300005618 Bacteria 5482
191 Ga0068864_100040062 3300005618 Bacteria 4007
192 Ga0068864_100058859 3300005618 Bacteria 3322
193 Ga0068864_100091754 3300005618 Bacteria 2680
194 Ga0068864_100169549 3300005618 Bacteria 1989
195 Ga0068864_100181318 3300005618 Bacteria 1925
196 Ga0068864_100221315 3300005618 Bacteria 1746
197 Ga0068864_100289355 3300005618 Bacteria 1531
198 Ga0068861_100005018 3300005719 Bacteria 8924
199 Ga0068861_100045628 3300005719 Bacteria 3301
200 Ga0068861_100211756 3300005719 Bacteria 1633
201 Ga0068851_10049114 3300005834 Bacteria 2139
202 Ga0068851_10119189 3300005834 Bacteria 1416
203 Ga0068870_10045754 3300005840 Bacteria 2293
204 Ga0068863_100044253 3300005841 Bacteria 4226
205 Ga0068863_100077587 3300005841 Bacteria 3144
206 Ga0068863_100118573 3300005841 Bacteria 2522
207 Ga0068863_100122546 3300005841 Bacteria 2480
208 Ga0068863_100186160 3300005841 Bacteria 1994
209 Ga0068858_100033970 3300005842 Bacteria 4731
210 Ga0068858_100086630 3300005842 Bacteria 2913
211 Ga0068860_100001433 3300005843 Bacteria 25834
212 Ga0068860_100002888 3300005843 Bacteria 17820
213 Ga0068860_100086627 3300005843 Bacteria 2981
214 Ga0068862_100073189 3300005844 Bacteria 2961
215 Ga0068862_100085473 3300005844 Bacteria 2741
216 Ga0075365_10034142 3300006038 Bacteria 3284
217 Ga0075363_100027625 3300006048 Bacteria 2911
218 Ga0075363_100049080 3300006048 Bacteria 2246
219 Ga0075363_100075231 3300006048 Bacteria 1840
220 Ga0075363_100130981 3300006048 Bacteria 1406
221 Ga0075364_10036978 3300006051 Bacteria 3159
222 Ga0075432_10015651 3300006058 Bacteria 2587
223 Ga0075362_10034752 3300006177 Bacteria 2198
224 Ga0075362_10036357 3300006177 Bacteria 2154
225 Ga0075362_10058139 3300006177 Bacteria 1744
226 Ga0075362_10104534 3300006177 Bacteria 1327
227 Ga0075367_10020509 3300006178 Bacteria 3682
228 Ga0075367_10021504 3300006178 Bacteria 3606
229 Ga0075367_10055062 3300006178 Bacteria 2359
230 Ga0075366_10004084 3300006195 Bacteria 7804
231 Ga0075366_10010236 3300006195 Bacteria 5261
232 Ga0075366_10032117 3300006195 Bacteria 3090
233 Ga0075366_10036620 3300006195 Bacteria 2893
234 Ga0075366_10037483 3300006195 Bacteria 2863
235 Ga0075366_10048963 3300006195 Bacteria 2507
236 Ga0075366_10073530 3300006195 Bacteria 2038
237 Ga0075366_10079616 3300006195 Bacteria 1956
238 Ga0097621_100059305 3300006237 Bacteria 3133
239 Ga0097621_100078866 3300006237 Bacteria 2736
240 Ga0097621_100084493 3300006237 Bacteria 2646
241 Ga0097621_100251520 3300006237 Bacteria 1547
242 Ga0075370_10006682 3300006353 Bacteria 5818
243 Ga0075370_10015610 3300006353 Bacteria 4069
244 Ga0075370_10020892 3300006353 Bacteria 3584
245 Ga0075370_10089462 3300006353 Bacteria 1775
246 Ga0075370_10150175 3300006353 Bacteria 1365
247 Ga0068871_100040812 3300006358 Bacteria 3718
248 Ga0068871_100078969 3300006358 Bacteria 2722
249 Ga0068871_100226750 3300006358 Bacteria 1620
250 Ga0075430_100090622 3300006846 Bacteria 2558
251 Ga0075430_100113633 3300006846 Bacteria 2257
252 Ga0075429_100004495 3300006880 Bacteria 11996
253 Ga0068865_100130144 3300006881 Bacteria 1884
254 Ga0068865_100206821 3300006881 Bacteria 1527
255 Ga0068865_100213969 3300006881 Bacteria 1503
256 Ga0097620_100002636 3300006931 Bacteria 18245
257 Ga0097620_100094639 3300006931 Bacteria 3040
258 Ga0097620_100187829 3300006931 Bacteria 2150
259 Ga0079104_1000002 3300006946 Bacteria 514469
260 Ga0079104_1000017 3300006946 Bacteria 313784
261 Ga0099826_10126482 3300006948 Bacteria 1497
262 Ga0099826_10130715 3300006948 Bacteria 1464
263 Ga0105250_10001691 3300009092 Bacteria 11652
264 Ga0105240_10003241 3300009093 Bacteria 25466
265 Ga0105240_10100781 3300009093 Bacteria 3514
266 Ga0105240_10215679 3300009093 Bacteria 2239
267 Ga0105240_10495046 3300009093 Bacteria 1360
268 Ga0105245_10570985 3300009098 Bacteria 1155
269 Ga0114129_10506345 3300009147 Bacteria 1576
270 Ga0105243_10004697 3300009148 Bacteria 10752
271 Ga0105243_10035673 3300009148 Bacteria 3856
272 Ga0105243_10036120 3300009148 Bacteria 3833
273 Ga0105243_10039925 3300009148 Bacteria 3662
274 Ga0105243_10051142 3300009148 Bacteria 3267
275 Ga0105243_10147809 3300009148 Bacteria 2012
276 Ga0105241_10219704 3300009174 Bacteria 1596
277 Ga0105248_10004383 3300009177 Bacteria 15617
278 Ga0105248_10340666 3300009177 Bacteria 1688
279 Ga0105248_10378942 3300009177 Bacteria 1593
280 Ga0105237_10022934 3300009545 Bacteria 6401
281 Ga0105237_10129037 3300009545 Bacteria 2523
282 Ga0105237_10392414 3300009545 Bacteria 1393
283 Ga0105238_10007213 3300009551 Bacteria 11126
284 Ga0105238_10055568 3300009551 Bacteria 3974
285 Ga0105238_10059028 3300009551 Bacteria 3844
286 Ga0105238_10145211 3300009551 Bacteria 2349
287 Ga0105249_10072632 3300009553 Bacteria 3181
288 Ga0105249_10108902 3300009553 Bacteria 2616
289 Ga0105239_10003789 3300010375 Bacteria 18406
290 Ga0105239_10085101 3300010375 Bacteria 3484
291 Ga0105239_10358062 3300010375 Bacteria 1648
292 Ga0157373_10037135 3300013100 Bacteria 3494
293 Ga0157370_10120358 3300013104 Bacteria 2451
294 Ga0157370_10265804 3300013104 Bacteria 1585
295 Ga0157369_10106740 3300013105 Bacteria 2980
296 Ga0157369_10212493 3300013105 Bacteria 2027
297 Ga0157374_10048034 3300013296 Bacteria 3959
298 Ga0157374_10171718 3300013296 Bacteria 2115
299 Ga0157378_10077966 3300013297 Bacteria 2988
300 Ga0163162_10017076 3300013306 Bacteria 7100
301 Ga0163162_10094494 3300013306 Bacteria 3076
302 Ga0163162_10102728 3300013306 Bacteria 2952
303 Ga0163162_10495827 3300013306 Bacteria 1352
304 Ga0157372_10077049 3300013307 Bacteria 3765
305 Ga0157372_10246431 3300013307 Bacteria 2073
306 Ga0157375_10151253 3300013308 Bacteria 2457
307 Ga0157375_10242243 3300013308 Bacteria 1963
308 Ga0157375_10430043 3300013308 Bacteria 1486
309 Ga0163163_10313942 3300014325 Bacteria 1621
310 Ga0157380_10138554 3300014326 Bacteria 2087
311 Ga0157380_10150634 3300014326 Bacteria 2010
312 Ga0182008_10030116 3300014497 Bacteria 2738
313 Ga0182008_10039803 3300014497 Bacteria 2348
314 Ga0157377_10000382 3300014745 Bacteria 19272
315 Ga0157377_10090589 3300014745 Bacteria 1805
316 Ga0157379_10013894 3300014968 Bacteria 7057
317 Ga0157379_10074533 3300014968 Bacteria 3038
318 Ga0157379_10111962 3300014968 Bacteria 2452
319 Ga0157379_10187678 3300014968 Bacteria 1868
320 Ga0157379_10189108 3300014968 Bacteria 1861
321 Ga0157379_10215996 3300014968 Bacteria 1737
322 Ga0157379_10235205 3300014968 Bacteria 1661
323 Ga0157379_10434370 3300014968 Bacteria 1210
324 Ga0157376_10016007 3300014969 Bacteria 5683
325 Ga0157376_10117911 3300014969 Bacteria 2348
326 Ga0157376_10292907 3300014969 Bacteria 1537
327 Ga0182006_1012764 3300015261 Bacteria 3668
328 Ga0182007_10013133 3300015262 Bacteria 3171
329 Ga0183362_10003 3300015683 Bacteria 977584
330 Ga0163161_10000166 3300017792 Bacteria 60327
331 Ga0163161_10046164 3300017792 Bacteria 3142
332 Ga0163161_10119951 3300017792 Bacteria 1975
333 Ga0163161_10254311 3300017792 Bacteria 1370
334 Ga0213872_10000011 3300021361 Bacteria 194139
335 Ga0213872_10000361 3300021361 Bacteria 38243
336 Ga0213872_10073865 3300021361 Bacteria 1535
337 Ga0213874_10052812 3300021377 Bacteria 1252
338 Ga0209435_100001 3300025206 Bacteria 1424171
339 Ga0209563_100005 3300025230 Bacteria 1774893
340 Ga0207425_1002262 3300025245 Bacteria 6965
341 Ga0207425_1004662 3300025245 Bacteria 4056
342 Ga0209646_1000001 3300025246 Bacteria 3092932
343 Ga0209026_1000003 3300025250 Bacteria 1060571
344 Ga0209759_1000001 3300025256 Bacteria 2799452
345 Ga0209129_1015901 3300025258 Bacteria 1528
346 Ga0209129_1016072 3300025258 Bacteria 1515
347 Ga0209565_1000083 3300025263 Bacteria 154007
348 Ga0209565_1000246 3300025263 Bacteria 57871
349 Ga0209565_1002553 3300025263 Bacteria 6472
350 Ga0209565_1006028 3300025263 Bacteria 3454
351 Ga0209565_1014281 3300025263 Bacteria 1829
352 Ga0209673_1000043 3300025273 Bacteria 291503
353 Ga0209673_1000323 3300025273 Bacteria 87588
354 Ga0209130_1000241 3300025284 Bacteria 70093
355 Ga0209130_1000623 3300025284 Bacteria 33778
356 Ga0209130_1001702 3300025284 Bacteria 13299
357 Ga0209675_1000081 3300025291 Bacteria 154007
358 Ga0209675_1000309 3300025291 Bacteria 44113
359 Ga0209675_1002145 3300025291 Bacteria 10408
360 Ga0209675_1013293 3300025291 Bacteria 2586
361 Ga0209676_1000007 3300025292 Bacteria 1029371
362 Ga0209676_1001036 3300025292 Bacteria 32214
363 Ga0209676_1011543 3300025292 Bacteria 3552
364 Ga0209676_1016039 3300025292 Bacteria 2728
365 Ga0209025_1001296 3300025294 Bacteria 34134
366 Ga0209025_1001745 3300025294 Bacteria 26100
367 Ga0209025_1003641 3300025294 Bacteria 14310
368 Ga0209025_1004965 3300025294 Bacteria 11133
369 Ga0209025_1092425 3300025294 Bacteria 984
370 Ga0209564_1000285 3300025295 Bacteria 102585
371 Ga0209564_1013541 3300025295 Bacteria 3453
372 Ga0209564_1022325 3300025295 Bacteria 2241
373 Ga0209758_1018074 3300025297 Bacteria 3475
374 Ga0209758_1028601 3300025297 Bacteria 2352
375 Ga0209050_1000003 3300025298 Bacteria 1609245
376 Ga0209050_1006287 3300025298 Bacteria 7101
377 Ga0209050_1008094 3300025298 Bacteria 5707
378 Ga0209050_1009215 3300025298 Bacteria 5096
379 Ga0209256_1000001 3300025299 Bacteria 2166974
380 Ga0209256_1000011 3300025299 Bacteria 865309
381 Ga0209256_1022688 3300025299 Bacteria 1893
382 Ga0207426_1000247 3300025302 Bacteria 119659
383 Ga0207426_1011141 3300025302 Bacteria 3445
384 Ga0209051_1000003 3300025303 Bacteria 1609245
385 Ga0209051_1000024 3300025303 Bacteria 437007
386 Ga0209051_1000373 3300025303 Bacteria 64348
387 Ga0209051_1002063 3300025303 Bacteria 15237
388 Ga0209257_1000020 3300025304 Bacteria 773356
389 Ga0209257_1000079 3300025304 Bacteria 316420
390 Ga0207697_10043396 3300025315 Bacteria 1849
391 Ga0207682_10001523 3300025893 Bacteria 10677
392 Ga0207682_10025532 3300025893 Bacteria 2343
393 Ga0207682_10034307 3300025893 Bacteria 2045
394 Ga0207682_10034969 3300025893 Bacteria 2028
395 Ga0207642_10006005 3300025899 Bacteria 4008
396 Ga0207710_10044146 3300025900 Bacteria 1984
397 Ga0207688_10049012 3300025901 Bacteria 2360
398 Ga0207680_10157086 3300025903 Bacteria 1522
399 Ga0207645_10060058 3300025907 Bacteria 2428
400 Ga0207645_10209487 3300025907 Bacteria 1284
401 Ga0207643_10035221 3300025908 Bacteria 2806
402 Ga0207643_10070522 3300025908 Bacteria 2010
403 Ga0207705_10168516 3300025909 Bacteria 1648
404 Ga0207705_10223921 3300025909 Bacteria 1429
405 Ga0207707_10063466 3300025912 Bacteria 3215
406 Ga0207671_10017960 3300025914 Bacteria 5442
407 Ga0207660_10003088 3300025917 Bacteria 10880
408 Ga0207662_10033021 3300025918 Bacteria 3014
409 Ga0207662_10237245 3300025918 Bacteria 1193
410 Ga0207657_10098939 3300025919 Bacteria 2423
411 Ga0207657_10104544 3300025919 Bacteria 2345
412 Ga0207657_10191083 3300025919 Bacteria 1652
413 Ga0207657_10213280 3300025919 Bacteria 1549
414 Ga0207657_10287065 3300025919 Bacteria 1305
415 Ga0207649_10004481 3300025920 Bacteria 7576
416 Ga0207649_10061414 3300025920 Bacteria 2365
417 Ga0207649_10065870 3300025920 Bacteria 2295
418 Ga0207652_10012428 3300025921 Bacteria 6881
419 Ga0207681_10033139 3300025923 Bacteria 3385
420 Ga0207681_10051113 3300025923 Bacteria 2799
421 Ga0207681_10063806 3300025923 Bacteria 2541
422 Ga0207681_10110231 3300025923 Bacteria 2001
423 Ga0207681_10222071 3300025923 Bacteria 1462
424 Ga0207694_10052371 3300025924 Bacteria 3164
425 Ga0207650_10002460 3300025925 Bacteria 12887
426 Ga0207650_10009009 3300025925 Bacteria 6823
427 Ga0207650_10066075 3300025925 Bacteria 2711
428 Ga0207650_10211125 3300025925 Bacteria 1559
429 Ga0207659_10008467 3300025926 Bacteria 6385
430 Ga0207659_10009925 3300025926 Bacteria 5958
431 Ga0207659_10021859 3300025926 Bacteria 4254
432 Ga0207659_10141592 3300025926 Bacteria 1867
433 Ga0207659_10271162 3300025926 Bacteria 1384
434 Ga0207687_10167859 3300025927 Bacteria 1690
435 Ga0207687_10371824 3300025927 Bacteria 1169
436 Ga0207644_10016645 3300025931 Bacteria 4949
437 Ga0207644_10092585 3300025931 Bacteria 2255
438 Ga0207644_10136571 3300025931 Bacteria 1883
439 Ga0207690_10061279 3300025932 Bacteria 2557
440 Ga0207690_10327615 3300025932 Bacteria 1205
441 Ga0207706_10000845 3300025933 Bacteria 31549
442 Ga0207706_10021027 3300025933 Bacteria 5862
443 Ga0207706_10053240 3300025933 Bacteria 3573
444 Ga0207706_10060560 3300025933 Bacteria 3333
445 Ga0207706_10063023 3300025933 Bacteria 3265
446 Ga0207706_10063573 3300025933 Bacteria 3249
447 Ga0207706_10069481 3300025933 Bacteria 3098
448 Ga0207686_10065792 3300025934 Bacteria 2313
449 Ga0207709_10000015 3300025935 Bacteria 493221
450 Ga0207709_10000424 3300025935 Bacteria 40863
451 Ga0207709_10011879 3300025935 Bacteria 4804
452 Ga0207709_10016722 3300025935 Bacteria 4083
453 Ga0207709_10086004 3300025935 Bacteria 2040
454 Ga0207709_10096765 3300025935 Bacteria 1942
455 Ga0207670_10114728 3300025936 Bacteria 1947
456 Ga0207670_10249727 3300025936 Bacteria 1370
457 Ga0207669_10073705 3300025937 Bacteria 2155
458 Ga0207669_10090249 3300025937 Bacteria 1992
459 Ga0207704_10023614 3300025938 Bacteria 3317
460 Ga0207704_10099319 3300025938 Bacteria 1936
461 Ga0207665_10080409 3300025939 Bacteria 2242
462 Ga0207691_10006082 3300025940 Bacteria 11664
463 Ga0207691_10007915 3300025940 Bacteria 10231
464 Ga0207691_10054365 3300025940 Bacteria 3653
465 Ga0207691_10064932 3300025940 Bacteria 3306
466 Ga0207691_10087220 3300025940 Bacteria 2800
467 Ga0207691_10108677 3300025940 Bacteria 2468
468 Ga0207691_10109867 3300025940 Bacteria 2453
469 Ga0207691_10205047 3300025940 Bacteria 1715
470 Ga0207691_10306427 3300025940 Bacteria 1364
471 Ga0207711_10028966 3300025941 Bacteria 4666
472 Ga0207711_10067388 3300025941 Bacteria 3098
473 Ga0207711_10182188 3300025941 Bacteria 1911
474 Ga0207711_10273282 3300025941 Bacteria 1555
475 Ga0207689_10000225 3300025942 Bacteria 50122
476 Ga0207689_10011178 3300025942 Bacteria 7701
477 Ga0207689_10014824 3300025942 Bacteria 6617
478 Ga0207689_10099591 3300025942 Bacteria 2388
479 Ga0207689_10120858 3300025942 Bacteria 2155
480 Ga0207689_10143284 3300025942 Bacteria 1969
481 Ga0207689_10303026 3300025942 Bacteria 1324
482 Ga0207689_10458555 3300025942 Bacteria 1066
483 Ga0207661_10071924 3300025944 Bacteria 2828
484 Ga0207661_10190549 3300025944 Bacteria 1797
485 Ga0207679_10000637 3300025945 Bacteria 23370
486 Ga0207679_10093459 3300025945 Bacteria 2332
487 Ga0207679_10221671 3300025945 Bacteria 1591
488 Ga0207667_10115644 3300025949 Bacteria 2765
489 Ga0207667_10147545 3300025949 Bacteria 2421
490 Ga0207667_10367606 3300025949 Bacteria 1466
491 Ga0207667_10482118 3300025949 Bacteria 1259
492 Ga0207651_10022218 3300025960 Bacteria 3873
493 Ga0207651_10022563 3300025960 Bacteria 3851
494 Ga0207651_10048057 3300025960 Bacteria 2881
495 Ga0207651_10241507 3300025960 Bacteria 1472
496 Ga0207651_10463435 3300025960 Bacteria 1089
497 Ga0207712_10005511 3300025961 Bacteria 7984
498 Ga0207712_10040982 3300025961 Bacteria 3181
499 Ga0207712_10062282 3300025961 Bacteria 2651
500 Ga0207668_10037660 3300025972 Bacteria 3239
501 Ga0207668_10104228 3300025972 Bacteria 2114
502 Ga0207668_10173140 3300025972 Bacteria 1695
503 Ga0207640_10182293 3300025981 Bacteria 1575
504 Ga0207640_10367989 3300025981 Bacteria 1161
505 Ga0207658_10000959 3300025986 Bacteria 23778
506 Ga0207658_10009082 3300025986 Bacteria 6742
507 Ga0207658_10095778 3300025986 Bacteria 2313
508 Ga0207658_10156383 3300025986 Bacteria 1863
509 Ga0207677_10005131 3300026023 Bacteria 7088
510 Ga0207677_10007983 3300026023 Bacteria 5886
511 Ga0207677_10036090 3300026023 Bacteria 3218
512 Ga0207677_10082138 3300026023 Bacteria 2315
513 Ga0207703_10001350 3300026035 Bacteria 22464
514 Ga0207703_10016674 3300026035 Bacteria 5731
515 Ga0207703_10112459 3300026035 Bacteria 2326
516 Ga0207703_10171927 3300026035 Bacteria 1906
517 Ga0207703_10179316 3300026035 Bacteria 1869
518 Ga0207639_10137219 3300026041 Bacteria 2033
519 Ga0207639_10311087 3300026041 Bacteria 1395
520 Ga0207639_10321025 3300026041 Bacteria 1375
521 Ga0207678_10059694 3300026067 Bacteria 3282
522 Ga0207678_10132667 3300026067 Bacteria 2125
523 Ga0207678_10139535 3300026067 Bacteria 2068
524 Ga0207708_10158905 3300026075 Bacteria 1784
525 Ga0207702_10014241 3300026078 Bacteria 6604
526 Ga0207702_10201368 3300026078 Bacteria 1846
527 Ga0207641_10009363 3300026088 Bacteria 8078
528 Ga0207641_10159332 3300026088 Bacteria 2050
529 Ga0207648_10002629 3300026089 Bacteria 19224
530 Ga0207648_10024680 3300026089 Bacteria 5363
531 Ga0207648_10037756 3300026089 Bacteria 4253
532 Ga0207648_10093629 3300026089 Bacteria 2627
533 Ga0207648_10113433 3300026089 Bacteria 2380
534 Ga0207648_10131878 3300026089 Bacteria 2199
535 Ga0207648_10145231 3300026089 Bacteria 2092
536 Ga0207648_10149930 3300026089 Bacteria 2057
537 Ga0207648_10191397 3300026089 Bacteria 1813
538 Ga0207648_10215001 3300026089 Bacteria 1707
539 Ga0207676_10010315 3300026095 Bacteria 6653
540 Ga0207676_10015099 3300026095 Bacteria 5569
541 Ga0207676_10026111 3300026095 Bacteria 4341
542 Ga0207676_10026609 3300026095 Bacteria 4302
543 Ga0207676_10219278 3300026095 Bacteria 1693
544 Ga0207676_10274003 3300026095 Bacteria 1529
545 Ga0207674_10008218 3300026116 Bacteria 12093
546 Ga0207674_10022905 3300026116 Bacteria 6701
547 Ga0207674_10162897 3300026116 Bacteria 2185
548 Ga0207675_100000728 3300026118 Bacteria 32670
549 Ga0207675_100001260 3300026118 Bacteria 25268
550 Ga0207675_100094683 3300026118 Bacteria 2809
551 Ga0207683_10103395 3300026121 Bacteria 2545
552 Ga0207683_10113119 3300026121 Bacteria 2431
553 Ga0207683_10161670 3300026121 Bacteria 2025
554 Ga0207683_10382882 3300026121 Bacteria 1293
555 Ga0207683_10400375 3300026121 Bacteria 1263
556 Ga0207698_10008850 3300026142 Bacteria 6382
557 Ga0207698_10200493 3300026142 Bacteria 1786
558 Ga0207698_10259193 3300026142 Bacteria 1596
559 Ga0207698_10300083 3300026142 Bacteria 1495
560 Ga0207698_10549191 3300026142 Bacteria 1132
561 Ga0209281_1000007 3300027111 Bacteria 938265
562 Ga0209281_1000042 3300027111 Bacteria 344748
563 Ga0209981_1005382 3300027378 Bacteria 1699
564 Ga0209968_1000691 3300027526 Bacteria 5183
565 Ga0209282_1001276 3300027666 Bacteria 13672
566 Ga0209282_1108405 3300027666 Bacteria 1415
567 Ga0209966_1000036 3300027695 Bacteria 55883
568 Ga0209974_10003598 3300027876 Bacteria 5568
569 Ga0209974_10012937 3300027876 Bacteria 2785
570 Ga0268266_10024378 3300028379 Bacteria 5145
571 Ga0268266_10175172 3300028379 Bacteria 1950
572 Ga0268265_10025246 3300028380 Bacteria 4215
573 Ga0268265_10036125 3300028380 Bacteria 3617
574 Ga0268265_10040812 3300028380 Bacteria 3429
575 Ga0268265_10304936 3300028380 Bacteria 1435
576 Ga0268264_10004852 3300028381 Bacteria 11396
577 Ga0268264_10042982 3300028381 Bacteria 3743
578 Ga0268264_10262861 3300028381 Bacteria 1608
579 Ga0265319_1038925 3300028563 Bacteria 1615
580 Ga0307517_10001871 3300028786 Bacteria 34464
581 Ga0307517_10107035 3300028786 Bacteria 2158
582 Ga0307515_10000020 3300028794 Bacteria 411735
583 Ga0307515_10000051 3300028794 Bacteria 272100
584 Ga0307515_10000101 3300028794 Bacteria 199593
585 Ga0307515_10000152 3300028794 Bacteria 167305
586 Ga0307515_10000991 3300028794 Bacteria 64898
587 Ga0307515_10001283 3300028794 Bacteria 57022
588 Ga0307515_10007242 3300028794 Bacteria 21968
589 Ga0307515_10008378 3300028794 Bacteria 20167
590 Ga0307515_10036978 3300028794 Bacteria 7871
591 Ga0307515_10038740 3300028794 Bacteria 7610
592 Ga0307515_10075161 3300028794 Bacteria 4506
593 Ga0307515_10120000 3300028794 Bacteria 2986
594 Ga0307515_10199515 3300028794 Bacteria 1881
595 Ga0307515_10307026 3300028794 Bacteria 1265
596 Ga0307512_10108096 3300030522 Bacteria 1847
597 Ga0307512_10116038 3300030522 Bacteria 1741
598 Ga0316177_1078761 3300030731 Bacteria 2960
599 Ga0314311_1107726 3300030733 Bacteria 1286
600 Ga0316179_1098911 3300030734 Bacteria 1576
601 Ga0316183_1077170 3300030742 Bacteria 6687
602 Ga0316181_1144972 3300030744 Bacteria 7327
603 Ga0316182_1067687 3300030745 Bacteria 2639
604 Ga0316182_1243175 3300030745 Bacteria 2444
605 Ga0265330_10000033 3300031235 Bacteria 126931
606 Ga0265332_10000001 3300031238 Bacteria 863783
607 Ga0265332_10000009 3300031238 Bacteria 295760
608 Ga0265320_10040578 3300031240 Bacteria 2320
609 Ga0265340_10018855 3300031247 Bacteria 3556
610 Ga0265327_10000184 3300031251 Bacteria 133023
611 Ga0265327_10001098 3300031251 Bacteria 37523
612 Ga0265327_10005755 3300031251 Bacteria 10210
613 Ga0265316_10000115 3300031344 Bacteria 86934
614 Ga0307513_10000004 3300031456 Bacteria 558931
615 Ga0307513_10000054 3300031456 Bacteria 148887
616 Ga0307513_10001123 3300031456 Bacteria 38793
617 Ga0307513_10010964 3300031456 Bacteria 11310
618 Ga0307513_10034868 3300031456 Bacteria 5639
619 Ga0307513_10142897 3300031456 Bacteria 2316
620 Ga0307513_10145257 3300031456 Bacteria 2291
621 Ga0307513_10158749 3300031456 Bacteria 2157
622 Ga0307509_10025279 3300031507 Bacteria 6635
623 Ga0307509_10030443 3300031507 Bacteria 5970
624 Ga0307509_10035773 3300031507 Bacteria 5446
625 Ga0307509_10180175 3300031507 Bacteria 1979
626 Ga0307408_100000079 3300031548 Bacteria 108053
627 Ga0307408_100007215 3300031548 Bacteria 7350
628 Ga0307408_100009340 3300031548 Bacteria 6463
629 Ga0307408_100080528 3300031548 Bacteria 2433
630 Ga0307408_100114897 3300031548 Bacteria 2075
631 Ga0307408_100187080 3300031548 Bacteria 1665
632 Ga0307408_100201107 3300031548 Bacteria 1612
633 Ga0307408_100259871 3300031548 Bacteria 1436
634 Ga0307408_100665947 3300031548 Bacteria 932
635 Ga0307508_10000007 3300031616 Bacteria 268359
636 Ga0307508_10000227 3300031616 Bacteria 68533
637 Ga0307508_10038562 3300031616 Bacteria 4293
638 Ga0307514_10001840 3300031649 Bacteria 23499
639 Ga0307514_10011126 3300031649 Bacteria 7491
640 Ga0307514_10062171 3300031649 Bacteria 2841
641 Ga0265314_10000022 3300031711 Bacteria 297299
642 Ga0307516_10000497 3300031730 Bacteria 52295
643 Ga0307516_10004946 3300031730 Bacteria 16201
644 Ga0307516_10012796 3300031730 Bacteria 9011
645 Ga0307516_10014242 3300031730 Bacteria 8424
646 Ga0307516_10016014 3300031730 Bacteria 7860
647 Ga0307516_10056935 3300031730 Bacteria 3810
648 Ga0307516_10181440 3300031730 Bacteria 1838
649 Ga0307516_10314341 3300031730 Bacteria 1239
650 Ga0307405_10047870 3300031731 Bacteria 2634
651 Ga0307405_10140284 3300031731 Bacteria 1684
652 Ga0307405_10328208 3300031731 Bacteria 1171
653 Ga0307413_10023658 3300031824 Bacteria 3332
654 Ga0307406_10013261 3300031901 Bacteria 4718
655 Ga0307406_10064183 3300031901 Bacteria 2382
656 Ga0307406_10229442 3300031901 Bacteria 1385
657 Ga0307406_10334584 3300031901 Bacteria 1177
658 Ga0307412_10034925 3300031911 Bacteria 3207
659 Ga0307412_10067234 3300031911 Bacteria 2432
660 Ga0307412_10085767 3300031911 Bacteria 2189
661 Ga0307412_10086513 3300031911 Bacteria 2181
662 Ga0307409_100021883 3300031995 Bacteria 4395
663 Ga0307416_100002560 3300032002 Bacteria 10494
664 Ga0307416_100615376 3300032002 Bacteria 1167
665 Ga0307414_10296397 3300032004 Bacteria 1366
666 Ga0307415_100027466 3300032126 Bacteria 3606
667 Ga0307510_10026627 3300033180 Bacteria 6642
668 Ga0307510_10111223 3300033180 Bacteria 2480
669 Ga0373959_0005445 3300034820 Bacteria 2087
670 Ga0373932_0086323 3300035112 Bacteria 1000
671 Ga0373939_0000016 3300035114 Bacteria 62934
672 Ga0373946_0071269 3300035171 Bacteria 1502
673 Ga0373931_0000554 3300035691 Bacteria 15366
674 Ga0373931_0016799 3300035691 Bacteria 3608
675 Ga0373931_0017937 3300035691 Bacteria 3510
676 Ga0373947_0149989 3300035725 Bacteria 1501
677 Ga0373937_0028691 3300036401 Bacteria 5037
678 Ga0373925_0007600 3300037068 Bacteria 7895
679 Ga0373925_0327725 3300037068 Bacteria 1240
680 Ga0395899_0015998 3300037312 Bacteria 5721
681 Ga0395899_0066645 3300037312 Bacteria 2643
682 Ga0395900_0000109 3300037418 Bacteria 146053
683 Ga0395900_0010948 3300037418 Bacteria 9276
684 Ga0395900_0104880 3300037418 Bacteria 2904
685 Ga0395900_0163513 3300037418 Bacteria 2269
686 Ga0395898_0000868 3300037466 Bacteria 49428
687 Ga0395898_0016081 3300037466 Bacteria 7665
688 Ga0395898_0184864 3300037466 Bacteria 1991
689 Ga0395905_0000431 3300037471 Bacteria 58717
690 Ga0395905_0001290 3300037471 Bacteria 30783
691 Ga0395905_0008841 3300037471 Bacteria 9898
692 Ga0395905_0009815 3300037471 Bacteria 9330
693 Ga0395905_0013446 3300037471 Bacteria 7843
694 Ga0395905_0016819 3300037471 Bacteria 6948
695 Ga0395905_0097083 3300037471 Bacteria 2766
696 Ga0395905_0108792 3300037471 Bacteria 2602
697 Ga0395901_0035513 3300038443 Bacteria 5150
698 Ga0395901_0066688 3300038443 Bacteria 3749
699 Ga0395901_0184620 3300038443 Bacteria 2187
700 Ga0395901_0348536 3300038443 Bacteria 1528
701 Ga0436361_0296121 3300039447 Bacteria 160237
702 Ga0436361_0416556 3300039447 Bacteria 4615
703 Ga0436361_0667144 3300039447 Bacteria 32170
704 Ga0436361_0932343 3300039447 Bacteria 25287
705 Ga0436361_0953550 3300039447 Bacteria 3924
706 Ga0436361_1028268 3300039447 Bacteria 2011
707 Ga0436361_1033023 3300039447 Bacteria 2767
708 Ga0436363_1441997 3300039450 Bacteria 1766
709 Ga0439436_0006977 3300041404 Bacteria 3473
710 Ga0439439_0052312 3300041406 Bacteria 1072
711 Ga0439465_0010818 3300041413 Bacteria 2863
712 Ga0451800_0898755 3300041459 Bacteria 1258
713 Ga0451807_1161842 3300041486 Bacteria 939
714 Ga0439431_0011306 3300041997 Bacteria 2038
715 Ga0439433_0006439 3300041999 Bacteria 2527
716 Ga0439442_005843 3300042002 Bacteria 2464
717 Ga0439445_0004163 3300042004 Bacteria 3267
718 Ga0439432_000677 3300042006 Bacteria 12757
719 Ga0439449_0000469 3300042007 Bacteria 15091
720 Ga0439449_0000924 3300042007 Bacteria 11444
721 Ga0439449_0002109 3300042007 Bacteria 7806
722 Ga0439452_009127 3300042010 Bacteria 2939
723 Ga0450923_015391 3300042125 Bacteria 1430
724 Ga0450896_012807 3300042133 Bacteria 1189
725 Ga0450908_011224 3300042184 Bacteria 1643
726 Ga0439434_0001859 3300042435 Bacteria 6135
727 Ga0439464_0009524 3300042439 Bacteria 2558
728 Ga0439464_0017013 3300042439 Bacteria 1969
729 Ga0450918_002732 3300042531 Bacteria 3308
730 Ga0450918_005105 3300042531 Bacteria 2366
731 Ga0451577_0002119 3300042876 Bacteria 24405
732 Ga0466969_0000385 3300044656 Bacteria 24302
733 Ga0466969_0019596 3300044656 Bacteria 3514
734 Ga0466969_0050717 3300044656 Bacteria 2045
735 Ga0453683_0091346 3300044673 Bacteria 1909
736 Ga0466965_0057196 3300044683 Bacteria 1943
737 Ga0466965_0065463 3300044683 Bacteria 1821
738 Ga0466966_0009505 3300044684 Bacteria 6437
739 Ga0466961_0002458 3300044693 Bacteria 11494
740 Ga0453684_0050727 3300044712 Bacteria 5453
741 Ga0453684_0174365 3300044712 Bacteria 2531
742 Ga0466971_0042912 3300044719 Bacteria 2032
743 Ga0466971_0064696 3300044719 Bacteria 1656
744 Ga0466959_0077189 3300045049 Bacteria 2404
745 Ga0466959_0197279 3300045049 Bacteria 1402
746 Ga0451576_0003324 3300045051 Bacteria 22289
747 Ga0451576_0168393 3300045051 Bacteria 2286
748 Ga0451576_0616456 3300045051 Bacteria 1140
749 Ga0495592_0000028 3300046454 Bacteria 132590
750 Ga0495603_0162358 3300046455 Bacteria 1296
751 Ga0495629_0166197 3300046459 Bacteria 1532
752 Ga0495580_0046417 3300046472 Bacteria 3082
753 Ga0495620_0023276 3300046515 Bacteria 2965
754 Ga0495632_0055206 3300046519 Bacteria 1945
755 Ga0495632_0073123 3300046519 Bacteria 1644
756 Ga0495654_0079515 3300046530 Bacteria 1540
757 Ga0495654_0093905 3300046530 Bacteria 1389
758 Ga0495587_0069353 3300046536 Bacteria 2053
759 Ga0495597_0025734 3300046542 Bacteria 2708
760 Ga0495597_0027421 3300046542 Bacteria 2611
761 Ga0495667_0182381 3300046559 Bacteria 1347
762 Ga0495656_0000202 3300046615 Bacteria 21338
763 Ga0495656_0042224 3300046615 Bacteria 1909
764 Ga0495656_0069636 3300046615 Bacteria 1559
765 Ga0495625_0005344 3300046660 Bacteria 11761
766 Ga0495625_0013990 3300046660 Bacteria 6426
767 Ga0495599_0160141 3300046678 Bacteria 1391
768 Ga0495658_0083956 3300046683 Bacteria 1874
769 Ga0495658_0106707 3300046683 Bacteria 1679
770 Ga0495658_0139347 3300046683 Bacteria 1482
771 Ga0495658_0203130 3300046683 Bacteria 1236
772 Ga0495649_0035849 3300046694 Bacteria 2727
773 Ga0495649_0203375 3300046694 Bacteria 1028
774 Ga0495660_0124699 3300046810 Bacteria 1299
775 Ga0495687_040301 3300047443 Bacteria 2059
776 Ga0495686_0183357 3300047472 Bacteria 1211
777 Ga0495593_0053969 3300047673 Bacteria 2120
778 Ga0496100_0151999 3300048903 Bacteria 1652
779 Ga0496100_0250119 3300048903 Bacteria 1311
780 Ga0496101_0001014 3300048904 Bacteria 16554
781 Ga0496102_0017154 3300048905 Bacteria 6340
782 Ga0496102_0038214 3300048905 Bacteria 4331
783 Ga0496102_0092470 3300048905 Bacteria 2801
784 Ga0496104_0164500 3300048907 Bacteria 2127
785 Ga0496105_0057169 3300048908 Bacteria 3221
786 Ga0496105_0131760 3300048908 Bacteria 2061
787 Ga0496105_0430180 3300048908 Bacteria 1044
788 Ga0496106_0054602 3300048909 Bacteria 3018
789 Ga0496106_0080771 3300048909 Bacteria 2497
790 Ga0496107_0183594 3300048910 Bacteria 1553
791 Ga0496108_0141293 3300048911 Bacteria 2074
792 Ga0496109_0629257 3300048912 Bacteria 1010
793 Ga0496110_0042297 3300048913 Bacteria 3977
794 Ga0496110_0120261 3300048913 Bacteria 2366
795 Ga0496111_0106565 3300048914 Bacteria 2063
796 Ga0496111_0111522 3300048914 Bacteria 2015
797 Ga0496113_0062969 3300048916 Bacteria 2802
798 Ga0496114_0106832 3300048917 Bacteria 2395
799 Ga0496122_0000985 3300048925 Bacteria 50829
800 Ga0496122_0089547 3300048925 Bacteria 2103
801 Ga0496123_0000656 3300048926 Bacteria 57313
802 Ga0496123_0081490 3300048926 Bacteria 1966
803 Ga0496124_0000317 3300048927 Bacteria 89188
804 Ga0496124_0081933 3300048927 Bacteria 2650
805 Ga0496125_0001040 3300048928 Bacteria 42892
806 Ga0496126_0315896 3300048929 Bacteria 1285
807 Ga0501031_0012766 3300049568 Bacteria 5489
808 Ga0501034_0158146 3300049571 Bacteria 2239
809 Ga0501043_0000004 3300049579 Bacteria 291085
810 Ga0501046_0000016 3300049580 Bacteria 234374
811 Ga0501047_0000012 3300049581 Bacteria 368824
812 Ga0501073_0191128 3300049589 Bacteria 1417
813 Ga0501198_000005 3300049649 Bacteria 156657
814 Ga0501222_000003 3300049662 Bacteria 157406
815 Ga0501262_000797 3300049759 Bacteria 3632
816 Ga0501035_0340835 3300049822 Bacteria 1256
817 nmdc:mga03n38_29940_c1 3300050490 Bacteria 2284
818 nmdc:mga00v17_183511_c1 3300050491 Bacteria 1350
819 nmdc:mga00v17_84012_c1 3300050491 Bacteria 1992
820 nmdc:mga0yw44_292201_c1 3300050492 Bacteria 1091
821 nmdc:mga0k408_156455_c1 3300050493 Bacteria 1357
822 nmdc:mga0k408_162745_c1 3300050493 Bacteria 1330
823 nmdc:mga0k408_23770_c1 3300050493 Bacteria 3461
824 nmdc:mga0k408_41156_c1 3300050493 Bacteria 2660
825 nmdc:mga0k408_52323_c1 3300050493 Bacteria 2367
826 nmdc:mga0k408_56668_c1 3300050493 Bacteria 2275
827 nmdc:mga0k408_80001_c1 3300050493 Bacteria 1912
828 nmdc:mga0k408_85470_c1 3300050493 Bacteria 1852
829 nmdc:mga0k408_9344_c1 3300050493 Bacteria 5283
830 nmdc:mga07m45_134711_c1 3300050496 Bacteria 1430
831 nmdc:mga07m45_14664_c1 3300050496 Bacteria 2470
832 nmdc:mga07m45_2993_c1 3300050496 Bacteria 2508
833 nmdc:mga07m45_60107_c1 3300050496 Bacteria 2151
834 nmdc:mga07m45_73331_c1 3300050496 Bacteria 1949
835 nmdc:mga07m45_898_c1 3300050496 Bacteria 12980
836 nmdc:mga0sz30_3098_c1 3300050516 Bacteria 5961
837 Ga0495601_0135285 3300053077 Bacteria 1607
838 Ga0495595_0181299 3300053084 Bacteria 1044
839 Ga0495619_0088437 3300053085 Bacteria 2095
840 Ga0495619_0230742 3300053085 Bacteria 1282
841 Ga0500651_0122933 3300053093 Bacteria 1574
842 Ga0500652_045576 3300053131 Bacteria 1778
843 Ga0500658_0044731 3300053134 Bacteria 1787
844 Ga0500559_0011048 3300053136 Bacteria 3866
845 Ga0500645_000413 3300053730 Bacteria 29917
846 Ga0590071_000652 3300059421 Bacteria 9845
847 Ga0590075_016697 3300059424 Bacteria 1806

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046678 Ga0495599_0160141 Ga0495599_0160141_274_1128 255
2 3300005355 Ga0070671_100032037 Ga0070671_1000320375 256
3 3300005457 Ga0070662_100057864 Ga0070662_1000578642 256
4 3300009177 Ga0105248_10004383 Ga0105248_100043838 256
5 3300025931 Ga0207644_10136571 Ga0207644_101365712 256
6 3300025933 Ga0207706_10000845 Ga0207706_100008455 256
7 3300041406 Ga0439439_0052312 Ga0439439_0052312_287_1057 256
8 3300048916 Ga0496113_0062969 Ga0496113_0062969_1098_1955 256
9 3300005344 Ga0070661_100001206 Ga0070661_1000012062 257
10 3300025920 Ga0207649_10004481 Ga0207649_100044812 257
11 3300025945 Ga0207679_10000637 Ga0207679_1000063716 257
12 3300005344 Ga0070661_100134856 Ga0070661_1001348562 258
13 3300028563 Ga0265319_1038925 Ga0265319_10389252 258
14 3300031344 Ga0265316_10000115 Ga0265316_1000011570 258
15 3300032004 Ga0307414_10296397 Ga0307414_102963972 258
16 3300034820 Ga0373959_0005445 Ga0373959_0005445_1094_1951 258
17 3300035114 Ga0373939_0000016 Ga0373939_0000016_61120_61977 258
18 3300035691 Ga0373931_0000554 Ga0373931_0000554_9222_10079 258
19 3300039447 Ga0436361_0953550 Ga0436361_0953550_2627_3484 258
20 3300042531 Ga0450918_005105 Ga0450918_005105_966_1823 258
21 3300044712 Ga0453684_0174365 Ga0453684_0174365_320_1177 258
22 3300059421 Ga0590071_000652 Ga0590071_000652_1902_2759 258
23 3300005334 Ga0068869_100230330 Ga0068869_1002303301 259
24 3300005353 Ga0070669_100074542 Ga0070669_1000745422 259
25 3300005441 Ga0070700_100121960 Ga0070700_1001219602 259
26 3300005459 Ga0068867_100025400 Ga0068867_1000254003 259
27 3300005617 Ga0068859_100094634 Ga0068859_1000946343 259
28 3300005843 Ga0068860_100002888 Ga0068860_10000288811 259
29 3300006931 Ga0097620_100094639 Ga0097620_1000946393 259
30 3300009553 Ga0105249_10108902 Ga0105249_101089023 259
31 3300025893 Ga0207682_10034307 Ga0207682_100343072 259
32 3300025923 Ga0207681_10051113 Ga0207681_100511132 259
33 3300025940 Ga0207691_10064932 Ga0207691_100649323 259
34 3300025942 Ga0207689_10143284 Ga0207689_101432843 259
35 3300025961 Ga0207712_10005511 Ga0207712_100055116 259
36 3300026075 Ga0207708_10158905 Ga0207708_101589052 259
37 3300026089 Ga0207648_10037756 Ga0207648_100377563 259
38 3300026118 Ga0207675_100000728 Ga0207675_10000072835 259
39 3300027876 Ga0209974_10003598 Ga0209974_100035983 259
40 3300037418 Ga0395900_0010948 Ga0395900_0010948_6917_7774 259
41 3300037466 Ga0395898_0184864 Ga0395898_0184864_1124_1981 259
42 3300044656 Ga0466969_0050717 Ga0466969_0050717_49_906 259
43 3300005564 Ga0070664_100311042 Ga0070664_1003110422 260
44 3300013297 Ga0157378_10077966 Ga0157378_100779663 260
45 3300014968 Ga0157379_10189108 Ga0157379_101891082 260
46 3300021361 Ga0213872_10000361 Ga0213872_100003616 260
47 3300025932 Ga0207690_10327615 Ga0207690_103276152 260
48 3300025945 Ga0207679_10093459 Ga0207679_100934592 260
49 3300026035 Ga0207703_10171927 Ga0207703_101719272 260
50 3300039447 Ga0436361_0667144 Ga0436361_0667144_6523_7380 260
51 3300042007 Ga0439449_0000469 Ga0439449_0000469_463_1320 260
52 3300031251 Ga0265327_10000184 Ga0265327_10000184113 261
53 3300037068 Ga0373925_0007600 Ga0373925_0007600_5069_5926 261
54 3300046683 Ga0495658_0139347 Ga0495658_0139347_428_1285 261
55 3300003773 Ga0055537_1001225 Ga0055537_100122512 262
56 3300003784 Ga0055534_1007760 Ga0055534_10077602 262
57 3300002987 JGI25159J45721_1006959 JGI25159J45721_10069592 263
58 3300003187 JGI25151J46595_10021076 JGI25151J46595_100210762 263
59 3300003771 Ga0055526_1014166 Ga0055526_10141662 263
60 3300003775 Ga0055524_1000006 Ga0055524_100000669 263
61 3300003781 Ga0055536_1000447 Ga0055536_100044725 263
62 3300003790 Ga0055528_1025062 Ga0055528_10250622 263
63 3300003791 Ga0055530_10000154 Ga0055530_100001542 263
64 3300003792 Ga0055540_1000005 Ga0055540_1000005245 263
65 3300003794 Ga0055531_10000607 Ga0055531_100006079 263
66 3300005719 Ga0068861_100211756 Ga0068861_1002117562 263
67 3300005844 Ga0068862_100085473 Ga0068862_1000854733 263
68 3300025245 Ga0207425_1002262 Ga0207425_10022622 263
69 3300025263 Ga0209565_1000246 Ga0209565_100024661 263
70 3300025273 Ga0209673_1000043 Ga0209673_1000043159 263
71 3300025284 Ga0209130_1000623 Ga0209130_10006232 263
72 3300025291 Ga0209675_1000309 Ga0209675_100030920 263
73 3300025292 Ga0209676_1000007 Ga0209676_1000007454 263
74 3300025294 Ga0209025_1003641 Ga0209025_100364117 263
75 3300025295 Ga0209564_1000285 Ga0209564_10002852 263
76 3300025297 Ga0209758_1028601 Ga0209758_10286012 263
77 3300025298 Ga0209050_1000003 Ga0209050_10000031054 263
78 3300025299 Ga0209256_1000001 Ga0209256_10000011060 263
79 3300025302 Ga0207426_1011141 Ga0207426_10111412 263
80 3300025303 Ga0209051_1000003 Ga0209051_10000031054 263
81 3300025304 Ga0209257_1000020 Ga0209257_1000020454 263
82 3300028380 Ga0268265_10304936 Ga0268265_103049362 263
83 3300031901 Ga0307406_10013261 Ga0307406_100132613 263
84 3300006195 Ga0075366_10073530 Ga0075366_100735303 264
85 3300009093 Ga0105240_10215679 Ga0105240_102156792 264
86 3300041486 Ga0451807_1161842 Ga0451807_1161842_126_920 264
87 3300006846 Ga0075430_100113633 Ga0075430_1001136333 265
88 3300031730 Ga0307516_10181440 Ga0307516_101814402 265
89 3300037471 Ga0395905_0001290 Ga0395905_0001290_23126_23980 265
90 3300038443 Ga0395901_0184620 Ga0395901_0184620_354_1211 266
91 3300042439 Ga0439464_0009524 Ga0439464_0009524_209_1063 267
92 3300014968 Ga0157379_10187678 Ga0157379_101876783 268
93 3300037471 Ga0395905_0097083 Ga0395905_0097083_327_1181 268
94 3300049571 Ga0501034_0158146 Ga0501034_0158146_1337_2194 268
95 3300059424 Ga0590075_016697 Ga0590075_016697_277_1134 268
96 3300031548 Ga0307408_100665947 Ga0307408_1006659471 269
97 3300031731 Ga0307405_10140284 Ga0307405_101402842 269
98 3300039447 Ga0436361_0932343 Ga0436361_0932343_10200_11054 269
99 3300045049 Ga0466959_0197279 Ga0466959_0197279_447_1304 269
100 3300006946 Ga0079104_1000002 Ga0079104_1000002165 270
101 3300009092 Ga0105250_10001691 Ga0105250_1000169110 270
102 3300009148 Ga0105243_10004697 Ga0105243_100046973 270
103 3300025935 Ga0207709_10000015 Ga0207709_10000015160 270
104 3300026023 Ga0207677_10005131 Ga0207677_100051316 270
105 3300027111 Ga0209281_1000007 Ga0209281_1000007383 270
106 3300037418 Ga0395900_0104880 Ga0395900_0104880_839_1696 270
107 3300037471 Ga0395905_0108792 Ga0395905_0108792_809_1666 270
108 3300038443 Ga0395901_0348536 Ga0395901_0348536_601_1458 270
109 3300003771 Ga0055526_1012424 Ga0055526_10124243 271
110 3300025295 Ga0209564_1013541 Ga0209564_10135413 271
111 3300037312 Ga0395899_0015998 Ga0395899_0015998_2310_3164 272
112 3300037312 Ga0395899_0066645 Ga0395899_0066645_1615_2469 272
113 3300037418 Ga0395900_0163513 Ga0395900_0163513_496_1353 272
114 3300037466 Ga0395898_0016081 Ga0395898_0016081_5756_6610 272
115 3300038443 Ga0395901_0035513 Ga0395901_0035513_2563_3417 272
116 3300005455 Ga0070663_100043641 Ga0070663_1000436412 273
117 3300026067 Ga0207678_10059694 Ga0207678_100596942 273
118 3300009174 Ga0105241_10219704 Ga0105241_102197042 274
119 3300009545 Ga0105237_10022934 Ga0105237_100229346 274
120 3300009551 Ga0105238_10007213 Ga0105238_1000721311 274
121 3300010375 Ga0105239_10003789 Ga0105239_100037894 274
122 3300025914 Ga0207671_10017960 Ga0207671_100179604 274
123 3300025935 Ga0207709_10096765 Ga0207709_100967653 274
124 3300028794 Ga0307515_10199515 Ga0307515_101995151 274
125 3300037471 Ga0395905_0013446 Ga0395905_0013446_3971_4828 274
126 3300005364 Ga0070673_100101542 Ga0070673_1001015422 275
127 3300005543 Ga0070672_100127067 Ga0070672_1001270671 275
128 3300025923 Ga0207681_10222071 Ga0207681_102220712 275
129 3300025940 Ga0207691_10108677 Ga0207691_101086773 275
130 3300025960 Ga0207651_10463435 Ga0207651_104634352 275
131 3300045051 Ga0451576_0616456 Ga0451576_0616456_87_944 275
132 3300002737 JGI25162J39368_1000584 JGI25162J39368_10005846 277
133 3300002741 JGI25157J39369_1001620 JGI25157J39369_10016203 277
134 3300002771 JGI25163J39215_1000159 JGI25163J39215_10001596 277
135 3300002772 JGI25164J39214_1000028 JGI25164J39214_10000286 277
136 3300003214 JGI25165J46597_1000108 JGI25165J46597_10001086 277
137 3300003751 Ga0055538_1001470 Ga0055538_10014701 277
138 3300003761 Ga0055535_1000976 Ga0055535_100097611 277
139 3300003762 Ga0055542_1000691 Ga0055542_10006916 277
140 3300003763 Ga0055529_1000078 Ga0055529_10000786 277
141 3300003775 Ga0055524_1000080 Ga0055524_100008069 278
142 3300005262 Ga0065165_1034706 Ga0065165_10347062 278
143 3300025263 Ga0209565_1014281 Ga0209565_10142812 278
144 3300025299 Ga0209256_1000011 Ga0209256_1000011636 278
145 3300026035 Ga0207703_10179316 Ga0207703_101793162 278
146 3300031238 Ga0265332_10000009 Ga0265332_10000009195 278
147 3300035171 Ga0373946_0071269 Ga0373946_0071269_205_1041 278
148 3300048917 Ga0496114_0106832 Ga0496114_0106832_975_1832 278
149 3300006946 Ga0079104_1000017 Ga0079104_1000017201 280
150 3300027111 Ga0209281_1000042 Ga0209281_1000042148 280
151 3300037471 Ga0395905_0000431 Ga0395905_0000431_54716_55573 280
152 iso_pu_bacteria 2547132374 2548500112 280
153 iso_pu_bacteria 2588253510 2588293134 280
154 iso_pu_bacteria 2643221717 2644644568 280
155 iso_pu_bacteria 2808606418 2809144884 280
156 iso_pu_bacteria 2919462493 2919464027 280
157 iso_pu_bacteria 2919704043 2919705121 280
158 iso_pu_bacteria 2945945610 2945946839 280
159 iso_pu_bacteria 2945972063 2945976556 280
160 iso_pu_bacteria 2511231002 2511246406 281
161 iso_pu_bacteria 2585428062 2587755595 281
162 iso_pu_bacteria 2643221544 2643745518 281
163 iso_pu_bacteria 2643221570 2643864848 281
164 iso_pu_bacteria 2643221585 2643935915 281
165 iso_pu_bacteria 2643221596 2643991211 281
166 iso_pu_bacteria 2643221609 2644059892 281
167 iso_pu_bacteria 2643221611 2644074487 281
168 iso_pu_bacteria 2643221628 2644162803 281
169 iso_pu_bacteria 2643221639 2644221380 281
170 iso_pu_bacteria 2643221644 2644245710 281
171 iso_pu_bacteria 2643221646 2644257863 281
172 iso_pu_bacteria 2643221652 2644293916 281
173 iso_pu_bacteria 2643221656 2644317698 281
174 iso_pu_bacteria 2643221660 2644338345 281
175 iso_pu_bacteria 2643221683 2644469192 281
176 iso_pu_bacteria 2721755523 2722882383 281
177 iso_pu_bacteria 2738541337 2739057890 281
178 iso_pu_bacteria 2738543012 2739241417 281
179 iso_pu_bacteria 2738543013 2739249867 281
180 iso_pu_bacteria 2816332133 2816473581 281
181 iso_pu_bacteria 2834641062 2834641820 281
182 iso_pu_bacteria 2839138175 2839142148 281
183 iso_pu_bacteria 2842677519 2842682591 281
184 iso_pu_bacteria 2842718218 2842719024 281
185 iso_pu_bacteria 2842733646 2842735310 281
186 iso_pu_bacteria 2842747753 2842749079 281
187 iso_pu_bacteria 2885192300 2885196176 281
188 iso_pu_bacteria 2894023352 2894024525 281
189 iso_pu_bacteria 2904449895 2904454841 281
190 iso_pu_bacteria 2904456579 2904462586 281
191 iso_pu_bacteria 2928115317 2928119235 281
192 iso_pu_bacteria 2929520902 2929523876 281
193 iso_pu_bacteria 2932422444 2932425100 281
194 iso_pu_bacteria 2939631187 2939635662 281
195 iso_pu_bacteria 2945909444 2945913058 281
196 iso_pu_bacteria 2945984333 2945984658 281
197 iso_pu_bacteria 2954767861 2954771589 281
198 iso_pu_bacteria 2990710928 2990711707 281
199 iso_pu_bacteria 8003400568 8003404636 281
200 3300039447 Ga0436361_1028268 Ga0436361_1028268_276_1127 283
201 3300049589 Ga0501073_0191128 Ga0501073_0191128_485_1336 283
202 iso_pu_bacteria 2904434214 2904438027 283
203 3300003773 Ga0055537_1000490 Ga0055537_100049018 284
204 3300003784 Ga0055534_1000042 Ga0055534_100004279 284
205 3300003790 Ga0055528_1000242 Ga0055528_100024234 284
206 3300005331 Ga0070670_100203386 Ga0070670_1002033862 284
207 3300006048 Ga0075363_100049080 Ga0075363_1000490802 284
208 3300006195 Ga0075366_10032117 Ga0075366_100321172 284
209 3300006353 Ga0075370_10006682 Ga0075370_100066827 284
210 3300025263 Ga0209565_1000083 Ga0209565_100008380 284
211 3300025273 Ga0209673_1000323 Ga0209673_100032377 284
212 3300025291 Ga0209675_1000081 Ga0209675_100008180 284
213 3300025942 Ga0207689_10303026 Ga0207689_103030262 284
214 3300027666 Ga0209282_1001276 Ga0209282_10012763 284
215 3300028794 Ga0307515_10001283 Ga0307515_1000128325 284
216 3300031456 Ga0307513_10034868 Ga0307513_100348682 284
217 3300031548 Ga0307408_100007215 Ga0307408_1000072153 284
218 3300031649 Ga0307514_10001840 Ga0307514_100018402 284
219 3300031730 Ga0307516_10056935 Ga0307516_100569352 284
220 3300031911 Ga0307412_10034925 Ga0307412_100349252 284
221 3300041404 Ga0439436_0006977 Ga0439436_0006977_854_1708 284
222 3300042007 Ga0439449_0002109 Ga0439449_0002109_6488_7342 284
223 3300042184 Ga0450908_011224 Ga0450908_011224_685_1539 284
224 3300044683 Ga0466965_0057196 Ga0466965_0057196_552_1406 284
225 3300046615 Ga0495656_0069636 Ga0495656_0069636_254_1108 284
226 3300048913 Ga0496110_0120261 Ga0496110_0120261_1366_2220 284
227 3300050496 nmdc:mga07m45_898_c1 nmdc:mga07m45_898_c1_3376_4230 284
228 2162886007 SwRhRL2b_contig_2165666 SwRhRL2b_0062.00001360 285
229 3300001989 JGI24739J22299_10013960 JGI24739J22299_100139603 285
230 3300002704 JGI25155J39150_1000079 JGI25155J39150_100007940 285
231 3300002705 JGI25156J39149_1000125 JGI25156J39149_100012540 285
232 3300002738 JGI25154J39366_1000141 JGI25154J39366_100014114 285
233 3300002741 JGI25157J39369_1000159 JGI25157J39369_100015940 285
234 3300002774 JGI25150J39212_1001816 JGI25150J39212_10018166 285
235 3300002987 JGI25159J45721_1000098 JGI25159J45721_10000982 285
236 3300003187 JGI25151J46595_10015062 JGI25151J46595_100150623 285
237 3300003187 JGI25151J46595_10017307 JGI25151J46595_100173073 285
238 3300003187 JGI25151J46595_10026635 JGI25151J46595_100266352 285
239 3300003322 rootL2_10017768 rootL2_100177683 285
240 3300003354 JGI25160J50197_1000067 JGI25160J50197_100006772 285
241 3300003374 JGI25161J50226_1000035 JGI25161J50226_100003593 285
242 3300003578 Ga0006562J51391_1072863 Ga0006562J51391_10728632 285
243 3300003759 Ga0055525_1000011 Ga0055525_10000112 285
244 3300003773 Ga0055537_1008939 Ga0055537_10089393 285
245 3300003781 Ga0055536_1011365 Ga0055536_10113652 285
246 3300003791 Ga0055530_10018003 Ga0055530_100180032 285
247 3300003792 Ga0055540_1000002 Ga0055540_1000002252 285
248 3300003792 Ga0055540_1002002 Ga0055540_100200213 285
249 3300003792 Ga0055540_1009923 Ga0055540_10099232 285
250 3300003794 Ga0055531_10004641 Ga0055531_100046418 285
251 3300004625 Ga0055543_1001234 Ga0055543_10012343 285
252 3300005262 Ga0065165_1018365 Ga0065165_10183651 285
253 3300005262 Ga0065165_1025665 Ga0065165_10256651 285
254 3300005262 Ga0065165_1038846 Ga0065165_10388462 285
255 3300005288 Ga0065714_10005692 Ga0065714_100056925 285
256 3300005288 Ga0065714_10009585 Ga0065714_100095853 285
257 3300005289 Ga0065704_10078204 Ga0065704_100782043 285
258 3300005290 Ga0065712_10096751 Ga0065712_100967512 285
259 3300005327 Ga0070658_10295950 Ga0070658_102959501 285
260 3300005328 Ga0070676_10051123 Ga0070676_100511232 285
261 3300005328 Ga0070676_10074266 Ga0070676_100742662 285
262 3300005328 Ga0070676_10230831 Ga0070676_102308312 285
263 3300005329 Ga0070683_100144544 Ga0070683_1001445442 285
264 3300005329 Ga0070683_100195668 Ga0070683_1001956682 285
265 3300005331 Ga0070670_100001820 Ga0070670_1000018202 285
266 3300005331 Ga0070670_100016116 Ga0070670_1000161167 285
267 3300005331 Ga0070670_100133748 Ga0070670_1001337482 285
268 3300005331 Ga0070670_100182630 Ga0070670_1001826302 285
269 3300005331 Ga0070670_100428261 Ga0070670_1004282612 285
270 3300005333 Ga0070677_10001548 Ga0070677_100015489 285
271 3300005333 Ga0070677_10064149 Ga0070677_100641492 285
272 3300005333 Ga0070677_10162993 Ga0070677_101629931 285
273 3300005334 Ga0068869_100004736 Ga0068869_1000047364 285
274 3300005334 Ga0068869_100094453 Ga0068869_1000944532 285
275 3300005334 Ga0068869_100099494 Ga0068869_1000994942 285
276 3300005334 Ga0068869_100184867 Ga0068869_1001848672 285
277 3300005334 Ga0068869_100224294 Ga0068869_1002242942 285
278 3300005335 Ga0070666_10043187 Ga0070666_100431872 285
279 3300005336 Ga0070680_100001873 Ga0070680_1000018736 285
280 3300005336 Ga0070680_100098893 Ga0070680_1000988933 285
281 3300005337 Ga0070682_100013288 Ga0070682_1000132883 285
282 3300005338 Ga0068868_100019821 Ga0068868_1000198214 285
283 3300005338 Ga0068868_100038602 Ga0068868_1000386022 285
284 3300005338 Ga0068868_100044804 Ga0068868_1000448043 285
285 3300005338 Ga0068868_100223448 Ga0068868_1002234481 285
286 3300005339 Ga0070660_100087926 Ga0070660_1000879262 285
287 3300005340 Ga0070689_100034512 Ga0070689_1000345124 285
288 3300005344 Ga0070661_100070089 Ga0070661_1000700892 285
289 3300005344 Ga0070661_100141366 Ga0070661_1001413662 285
290 3300005347 Ga0070668_100009291 Ga0070668_1000092918 285
291 3300005347 Ga0070668_100152483 Ga0070668_1001524832 285
292 3300005353 Ga0070669_100021681 Ga0070669_1000216816 285
293 3300005353 Ga0070669_100035355 Ga0070669_1000353553 285
294 3300005353 Ga0070669_100056517 Ga0070669_1000565173 285
295 3300005353 Ga0070669_100248588 Ga0070669_1002485882 285
296 3300005353 Ga0070669_100304978 Ga0070669_1003049782 285
297 3300005354 Ga0070675_100005184 Ga0070675_10000518412 285
298 3300005354 Ga0070675_100017625 Ga0070675_1000176254 285
299 3300005354 Ga0070675_100019867 Ga0070675_1000198674 285
300 3300005354 Ga0070675_100047712 Ga0070675_1000477122 285
301 3300005354 Ga0070675_100140465 Ga0070675_1001404651 285
302 3300005354 Ga0070675_100240952 Ga0070675_1002409522 285
303 3300005355 Ga0070671_100020104 Ga0070671_1000201045 285
304 3300005355 Ga0070671_100021133 Ga0070671_1000211338 285
305 3300005355 Ga0070671_100051569 Ga0070671_1000515692 285
306 3300005355 Ga0070671_100104371 Ga0070671_1001043712 285
307 3300005355 Ga0070671_100250238 Ga0070671_1002502381 285
308 3300005355 Ga0070671_100256485 Ga0070671_1002564852 285
309 3300005356 Ga0070674_100047523 Ga0070674_1000475232 285
310 3300005356 Ga0070674_100052925 Ga0070674_1000529252 285
311 3300005356 Ga0070674_100332420 Ga0070674_1003324202 285
312 3300005364 Ga0070673_100016137 Ga0070673_1000161373 285
313 3300005364 Ga0070673_100118033 Ga0070673_1001180332 285
314 3300005364 Ga0070673_100125705 Ga0070673_1001257052 285
315 3300005366 Ga0070659_100105331 Ga0070659_1001053312 285
316 3300005366 Ga0070659_100167311 Ga0070659_1001673111 285
317 3300005367 Ga0070667_100001171 Ga0070667_1000011719 285
318 3300005367 Ga0070667_100003010 Ga0070667_1000030108 285
319 3300005367 Ga0070667_100070593 Ga0070667_1000705932 285
320 3300005367 Ga0070667_100202497 Ga0070667_1002024972 285
321 3300005367 Ga0070667_100244654 Ga0070667_1002446543 285
322 3300005367 Ga0070667_100253932 Ga0070667_1002539322 285
323 3300005455 Ga0070663_100288266 Ga0070663_1002882661 285
324 3300005455 Ga0070663_100395556 Ga0070663_1003955561 285
325 3300005456 Ga0070678_100001334 Ga0070678_1000013345 285
326 3300005456 Ga0070678_100009607 Ga0070678_1000096076 285
327 3300005456 Ga0070678_100119544 Ga0070678_1001195442 285
328 3300005456 Ga0070678_100376883 Ga0070678_1003768832 285
329 3300005457 Ga0070662_100010471 Ga0070662_1000104718 285
330 3300005457 Ga0070662_100026458 Ga0070662_1000264582 285
331 3300005457 Ga0070662_100042844 Ga0070662_1000428443 285
332 3300005457 Ga0070662_100118656 Ga0070662_1001186562 285
333 3300005457 Ga0070662_100177172 Ga0070662_1001771722 285
334 3300005457 Ga0070662_100264095 Ga0070662_1002640951 285
335 3300005459 Ga0068867_100000815 Ga0068867_10000081512 285
336 3300005459 Ga0068867_100002971 Ga0068867_1000029712 285
337 3300005459 Ga0068867_100019006 Ga0068867_1000190063 285
338 3300005459 Ga0068867_100030023 Ga0068867_1000300232 285
339 3300005459 Ga0068867_100157367 Ga0068867_1001573672 285
340 3300005459 Ga0068867_100382539 Ga0068867_1003825392 285
341 3300005467 Ga0070706_100003926 Ga0070706_10000392610 285
342 3300005468 Ga0070707_100206103 Ga0070707_1002061032 285
343 3300005530 Ga0070679_100032769 Ga0070679_1000327693 285
344 3300005530 Ga0070679_100257989 Ga0070679_1002579892 285
345 3300005535 Ga0070684_100077908 Ga0070684_1000779083 285
346 3300005539 Ga0068853_100046481 Ga0068853_1000464813 285
347 3300005539 Ga0068853_100108827 Ga0068853_1001088272 285
348 3300005543 Ga0070672_100002062 Ga0070672_10000206212 285
349 3300005543 Ga0070672_100010713 Ga0070672_1000107138 285
350 3300005543 Ga0070672_100055349 Ga0070672_1000553493 285
351 3300005543 Ga0070672_100094795 Ga0070672_1000947952 285
352 3300005543 Ga0070672_100208158 Ga0070672_1002081582 285
353 3300005547 Ga0070693_100135876 Ga0070693_1001358762 285
354 3300005563 Ga0068855_100010968 Ga0068855_1000109688 285
355 3300005563 Ga0068855_100242662 Ga0068855_1002426622 285
356 3300005563 Ga0068855_100245701 Ga0068855_1002457012 285
357 3300005564 Ga0070664_100071398 Ga0070664_1000713982 285
358 3300005564 Ga0070664_100133510 Ga0070664_1001335102 285
359 3300005564 Ga0070664_100444546 Ga0070664_1004445462 285
360 3300005577 Ga0068857_100123879 Ga0068857_1001238792 285
361 3300005577 Ga0068857_100190795 Ga0068857_1001907952 285
362 3300005577 Ga0068857_100200631 Ga0068857_1002006312 285
363 3300005578 Ga0068854_100043894 Ga0068854_1000438942 285
364 3300005614 Ga0068856_100034780 Ga0068856_1000347804 285
365 3300005614 Ga0068856_100298390 Ga0068856_1002983903 285
366 3300005614 Ga0068856_100553496 Ga0068856_1005534962 285
367 3300005615 Ga0070702_100097362 Ga0070702_1000973622 285
368 3300005615 Ga0070702_100271548 Ga0070702_1002715482 285
369 3300005616 Ga0068852_100012899 Ga0068852_1000128996 285
370 3300005616 Ga0068852_100096174 Ga0068852_1000961742 285
371 3300005616 Ga0068852_100102065 Ga0068852_1001020652 285
372 3300005616 Ga0068852_100222779 Ga0068852_1002227792 285
373 3300005616 Ga0068852_100348988 Ga0068852_1003489882 285
374 3300005616 Ga0068852_100514681 Ga0068852_1005146812 285
375 3300005617 Ga0068859_100002636 Ga0068859_1000026362 285
376 3300005617 Ga0068859_100187823 Ga0068859_1001878232 285
377 3300005618 Ga0068864_100020879 Ga0068864_1000208798 285
378 3300005618 Ga0068864_100040062 Ga0068864_1000400622 285
379 3300005618 Ga0068864_100058859 Ga0068864_1000588592 285
380 3300005618 Ga0068864_100091754 Ga0068864_1000917542 285
381 3300005618 Ga0068864_100169549 Ga0068864_1001695492 285
382 3300005618 Ga0068864_100181318 Ga0068864_1001813182 285
383 3300005618 Ga0068864_100221315 Ga0068864_1002213152 285
384 3300005618 Ga0068864_100289355 Ga0068864_1002893552 285
385 3300005719 Ga0068861_100005018 Ga0068861_1000050188 285
386 3300005719 Ga0068861_100045628 Ga0068861_1000456282 285
387 3300005834 Ga0068851_10049114 Ga0068851_100491142 285
388 3300005834 Ga0068851_10119189 Ga0068851_101191892 285
389 3300005840 Ga0068870_10045754 Ga0068870_100457542 285
390 3300005841 Ga0068863_100044253 Ga0068863_1000442532 285
391 3300005841 Ga0068863_100077587 Ga0068863_1000775872 285
392 3300005841 Ga0068863_100118573 Ga0068863_1001185732 285
393 3300005841 Ga0068863_100122546 Ga0068863_1001225462 285
394 3300005841 Ga0068863_100186160 Ga0068863_1001861602 285
395 3300005842 Ga0068858_100033970 Ga0068858_1000339704 285
396 3300005842 Ga0068858_100086630 Ga0068858_1000866302 285
397 3300005843 Ga0068860_100001433 Ga0068860_1000014332 285
398 3300005843 Ga0068860_100086627 Ga0068860_1000866272 285
399 3300005844 Ga0068862_100073189 Ga0068862_1000731892 285
400 3300006038 Ga0075365_10034142 Ga0075365_100341422 285
401 3300006048 Ga0075363_100027625 Ga0075363_1000276253 285
402 3300006048 Ga0075363_100075231 Ga0075363_1000752312 285
403 3300006048 Ga0075363_100130981 Ga0075363_1001309812 285
404 3300006051 Ga0075364_10036978 Ga0075364_100369783 285
405 3300006058 Ga0075432_10015651 Ga0075432_100156513 285
406 3300006177 Ga0075362_10034752 Ga0075362_100347522 285
407 3300006177 Ga0075362_10036357 Ga0075362_100363572 285
408 3300006177 Ga0075362_10058139 Ga0075362_100581392 285
409 3300006177 Ga0075362_10104534 Ga0075362_101045343 285
410 3300006178 Ga0075367_10020509 Ga0075367_100205094 285
411 3300006178 Ga0075367_10021504 Ga0075367_100215042 285
412 3300006178 Ga0075367_10055062 Ga0075367_100550622 285
413 3300006195 Ga0075366_10004084 Ga0075366_100040849 285
414 3300006195 Ga0075366_10010236 Ga0075366_100102362 285
415 3300006195 Ga0075366_10036620 Ga0075366_100366202 285
416 3300006195 Ga0075366_10037483 Ga0075366_100374832 285
417 3300006195 Ga0075366_10048963 Ga0075366_100489632 285
418 3300006195 Ga0075366_10079616 Ga0075366_100796162 285
419 3300006237 Ga0097621_100059305 Ga0097621_1000593054 285
420 3300006237 Ga0097621_100078866 Ga0097621_1000788662 285
421 3300006237 Ga0097621_100084493 Ga0097621_1000844932 285
422 3300006237 Ga0097621_100251520 Ga0097621_1002515202 285
423 3300006353 Ga0075370_10015610 Ga0075370_100156102 285
424 3300006353 Ga0075370_10020892 Ga0075370_100208922 285
425 3300006353 Ga0075370_10089462 Ga0075370_100894622 285
426 3300006353 Ga0075370_10150175 Ga0075370_101501751 285
427 3300006358 Ga0068871_100040812 Ga0068871_1000408125 285
428 3300006358 Ga0068871_100078969 Ga0068871_1000789693 285
429 3300006358 Ga0068871_100226750 Ga0068871_1002267502 285
430 3300006846 Ga0075430_100090622 Ga0075430_1000906222 285
431 3300006880 Ga0075429_100004495 Ga0075429_1000044958 285
432 3300006881 Ga0068865_100130144 Ga0068865_1001301442 285
433 3300006881 Ga0068865_100206821 Ga0068865_1002068212 285
434 3300006881 Ga0068865_100213969 Ga0068865_1002139692 285
435 3300006931 Ga0097620_100002636 Ga0097620_1000026362 285
436 3300006931 Ga0097620_100187829 Ga0097620_1001878292 285
437 3300006948 Ga0099826_10126482 Ga0099826_101264823 285
438 3300006948 Ga0099826_10130715 Ga0099826_101307153 285
439 3300009093 Ga0105240_10003241 Ga0105240_1000324123 285
440 3300009093 Ga0105240_10100781 Ga0105240_101007812 285
441 3300009093 Ga0105240_10495046 Ga0105240_104950462 285
442 3300009098 Ga0105245_10570985 Ga0105245_105709852 285
443 3300009147 Ga0114129_10506345 Ga0114129_105063452 285
444 3300009148 Ga0105243_10035673 Ga0105243_100356732 285
445 3300009148 Ga0105243_10036120 Ga0105243_100361203 285
446 3300009148 Ga0105243_10039925 Ga0105243_100399252 285
447 3300009148 Ga0105243_10051142 Ga0105243_100511422 285
448 3300009148 Ga0105243_10147809 Ga0105243_101478092 285
449 3300009177 Ga0105248_10340666 Ga0105248_103406662 285
450 3300009177 Ga0105248_10378942 Ga0105248_103789422 285
451 3300009545 Ga0105237_10129037 Ga0105237_101290372 285
452 3300009545 Ga0105237_10392414 Ga0105237_103924142 285
453 3300009551 Ga0105238_10055568 Ga0105238_100555682 285
454 3300009551 Ga0105238_10059028 Ga0105238_100590285 285
455 3300009551 Ga0105238_10145211 Ga0105238_101452112 285
456 3300009553 Ga0105249_10072632 Ga0105249_100726322 285
457 3300010375 Ga0105239_10085101 Ga0105239_100851012 285
458 3300010375 Ga0105239_10358062 Ga0105239_103580622 285
459 3300013100 Ga0157373_10037135 Ga0157373_100371352 285
460 3300013104 Ga0157370_10120358 Ga0157370_101203583 285
461 3300013104 Ga0157370_10265804 Ga0157370_102658042 285
462 3300013105 Ga0157369_10106740 Ga0157369_101067402 285
463 3300013105 Ga0157369_10212493 Ga0157369_102124932 285
464 3300013296 Ga0157374_10048034 Ga0157374_100480344 285
465 3300013296 Ga0157374_10171718 Ga0157374_101717182 285
466 3300013306 Ga0163162_10017076 Ga0163162_100170763 285
467 3300013306 Ga0163162_10094494 Ga0163162_100944942 285
468 3300013306 Ga0163162_10102728 Ga0163162_101027283 285
469 3300013306 Ga0163162_10495827 Ga0163162_104958272 285
470 3300013307 Ga0157372_10077049 Ga0157372_100770492 285
471 3300013307 Ga0157372_10246431 Ga0157372_102464312 285
472 3300013308 Ga0157375_10151253 Ga0157375_101512533 285
473 3300013308 Ga0157375_10242243 Ga0157375_102422432 285
474 3300013308 Ga0157375_10430043 Ga0157375_104300432 285
475 3300014325 Ga0163163_10313942 Ga0163163_103139422 285
476 3300014326 Ga0157380_10138554 Ga0157380_101385542 285
477 3300014326 Ga0157380_10150634 Ga0157380_101506342 285
478 3300014497 Ga0182008_10030116 Ga0182008_100301164 285
479 3300014497 Ga0182008_10039803 Ga0182008_100398032 285
480 3300014745 Ga0157377_10000382 Ga0157377_1000038212 285
481 3300014745 Ga0157377_10090589 Ga0157377_100905892 285
482 3300014968 Ga0157379_10013894 Ga0157379_100138948 285
483 3300014968 Ga0157379_10074533 Ga0157379_100745332 285
484 3300014968 Ga0157379_10111962 Ga0157379_101119622 285
485 3300014968 Ga0157379_10215996 Ga0157379_102159962 285
486 3300014968 Ga0157379_10235205 Ga0157379_102352052 285
487 3300014968 Ga0157379_10434370 Ga0157379_104343702 285
488 3300014969 Ga0157376_10016007 Ga0157376_100160075 285
489 3300014969 Ga0157376_10117911 Ga0157376_101179112 285
490 3300014969 Ga0157376_10292907 Ga0157376_102929072 285
491 3300015261 Ga0182006_1012764 Ga0182006_10127642 285
492 3300015262 Ga0182007_10013133 Ga0182007_100131333 285
493 3300015683 Ga0183362_10003 Ga0183362_1000377 285
494 3300017792 Ga0163161_10000166 Ga0163161_1000016652 285
495 3300017792 Ga0163161_10046164 Ga0163161_100461643 285
496 3300017792 Ga0163161_10119951 Ga0163161_101199512 285
497 3300017792 Ga0163161_10254311 Ga0163161_102543111 285
498 3300021361 Ga0213872_10000011 Ga0213872_1000001176 285
499 3300021361 Ga0213872_10073865 Ga0213872_100738652 285
500 3300021377 Ga0213874_10052812 Ga0213874_100528122 285
501 3300025206 Ga0209435_100001 Ga0209435_10000113 285
502 3300025230 Ga0209563_100005 Ga0209563_100005327 285
503 3300025245 Ga0207425_1004662 Ga0207425_10046622 285
504 3300025246 Ga0209646_1000001 Ga0209646_1000001382 285
505 3300025250 Ga0209026_1000003 Ga0209026_100000313 285
506 3300025256 Ga0209759_1000001 Ga0209759_100000113 285
507 3300025258 Ga0209129_1015901 Ga0209129_10159012 285
508 3300025258 Ga0209129_1016072 Ga0209129_10160722 285
509 3300025263 Ga0209565_1002553 Ga0209565_10025532 285
510 3300025263 Ga0209565_1006028 Ga0209565_10060283 285
511 3300025284 Ga0209130_1000241 Ga0209130_100024172 285
512 3300025284 Ga0209130_1001702 Ga0209130_100170211 285
513 3300025291 Ga0209675_1002145 Ga0209675_10021454 285
514 3300025291 Ga0209675_1013293 Ga0209675_10132933 285
515 3300025292 Ga0209676_1001036 Ga0209676_100103627 285
516 3300025292 Ga0209676_1011543 Ga0209676_10115432 285
517 3300025292 Ga0209676_1016039 Ga0209676_10160392 285
518 3300025294 Ga0209025_1001296 Ga0209025_10012966 285
519 3300025294 Ga0209025_1001745 Ga0209025_10017452 285
520 3300025294 Ga0209025_1004965 Ga0209025_10049652 285
521 3300025294 Ga0209025_1092425 Ga0209025_10924251 285
522 3300025295 Ga0209564_1022325 Ga0209564_10223252 285
523 3300025297 Ga0209758_1018074 Ga0209758_10180742 285
524 3300025298 Ga0209050_1006287 Ga0209050_10062873 285
525 3300025298 Ga0209050_1008094 Ga0209050_10080942 285
526 3300025298 Ga0209050_1009215 Ga0209050_10092152 285
527 3300025299 Ga0209256_1022688 Ga0209256_10226883 285
528 3300025302 Ga0207426_1000247 Ga0207426_100024746 285
529 3300025303 Ga0209051_1000024 Ga0209051_1000024253 285
530 3300025303 Ga0209051_1000373 Ga0209051_100037325 285
531 3300025303 Ga0209051_1002063 Ga0209051_100206312 285
532 3300025304 Ga0209257_1000079 Ga0209257_1000079253 285
533 3300025315 Ga0207697_10043396 Ga0207697_100433962 285
534 3300025893 Ga0207682_10001523 Ga0207682_1000152312 285
535 3300025893 Ga0207682_10025532 Ga0207682_100255322 285
536 3300025893 Ga0207682_10034969 Ga0207682_100349693 285
537 3300025899 Ga0207642_10006005 Ga0207642_100060053 285
538 3300025900 Ga0207710_10044146 Ga0207710_100441462 285
539 3300025901 Ga0207688_10049012 Ga0207688_100490122 285
540 3300025903 Ga0207680_10157086 Ga0207680_101570862 285
541 3300025907 Ga0207645_10060058 Ga0207645_100600582 285
542 3300025907 Ga0207645_10209487 Ga0207645_102094871 285
543 3300025908 Ga0207643_10035221 Ga0207643_100352213 285
544 3300025908 Ga0207643_10070522 Ga0207643_100705222 285
545 3300025909 Ga0207705_10168516 Ga0207705_101685162 285
546 3300025909 Ga0207705_10223921 Ga0207705_102239212 285
547 3300025912 Ga0207707_10063466 Ga0207707_100634662 285
548 3300025917 Ga0207660_10003088 Ga0207660_100030888 285
549 3300025918 Ga0207662_10033021 Ga0207662_100330212 285
550 3300025918 Ga0207662_10237245 Ga0207662_102372452 285
551 3300025919 Ga0207657_10098939 Ga0207657_100989392 285
552 3300025919 Ga0207657_10104544 Ga0207657_101045442 285
553 3300025919 Ga0207657_10191083 Ga0207657_101910832 285
554 3300025919 Ga0207657_10213280 Ga0207657_102132802 285
555 3300025919 Ga0207657_10287065 Ga0207657_102870652 285
556 3300025920 Ga0207649_10061414 Ga0207649_100614142 285
557 3300025920 Ga0207649_10065870 Ga0207649_100658702 285
558 3300025921 Ga0207652_10012428 Ga0207652_100124282 285
559 3300025923 Ga0207681_10033139 Ga0207681_100331392 285
560 3300025923 Ga0207681_10063806 Ga0207681_100638062 285
561 3300025923 Ga0207681_10110231 Ga0207681_101102312 285
562 3300025924 Ga0207694_10052371 Ga0207694_100523712 285
563 3300025925 Ga0207650_10002460 Ga0207650_100024602 285
564 3300025925 Ga0207650_10009009 Ga0207650_100090092 285
565 3300025925 Ga0207650_10066075 Ga0207650_100660752 285
566 3300025925 Ga0207650_10211125 Ga0207650_102111253 285
567 3300025926 Ga0207659_10008467 Ga0207659_100084674 285
568 3300025926 Ga0207659_10009925 Ga0207659_100099253 285
569 3300025926 Ga0207659_10021859 Ga0207659_100218593 285
570 3300025926 Ga0207659_10141592 Ga0207659_101415922 285
571 3300025926 Ga0207659_10271162 Ga0207659_102711622 285
572 3300025927 Ga0207687_10167859 Ga0207687_101678592 285
573 3300025927 Ga0207687_10371824 Ga0207687_103718241 285
574 3300025931 Ga0207644_10016645 Ga0207644_100166455 285
575 3300025931 Ga0207644_10092585 Ga0207644_100925852 285
576 3300025932 Ga0207690_10061279 Ga0207690_100612792 285
577 3300025933 Ga0207706_10021027 Ga0207706_100210272 285
578 3300025933 Ga0207706_10053240 Ga0207706_100532402 285
579 3300025933 Ga0207706_10060560 Ga0207706_100605602 285
580 3300025933 Ga0207706_10063023 Ga0207706_100630232 285
581 3300025933 Ga0207706_10063573 Ga0207706_100635732 285
582 3300025933 Ga0207706_10069481 Ga0207706_100694814 285
583 3300025934 Ga0207686_10065792 Ga0207686_100657922 285
584 3300025935 Ga0207709_10000424 Ga0207709_1000042446 285
585 3300025935 Ga0207709_10011879 Ga0207709_100118797 285
586 3300025935 Ga0207709_10016722 Ga0207709_100167224 285
587 3300025935 Ga0207709_10086004 Ga0207709_100860042 285
588 3300025936 Ga0207670_10114728 Ga0207670_101147282 285
589 3300025936 Ga0207670_10249727 Ga0207670_102497271 285
590 3300025937 Ga0207669_10073705 Ga0207669_100737052 285
591 3300025937 Ga0207669_10090249 Ga0207669_100902492 285
592 3300025938 Ga0207704_10023614 Ga0207704_100236142 285
593 3300025938 Ga0207704_10099319 Ga0207704_100993192 285
594 3300025939 Ga0207665_10080409 Ga0207665_100804092 285
595 3300025940 Ga0207691_10006082 Ga0207691_100060822 285
596 3300025940 Ga0207691_10007915 Ga0207691_1000791511 285
597 3300025940 Ga0207691_10054365 Ga0207691_100543652 285
598 3300025940 Ga0207691_10087220 Ga0207691_100872202 285
599 3300025940 Ga0207691_10109867 Ga0207691_101098672 285
600 3300025940 Ga0207691_10205047 Ga0207691_102050472 285
601 3300025940 Ga0207691_10306427 Ga0207691_103064272 285
602 3300025941 Ga0207711_10028966 Ga0207711_100289662 285
603 3300025941 Ga0207711_10067388 Ga0207711_100673883 285
604 3300025941 Ga0207711_10182188 Ga0207711_101821882 285
605 3300025941 Ga0207711_10273282 Ga0207711_102732822 285
606 3300025942 Ga0207689_10000225 Ga0207689_1000022528 285
607 3300025942 Ga0207689_10011178 Ga0207689_100111788 285
608 3300025942 Ga0207689_10014824 Ga0207689_100148242 285
609 3300025942 Ga0207689_10099591 Ga0207689_100995912 285
610 3300025942 Ga0207689_10120858 Ga0207689_101208583 285
611 3300025942 Ga0207689_10458555 Ga0207689_104585551 285
612 3300025944 Ga0207661_10071924 Ga0207661_100719242 285
613 3300025944 Ga0207661_10190549 Ga0207661_101905492 285
614 3300025945 Ga0207679_10221671 Ga0207679_102216712 285
615 3300025949 Ga0207667_10115644 Ga0207667_101156442 285
616 3300025949 Ga0207667_10147545 Ga0207667_101475451 285
617 3300025949 Ga0207667_10367606 Ga0207667_103676062 285
618 3300025949 Ga0207667_10482118 Ga0207667_104821182 285
619 3300025960 Ga0207651_10022218 Ga0207651_100222183 285
620 3300025960 Ga0207651_10022563 Ga0207651_100225632 285
621 3300025960 Ga0207651_10048057 Ga0207651_100480572 285
622 3300025960 Ga0207651_10241507 Ga0207651_102415072 285
623 3300025961 Ga0207712_10040982 Ga0207712_100409822 285
624 3300025961 Ga0207712_10062282 Ga0207712_100622822 285
625 3300025972 Ga0207668_10037660 Ga0207668_100376602 285
626 3300025972 Ga0207668_10104228 Ga0207668_101042283 285
627 3300025972 Ga0207668_10173140 Ga0207668_101731402 285
628 3300025981 Ga0207640_10182293 Ga0207640_101822932 285
629 3300025981 Ga0207640_10367989 Ga0207640_103679892 285
630 3300025986 Ga0207658_10000959 Ga0207658_100009599 285
631 3300025986 Ga0207658_10009082 Ga0207658_100090822 285
632 3300025986 Ga0207658_10095778 Ga0207658_100957782 285
633 3300025986 Ga0207658_10156383 Ga0207658_101563831 285
634 3300026023 Ga0207677_10007983 Ga0207677_100079832 285
635 3300026023 Ga0207677_10036090 Ga0207677_100360903 285
636 3300026023 Ga0207677_10082138 Ga0207677_100821382 285
637 3300026035 Ga0207703_10001350 Ga0207703_100013502 285
638 3300026035 Ga0207703_10016674 Ga0207703_100166742 285
639 3300026035 Ga0207703_10112459 Ga0207703_101124592 285
640 3300026041 Ga0207639_10137219 Ga0207639_101372192 285
641 3300026041 Ga0207639_10311087 Ga0207639_103110872 285
642 3300026041 Ga0207639_10321025 Ga0207639_103210252 285
643 3300026067 Ga0207678_10132667 Ga0207678_101326672 285
644 3300026067 Ga0207678_10139535 Ga0207678_101395352 285
645 3300026078 Ga0207702_10014241 Ga0207702_100142417 285
646 3300026078 Ga0207702_10201368 Ga0207702_102013682 285
647 3300026088 Ga0207641_10009363 Ga0207641_100093632 285
648 3300026088 Ga0207641_10159332 Ga0207641_101593322 285
649 3300026089 Ga0207648_10002629 Ga0207648_1000262910 285
650 3300026089 Ga0207648_10024680 Ga0207648_100246803 285
651 3300026089 Ga0207648_10093629 Ga0207648_100936292 285
652 3300026089 Ga0207648_10113433 Ga0207648_101134332 285
653 3300026089 Ga0207648_10131878 Ga0207648_101318782 285
654 3300026089 Ga0207648_10145231 Ga0207648_101452312 285
655 3300026089 Ga0207648_10149930 Ga0207648_101499302 285
656 3300026089 Ga0207648_10191397 Ga0207648_101913971 285
657 3300026089 Ga0207648_10215001 Ga0207648_102150011 285
658 3300026095 Ga0207676_10010315 Ga0207676_100103152 285
659 3300026095 Ga0207676_10015099 Ga0207676_100150992 285
660 3300026095 Ga0207676_10026111 Ga0207676_100261115 285
661 3300026095 Ga0207676_10026609 Ga0207676_100266092 285
662 3300026095 Ga0207676_10219278 Ga0207676_102192781 285
663 3300026095 Ga0207676_10274003 Ga0207676_102740032 285
664 3300026116 Ga0207674_10008218 Ga0207674_100082182 285
665 3300026116 Ga0207674_10022905 Ga0207674_100229057 285
666 3300026116 Ga0207674_10162897 Ga0207674_101628972 285
667 3300026118 Ga0207675_100001260 Ga0207675_1000012606 285
668 3300026118 Ga0207675_100094683 Ga0207675_1000946832 285
669 3300026121 Ga0207683_10103395 Ga0207683_101033952 285
670 3300026121 Ga0207683_10113119 Ga0207683_101131192 285
671 3300026121 Ga0207683_10161670 Ga0207683_101616702 285
672 3300026121 Ga0207683_10382882 Ga0207683_103828822 285
673 3300026121 Ga0207683_10400375 Ga0207683_104003752 285
674 3300026142 Ga0207698_10008850 Ga0207698_100088506 285
675 3300026142 Ga0207698_10200493 Ga0207698_102004932 285
676 3300026142 Ga0207698_10259193 Ga0207698_102591932 285
677 3300026142 Ga0207698_10300083 Ga0207698_103000831 285
678 3300026142 Ga0207698_10549191 Ga0207698_105491911 285
679 3300027378 Ga0209981_1005382 Ga0209981_10053822 285
680 3300027526 Ga0209968_1000691 Ga0209968_10006914 285
681 3300027666 Ga0209282_1108405 Ga0209282_11084051 285
682 3300027695 Ga0209966_1000036 Ga0209966_100003625 285
683 3300027876 Ga0209974_10012937 Ga0209974_100129372 285
684 3300028379 Ga0268266_10024378 Ga0268266_100243784 285
685 3300028379 Ga0268266_10175172 Ga0268266_101751722 285
686 3300028380 Ga0268265_10025246 Ga0268265_100252465 285
687 3300028380 Ga0268265_10036125 Ga0268265_100361252 285
688 3300028380 Ga0268265_10040812 Ga0268265_100408122 285
689 3300028381 Ga0268264_10004852 Ga0268264_100048525 285
690 3300028381 Ga0268264_10042982 Ga0268264_100429822 285
691 3300028381 Ga0268264_10262861 Ga0268264_102628612 285
692 3300028786 Ga0307517_10001871 Ga0307517_100018714 285
693 3300028786 Ga0307517_10107035 Ga0307517_101070352 285
694 3300028794 Ga0307515_10000020 Ga0307515_10000020242 285
695 3300028794 Ga0307515_10000051 Ga0307515_10000051260 285
696 3300028794 Ga0307515_10000101 Ga0307515_10000101126 285
697 3300028794 Ga0307515_10000152 Ga0307515_1000015292 285
698 3300028794 Ga0307515_10000991 Ga0307515_1000099157 285
699 3300028794 Ga0307515_10007242 Ga0307515_1000724217 285
700 3300028794 Ga0307515_10008378 Ga0307515_100083786 285
701 3300028794 Ga0307515_10036978 Ga0307515_100369785 285
702 3300028794 Ga0307515_10038740 Ga0307515_100387403 285
703 3300028794 Ga0307515_10075161 Ga0307515_100751613 285
704 3300028794 Ga0307515_10120000 Ga0307515_101200002 285
705 3300028794 Ga0307515_10307026 Ga0307515_103070262 285
706 3300030522 Ga0307512_10108096 Ga0307512_101080962 285
707 3300030522 Ga0307512_10116038 Ga0307512_101160382 285
708 3300030731 Ga0316177_1078761 Ga0316177_10787612 285
709 3300030733 Ga0314311_1107726 Ga0314311_11077262 285
710 3300030734 Ga0316179_1098911 Ga0316179_10989112 285
711 3300030742 Ga0316183_1077170 Ga0316183_10771703 285
712 3300030744 Ga0316181_1144972 Ga0316181_11449727 285
713 3300030745 Ga0316182_1067687 Ga0316182_10676872 285
714 3300030745 Ga0316182_1243175 Ga0316182_12431752 285
715 3300031235 Ga0265330_10000033 Ga0265330_1000003362 285
716 3300031238 Ga0265332_10000001 Ga0265332_10000001186 285
717 3300031240 Ga0265320_10040578 Ga0265320_100405782 285
718 3300031247 Ga0265340_10018855 Ga0265340_100188555 285
719 3300031251 Ga0265327_10001098 Ga0265327_1000109835 285
720 3300031251 Ga0265327_10005755 Ga0265327_1000575511 285
721 3300031456 Ga0307513_10000004 Ga0307513_10000004336 285
722 3300031456 Ga0307513_10000054 Ga0307513_10000054100 285
723 3300031456 Ga0307513_10001123 Ga0307513_1000112335 285
724 3300031456 Ga0307513_10010964 Ga0307513_100109642 285
725 3300031456 Ga0307513_10142897 Ga0307513_101428972 285
726 3300031456 Ga0307513_10145257 Ga0307513_101452572 285
727 3300031456 Ga0307513_10158749 Ga0307513_101587492 285
728 3300031507 Ga0307509_10025279 Ga0307509_100252792 285
729 3300031507 Ga0307509_10030443 Ga0307509_100304432 285
730 3300031507 Ga0307509_10035773 Ga0307509_100357732 285
731 3300031507 Ga0307509_10180175 Ga0307509_101801752 285
732 3300031548 Ga0307408_100000079 Ga0307408_1000000792 285
733 3300031548 Ga0307408_100009340 Ga0307408_1000093402 285
734 3300031548 Ga0307408_100080528 Ga0307408_1000805283 285
735 3300031548 Ga0307408_100114897 Ga0307408_1001148972 285
736 3300031548 Ga0307408_100187080 Ga0307408_1001870803 285
737 3300031548 Ga0307408_100201107 Ga0307408_1002011072 285
738 3300031548 Ga0307408_100259871 Ga0307408_1002598712 285
739 3300031616 Ga0307508_10000007 Ga0307508_1000000733 285
740 3300031616 Ga0307508_10000227 Ga0307508_1000022720 285
741 3300031616 Ga0307508_10038562 Ga0307508_100385626 285
742 3300031649 Ga0307514_10011126 Ga0307514_100111265 285
743 3300031649 Ga0307514_10062171 Ga0307514_100621712 285
744 3300031711 Ga0265314_10000022 Ga0265314_10000022191 285
745 3300031730 Ga0307516_10000497 Ga0307516_1000049729 285
746 3300031730 Ga0307516_10004946 Ga0307516_100049466 285
747 3300031730 Ga0307516_10012796 Ga0307516_100127962 285
748 3300031730 Ga0307516_10014242 Ga0307516_100142423 285
749 3300031730 Ga0307516_10016014 Ga0307516_100160142 285
750 3300031730 Ga0307516_10314341 Ga0307516_103143412 285
751 3300031731 Ga0307405_10047870 Ga0307405_100478702 285
752 3300031731 Ga0307405_10328208 Ga0307405_103282082 285
753 3300031824 Ga0307413_10023658 Ga0307413_100236582 285
754 3300031901 Ga0307406_10064183 Ga0307406_100641832 285
755 3300031901 Ga0307406_10229442 Ga0307406_102294421 285
756 3300031901 Ga0307406_10334584 Ga0307406_103345842 285
757 3300031911 Ga0307412_10067234 Ga0307412_100672342 285
758 3300031911 Ga0307412_10085767 Ga0307412_100857673 285
759 3300031911 Ga0307412_10086513 Ga0307412_100865133 285
760 3300031995 Ga0307409_100021883 Ga0307409_1000218834 285
761 3300032002 Ga0307416_100002560 Ga0307416_1000025604 285
762 3300032002 Ga0307416_100615376 Ga0307416_1006153762 285
763 3300032126 Ga0307415_100027466 Ga0307415_1000274662 285
764 3300033180 Ga0307510_10026627 Ga0307510_100266272 285
765 3300033180 Ga0307510_10111223 Ga0307510_101112232 285
766 3300035112 Ga0373932_0086323 Ga0373932_0086323_111_968 285
767 3300035691 Ga0373931_0016799 Ga0373931_0016799_673_1530 285
768 3300035691 Ga0373931_0017937 Ga0373931_0017937_1739_2596 285
769 3300035725 Ga0373947_0149989 Ga0373947_0149989_242_1099 285
770 3300036401 Ga0373937_0028691 Ga0373937_0028691_1408_2265 285
771 3300037068 Ga0373925_0327725 Ga0373925_0327725_145_1002 285
772 3300037418 Ga0395900_0000109 Ga0395900_0000109_88007_88870 285
773 3300037466 Ga0395898_0000868 Ga0395898_0000868_35669_36532 285
774 3300037471 Ga0395905_0008841 Ga0395905_0008841_360_1217 285
775 3300037471 Ga0395905_0009815 Ga0395905_0009815_4319_5176 285
776 3300037471 Ga0395905_0016819 Ga0395905_0016819_5866_6723 285
777 3300038443 Ga0395901_0066688 Ga0395901_0066688_1198_2055 285
778 3300039447 Ga0436361_0296121 Ga0436361_0296121_12581_13447 285
779 3300039447 Ga0436361_0416556 Ga0436361_0416556_2798_3655 285
780 3300039447 Ga0436361_1033023 Ga0436361_1033023_1176_2033 285
781 3300039450 Ga0436363_1441997 Ga0436363_1441997_842_1699 285
782 3300041413 Ga0439465_0010818 Ga0439465_0010818_831_1688 285
783 3300041459 Ga0451800_0898755 Ga0451800_0898755_268_1125 285
784 3300041997 Ga0439431_0011306 Ga0439431_0011306_1029_1886 285
785 3300041999 Ga0439433_0006439 Ga0439433_0006439_990_1847 285
786 3300042002 Ga0439442_005843 Ga0439442_005843_763_1620 285
787 3300042004 Ga0439445_0004163 Ga0439445_0004163_1418_2275 285
788 3300042006 Ga0439432_000677 Ga0439432_000677_6814_7671 285
789 3300042007 Ga0439449_0000924 Ga0439449_0000924_9720_10577 285
790 3300042010 Ga0439452_009127 Ga0439452_009127_1355_2212 285
791 3300042125 Ga0450923_015391 Ga0450923_015391_421_1278 285
792 3300042133 Ga0450896_012807 Ga0450896_012807_56_913 285
793 3300042435 Ga0439434_0001859 Ga0439434_0001859_4869_5726 285
794 3300042439 Ga0439464_0017013 Ga0439464_0017013_168_1025 285
795 3300042531 Ga0450918_002732 Ga0450918_002732_1085_1942 285
796 3300042876 Ga0451577_0002119 Ga0451577_0002119_23218_24075 285
797 3300044656 Ga0466969_0000385 Ga0466969_0000385_1508_2365 285
798 3300044656 Ga0466969_0019596 Ga0466969_0019596_2610_3467 285
799 3300044673 Ga0453683_0091346 Ga0453683_0091346_91_948 285
800 3300044683 Ga0466965_0065463 Ga0466965_0065463_702_1559 285
801 3300044684 Ga0466966_0009505 Ga0466966_0009505_624_1481 285
802 3300044693 Ga0466961_0002458 Ga0466961_0002458_4420_5277 285
803 3300044712 Ga0453684_0050727 Ga0453684_0050727_3292_4149 285
804 3300044719 Ga0466971_0042912 Ga0466971_0042912_1129_1986 285
805 3300044719 Ga0466971_0064696 Ga0466971_0064696_184_1041 285
806 3300045049 Ga0466959_0077189 Ga0466959_0077189_892_1749 285
807 3300045051 Ga0451576_0003324 Ga0451576_0003324_809_1666 285
808 3300045051 Ga0451576_0168393 Ga0451576_0168393_584_1441 285
809 3300046454 Ga0495592_0000028 Ga0495592_0000028_53740_54597 285
810 3300046455 Ga0495603_0162358 Ga0495603_0162358_156_1013 285
811 3300046459 Ga0495629_0166197 Ga0495629_0166197_51_908 285
812 3300046472 Ga0495580_0046417 Ga0495580_0046417_1181_2038 285
813 3300046515 Ga0495620_0023276 Ga0495620_0023276_240_1097 285
814 3300046519 Ga0495632_0055206 Ga0495632_0055206_837_1694 285
815 3300046519 Ga0495632_0073123 Ga0495632_0073123_417_1274 285
816 3300046530 Ga0495654_0079515 Ga0495654_0079515_141_998 285
817 3300046530 Ga0495654_0093905 Ga0495654_0093905_243_1100 285
818 3300046536 Ga0495587_0069353 Ga0495587_0069353_15_872 285
819 3300046542 Ga0495597_0025734 Ga0495597_0025734_1350_2207 285
820 3300046542 Ga0495597_0027421 Ga0495597_0027421_896_1753 285
821 3300046559 Ga0495667_0182381 Ga0495667_0182381_30_887 285
822 3300046615 Ga0495656_0000202 Ga0495656_0000202_13142_13999 285
823 3300046615 Ga0495656_0042224 Ga0495656_0042224_559_1416 285
824 3300046660 Ga0495625_0005344 Ga0495625_0005344_10319_11176 285
825 3300046660 Ga0495625_0013990 Ga0495625_0013990_777_1634 285
826 3300046683 Ga0495658_0083956 Ga0495658_0083956_825_1682 285
827 3300046683 Ga0495658_0106707 Ga0495658_0106707_411_1268 285
828 3300046683 Ga0495658_0203130 Ga0495658_0203130_203_1063 285
829 3300046694 Ga0495649_0035849 Ga0495649_0035849_1095_1952 285
830 3300046694 Ga0495649_0203375 Ga0495649_0203375_145_1002 285
831 3300046810 Ga0495660_0124699 Ga0495660_0124699_201_1058 285
832 3300047443 Ga0495687_040301 Ga0495687_040301_985_1842 285
833 3300047472 Ga0495686_0183357 Ga0495686_0183357_122_979 285
834 3300047673 Ga0495593_0053969 Ga0495593_0053969_365_1222 285
835 3300048903 Ga0496100_0151999 Ga0496100_0151999_394_1251 285
836 3300048903 Ga0496100_0250119 Ga0496100_0250119_286_1143 285
837 3300048904 Ga0496101_0001014 Ga0496101_0001014_2615_3472 285
838 3300048905 Ga0496102_0017154 Ga0496102_0017154_617_1474 285
839 3300048905 Ga0496102_0038214 Ga0496102_0038214_1535_2392 285
840 3300048905 Ga0496102_0092470 Ga0496102_0092470_1237_2094 285
841 3300048907 Ga0496104_0164500 Ga0496104_0164500_155_1012 285
842 3300048908 Ga0496105_0057169 Ga0496105_0057169_491_1348 285
843 3300048908 Ga0496105_0131760 Ga0496105_0131760_103_963 285
844 3300048908 Ga0496105_0430180 Ga0496105_0430180_68_925 285
845 3300048909 Ga0496106_0054602 Ga0496106_0054602_956_1813 285
846 3300048909 Ga0496106_0080771 Ga0496106_0080771_536_1393 285
847 3300048910 Ga0496107_0183594 Ga0496107_0183594_209_1066 285
848 3300048911 Ga0496108_0141293 Ga0496108_0141293_1061_1918 285
849 3300048912 Ga0496109_0629257 Ga0496109_0629257_11_868 285
850 3300048913 Ga0496110_0042297 Ga0496110_0042297_154_1011 285
851 3300048914 Ga0496111_0106565 Ga0496111_0106565_686_1543 285
852 3300048914 Ga0496111_0111522 Ga0496111_0111522_419_1276 285
853 3300048925 Ga0496122_0000985 Ga0496122_0000985_48704_49561 285
854 3300048925 Ga0496122_0089547 Ga0496122_0089547_896_1753 285
855 3300048926 Ga0496123_0000656 Ga0496123_0000656_41172_42029 285
856 3300048926 Ga0496123_0081490 Ga0496123_0081490_479_1336 285
857 3300048927 Ga0496124_0000317 Ga0496124_0000317_19554_20411 285
858 3300048927 Ga0496124_0081933 Ga0496124_0081933_1474_2331 285
859 3300048928 Ga0496125_0001040 Ga0496125_0001040_748_1605 285
860 3300048929 Ga0496126_0315896 Ga0496126_0315896_347_1204 285
861 3300049568 Ga0501031_0012766 Ga0501031_0012766_438_1295 285
862 3300049579 Ga0501043_0000004 Ga0501043_0000004_147246_148103 285
863 3300049580 Ga0501046_0000016 Ga0501046_0000016_143733_144590 285
864 3300049581 Ga0501047_0000012 Ga0501047_0000012_143413_144270 285
865 3300049649 Ga0501198_000005 Ga0501198_000005_133802_134659 285
866 3300049662 Ga0501222_000003 Ga0501222_000003_134551_135408 285
867 3300049759 Ga0501262_000797 Ga0501262_000797_48_905 285
868 3300049822 Ga0501035_0340835 Ga0501035_0340835_130_987 285
869 3300050490 nmdc:mga03n38_29940_c1 nmdc:mga03n38_29940_c1_78_935 285
870 3300050491 nmdc:mga00v17_183511_c1 nmdc:mga00v17_183511_c1_328_1185 285
871 3300050491 nmdc:mga00v17_84012_c1 nmdc:mga00v17_84012_c1_170_1027 285
872 3300050492 nmdc:mga0yw44_292201_c1 nmdc:mga0yw44_292201_c1_172_1029 285
873 3300050493 nmdc:mga0k408_156455_c1 nmdc:mga0k408_156455_c1_255_1112 285
874 3300050493 nmdc:mga0k408_162745_c1 nmdc:mga0k408_162745_c1_359_1216 285
875 3300050493 nmdc:mga0k408_23770_c1 nmdc:mga0k408_23770_c1_168_1025 285
876 3300050493 nmdc:mga0k408_41156_c1 nmdc:mga0k408_41156_c1_1670_2527 285
877 3300050493 nmdc:mga0k408_52323_c1 nmdc:mga0k408_52323_c1_811_1668 285
878 3300050493 nmdc:mga0k408_56668_c1 nmdc:mga0k408_56668_c1_286_1143 285
879 3300050493 nmdc:mga0k408_80001_c1 nmdc:mga0k408_80001_c1_257_1114 285
880 3300050493 nmdc:mga0k408_85470_c1 nmdc:mga0k408_85470_c1_251_1108 285
881 3300050493 nmdc:mga0k408_9344_c1 nmdc:mga0k408_9344_c1_3294_4151 285
882 3300050496 nmdc:mga07m45_134711_c1 nmdc:mga07m45_134711_c1_528_1385 285
883 3300050496 nmdc:mga07m45_14664_c1 nmdc:mga07m45_14664_c1_1094_1951 285
884 3300050496 nmdc:mga07m45_2993_c1 nmdc:mga07m45_2993_c1_737_1594 285
885 3300050496 nmdc:mga07m45_60107_c1 nmdc:mga07m45_60107_c1_596_1453 285
886 3300050496 nmdc:mga07m45_73331_c1 nmdc:mga07m45_73331_c1_69_926 285
887 3300050516 nmdc:mga0sz30_3098_c1 nmdc:mga0sz30_3098_c1_2006_2863 285
888 3300053077 Ga0495601_0135285 Ga0495601_0135285_151_1008 285
889 3300053084 Ga0495595_0181299 Ga0495595_0181299_160_1017 285
890 3300053085 Ga0495619_0088437 Ga0495619_0088437_988_1845 285
891 3300053085 Ga0495619_0230742 Ga0495619_0230742_374_1231 285
892 3300053093 Ga0500651_0122933 Ga0500651_0122933_217_1074 285
893 3300053131 Ga0500652_045576 Ga0500652_045576_827_1684 285
894 3300053134 Ga0500658_0044731 Ga0500658_0044731_178_1035 285
895 3300053136 Ga0500559_0011048 Ga0500559_0011048_990_1847 285
896 3300053730 Ga0500645_000413 Ga0500645_000413_14262_15119 285

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00793

DAHP_synth_1

DAHP synthetase I family

4

269

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
3tml-assembly2.cif.gz_A crystal structure of 2-dehydro-3-deoxyphosphooctonate aldolase from burkholderia cenocepacia 0.9706 1 281
3tml-assembly1.cif.gz_B crystal structure of 2-dehydro-3-deoxyphosphooctonate aldolase from burkholderia cenocepacia 0.9677 1 281
6mdy-assembly1.cif.gz_A crystal structure of a 2-dehydro-3-deoxyphosphooctonate aldolase from legionella pneumophila philadelphia 1 0.9667 1 275
6mdy-assembly1.cif.gz_B crystal structure of a 2-dehydro-3-deoxyphosphooctonate aldolase from legionella pneumophila philadelphia 1 0.9661 1 277
6mdy-assembly1.cif.gz_C crystal structure of a 2-dehydro-3-deoxyphosphooctonate aldolase from legionella pneumophila philadelphia 1 0.9566 1 277
ID Description Score Start End Superfamily
1fwtA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.948 12 276 3.20.20.70
3t4cC00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9377 1 281 3.20.20.70
1fwtA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9305 12 276 3.20.20.70
3t4cC00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9238 1 281 3.20.20.70
1o60D00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.915 2 274 3.20.20.70
ID Description Score Start End GO Terms
AF-A0A536Y3N3-F1-model_v4 3-deoxy-8-phosphooctulonate synthase (EC 2.5.1.55) 0.9838 1 130 GO:0005737
GO:0008676
GO:0009103
AF-A0A257L132-F1-model_v4 3-deoxy-8-phosphooctulonate synthase (EC 2.5.1.55) 0.9795 1 175 GO:0005737
GO:0008676
GO:0009103
AF-A0A356HN51-F1-model_v4 deleted 0.9781 1 123
AF-A0A382NXE0-F1-model_v4 3-deoxy-8-phosphooctulonate synthase (EC 2.5.1.55) 0.9769 14 138 GO:0005737
GO:0008676
GO:0009058
AF-A0A365VQ31-F1-model_v4 deleted 0.9769 1 119

Feature Viewer

pLDDT pTM Quality
91.23 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map