F484996
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 896 | 402 | 847 | 282 |
Family's Representative Sequence
| Representative Sequence | 3300002737|JGI25162J39368_1000584|JGI25162J39368_10005846 |
| Length | 277 |
| Sequence | MKLCGFEVGLDKPLFLIAGPCVVESEQLQMDTAGKLKEITSKLGINFIFKSSFDKANRSSGTSFRGPGMEAGLKILAEVKRQLGVPVLTDVHEYTPMNEVAAVVDVLQTPAFLCRQTDFIQNVARAGKPVNIKKGQFLAPWDMKNVVEKAKAVGNDDIMVCERGASFGYNNLVSDMRSISVMRDTGCPVVFDATHSVQLPGGQGTSSGGQREFVPVLARAAVAVGVAGLFAETHPDPSKALSDGPNAWPLDKMEALLETLLELDQVTKRHQFLEHTL |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 2 | 2511231002 | Polaromonas sp. CF318 | Isolate | Rhizosphere |
| 3 | 2547132374 | Acidovorax radicis N35 | Isolate | Unclassified |
| 4 | 2585428062 | Methylibium sp. CF059 | Isolate | Rhizosphere |
| 5 | 2588253510 | Rhizobacter sp. OV335 | Isolate | Rhizosphere |
| 6 | 2643221544 | Pelomonas sp. Root1444 | Isolate | Unclassified |
| 7 | 2643221570 | Acidovorax sp. Root568 | Isolate | Unclassified |
| 8 | 2643221585 | Pelomonas sp. Root662 | Isolate | Unclassified |
| 9 | 2643221596 | Acidovorax sp. Root70 | Isolate | Unclassified |
| 10 | 2643221609 | Acidovorax sp. Root217 | Isolate | Unclassified |
| 11 | 2643221611 | Acidovorax sp. Root219 | Isolate | Unclassified |
| 12 | 2643221628 | Variovorax sp. Root318D1 | Isolate | Unclassified |
| 13 | 2643221639 | Pelomonas sp. Root1217 | Isolate | Unclassified |
| 14 | 2643221644 | Rhizobacter sp. Root1221 | Isolate | Unclassified |
| 15 | 2643221646 | Pelomonas sp. Root1237 | Isolate | Unclassified |
| 16 | 2643221652 | Acidovorax sp. Root402 | Isolate | Unclassified |
| 17 | 2643221656 | Pelomonas sp. Root405 | Isolate | Unclassified |
| 18 | 2643221660 | Methylibium sp. Root1272 | Isolate | Unclassified |
| 19 | 2643221683 | Variovorax sp. Root473 | Isolate | Unclassified |
| 20 | 2643221717 | Acidovorax sp. Root267 | Isolate | Unclassified |
| 21 | 2721755523 | Delftia sp. HK171 | Isolate | Unclassified |
| 22 | 2738541337 | Pelomonas sp. BT06 | Isolate | Unclassified |
| 23 | 2738543012 | Acidovorax sp. CF301 | Isolate | Unclassified |
| 24 | 2738543013 | Variovorax sp. BT01 | Isolate | Unclassified |
| 25 | 2808606418 | Herbaspirillum sp. SJZ107 | Isolate | Rhizosphere |
| 26 | 2816332133 | Acidovorax radicis 2721A | Isolate | Unclassified |
| 27 | 2834641062 | Cupriavidus gilardii JZ4 | Isolate | Unclassified |
| 28 | 2839138175 | Delftia acidovorans B15 | Isolate | Rhizosphere |
| 29 | 2842677519 | Variovorax sp. R-72495 | Isolate | Unclassified |
| 30 | 2842718218 | Acidovorax sp. R-73343 | Isolate | Unclassified |
| 31 | 2842733646 | Variovorax sp. R-72446 | Isolate | Unclassified |
| 32 | 2842747753 | Variovorax sp. R-72060 | Isolate | Unclassified |
| 33 | 2885192300 | Variovorax sp. MHTC-1 | Isolate | Rhizosphere |
| 34 | 2894023352 | Diaphorobacter ruginosibacter DSM 27467 | Isolate | Nodule |
| 35 | 2904434214 | Robbsia andropogonis 1567 | Isolate | Rhizosphere |
| 36 | 2904449895 | Variovorax sp. 1763 | Isolate | Rhizosphere |
| 37 | 2904456579 | Variovorax sp. 2002 | Isolate | Unclassified |
| 38 | 2919462493 | Variovorax sp. 3319 | Isolate | Rhizosphere |
| 39 | 2919704043 | Hydrogenophaga palleronii 4249 | Isolate | Unclassified |
| 40 | 2928115317 | Pseudacidovorax sp. 1753 | Isolate | Rhizosphere |
| 41 | 2929520902 | Variovorax beijingensis 502 | Isolate | Unclassified |
| 42 | 2932422444 | Comamonas sp. 4034 | Isolate | Rhizosphere |
| 43 | 2939631187 | Ottowia thiooxydans 2709 | Isolate | Rhizosphere |
| 44 | 2945909444 | Variovorax sp. CRF3-Va-1 W1I1 | Isolate | Rhizosphere |
| 45 | 2945945610 | Variovorax paradoxus W1I18 | Isolate | Rhizosphere |
| 46 | 2945972063 | Variovorax paradoxus W2I8 | Isolate | Rhizosphere |
| 47 | 2945984333 | Variovorax sp. W2I14 | Isolate | Rhizosphere |
| 48 | 2954767861 | Variovorax sp. TBS-050B | Isolate | Rhizosphere |
| 49 | 2990710928 | Acidovorax delafieldii SLBN-75 | Isolate | Rhizosphere |
| 50 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 51 | 3300002704 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB | Metagenome | Unclassified |
| 52 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 53 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 54 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 55 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 56 | 3300002771 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB | Metagenome | Endosphere |
| 57 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 58 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 59 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 60 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 61 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 62 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 63 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 64 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 65 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 66 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 67 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 68 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 69 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 70 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 71 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 72 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 73 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 74 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 75 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 76 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 77 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 78 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 79 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 80 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 81 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 82 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 83 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 84 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 85 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 86 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 87 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 88 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 89 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 90 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 91 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 92 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 93 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 94 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 95 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 96 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 97 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 98 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 99 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 100 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 101 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 102 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 103 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 104 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 105 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 106 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 107 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 108 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 109 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 110 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 111 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 112 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 113 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 114 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 115 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 116 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 117 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 118 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 119 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 120 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 121 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 122 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 123 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 124 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 125 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 126 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 127 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 128 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 129 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 130 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 131 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 132 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 133 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 134 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 135 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 136 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 137 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 138 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 139 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 140 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 141 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 143 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 144 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 145 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 146 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 147 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 149 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 150 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 151 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 152 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 153 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 155 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 156 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 157 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 158 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 159 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 160 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 161 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 162 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 163 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 164 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 165 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 166 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 167 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 168 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 169 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 170 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 171 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 172 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 173 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 174 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 175 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 176 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 177 | 3300015683 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 | Metagenome | Rhizosphere |
| 178 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 179 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 180 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 181 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 182 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 183 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 184 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 185 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 186 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 187 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 188 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 189 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 190 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 191 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 192 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 193 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 194 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 195 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 196 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 197 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 198 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 199 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 200 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 201 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 234 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 235 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 236 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 237 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 238 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 239 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 240 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 241 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 242 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 243 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 244 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 245 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 246 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 247 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 248 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 249 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 250 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 251 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 252 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 253 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 254 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 255 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 256 | 3300027378 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 257 | 3300027526 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 258 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 259 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 260 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 261 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 262 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 263 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 264 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 265 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 266 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 267 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 268 | 3300030731 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 | Metagenome | Rhizosphere |
| 269 | 3300030733 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 | Metagenome | Rhizosphere |
| 270 | 3300030734 | Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 | Metagenome | Rhizosphere |
| 271 | 3300030742 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 | Metagenome | Rhizosphere |
| 272 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 273 | 3300030745 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 | Metagenome | Rhizosphere |
| 274 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 275 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 276 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 277 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 278 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 279 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 280 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 281 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 282 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 283 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 284 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 285 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 286 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 287 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 288 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 289 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 290 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 291 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 292 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 293 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 294 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 295 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 296 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 297 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 298 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 299 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 300 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 301 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 302 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 303 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 304 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 305 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 306 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 307 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 308 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 309 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 310 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 311 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 312 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 313 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 314 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 315 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 316 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 317 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 318 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 319 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 320 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 321 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 322 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 323 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 324 | 3300042133 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 | Metagenome | Rhizosphere |
| 325 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 326 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 327 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 328 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 329 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 330 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 331 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 332 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 333 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 334 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 335 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 336 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 337 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 338 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 339 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 359 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 360 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 361 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 362 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 363 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 364 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 365 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 366 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 367 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 368 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 369 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 370 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 371 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 372 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 373 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 374 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 375 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 376 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 377 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 378 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 379 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 380 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 381 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 382 | 3300049649 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought | Metagenome | Rhizosphere |
| 383 | 3300049662 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control | Metagenome | Rhizosphere |
| 384 | 3300049759 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought | Metagenome | Rhizosphere |
| 385 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 386 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 387 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 388 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 389 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 390 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 391 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 392 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 393 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 394 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 395 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 396 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 397 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 398 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 399 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 400 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 401 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 402 | 8003400568 | Cupriavidus gilardii USM5 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 94.42 |
| Metatranscriptomes | 0.11 |
| Isolates | 5.47 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 15.96 |
| Nodule | 1 |
| Rhizoplane | 2.57 |
| Rhizosphere | 69.75 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 10.71 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL2b_contig_2165666 | 2162886007 | Bacteria | 1478 |
| 2 | JGI24739J22299_10013960 | 3300001989 | Bacteria | 2925 |
| 3 | JGI25155J39150_1000079 | 3300002704 | Bacteria | 56287 |
| 4 | JGI25156J39149_1000125 | 3300002705 | Bacteria | 56308 |
| 5 | JGI25162J39368_1000584 | 3300002737 | Bacteria | 26712 |
| 6 | JGI25154J39366_1000141 | 3300002738 | Bacteria | 56305 |
| 7 | JGI25157J39369_1000159 | 3300002741 | Bacteria | 56308 |
| 8 | JGI25157J39369_1001620 | 3300002741 | Bacteria | 7791 |
| 9 | JGI25163J39215_1000159 | 3300002771 | Bacteria | 26694 |
| 10 | JGI25164J39214_1000028 | 3300002772 | Bacteria | 150310 |
| 11 | JGI25150J39212_1001816 | 3300002774 | Bacteria | 5662 |
| 12 | JGI25159J45721_1000098 | 3300002987 | Bacteria | 41673 |
| 13 | JGI25159J45721_1006959 | 3300002987 | Bacteria | 3306 |
| 14 | JGI25151J46595_10015062 | 3300003187 | Bacteria | 3427 |
| 15 | JGI25151J46595_10017307 | 3300003187 | Bacteria | 3130 |
| 16 | JGI25151J46595_10021076 | 3300003187 | Bacteria | 2735 |
| 17 | JGI25151J46595_10026635 | 3300003187 | Bacteria | 2329 |
| 18 | JGI25165J46597_1000108 | 3300003214 | Bacteria | 150310 |
| 19 | rootL2_10017768 | 3300003322 | Bacteria | 1581 |
| 20 | JGI25160J50197_1000067 | 3300003354 | Bacteria | 113436 |
| 21 | JGI25161J50226_1000035 | 3300003374 | Bacteria | 133666 |
| 22 | Ga0006562J51391_1072863 | 3300003578 | Bacteria | 3470 |
| 23 | Ga0055538_1001470 | 3300003751 | Bacteria | 4493 |
| 24 | Ga0055525_1000011 | 3300003759 | Bacteria | 503124 |
| 25 | Ga0055535_1000976 | 3300003761 | Bacteria | 18665 |
| 26 | Ga0055542_1000691 | 3300003762 | Bacteria | 26712 |
| 27 | Ga0055529_1000078 | 3300003763 | Bacteria | 150310 |
| 28 | Ga0055526_1012424 | 3300003771 | Bacteria | 3717 |
| 29 | Ga0055526_1014166 | 3300003771 | Bacteria | 3304 |
| 30 | Ga0055537_1000490 | 3300003773 | Bacteria | 24227 |
| 31 | Ga0055537_1001225 | 3300003773 | Bacteria | 10779 |
| 32 | Ga0055537_1008939 | 3300003773 | Bacteria | 2258 |
| 33 | Ga0055524_1000006 | 3300003775 | Bacteria | 324702 |
| 34 | Ga0055524_1000080 | 3300003775 | Bacteria | 120203 |
| 35 | Ga0055536_1000447 | 3300003781 | Bacteria | 29029 |
| 36 | Ga0055536_1011365 | 3300003781 | Bacteria | 3421 |
| 37 | Ga0055534_1000042 | 3300003784 | Bacteria | 99433 |
| 38 | Ga0055534_1007760 | 3300003784 | Bacteria | 2513 |
| 39 | Ga0055528_1000242 | 3300003790 | Bacteria | 45905 |
| 40 | Ga0055528_1025062 | 3300003790 | Bacteria | 1766 |
| 41 | Ga0055530_10000154 | 3300003791 | Bacteria | 61878 |
| 42 | Ga0055530_10018003 | 3300003791 | Bacteria | 2194 |
| 43 | Ga0055540_1000002 | 3300003792 | Bacteria | 436954 |
| 44 | Ga0055540_1000005 | 3300003792 | Bacteria | 378126 |
| 45 | Ga0055540_1002002 | 3300003792 | Bacteria | 11371 |
| 46 | Ga0055540_1009923 | 3300003792 | Bacteria | 3221 |
| 47 | Ga0055531_10000607 | 3300003794 | Bacteria | 31111 |
| 48 | Ga0055531_10004641 | 3300003794 | Bacteria | 8250 |
| 49 | Ga0055543_1001234 | 3300004625 | Bacteria | 10671 |
| 50 | Ga0065165_1018365 | 3300005262 | Bacteria | 2533 |
| 51 | Ga0065165_1025665 | 3300005262 | Bacteria | 1954 |
| 52 | Ga0065165_1034706 | 3300005262 | Bacteria | 1557 |
| 53 | Ga0065165_1038846 | 3300005262 | Bacteria | 1431 |
| 54 | Ga0065714_10005692 | 3300005288 | Bacteria | 5083 |
| 55 | Ga0065714_10009585 | 3300005288 | Bacteria | 3638 |
| 56 | Ga0065704_10078204 | 3300005289 | Bacteria | 4499 |
| 57 | Ga0065712_10096751 | 3300005290 | Bacteria | 2173 |
| 58 | Ga0070658_10295950 | 3300005327 | Bacteria | 1380 |
| 59 | Ga0070676_10051123 | 3300005328 | Bacteria | 2425 |
| 60 | Ga0070676_10074266 | 3300005328 | Bacteria | 2047 |
| 61 | Ga0070676_10230831 | 3300005328 | Bacteria | 1227 |
| 62 | Ga0070683_100144544 | 3300005329 | Bacteria | 2253 |
| 63 | Ga0070683_100195668 | 3300005329 | Bacteria | 1919 |
| 64 | Ga0070670_100001820 | 3300005331 | Bacteria | 17371 |
| 65 | Ga0070670_100016116 | 3300005331 | Bacteria | 6414 |
| 66 | Ga0070670_100133748 | 3300005331 | Bacteria | 2142 |
| 67 | Ga0070670_100182630 | 3300005331 | Bacteria | 1821 |
| 68 | Ga0070670_100203386 | 3300005331 | Bacteria | 1721 |
| 69 | Ga0070670_100428261 | 3300005331 | Bacteria | 1170 |
| 70 | Ga0070677_10001548 | 3300005333 | Bacteria | 7279 |
| 71 | Ga0070677_10064149 | 3300005333 | Bacteria | 1524 |
| 72 | Ga0070677_10162993 | 3300005333 | Bacteria | 1048 |
| 73 | Ga0068869_100004736 | 3300005334 | Bacteria | 8487 |
| 74 | Ga0068869_100094453 | 3300005334 | Bacteria | 2254 |
| 75 | Ga0068869_100099494 | 3300005334 | Bacteria | 2198 |
| 76 | Ga0068869_100184867 | 3300005334 | Bacteria | 1635 |
| 77 | Ga0068869_100224294 | 3300005334 | Bacteria | 1491 |
| 78 | Ga0068869_100230330 | 3300005334 | Bacteria | 1472 |
| 79 | Ga0070666_10043187 | 3300005335 | Bacteria | 3018 |
| 80 | Ga0070680_100001873 | 3300005336 | Bacteria | 15421 |
| 81 | Ga0070680_100098893 | 3300005336 | Bacteria | 2421 |
| 82 | Ga0070682_100013288 | 3300005337 | Bacteria | 4735 |
| 83 | Ga0068868_100019821 | 3300005338 | Bacteria | 5045 |
| 84 | Ga0068868_100038602 | 3300005338 | Bacteria | 3707 |
| 85 | Ga0068868_100044804 | 3300005338 | Bacteria | 3459 |
| 86 | Ga0068868_100223448 | 3300005338 | Bacteria | 1577 |
| 87 | Ga0070660_100087926 | 3300005339 | Bacteria | 2446 |
| 88 | Ga0070689_100034512 | 3300005340 | Bacteria | 3860 |
| 89 | Ga0070661_100001206 | 3300005344 | Bacteria | 18196 |
| 90 | Ga0070661_100070089 | 3300005344 | Bacteria | 2578 |
| 91 | Ga0070661_100134856 | 3300005344 | Bacteria | 1857 |
| 92 | Ga0070661_100141366 | 3300005344 | Bacteria | 1814 |
| 93 | Ga0070668_100009291 | 3300005347 | Bacteria | 7292 |
| 94 | Ga0070668_100152483 | 3300005347 | Bacteria | 1870 |
| 95 | Ga0070669_100021681 | 3300005353 | Bacteria | 4591 |
| 96 | Ga0070669_100035355 | 3300005353 | Bacteria | 3619 |
| 97 | Ga0070669_100056517 | 3300005353 | Bacteria | 2877 |
| 98 | Ga0070669_100074542 | 3300005353 | Bacteria | 2516 |
| 99 | Ga0070669_100248588 | 3300005353 | Bacteria | 1415 |
| 100 | Ga0070669_100304978 | 3300005353 | Bacteria | 1282 |
| 101 | Ga0070675_100005184 | 3300005354 | Bacteria | 9937 |
| 102 | Ga0070675_100017625 | 3300005354 | Bacteria | 5678 |
| 103 | Ga0070675_100019867 | 3300005354 | Bacteria | 5359 |
| 104 | Ga0070675_100047712 | 3300005354 | Bacteria | 3510 |
| 105 | Ga0070675_100140465 | 3300005354 | Bacteria | 2064 |
| 106 | Ga0070675_100240952 | 3300005354 | Bacteria | 1580 |
| 107 | Ga0070671_100020104 | 3300005355 | Bacteria | 5441 |
| 108 | Ga0070671_100021133 | 3300005355 | Bacteria | 5314 |
| 109 | Ga0070671_100032037 | 3300005355 | Bacteria | 4346 |
| 110 | Ga0070671_100051569 | 3300005355 | Bacteria | 3422 |
| 111 | Ga0070671_100104371 | 3300005355 | Bacteria | 2378 |
| 112 | Ga0070671_100250238 | 3300005355 | Bacteria | 1505 |
| 113 | Ga0070671_100256485 | 3300005355 | Bacteria | 1486 |
| 114 | Ga0070674_100047523 | 3300005356 | Bacteria | 2941 |
| 115 | Ga0070674_100052925 | 3300005356 | Bacteria | 2801 |
| 116 | Ga0070674_100332420 | 3300005356 | Bacteria | 1222 |
| 117 | Ga0070673_100016137 | 3300005364 | Bacteria | 5271 |
| 118 | Ga0070673_100101542 | 3300005364 | Bacteria | 2370 |
| 119 | Ga0070673_100118033 | 3300005364 | Bacteria | 2209 |
| 120 | Ga0070673_100125705 | 3300005364 | Bacteria | 2145 |
| 121 | Ga0070659_100105331 | 3300005366 | Bacteria | 2272 |
| 122 | Ga0070659_100167311 | 3300005366 | Bacteria | 1799 |
| 123 | Ga0070667_100001171 | 3300005367 | Bacteria | 23847 |
| 124 | Ga0070667_100003010 | 3300005367 | Bacteria | 14476 |
| 125 | Ga0070667_100070593 | 3300005367 | Bacteria | 2973 |
| 126 | Ga0070667_100202497 | 3300005367 | Bacteria | 1762 |
| 127 | Ga0070667_100244654 | 3300005367 | Bacteria | 1603 |
| 128 | Ga0070667_100253932 | 3300005367 | Bacteria | 1572 |
| 129 | Ga0070700_100121960 | 3300005441 | Bacteria | 1748 |
| 130 | Ga0070663_100043641 | 3300005455 | Bacteria | 3156 |
| 131 | Ga0070663_100288266 | 3300005455 | Bacteria | 1310 |
| 132 | Ga0070663_100395556 | 3300005455 | Bacteria | 1128 |
| 133 | Ga0070678_100001334 | 3300005456 | Bacteria | 13117 |
| 134 | Ga0070678_100009607 | 3300005456 | Bacteria | 5871 |
| 135 | Ga0070678_100119544 | 3300005456 | Bacteria | 2075 |
| 136 | Ga0070678_100376883 | 3300005456 | Bacteria | 1227 |
| 137 | Ga0070662_100010471 | 3300005457 | Bacteria | 6087 |
| 138 | Ga0070662_100026458 | 3300005457 | Bacteria | 4018 |
| 139 | Ga0070662_100042844 | 3300005457 | Bacteria | 3235 |
| 140 | Ga0070662_100057864 | 3300005457 | Bacteria | 2818 |
| 141 | Ga0070662_100118656 | 3300005457 | Bacteria | 2025 |
| 142 | Ga0070662_100177172 | 3300005457 | Bacteria | 1679 |
| 143 | Ga0070662_100264095 | 3300005457 | Bacteria | 1388 |
| 144 | Ga0068867_100000815 | 3300005459 | Bacteria | 21046 |
| 145 | Ga0068867_100002971 | 3300005459 | Bacteria | 11946 |
| 146 | Ga0068867_100019006 | 3300005459 | Bacteria | 4892 |
| 147 | Ga0068867_100025400 | 3300005459 | Bacteria | 4250 |
| 148 | Ga0068867_100030023 | 3300005459 | Bacteria | 3920 |
| 149 | Ga0068867_100157367 | 3300005459 | Bacteria | 1790 |
| 150 | Ga0068867_100382539 | 3300005459 | Bacteria | 1182 |
| 151 | Ga0070706_100003926 | 3300005467 | Bacteria | 14492 |
| 152 | Ga0070707_100206103 | 3300005468 | Bacteria | 1916 |
| 153 | Ga0070679_100032769 | 3300005530 | Bacteria | 5142 |
| 154 | Ga0070679_100257989 | 3300005530 | Bacteria | 1698 |
| 155 | Ga0070684_100077908 | 3300005535 | Bacteria | 2928 |
| 156 | Ga0068853_100046481 | 3300005539 | Bacteria | 3722 |
| 157 | Ga0068853_100108827 | 3300005539 | Bacteria | 2459 |
| 158 | Ga0070672_100002062 | 3300005543 | Bacteria | 12665 |
| 159 | Ga0070672_100010713 | 3300005543 | Bacteria | 6369 |
| 160 | Ga0070672_100055349 | 3300005543 | Bacteria | 3107 |
| 161 | Ga0070672_100094795 | 3300005543 | Bacteria | 2413 |
| 162 | Ga0070672_100127067 | 3300005543 | Bacteria | 2092 |
| 163 | Ga0070672_100208158 | 3300005543 | Bacteria | 1637 |
| 164 | Ga0070693_100135876 | 3300005547 | Bacteria | 1542 |
| 165 | Ga0068855_100010968 | 3300005563 | Bacteria | 10935 |
| 166 | Ga0068855_100242662 | 3300005563 | Bacteria | 2012 |
| 167 | Ga0068855_100245701 | 3300005563 | Bacteria | 1998 |
| 168 | Ga0070664_100071398 | 3300005564 | Bacteria | 2975 |
| 169 | Ga0070664_100133510 | 3300005564 | Bacteria | 2181 |
| 170 | Ga0070664_100311042 | 3300005564 | Bacteria | 1425 |
| 171 | Ga0070664_100444546 | 3300005564 | Bacteria | 1189 |
| 172 | Ga0068857_100123879 | 3300005577 | Bacteria | 2329 |
| 173 | Ga0068857_100190795 | 3300005577 | Bacteria | 1866 |
| 174 | Ga0068857_100200631 | 3300005577 | Bacteria | 1818 |
| 175 | Ga0068854_100043894 | 3300005578 | Bacteria | 3171 |
| 176 | Ga0068856_100034780 | 3300005614 | Bacteria | 4936 |
| 177 | Ga0068856_100298390 | 3300005614 | Bacteria | 1629 |
| 178 | Ga0068856_100553496 | 3300005614 | Bacteria | 1171 |
| 179 | Ga0070702_100097362 | 3300005615 | Bacteria | 1797 |
| 180 | Ga0070702_100271548 | 3300005615 | Bacteria | 1160 |
| 181 | Ga0068852_100012899 | 3300005616 | Bacteria | 6371 |
| 182 | Ga0068852_100096174 | 3300005616 | Bacteria | 2661 |
| 183 | Ga0068852_100102065 | 3300005616 | Bacteria | 2591 |
| 184 | Ga0068852_100222779 | 3300005616 | Bacteria | 1794 |
| 185 | Ga0068852_100348988 | 3300005616 | Bacteria | 1444 |
| 186 | Ga0068852_100514681 | 3300005616 | Bacteria | 1193 |
| 187 | Ga0068859_100002636 | 3300005617 | Bacteria | 18245 |
| 188 | Ga0068859_100094634 | 3300005617 | Bacteria | 3040 |
| 189 | Ga0068859_100187823 | 3300005617 | Bacteria | 2150 |
| 190 | Ga0068864_100020879 | 3300005618 | Bacteria | 5482 |
| 191 | Ga0068864_100040062 | 3300005618 | Bacteria | 4007 |
| 192 | Ga0068864_100058859 | 3300005618 | Bacteria | 3322 |
| 193 | Ga0068864_100091754 | 3300005618 | Bacteria | 2680 |
| 194 | Ga0068864_100169549 | 3300005618 | Bacteria | 1989 |
| 195 | Ga0068864_100181318 | 3300005618 | Bacteria | 1925 |
| 196 | Ga0068864_100221315 | 3300005618 | Bacteria | 1746 |
| 197 | Ga0068864_100289355 | 3300005618 | Bacteria | 1531 |
| 198 | Ga0068861_100005018 | 3300005719 | Bacteria | 8924 |
| 199 | Ga0068861_100045628 | 3300005719 | Bacteria | 3301 |
| 200 | Ga0068861_100211756 | 3300005719 | Bacteria | 1633 |
| 201 | Ga0068851_10049114 | 3300005834 | Bacteria | 2139 |
| 202 | Ga0068851_10119189 | 3300005834 | Bacteria | 1416 |
| 203 | Ga0068870_10045754 | 3300005840 | Bacteria | 2293 |
| 204 | Ga0068863_100044253 | 3300005841 | Bacteria | 4226 |
| 205 | Ga0068863_100077587 | 3300005841 | Bacteria | 3144 |
| 206 | Ga0068863_100118573 | 3300005841 | Bacteria | 2522 |
| 207 | Ga0068863_100122546 | 3300005841 | Bacteria | 2480 |
| 208 | Ga0068863_100186160 | 3300005841 | Bacteria | 1994 |
| 209 | Ga0068858_100033970 | 3300005842 | Bacteria | 4731 |
| 210 | Ga0068858_100086630 | 3300005842 | Bacteria | 2913 |
| 211 | Ga0068860_100001433 | 3300005843 | Bacteria | 25834 |
| 212 | Ga0068860_100002888 | 3300005843 | Bacteria | 17820 |
| 213 | Ga0068860_100086627 | 3300005843 | Bacteria | 2981 |
| 214 | Ga0068862_100073189 | 3300005844 | Bacteria | 2961 |
| 215 | Ga0068862_100085473 | 3300005844 | Bacteria | 2741 |
| 216 | Ga0075365_10034142 | 3300006038 | Bacteria | 3284 |
| 217 | Ga0075363_100027625 | 3300006048 | Bacteria | 2911 |
| 218 | Ga0075363_100049080 | 3300006048 | Bacteria | 2246 |
| 219 | Ga0075363_100075231 | 3300006048 | Bacteria | 1840 |
| 220 | Ga0075363_100130981 | 3300006048 | Bacteria | 1406 |
| 221 | Ga0075364_10036978 | 3300006051 | Bacteria | 3159 |
| 222 | Ga0075432_10015651 | 3300006058 | Bacteria | 2587 |
| 223 | Ga0075362_10034752 | 3300006177 | Bacteria | 2198 |
| 224 | Ga0075362_10036357 | 3300006177 | Bacteria | 2154 |
| 225 | Ga0075362_10058139 | 3300006177 | Bacteria | 1744 |
| 226 | Ga0075362_10104534 | 3300006177 | Bacteria | 1327 |
| 227 | Ga0075367_10020509 | 3300006178 | Bacteria | 3682 |
| 228 | Ga0075367_10021504 | 3300006178 | Bacteria | 3606 |
| 229 | Ga0075367_10055062 | 3300006178 | Bacteria | 2359 |
| 230 | Ga0075366_10004084 | 3300006195 | Bacteria | 7804 |
| 231 | Ga0075366_10010236 | 3300006195 | Bacteria | 5261 |
| 232 | Ga0075366_10032117 | 3300006195 | Bacteria | 3090 |
| 233 | Ga0075366_10036620 | 3300006195 | Bacteria | 2893 |
| 234 | Ga0075366_10037483 | 3300006195 | Bacteria | 2863 |
| 235 | Ga0075366_10048963 | 3300006195 | Bacteria | 2507 |
| 236 | Ga0075366_10073530 | 3300006195 | Bacteria | 2038 |
| 237 | Ga0075366_10079616 | 3300006195 | Bacteria | 1956 |
| 238 | Ga0097621_100059305 | 3300006237 | Bacteria | 3133 |
| 239 | Ga0097621_100078866 | 3300006237 | Bacteria | 2736 |
| 240 | Ga0097621_100084493 | 3300006237 | Bacteria | 2646 |
| 241 | Ga0097621_100251520 | 3300006237 | Bacteria | 1547 |
| 242 | Ga0075370_10006682 | 3300006353 | Bacteria | 5818 |
| 243 | Ga0075370_10015610 | 3300006353 | Bacteria | 4069 |
| 244 | Ga0075370_10020892 | 3300006353 | Bacteria | 3584 |
| 245 | Ga0075370_10089462 | 3300006353 | Bacteria | 1775 |
| 246 | Ga0075370_10150175 | 3300006353 | Bacteria | 1365 |
| 247 | Ga0068871_100040812 | 3300006358 | Bacteria | 3718 |
| 248 | Ga0068871_100078969 | 3300006358 | Bacteria | 2722 |
| 249 | Ga0068871_100226750 | 3300006358 | Bacteria | 1620 |
| 250 | Ga0075430_100090622 | 3300006846 | Bacteria | 2558 |
| 251 | Ga0075430_100113633 | 3300006846 | Bacteria | 2257 |
| 252 | Ga0075429_100004495 | 3300006880 | Bacteria | 11996 |
| 253 | Ga0068865_100130144 | 3300006881 | Bacteria | 1884 |
| 254 | Ga0068865_100206821 | 3300006881 | Bacteria | 1527 |
| 255 | Ga0068865_100213969 | 3300006881 | Bacteria | 1503 |
| 256 | Ga0097620_100002636 | 3300006931 | Bacteria | 18245 |
| 257 | Ga0097620_100094639 | 3300006931 | Bacteria | 3040 |
| 258 | Ga0097620_100187829 | 3300006931 | Bacteria | 2150 |
| 259 | Ga0079104_1000002 | 3300006946 | Bacteria | 514469 |
| 260 | Ga0079104_1000017 | 3300006946 | Bacteria | 313784 |
| 261 | Ga0099826_10126482 | 3300006948 | Bacteria | 1497 |
| 262 | Ga0099826_10130715 | 3300006948 | Bacteria | 1464 |
| 263 | Ga0105250_10001691 | 3300009092 | Bacteria | 11652 |
| 264 | Ga0105240_10003241 | 3300009093 | Bacteria | 25466 |
| 265 | Ga0105240_10100781 | 3300009093 | Bacteria | 3514 |
| 266 | Ga0105240_10215679 | 3300009093 | Bacteria | 2239 |
| 267 | Ga0105240_10495046 | 3300009093 | Bacteria | 1360 |
| 268 | Ga0105245_10570985 | 3300009098 | Bacteria | 1155 |
| 269 | Ga0114129_10506345 | 3300009147 | Bacteria | 1576 |
| 270 | Ga0105243_10004697 | 3300009148 | Bacteria | 10752 |
| 271 | Ga0105243_10035673 | 3300009148 | Bacteria | 3856 |
| 272 | Ga0105243_10036120 | 3300009148 | Bacteria | 3833 |
| 273 | Ga0105243_10039925 | 3300009148 | Bacteria | 3662 |
| 274 | Ga0105243_10051142 | 3300009148 | Bacteria | 3267 |
| 275 | Ga0105243_10147809 | 3300009148 | Bacteria | 2012 |
| 276 | Ga0105241_10219704 | 3300009174 | Bacteria | 1596 |
| 277 | Ga0105248_10004383 | 3300009177 | Bacteria | 15617 |
| 278 | Ga0105248_10340666 | 3300009177 | Bacteria | 1688 |
| 279 | Ga0105248_10378942 | 3300009177 | Bacteria | 1593 |
| 280 | Ga0105237_10022934 | 3300009545 | Bacteria | 6401 |
| 281 | Ga0105237_10129037 | 3300009545 | Bacteria | 2523 |
| 282 | Ga0105237_10392414 | 3300009545 | Bacteria | 1393 |
| 283 | Ga0105238_10007213 | 3300009551 | Bacteria | 11126 |
| 284 | Ga0105238_10055568 | 3300009551 | Bacteria | 3974 |
| 285 | Ga0105238_10059028 | 3300009551 | Bacteria | 3844 |
| 286 | Ga0105238_10145211 | 3300009551 | Bacteria | 2349 |
| 287 | Ga0105249_10072632 | 3300009553 | Bacteria | 3181 |
| 288 | Ga0105249_10108902 | 3300009553 | Bacteria | 2616 |
| 289 | Ga0105239_10003789 | 3300010375 | Bacteria | 18406 |
| 290 | Ga0105239_10085101 | 3300010375 | Bacteria | 3484 |
| 291 | Ga0105239_10358062 | 3300010375 | Bacteria | 1648 |
| 292 | Ga0157373_10037135 | 3300013100 | Bacteria | 3494 |
| 293 | Ga0157370_10120358 | 3300013104 | Bacteria | 2451 |
| 294 | Ga0157370_10265804 | 3300013104 | Bacteria | 1585 |
| 295 | Ga0157369_10106740 | 3300013105 | Bacteria | 2980 |
| 296 | Ga0157369_10212493 | 3300013105 | Bacteria | 2027 |
| 297 | Ga0157374_10048034 | 3300013296 | Bacteria | 3959 |
| 298 | Ga0157374_10171718 | 3300013296 | Bacteria | 2115 |
| 299 | Ga0157378_10077966 | 3300013297 | Bacteria | 2988 |
| 300 | Ga0163162_10017076 | 3300013306 | Bacteria | 7100 |
| 301 | Ga0163162_10094494 | 3300013306 | Bacteria | 3076 |
| 302 | Ga0163162_10102728 | 3300013306 | Bacteria | 2952 |
| 303 | Ga0163162_10495827 | 3300013306 | Bacteria | 1352 |
| 304 | Ga0157372_10077049 | 3300013307 | Bacteria | 3765 |
| 305 | Ga0157372_10246431 | 3300013307 | Bacteria | 2073 |
| 306 | Ga0157375_10151253 | 3300013308 | Bacteria | 2457 |
| 307 | Ga0157375_10242243 | 3300013308 | Bacteria | 1963 |
| 308 | Ga0157375_10430043 | 3300013308 | Bacteria | 1486 |
| 309 | Ga0163163_10313942 | 3300014325 | Bacteria | 1621 |
| 310 | Ga0157380_10138554 | 3300014326 | Bacteria | 2087 |
| 311 | Ga0157380_10150634 | 3300014326 | Bacteria | 2010 |
| 312 | Ga0182008_10030116 | 3300014497 | Bacteria | 2738 |
| 313 | Ga0182008_10039803 | 3300014497 | Bacteria | 2348 |
| 314 | Ga0157377_10000382 | 3300014745 | Bacteria | 19272 |
| 315 | Ga0157377_10090589 | 3300014745 | Bacteria | 1805 |
| 316 | Ga0157379_10013894 | 3300014968 | Bacteria | 7057 |
| 317 | Ga0157379_10074533 | 3300014968 | Bacteria | 3038 |
| 318 | Ga0157379_10111962 | 3300014968 | Bacteria | 2452 |
| 319 | Ga0157379_10187678 | 3300014968 | Bacteria | 1868 |
| 320 | Ga0157379_10189108 | 3300014968 | Bacteria | 1861 |
| 321 | Ga0157379_10215996 | 3300014968 | Bacteria | 1737 |
| 322 | Ga0157379_10235205 | 3300014968 | Bacteria | 1661 |
| 323 | Ga0157379_10434370 | 3300014968 | Bacteria | 1210 |
| 324 | Ga0157376_10016007 | 3300014969 | Bacteria | 5683 |
| 325 | Ga0157376_10117911 | 3300014969 | Bacteria | 2348 |
| 326 | Ga0157376_10292907 | 3300014969 | Bacteria | 1537 |
| 327 | Ga0182006_1012764 | 3300015261 | Bacteria | 3668 |
| 328 | Ga0182007_10013133 | 3300015262 | Bacteria | 3171 |
| 329 | Ga0183362_10003 | 3300015683 | Bacteria | 977584 |
| 330 | Ga0163161_10000166 | 3300017792 | Bacteria | 60327 |
| 331 | Ga0163161_10046164 | 3300017792 | Bacteria | 3142 |
| 332 | Ga0163161_10119951 | 3300017792 | Bacteria | 1975 |
| 333 | Ga0163161_10254311 | 3300017792 | Bacteria | 1370 |
| 334 | Ga0213872_10000011 | 3300021361 | Bacteria | 194139 |
| 335 | Ga0213872_10000361 | 3300021361 | Bacteria | 38243 |
| 336 | Ga0213872_10073865 | 3300021361 | Bacteria | 1535 |
| 337 | Ga0213874_10052812 | 3300021377 | Bacteria | 1252 |
| 338 | Ga0209435_100001 | 3300025206 | Bacteria | 1424171 |
| 339 | Ga0209563_100005 | 3300025230 | Bacteria | 1774893 |
| 340 | Ga0207425_1002262 | 3300025245 | Bacteria | 6965 |
| 341 | Ga0207425_1004662 | 3300025245 | Bacteria | 4056 |
| 342 | Ga0209646_1000001 | 3300025246 | Bacteria | 3092932 |
| 343 | Ga0209026_1000003 | 3300025250 | Bacteria | 1060571 |
| 344 | Ga0209759_1000001 | 3300025256 | Bacteria | 2799452 |
| 345 | Ga0209129_1015901 | 3300025258 | Bacteria | 1528 |
| 346 | Ga0209129_1016072 | 3300025258 | Bacteria | 1515 |
| 347 | Ga0209565_1000083 | 3300025263 | Bacteria | 154007 |
| 348 | Ga0209565_1000246 | 3300025263 | Bacteria | 57871 |
| 349 | Ga0209565_1002553 | 3300025263 | Bacteria | 6472 |
| 350 | Ga0209565_1006028 | 3300025263 | Bacteria | 3454 |
| 351 | Ga0209565_1014281 | 3300025263 | Bacteria | 1829 |
| 352 | Ga0209673_1000043 | 3300025273 | Bacteria | 291503 |
| 353 | Ga0209673_1000323 | 3300025273 | Bacteria | 87588 |
| 354 | Ga0209130_1000241 | 3300025284 | Bacteria | 70093 |
| 355 | Ga0209130_1000623 | 3300025284 | Bacteria | 33778 |
| 356 | Ga0209130_1001702 | 3300025284 | Bacteria | 13299 |
| 357 | Ga0209675_1000081 | 3300025291 | Bacteria | 154007 |
| 358 | Ga0209675_1000309 | 3300025291 | Bacteria | 44113 |
| 359 | Ga0209675_1002145 | 3300025291 | Bacteria | 10408 |
| 360 | Ga0209675_1013293 | 3300025291 | Bacteria | 2586 |
| 361 | Ga0209676_1000007 | 3300025292 | Bacteria | 1029371 |
| 362 | Ga0209676_1001036 | 3300025292 | Bacteria | 32214 |
| 363 | Ga0209676_1011543 | 3300025292 | Bacteria | 3552 |
| 364 | Ga0209676_1016039 | 3300025292 | Bacteria | 2728 |
| 365 | Ga0209025_1001296 | 3300025294 | Bacteria | 34134 |
| 366 | Ga0209025_1001745 | 3300025294 | Bacteria | 26100 |
| 367 | Ga0209025_1003641 | 3300025294 | Bacteria | 14310 |
| 368 | Ga0209025_1004965 | 3300025294 | Bacteria | 11133 |
| 369 | Ga0209025_1092425 | 3300025294 | Bacteria | 984 |
| 370 | Ga0209564_1000285 | 3300025295 | Bacteria | 102585 |
| 371 | Ga0209564_1013541 | 3300025295 | Bacteria | 3453 |
| 372 | Ga0209564_1022325 | 3300025295 | Bacteria | 2241 |
| 373 | Ga0209758_1018074 | 3300025297 | Bacteria | 3475 |
| 374 | Ga0209758_1028601 | 3300025297 | Bacteria | 2352 |
| 375 | Ga0209050_1000003 | 3300025298 | Bacteria | 1609245 |
| 376 | Ga0209050_1006287 | 3300025298 | Bacteria | 7101 |
| 377 | Ga0209050_1008094 | 3300025298 | Bacteria | 5707 |
| 378 | Ga0209050_1009215 | 3300025298 | Bacteria | 5096 |
| 379 | Ga0209256_1000001 | 3300025299 | Bacteria | 2166974 |
| 380 | Ga0209256_1000011 | 3300025299 | Bacteria | 865309 |
| 381 | Ga0209256_1022688 | 3300025299 | Bacteria | 1893 |
| 382 | Ga0207426_1000247 | 3300025302 | Bacteria | 119659 |
| 383 | Ga0207426_1011141 | 3300025302 | Bacteria | 3445 |
| 384 | Ga0209051_1000003 | 3300025303 | Bacteria | 1609245 |
| 385 | Ga0209051_1000024 | 3300025303 | Bacteria | 437007 |
| 386 | Ga0209051_1000373 | 3300025303 | Bacteria | 64348 |
| 387 | Ga0209051_1002063 | 3300025303 | Bacteria | 15237 |
| 388 | Ga0209257_1000020 | 3300025304 | Bacteria | 773356 |
| 389 | Ga0209257_1000079 | 3300025304 | Bacteria | 316420 |
| 390 | Ga0207697_10043396 | 3300025315 | Bacteria | 1849 |
| 391 | Ga0207682_10001523 | 3300025893 | Bacteria | 10677 |
| 392 | Ga0207682_10025532 | 3300025893 | Bacteria | 2343 |
| 393 | Ga0207682_10034307 | 3300025893 | Bacteria | 2045 |
| 394 | Ga0207682_10034969 | 3300025893 | Bacteria | 2028 |
| 395 | Ga0207642_10006005 | 3300025899 | Bacteria | 4008 |
| 396 | Ga0207710_10044146 | 3300025900 | Bacteria | 1984 |
| 397 | Ga0207688_10049012 | 3300025901 | Bacteria | 2360 |
| 398 | Ga0207680_10157086 | 3300025903 | Bacteria | 1522 |
| 399 | Ga0207645_10060058 | 3300025907 | Bacteria | 2428 |
| 400 | Ga0207645_10209487 | 3300025907 | Bacteria | 1284 |
| 401 | Ga0207643_10035221 | 3300025908 | Bacteria | 2806 |
| 402 | Ga0207643_10070522 | 3300025908 | Bacteria | 2010 |
| 403 | Ga0207705_10168516 | 3300025909 | Bacteria | 1648 |
| 404 | Ga0207705_10223921 | 3300025909 | Bacteria | 1429 |
| 405 | Ga0207707_10063466 | 3300025912 | Bacteria | 3215 |
| 406 | Ga0207671_10017960 | 3300025914 | Bacteria | 5442 |
| 407 | Ga0207660_10003088 | 3300025917 | Bacteria | 10880 |
| 408 | Ga0207662_10033021 | 3300025918 | Bacteria | 3014 |
| 409 | Ga0207662_10237245 | 3300025918 | Bacteria | 1193 |
| 410 | Ga0207657_10098939 | 3300025919 | Bacteria | 2423 |
| 411 | Ga0207657_10104544 | 3300025919 | Bacteria | 2345 |
| 412 | Ga0207657_10191083 | 3300025919 | Bacteria | 1652 |
| 413 | Ga0207657_10213280 | 3300025919 | Bacteria | 1549 |
| 414 | Ga0207657_10287065 | 3300025919 | Bacteria | 1305 |
| 415 | Ga0207649_10004481 | 3300025920 | Bacteria | 7576 |
| 416 | Ga0207649_10061414 | 3300025920 | Bacteria | 2365 |
| 417 | Ga0207649_10065870 | 3300025920 | Bacteria | 2295 |
| 418 | Ga0207652_10012428 | 3300025921 | Bacteria | 6881 |
| 419 | Ga0207681_10033139 | 3300025923 | Bacteria | 3385 |
| 420 | Ga0207681_10051113 | 3300025923 | Bacteria | 2799 |
| 421 | Ga0207681_10063806 | 3300025923 | Bacteria | 2541 |
| 422 | Ga0207681_10110231 | 3300025923 | Bacteria | 2001 |
| 423 | Ga0207681_10222071 | 3300025923 | Bacteria | 1462 |
| 424 | Ga0207694_10052371 | 3300025924 | Bacteria | 3164 |
| 425 | Ga0207650_10002460 | 3300025925 | Bacteria | 12887 |
| 426 | Ga0207650_10009009 | 3300025925 | Bacteria | 6823 |
| 427 | Ga0207650_10066075 | 3300025925 | Bacteria | 2711 |
| 428 | Ga0207650_10211125 | 3300025925 | Bacteria | 1559 |
| 429 | Ga0207659_10008467 | 3300025926 | Bacteria | 6385 |
| 430 | Ga0207659_10009925 | 3300025926 | Bacteria | 5958 |
| 431 | Ga0207659_10021859 | 3300025926 | Bacteria | 4254 |
| 432 | Ga0207659_10141592 | 3300025926 | Bacteria | 1867 |
| 433 | Ga0207659_10271162 | 3300025926 | Bacteria | 1384 |
| 434 | Ga0207687_10167859 | 3300025927 | Bacteria | 1690 |
| 435 | Ga0207687_10371824 | 3300025927 | Bacteria | 1169 |
| 436 | Ga0207644_10016645 | 3300025931 | Bacteria | 4949 |
| 437 | Ga0207644_10092585 | 3300025931 | Bacteria | 2255 |
| 438 | Ga0207644_10136571 | 3300025931 | Bacteria | 1883 |
| 439 | Ga0207690_10061279 | 3300025932 | Bacteria | 2557 |
| 440 | Ga0207690_10327615 | 3300025932 | Bacteria | 1205 |
| 441 | Ga0207706_10000845 | 3300025933 | Bacteria | 31549 |
| 442 | Ga0207706_10021027 | 3300025933 | Bacteria | 5862 |
| 443 | Ga0207706_10053240 | 3300025933 | Bacteria | 3573 |
| 444 | Ga0207706_10060560 | 3300025933 | Bacteria | 3333 |
| 445 | Ga0207706_10063023 | 3300025933 | Bacteria | 3265 |
| 446 | Ga0207706_10063573 | 3300025933 | Bacteria | 3249 |
| 447 | Ga0207706_10069481 | 3300025933 | Bacteria | 3098 |
| 448 | Ga0207686_10065792 | 3300025934 | Bacteria | 2313 |
| 449 | Ga0207709_10000015 | 3300025935 | Bacteria | 493221 |
| 450 | Ga0207709_10000424 | 3300025935 | Bacteria | 40863 |
| 451 | Ga0207709_10011879 | 3300025935 | Bacteria | 4804 |
| 452 | Ga0207709_10016722 | 3300025935 | Bacteria | 4083 |
| 453 | Ga0207709_10086004 | 3300025935 | Bacteria | 2040 |
| 454 | Ga0207709_10096765 | 3300025935 | Bacteria | 1942 |
| 455 | Ga0207670_10114728 | 3300025936 | Bacteria | 1947 |
| 456 | Ga0207670_10249727 | 3300025936 | Bacteria | 1370 |
| 457 | Ga0207669_10073705 | 3300025937 | Bacteria | 2155 |
| 458 | Ga0207669_10090249 | 3300025937 | Bacteria | 1992 |
| 459 | Ga0207704_10023614 | 3300025938 | Bacteria | 3317 |
| 460 | Ga0207704_10099319 | 3300025938 | Bacteria | 1936 |
| 461 | Ga0207665_10080409 | 3300025939 | Bacteria | 2242 |
| 462 | Ga0207691_10006082 | 3300025940 | Bacteria | 11664 |
| 463 | Ga0207691_10007915 | 3300025940 | Bacteria | 10231 |
| 464 | Ga0207691_10054365 | 3300025940 | Bacteria | 3653 |
| 465 | Ga0207691_10064932 | 3300025940 | Bacteria | 3306 |
| 466 | Ga0207691_10087220 | 3300025940 | Bacteria | 2800 |
| 467 | Ga0207691_10108677 | 3300025940 | Bacteria | 2468 |
| 468 | Ga0207691_10109867 | 3300025940 | Bacteria | 2453 |
| 469 | Ga0207691_10205047 | 3300025940 | Bacteria | 1715 |
| 470 | Ga0207691_10306427 | 3300025940 | Bacteria | 1364 |
| 471 | Ga0207711_10028966 | 3300025941 | Bacteria | 4666 |
| 472 | Ga0207711_10067388 | 3300025941 | Bacteria | 3098 |
| 473 | Ga0207711_10182188 | 3300025941 | Bacteria | 1911 |
| 474 | Ga0207711_10273282 | 3300025941 | Bacteria | 1555 |
| 475 | Ga0207689_10000225 | 3300025942 | Bacteria | 50122 |
| 476 | Ga0207689_10011178 | 3300025942 | Bacteria | 7701 |
| 477 | Ga0207689_10014824 | 3300025942 | Bacteria | 6617 |
| 478 | Ga0207689_10099591 | 3300025942 | Bacteria | 2388 |
| 479 | Ga0207689_10120858 | 3300025942 | Bacteria | 2155 |
| 480 | Ga0207689_10143284 | 3300025942 | Bacteria | 1969 |
| 481 | Ga0207689_10303026 | 3300025942 | Bacteria | 1324 |
| 482 | Ga0207689_10458555 | 3300025942 | Bacteria | 1066 |
| 483 | Ga0207661_10071924 | 3300025944 | Bacteria | 2828 |
| 484 | Ga0207661_10190549 | 3300025944 | Bacteria | 1797 |
| 485 | Ga0207679_10000637 | 3300025945 | Bacteria | 23370 |
| 486 | Ga0207679_10093459 | 3300025945 | Bacteria | 2332 |
| 487 | Ga0207679_10221671 | 3300025945 | Bacteria | 1591 |
| 488 | Ga0207667_10115644 | 3300025949 | Bacteria | 2765 |
| 489 | Ga0207667_10147545 | 3300025949 | Bacteria | 2421 |
| 490 | Ga0207667_10367606 | 3300025949 | Bacteria | 1466 |
| 491 | Ga0207667_10482118 | 3300025949 | Bacteria | 1259 |
| 492 | Ga0207651_10022218 | 3300025960 | Bacteria | 3873 |
| 493 | Ga0207651_10022563 | 3300025960 | Bacteria | 3851 |
| 494 | Ga0207651_10048057 | 3300025960 | Bacteria | 2881 |
| 495 | Ga0207651_10241507 | 3300025960 | Bacteria | 1472 |
| 496 | Ga0207651_10463435 | 3300025960 | Bacteria | 1089 |
| 497 | Ga0207712_10005511 | 3300025961 | Bacteria | 7984 |
| 498 | Ga0207712_10040982 | 3300025961 | Bacteria | 3181 |
| 499 | Ga0207712_10062282 | 3300025961 | Bacteria | 2651 |
| 500 | Ga0207668_10037660 | 3300025972 | Bacteria | 3239 |
| 501 | Ga0207668_10104228 | 3300025972 | Bacteria | 2114 |
| 502 | Ga0207668_10173140 | 3300025972 | Bacteria | 1695 |
| 503 | Ga0207640_10182293 | 3300025981 | Bacteria | 1575 |
| 504 | Ga0207640_10367989 | 3300025981 | Bacteria | 1161 |
| 505 | Ga0207658_10000959 | 3300025986 | Bacteria | 23778 |
| 506 | Ga0207658_10009082 | 3300025986 | Bacteria | 6742 |
| 507 | Ga0207658_10095778 | 3300025986 | Bacteria | 2313 |
| 508 | Ga0207658_10156383 | 3300025986 | Bacteria | 1863 |
| 509 | Ga0207677_10005131 | 3300026023 | Bacteria | 7088 |
| 510 | Ga0207677_10007983 | 3300026023 | Bacteria | 5886 |
| 511 | Ga0207677_10036090 | 3300026023 | Bacteria | 3218 |
| 512 | Ga0207677_10082138 | 3300026023 | Bacteria | 2315 |
| 513 | Ga0207703_10001350 | 3300026035 | Bacteria | 22464 |
| 514 | Ga0207703_10016674 | 3300026035 | Bacteria | 5731 |
| 515 | Ga0207703_10112459 | 3300026035 | Bacteria | 2326 |
| 516 | Ga0207703_10171927 | 3300026035 | Bacteria | 1906 |
| 517 | Ga0207703_10179316 | 3300026035 | Bacteria | 1869 |
| 518 | Ga0207639_10137219 | 3300026041 | Bacteria | 2033 |
| 519 | Ga0207639_10311087 | 3300026041 | Bacteria | 1395 |
| 520 | Ga0207639_10321025 | 3300026041 | Bacteria | 1375 |
| 521 | Ga0207678_10059694 | 3300026067 | Bacteria | 3282 |
| 522 | Ga0207678_10132667 | 3300026067 | Bacteria | 2125 |
| 523 | Ga0207678_10139535 | 3300026067 | Bacteria | 2068 |
| 524 | Ga0207708_10158905 | 3300026075 | Bacteria | 1784 |
| 525 | Ga0207702_10014241 | 3300026078 | Bacteria | 6604 |
| 526 | Ga0207702_10201368 | 3300026078 | Bacteria | 1846 |
| 527 | Ga0207641_10009363 | 3300026088 | Bacteria | 8078 |
| 528 | Ga0207641_10159332 | 3300026088 | Bacteria | 2050 |
| 529 | Ga0207648_10002629 | 3300026089 | Bacteria | 19224 |
| 530 | Ga0207648_10024680 | 3300026089 | Bacteria | 5363 |
| 531 | Ga0207648_10037756 | 3300026089 | Bacteria | 4253 |
| 532 | Ga0207648_10093629 | 3300026089 | Bacteria | 2627 |
| 533 | Ga0207648_10113433 | 3300026089 | Bacteria | 2380 |
| 534 | Ga0207648_10131878 | 3300026089 | Bacteria | 2199 |
| 535 | Ga0207648_10145231 | 3300026089 | Bacteria | 2092 |
| 536 | Ga0207648_10149930 | 3300026089 | Bacteria | 2057 |
| 537 | Ga0207648_10191397 | 3300026089 | Bacteria | 1813 |
| 538 | Ga0207648_10215001 | 3300026089 | Bacteria | 1707 |
| 539 | Ga0207676_10010315 | 3300026095 | Bacteria | 6653 |
| 540 | Ga0207676_10015099 | 3300026095 | Bacteria | 5569 |
| 541 | Ga0207676_10026111 | 3300026095 | Bacteria | 4341 |
| 542 | Ga0207676_10026609 | 3300026095 | Bacteria | 4302 |
| 543 | Ga0207676_10219278 | 3300026095 | Bacteria | 1693 |
| 544 | Ga0207676_10274003 | 3300026095 | Bacteria | 1529 |
| 545 | Ga0207674_10008218 | 3300026116 | Bacteria | 12093 |
| 546 | Ga0207674_10022905 | 3300026116 | Bacteria | 6701 |
| 547 | Ga0207674_10162897 | 3300026116 | Bacteria | 2185 |
| 548 | Ga0207675_100000728 | 3300026118 | Bacteria | 32670 |
| 549 | Ga0207675_100001260 | 3300026118 | Bacteria | 25268 |
| 550 | Ga0207675_100094683 | 3300026118 | Bacteria | 2809 |
| 551 | Ga0207683_10103395 | 3300026121 | Bacteria | 2545 |
| 552 | Ga0207683_10113119 | 3300026121 | Bacteria | 2431 |
| 553 | Ga0207683_10161670 | 3300026121 | Bacteria | 2025 |
| 554 | Ga0207683_10382882 | 3300026121 | Bacteria | 1293 |
| 555 | Ga0207683_10400375 | 3300026121 | Bacteria | 1263 |
| 556 | Ga0207698_10008850 | 3300026142 | Bacteria | 6382 |
| 557 | Ga0207698_10200493 | 3300026142 | Bacteria | 1786 |
| 558 | Ga0207698_10259193 | 3300026142 | Bacteria | 1596 |
| 559 | Ga0207698_10300083 | 3300026142 | Bacteria | 1495 |
| 560 | Ga0207698_10549191 | 3300026142 | Bacteria | 1132 |
| 561 | Ga0209281_1000007 | 3300027111 | Bacteria | 938265 |
| 562 | Ga0209281_1000042 | 3300027111 | Bacteria | 344748 |
| 563 | Ga0209981_1005382 | 3300027378 | Bacteria | 1699 |
| 564 | Ga0209968_1000691 | 3300027526 | Bacteria | 5183 |
| 565 | Ga0209282_1001276 | 3300027666 | Bacteria | 13672 |
| 566 | Ga0209282_1108405 | 3300027666 | Bacteria | 1415 |
| 567 | Ga0209966_1000036 | 3300027695 | Bacteria | 55883 |
| 568 | Ga0209974_10003598 | 3300027876 | Bacteria | 5568 |
| 569 | Ga0209974_10012937 | 3300027876 | Bacteria | 2785 |
| 570 | Ga0268266_10024378 | 3300028379 | Bacteria | 5145 |
| 571 | Ga0268266_10175172 | 3300028379 | Bacteria | 1950 |
| 572 | Ga0268265_10025246 | 3300028380 | Bacteria | 4215 |
| 573 | Ga0268265_10036125 | 3300028380 | Bacteria | 3617 |
| 574 | Ga0268265_10040812 | 3300028380 | Bacteria | 3429 |
| 575 | Ga0268265_10304936 | 3300028380 | Bacteria | 1435 |
| 576 | Ga0268264_10004852 | 3300028381 | Bacteria | 11396 |
| 577 | Ga0268264_10042982 | 3300028381 | Bacteria | 3743 |
| 578 | Ga0268264_10262861 | 3300028381 | Bacteria | 1608 |
| 579 | Ga0265319_1038925 | 3300028563 | Bacteria | 1615 |
| 580 | Ga0307517_10001871 | 3300028786 | Bacteria | 34464 |
| 581 | Ga0307517_10107035 | 3300028786 | Bacteria | 2158 |
| 582 | Ga0307515_10000020 | 3300028794 | Bacteria | 411735 |
| 583 | Ga0307515_10000051 | 3300028794 | Bacteria | 272100 |
| 584 | Ga0307515_10000101 | 3300028794 | Bacteria | 199593 |
| 585 | Ga0307515_10000152 | 3300028794 | Bacteria | 167305 |
| 586 | Ga0307515_10000991 | 3300028794 | Bacteria | 64898 |
| 587 | Ga0307515_10001283 | 3300028794 | Bacteria | 57022 |
| 588 | Ga0307515_10007242 | 3300028794 | Bacteria | 21968 |
| 589 | Ga0307515_10008378 | 3300028794 | Bacteria | 20167 |
| 590 | Ga0307515_10036978 | 3300028794 | Bacteria | 7871 |
| 591 | Ga0307515_10038740 | 3300028794 | Bacteria | 7610 |
| 592 | Ga0307515_10075161 | 3300028794 | Bacteria | 4506 |
| 593 | Ga0307515_10120000 | 3300028794 | Bacteria | 2986 |
| 594 | Ga0307515_10199515 | 3300028794 | Bacteria | 1881 |
| 595 | Ga0307515_10307026 | 3300028794 | Bacteria | 1265 |
| 596 | Ga0307512_10108096 | 3300030522 | Bacteria | 1847 |
| 597 | Ga0307512_10116038 | 3300030522 | Bacteria | 1741 |
| 598 | Ga0316177_1078761 | 3300030731 | Bacteria | 2960 |
| 599 | Ga0314311_1107726 | 3300030733 | Bacteria | 1286 |
| 600 | Ga0316179_1098911 | 3300030734 | Bacteria | 1576 |
| 601 | Ga0316183_1077170 | 3300030742 | Bacteria | 6687 |
| 602 | Ga0316181_1144972 | 3300030744 | Bacteria | 7327 |
| 603 | Ga0316182_1067687 | 3300030745 | Bacteria | 2639 |
| 604 | Ga0316182_1243175 | 3300030745 | Bacteria | 2444 |
| 605 | Ga0265330_10000033 | 3300031235 | Bacteria | 126931 |
| 606 | Ga0265332_10000001 | 3300031238 | Bacteria | 863783 |
| 607 | Ga0265332_10000009 | 3300031238 | Bacteria | 295760 |
| 608 | Ga0265320_10040578 | 3300031240 | Bacteria | 2320 |
| 609 | Ga0265340_10018855 | 3300031247 | Bacteria | 3556 |
| 610 | Ga0265327_10000184 | 3300031251 | Bacteria | 133023 |
| 611 | Ga0265327_10001098 | 3300031251 | Bacteria | 37523 |
| 612 | Ga0265327_10005755 | 3300031251 | Bacteria | 10210 |
| 613 | Ga0265316_10000115 | 3300031344 | Bacteria | 86934 |
| 614 | Ga0307513_10000004 | 3300031456 | Bacteria | 558931 |
| 615 | Ga0307513_10000054 | 3300031456 | Bacteria | 148887 |
| 616 | Ga0307513_10001123 | 3300031456 | Bacteria | 38793 |
| 617 | Ga0307513_10010964 | 3300031456 | Bacteria | 11310 |
| 618 | Ga0307513_10034868 | 3300031456 | Bacteria | 5639 |
| 619 | Ga0307513_10142897 | 3300031456 | Bacteria | 2316 |
| 620 | Ga0307513_10145257 | 3300031456 | Bacteria | 2291 |
| 621 | Ga0307513_10158749 | 3300031456 | Bacteria | 2157 |
| 622 | Ga0307509_10025279 | 3300031507 | Bacteria | 6635 |
| 623 | Ga0307509_10030443 | 3300031507 | Bacteria | 5970 |
| 624 | Ga0307509_10035773 | 3300031507 | Bacteria | 5446 |
| 625 | Ga0307509_10180175 | 3300031507 | Bacteria | 1979 |
| 626 | Ga0307408_100000079 | 3300031548 | Bacteria | 108053 |
| 627 | Ga0307408_100007215 | 3300031548 | Bacteria | 7350 |
| 628 | Ga0307408_100009340 | 3300031548 | Bacteria | 6463 |
| 629 | Ga0307408_100080528 | 3300031548 | Bacteria | 2433 |
| 630 | Ga0307408_100114897 | 3300031548 | Bacteria | 2075 |
| 631 | Ga0307408_100187080 | 3300031548 | Bacteria | 1665 |
| 632 | Ga0307408_100201107 | 3300031548 | Bacteria | 1612 |
| 633 | Ga0307408_100259871 | 3300031548 | Bacteria | 1436 |
| 634 | Ga0307408_100665947 | 3300031548 | Bacteria | 932 |
| 635 | Ga0307508_10000007 | 3300031616 | Bacteria | 268359 |
| 636 | Ga0307508_10000227 | 3300031616 | Bacteria | 68533 |
| 637 | Ga0307508_10038562 | 3300031616 | Bacteria | 4293 |
| 638 | Ga0307514_10001840 | 3300031649 | Bacteria | 23499 |
| 639 | Ga0307514_10011126 | 3300031649 | Bacteria | 7491 |
| 640 | Ga0307514_10062171 | 3300031649 | Bacteria | 2841 |
| 641 | Ga0265314_10000022 | 3300031711 | Bacteria | 297299 |
| 642 | Ga0307516_10000497 | 3300031730 | Bacteria | 52295 |
| 643 | Ga0307516_10004946 | 3300031730 | Bacteria | 16201 |
| 644 | Ga0307516_10012796 | 3300031730 | Bacteria | 9011 |
| 645 | Ga0307516_10014242 | 3300031730 | Bacteria | 8424 |
| 646 | Ga0307516_10016014 | 3300031730 | Bacteria | 7860 |
| 647 | Ga0307516_10056935 | 3300031730 | Bacteria | 3810 |
| 648 | Ga0307516_10181440 | 3300031730 | Bacteria | 1838 |
| 649 | Ga0307516_10314341 | 3300031730 | Bacteria | 1239 |
| 650 | Ga0307405_10047870 | 3300031731 | Bacteria | 2634 |
| 651 | Ga0307405_10140284 | 3300031731 | Bacteria | 1684 |
| 652 | Ga0307405_10328208 | 3300031731 | Bacteria | 1171 |
| 653 | Ga0307413_10023658 | 3300031824 | Bacteria | 3332 |
| 654 | Ga0307406_10013261 | 3300031901 | Bacteria | 4718 |
| 655 | Ga0307406_10064183 | 3300031901 | Bacteria | 2382 |
| 656 | Ga0307406_10229442 | 3300031901 | Bacteria | 1385 |
| 657 | Ga0307406_10334584 | 3300031901 | Bacteria | 1177 |
| 658 | Ga0307412_10034925 | 3300031911 | Bacteria | 3207 |
| 659 | Ga0307412_10067234 | 3300031911 | Bacteria | 2432 |
| 660 | Ga0307412_10085767 | 3300031911 | Bacteria | 2189 |
| 661 | Ga0307412_10086513 | 3300031911 | Bacteria | 2181 |
| 662 | Ga0307409_100021883 | 3300031995 | Bacteria | 4395 |
| 663 | Ga0307416_100002560 | 3300032002 | Bacteria | 10494 |
| 664 | Ga0307416_100615376 | 3300032002 | Bacteria | 1167 |
| 665 | Ga0307414_10296397 | 3300032004 | Bacteria | 1366 |
| 666 | Ga0307415_100027466 | 3300032126 | Bacteria | 3606 |
| 667 | Ga0307510_10026627 | 3300033180 | Bacteria | 6642 |
| 668 | Ga0307510_10111223 | 3300033180 | Bacteria | 2480 |
| 669 | Ga0373959_0005445 | 3300034820 | Bacteria | 2087 |
| 670 | Ga0373932_0086323 | 3300035112 | Bacteria | 1000 |
| 671 | Ga0373939_0000016 | 3300035114 | Bacteria | 62934 |
| 672 | Ga0373946_0071269 | 3300035171 | Bacteria | 1502 |
| 673 | Ga0373931_0000554 | 3300035691 | Bacteria | 15366 |
| 674 | Ga0373931_0016799 | 3300035691 | Bacteria | 3608 |
| 675 | Ga0373931_0017937 | 3300035691 | Bacteria | 3510 |
| 676 | Ga0373947_0149989 | 3300035725 | Bacteria | 1501 |
| 677 | Ga0373937_0028691 | 3300036401 | Bacteria | 5037 |
| 678 | Ga0373925_0007600 | 3300037068 | Bacteria | 7895 |
| 679 | Ga0373925_0327725 | 3300037068 | Bacteria | 1240 |
| 680 | Ga0395899_0015998 | 3300037312 | Bacteria | 5721 |
| 681 | Ga0395899_0066645 | 3300037312 | Bacteria | 2643 |
| 682 | Ga0395900_0000109 | 3300037418 | Bacteria | 146053 |
| 683 | Ga0395900_0010948 | 3300037418 | Bacteria | 9276 |
| 684 | Ga0395900_0104880 | 3300037418 | Bacteria | 2904 |
| 685 | Ga0395900_0163513 | 3300037418 | Bacteria | 2269 |
| 686 | Ga0395898_0000868 | 3300037466 | Bacteria | 49428 |
| 687 | Ga0395898_0016081 | 3300037466 | Bacteria | 7665 |
| 688 | Ga0395898_0184864 | 3300037466 | Bacteria | 1991 |
| 689 | Ga0395905_0000431 | 3300037471 | Bacteria | 58717 |
| 690 | Ga0395905_0001290 | 3300037471 | Bacteria | 30783 |
| 691 | Ga0395905_0008841 | 3300037471 | Bacteria | 9898 |
| 692 | Ga0395905_0009815 | 3300037471 | Bacteria | 9330 |
| 693 | Ga0395905_0013446 | 3300037471 | Bacteria | 7843 |
| 694 | Ga0395905_0016819 | 3300037471 | Bacteria | 6948 |
| 695 | Ga0395905_0097083 | 3300037471 | Bacteria | 2766 |
| 696 | Ga0395905_0108792 | 3300037471 | Bacteria | 2602 |
| 697 | Ga0395901_0035513 | 3300038443 | Bacteria | 5150 |
| 698 | Ga0395901_0066688 | 3300038443 | Bacteria | 3749 |
| 699 | Ga0395901_0184620 | 3300038443 | Bacteria | 2187 |
| 700 | Ga0395901_0348536 | 3300038443 | Bacteria | 1528 |
| 701 | Ga0436361_0296121 | 3300039447 | Bacteria | 160237 |
| 702 | Ga0436361_0416556 | 3300039447 | Bacteria | 4615 |
| 703 | Ga0436361_0667144 | 3300039447 | Bacteria | 32170 |
| 704 | Ga0436361_0932343 | 3300039447 | Bacteria | 25287 |
| 705 | Ga0436361_0953550 | 3300039447 | Bacteria | 3924 |
| 706 | Ga0436361_1028268 | 3300039447 | Bacteria | 2011 |
| 707 | Ga0436361_1033023 | 3300039447 | Bacteria | 2767 |
| 708 | Ga0436363_1441997 | 3300039450 | Bacteria | 1766 |
| 709 | Ga0439436_0006977 | 3300041404 | Bacteria | 3473 |
| 710 | Ga0439439_0052312 | 3300041406 | Bacteria | 1072 |
| 711 | Ga0439465_0010818 | 3300041413 | Bacteria | 2863 |
| 712 | Ga0451800_0898755 | 3300041459 | Bacteria | 1258 |
| 713 | Ga0451807_1161842 | 3300041486 | Bacteria | 939 |
| 714 | Ga0439431_0011306 | 3300041997 | Bacteria | 2038 |
| 715 | Ga0439433_0006439 | 3300041999 | Bacteria | 2527 |
| 716 | Ga0439442_005843 | 3300042002 | Bacteria | 2464 |
| 717 | Ga0439445_0004163 | 3300042004 | Bacteria | 3267 |
| 718 | Ga0439432_000677 | 3300042006 | Bacteria | 12757 |
| 719 | Ga0439449_0000469 | 3300042007 | Bacteria | 15091 |
| 720 | Ga0439449_0000924 | 3300042007 | Bacteria | 11444 |
| 721 | Ga0439449_0002109 | 3300042007 | Bacteria | 7806 |
| 722 | Ga0439452_009127 | 3300042010 | Bacteria | 2939 |
| 723 | Ga0450923_015391 | 3300042125 | Bacteria | 1430 |
| 724 | Ga0450896_012807 | 3300042133 | Bacteria | 1189 |
| 725 | Ga0450908_011224 | 3300042184 | Bacteria | 1643 |
| 726 | Ga0439434_0001859 | 3300042435 | Bacteria | 6135 |
| 727 | Ga0439464_0009524 | 3300042439 | Bacteria | 2558 |
| 728 | Ga0439464_0017013 | 3300042439 | Bacteria | 1969 |
| 729 | Ga0450918_002732 | 3300042531 | Bacteria | 3308 |
| 730 | Ga0450918_005105 | 3300042531 | Bacteria | 2366 |
| 731 | Ga0451577_0002119 | 3300042876 | Bacteria | 24405 |
| 732 | Ga0466969_0000385 | 3300044656 | Bacteria | 24302 |
| 733 | Ga0466969_0019596 | 3300044656 | Bacteria | 3514 |
| 734 | Ga0466969_0050717 | 3300044656 | Bacteria | 2045 |
| 735 | Ga0453683_0091346 | 3300044673 | Bacteria | 1909 |
| 736 | Ga0466965_0057196 | 3300044683 | Bacteria | 1943 |
| 737 | Ga0466965_0065463 | 3300044683 | Bacteria | 1821 |
| 738 | Ga0466966_0009505 | 3300044684 | Bacteria | 6437 |
| 739 | Ga0466961_0002458 | 3300044693 | Bacteria | 11494 |
| 740 | Ga0453684_0050727 | 3300044712 | Bacteria | 5453 |
| 741 | Ga0453684_0174365 | 3300044712 | Bacteria | 2531 |
| 742 | Ga0466971_0042912 | 3300044719 | Bacteria | 2032 |
| 743 | Ga0466971_0064696 | 3300044719 | Bacteria | 1656 |
| 744 | Ga0466959_0077189 | 3300045049 | Bacteria | 2404 |
| 745 | Ga0466959_0197279 | 3300045049 | Bacteria | 1402 |
| 746 | Ga0451576_0003324 | 3300045051 | Bacteria | 22289 |
| 747 | Ga0451576_0168393 | 3300045051 | Bacteria | 2286 |
| 748 | Ga0451576_0616456 | 3300045051 | Bacteria | 1140 |
| 749 | Ga0495592_0000028 | 3300046454 | Bacteria | 132590 |
| 750 | Ga0495603_0162358 | 3300046455 | Bacteria | 1296 |
| 751 | Ga0495629_0166197 | 3300046459 | Bacteria | 1532 |
| 752 | Ga0495580_0046417 | 3300046472 | Bacteria | 3082 |
| 753 | Ga0495620_0023276 | 3300046515 | Bacteria | 2965 |
| 754 | Ga0495632_0055206 | 3300046519 | Bacteria | 1945 |
| 755 | Ga0495632_0073123 | 3300046519 | Bacteria | 1644 |
| 756 | Ga0495654_0079515 | 3300046530 | Bacteria | 1540 |
| 757 | Ga0495654_0093905 | 3300046530 | Bacteria | 1389 |
| 758 | Ga0495587_0069353 | 3300046536 | Bacteria | 2053 |
| 759 | Ga0495597_0025734 | 3300046542 | Bacteria | 2708 |
| 760 | Ga0495597_0027421 | 3300046542 | Bacteria | 2611 |
| 761 | Ga0495667_0182381 | 3300046559 | Bacteria | 1347 |
| 762 | Ga0495656_0000202 | 3300046615 | Bacteria | 21338 |
| 763 | Ga0495656_0042224 | 3300046615 | Bacteria | 1909 |
| 764 | Ga0495656_0069636 | 3300046615 | Bacteria | 1559 |
| 765 | Ga0495625_0005344 | 3300046660 | Bacteria | 11761 |
| 766 | Ga0495625_0013990 | 3300046660 | Bacteria | 6426 |
| 767 | Ga0495599_0160141 | 3300046678 | Bacteria | 1391 |
| 768 | Ga0495658_0083956 | 3300046683 | Bacteria | 1874 |
| 769 | Ga0495658_0106707 | 3300046683 | Bacteria | 1679 |
| 770 | Ga0495658_0139347 | 3300046683 | Bacteria | 1482 |
| 771 | Ga0495658_0203130 | 3300046683 | Bacteria | 1236 |
| 772 | Ga0495649_0035849 | 3300046694 | Bacteria | 2727 |
| 773 | Ga0495649_0203375 | 3300046694 | Bacteria | 1028 |
| 774 | Ga0495660_0124699 | 3300046810 | Bacteria | 1299 |
| 775 | Ga0495687_040301 | 3300047443 | Bacteria | 2059 |
| 776 | Ga0495686_0183357 | 3300047472 | Bacteria | 1211 |
| 777 | Ga0495593_0053969 | 3300047673 | Bacteria | 2120 |
| 778 | Ga0496100_0151999 | 3300048903 | Bacteria | 1652 |
| 779 | Ga0496100_0250119 | 3300048903 | Bacteria | 1311 |
| 780 | Ga0496101_0001014 | 3300048904 | Bacteria | 16554 |
| 781 | Ga0496102_0017154 | 3300048905 | Bacteria | 6340 |
| 782 | Ga0496102_0038214 | 3300048905 | Bacteria | 4331 |
| 783 | Ga0496102_0092470 | 3300048905 | Bacteria | 2801 |
| 784 | Ga0496104_0164500 | 3300048907 | Bacteria | 2127 |
| 785 | Ga0496105_0057169 | 3300048908 | Bacteria | 3221 |
| 786 | Ga0496105_0131760 | 3300048908 | Bacteria | 2061 |
| 787 | Ga0496105_0430180 | 3300048908 | Bacteria | 1044 |
| 788 | Ga0496106_0054602 | 3300048909 | Bacteria | 3018 |
| 789 | Ga0496106_0080771 | 3300048909 | Bacteria | 2497 |
| 790 | Ga0496107_0183594 | 3300048910 | Bacteria | 1553 |
| 791 | Ga0496108_0141293 | 3300048911 | Bacteria | 2074 |
| 792 | Ga0496109_0629257 | 3300048912 | Bacteria | 1010 |
| 793 | Ga0496110_0042297 | 3300048913 | Bacteria | 3977 |
| 794 | Ga0496110_0120261 | 3300048913 | Bacteria | 2366 |
| 795 | Ga0496111_0106565 | 3300048914 | Bacteria | 2063 |
| 796 | Ga0496111_0111522 | 3300048914 | Bacteria | 2015 |
| 797 | Ga0496113_0062969 | 3300048916 | Bacteria | 2802 |
| 798 | Ga0496114_0106832 | 3300048917 | Bacteria | 2395 |
| 799 | Ga0496122_0000985 | 3300048925 | Bacteria | 50829 |
| 800 | Ga0496122_0089547 | 3300048925 | Bacteria | 2103 |
| 801 | Ga0496123_0000656 | 3300048926 | Bacteria | 57313 |
| 802 | Ga0496123_0081490 | 3300048926 | Bacteria | 1966 |
| 803 | Ga0496124_0000317 | 3300048927 | Bacteria | 89188 |
| 804 | Ga0496124_0081933 | 3300048927 | Bacteria | 2650 |
| 805 | Ga0496125_0001040 | 3300048928 | Bacteria | 42892 |
| 806 | Ga0496126_0315896 | 3300048929 | Bacteria | 1285 |
| 807 | Ga0501031_0012766 | 3300049568 | Bacteria | 5489 |
| 808 | Ga0501034_0158146 | 3300049571 | Bacteria | 2239 |
| 809 | Ga0501043_0000004 | 3300049579 | Bacteria | 291085 |
| 810 | Ga0501046_0000016 | 3300049580 | Bacteria | 234374 |
| 811 | Ga0501047_0000012 | 3300049581 | Bacteria | 368824 |
| 812 | Ga0501073_0191128 | 3300049589 | Bacteria | 1417 |
| 813 | Ga0501198_000005 | 3300049649 | Bacteria | 156657 |
| 814 | Ga0501222_000003 | 3300049662 | Bacteria | 157406 |
| 815 | Ga0501262_000797 | 3300049759 | Bacteria | 3632 |
| 816 | Ga0501035_0340835 | 3300049822 | Bacteria | 1256 |
| 817 | nmdc:mga03n38_29940_c1 | 3300050490 | Bacteria | 2284 |
| 818 | nmdc:mga00v17_183511_c1 | 3300050491 | Bacteria | 1350 |
| 819 | nmdc:mga00v17_84012_c1 | 3300050491 | Bacteria | 1992 |
| 820 | nmdc:mga0yw44_292201_c1 | 3300050492 | Bacteria | 1091 |
| 821 | nmdc:mga0k408_156455_c1 | 3300050493 | Bacteria | 1357 |
| 822 | nmdc:mga0k408_162745_c1 | 3300050493 | Bacteria | 1330 |
| 823 | nmdc:mga0k408_23770_c1 | 3300050493 | Bacteria | 3461 |
| 824 | nmdc:mga0k408_41156_c1 | 3300050493 | Bacteria | 2660 |
| 825 | nmdc:mga0k408_52323_c1 | 3300050493 | Bacteria | 2367 |
| 826 | nmdc:mga0k408_56668_c1 | 3300050493 | Bacteria | 2275 |
| 827 | nmdc:mga0k408_80001_c1 | 3300050493 | Bacteria | 1912 |
| 828 | nmdc:mga0k408_85470_c1 | 3300050493 | Bacteria | 1852 |
| 829 | nmdc:mga0k408_9344_c1 | 3300050493 | Bacteria | 5283 |
| 830 | nmdc:mga07m45_134711_c1 | 3300050496 | Bacteria | 1430 |
| 831 | nmdc:mga07m45_14664_c1 | 3300050496 | Bacteria | 2470 |
| 832 | nmdc:mga07m45_2993_c1 | 3300050496 | Bacteria | 2508 |
| 833 | nmdc:mga07m45_60107_c1 | 3300050496 | Bacteria | 2151 |
| 834 | nmdc:mga07m45_73331_c1 | 3300050496 | Bacteria | 1949 |
| 835 | nmdc:mga07m45_898_c1 | 3300050496 | Bacteria | 12980 |
| 836 | nmdc:mga0sz30_3098_c1 | 3300050516 | Bacteria | 5961 |
| 837 | Ga0495601_0135285 | 3300053077 | Bacteria | 1607 |
| 838 | Ga0495595_0181299 | 3300053084 | Bacteria | 1044 |
| 839 | Ga0495619_0088437 | 3300053085 | Bacteria | 2095 |
| 840 | Ga0495619_0230742 | 3300053085 | Bacteria | 1282 |
| 841 | Ga0500651_0122933 | 3300053093 | Bacteria | 1574 |
| 842 | Ga0500652_045576 | 3300053131 | Bacteria | 1778 |
| 843 | Ga0500658_0044731 | 3300053134 | Bacteria | 1787 |
| 844 | Ga0500559_0011048 | 3300053136 | Bacteria | 3866 |
| 845 | Ga0500645_000413 | 3300053730 | Bacteria | 29917 |
| 846 | Ga0590071_000652 | 3300059421 | Bacteria | 9845 |
| 847 | Ga0590075_016697 | 3300059424 | Bacteria | 1806 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300046678 | Ga0495599_0160141 | Ga0495599_0160141_274_1128 | 255 |
| 2 | 3300005355 | Ga0070671_100032037 | Ga0070671_1000320375 | 256 |
| 3 | 3300005457 | Ga0070662_100057864 | Ga0070662_1000578642 | 256 |
| 4 | 3300009177 | Ga0105248_10004383 | Ga0105248_100043838 | 256 |
| 5 | 3300025931 | Ga0207644_10136571 | Ga0207644_101365712 | 256 |
| 6 | 3300025933 | Ga0207706_10000845 | Ga0207706_100008455 | 256 |
| 7 | 3300041406 | Ga0439439_0052312 | Ga0439439_0052312_287_1057 | 256 |
| 8 | 3300048916 | Ga0496113_0062969 | Ga0496113_0062969_1098_1955 | 256 |
| 9 | 3300005344 | Ga0070661_100001206 | Ga0070661_1000012062 | 257 |
| 10 | 3300025920 | Ga0207649_10004481 | Ga0207649_100044812 | 257 |
| 11 | 3300025945 | Ga0207679_10000637 | Ga0207679_1000063716 | 257 |
| 12 | 3300005344 | Ga0070661_100134856 | Ga0070661_1001348562 | 258 |
| 13 | 3300028563 | Ga0265319_1038925 | Ga0265319_10389252 | 258 |
| 14 | 3300031344 | Ga0265316_10000115 | Ga0265316_1000011570 | 258 |
| 15 | 3300032004 | Ga0307414_10296397 | Ga0307414_102963972 | 258 |
| 16 | 3300034820 | Ga0373959_0005445 | Ga0373959_0005445_1094_1951 | 258 |
| 17 | 3300035114 | Ga0373939_0000016 | Ga0373939_0000016_61120_61977 | 258 |
| 18 | 3300035691 | Ga0373931_0000554 | Ga0373931_0000554_9222_10079 | 258 |
| 19 | 3300039447 | Ga0436361_0953550 | Ga0436361_0953550_2627_3484 | 258 |
| 20 | 3300042531 | Ga0450918_005105 | Ga0450918_005105_966_1823 | 258 |
| 21 | 3300044712 | Ga0453684_0174365 | Ga0453684_0174365_320_1177 | 258 |
| 22 | 3300059421 | Ga0590071_000652 | Ga0590071_000652_1902_2759 | 258 |
| 23 | 3300005334 | Ga0068869_100230330 | Ga0068869_1002303301 | 259 |
| 24 | 3300005353 | Ga0070669_100074542 | Ga0070669_1000745422 | 259 |
| 25 | 3300005441 | Ga0070700_100121960 | Ga0070700_1001219602 | 259 |
| 26 | 3300005459 | Ga0068867_100025400 | Ga0068867_1000254003 | 259 |
| 27 | 3300005617 | Ga0068859_100094634 | Ga0068859_1000946343 | 259 |
| 28 | 3300005843 | Ga0068860_100002888 | Ga0068860_10000288811 | 259 |
| 29 | 3300006931 | Ga0097620_100094639 | Ga0097620_1000946393 | 259 |
| 30 | 3300009553 | Ga0105249_10108902 | Ga0105249_101089023 | 259 |
| 31 | 3300025893 | Ga0207682_10034307 | Ga0207682_100343072 | 259 |
| 32 | 3300025923 | Ga0207681_10051113 | Ga0207681_100511132 | 259 |
| 33 | 3300025940 | Ga0207691_10064932 | Ga0207691_100649323 | 259 |
| 34 | 3300025942 | Ga0207689_10143284 | Ga0207689_101432843 | 259 |
| 35 | 3300025961 | Ga0207712_10005511 | Ga0207712_100055116 | 259 |
| 36 | 3300026075 | Ga0207708_10158905 | Ga0207708_101589052 | 259 |
| 37 | 3300026089 | Ga0207648_10037756 | Ga0207648_100377563 | 259 |
| 38 | 3300026118 | Ga0207675_100000728 | Ga0207675_10000072835 | 259 |
| 39 | 3300027876 | Ga0209974_10003598 | Ga0209974_100035983 | 259 |
| 40 | 3300037418 | Ga0395900_0010948 | Ga0395900_0010948_6917_7774 | 259 |
| 41 | 3300037466 | Ga0395898_0184864 | Ga0395898_0184864_1124_1981 | 259 |
| 42 | 3300044656 | Ga0466969_0050717 | Ga0466969_0050717_49_906 | 259 |
| 43 | 3300005564 | Ga0070664_100311042 | Ga0070664_1003110422 | 260 |
| 44 | 3300013297 | Ga0157378_10077966 | Ga0157378_100779663 | 260 |
| 45 | 3300014968 | Ga0157379_10189108 | Ga0157379_101891082 | 260 |
| 46 | 3300021361 | Ga0213872_10000361 | Ga0213872_100003616 | 260 |
| 47 | 3300025932 | Ga0207690_10327615 | Ga0207690_103276152 | 260 |
| 48 | 3300025945 | Ga0207679_10093459 | Ga0207679_100934592 | 260 |
| 49 | 3300026035 | Ga0207703_10171927 | Ga0207703_101719272 | 260 |
| 50 | 3300039447 | Ga0436361_0667144 | Ga0436361_0667144_6523_7380 | 260 |
| 51 | 3300042007 | Ga0439449_0000469 | Ga0439449_0000469_463_1320 | 260 |
| 52 | 3300031251 | Ga0265327_10000184 | Ga0265327_10000184113 | 261 |
| 53 | 3300037068 | Ga0373925_0007600 | Ga0373925_0007600_5069_5926 | 261 |
| 54 | 3300046683 | Ga0495658_0139347 | Ga0495658_0139347_428_1285 | 261 |
| 55 | 3300003773 | Ga0055537_1001225 | Ga0055537_100122512 | 262 |
| 56 | 3300003784 | Ga0055534_1007760 | Ga0055534_10077602 | 262 |
| 57 | 3300002987 | JGI25159J45721_1006959 | JGI25159J45721_10069592 | 263 |
| 58 | 3300003187 | JGI25151J46595_10021076 | JGI25151J46595_100210762 | 263 |
| 59 | 3300003771 | Ga0055526_1014166 | Ga0055526_10141662 | 263 |
| 60 | 3300003775 | Ga0055524_1000006 | Ga0055524_100000669 | 263 |
| 61 | 3300003781 | Ga0055536_1000447 | Ga0055536_100044725 | 263 |
| 62 | 3300003790 | Ga0055528_1025062 | Ga0055528_10250622 | 263 |
| 63 | 3300003791 | Ga0055530_10000154 | Ga0055530_100001542 | 263 |
| 64 | 3300003792 | Ga0055540_1000005 | Ga0055540_1000005245 | 263 |
| 65 | 3300003794 | Ga0055531_10000607 | Ga0055531_100006079 | 263 |
| 66 | 3300005719 | Ga0068861_100211756 | Ga0068861_1002117562 | 263 |
| 67 | 3300005844 | Ga0068862_100085473 | Ga0068862_1000854733 | 263 |
| 68 | 3300025245 | Ga0207425_1002262 | Ga0207425_10022622 | 263 |
| 69 | 3300025263 | Ga0209565_1000246 | Ga0209565_100024661 | 263 |
| 70 | 3300025273 | Ga0209673_1000043 | Ga0209673_1000043159 | 263 |
| 71 | 3300025284 | Ga0209130_1000623 | Ga0209130_10006232 | 263 |
| 72 | 3300025291 | Ga0209675_1000309 | Ga0209675_100030920 | 263 |
| 73 | 3300025292 | Ga0209676_1000007 | Ga0209676_1000007454 | 263 |
| 74 | 3300025294 | Ga0209025_1003641 | Ga0209025_100364117 | 263 |
| 75 | 3300025295 | Ga0209564_1000285 | Ga0209564_10002852 | 263 |
| 76 | 3300025297 | Ga0209758_1028601 | Ga0209758_10286012 | 263 |
| 77 | 3300025298 | Ga0209050_1000003 | Ga0209050_10000031054 | 263 |
| 78 | 3300025299 | Ga0209256_1000001 | Ga0209256_10000011060 | 263 |
| 79 | 3300025302 | Ga0207426_1011141 | Ga0207426_10111412 | 263 |
| 80 | 3300025303 | Ga0209051_1000003 | Ga0209051_10000031054 | 263 |
| 81 | 3300025304 | Ga0209257_1000020 | Ga0209257_1000020454 | 263 |
| 82 | 3300028380 | Ga0268265_10304936 | Ga0268265_103049362 | 263 |
| 83 | 3300031901 | Ga0307406_10013261 | Ga0307406_100132613 | 263 |
| 84 | 3300006195 | Ga0075366_10073530 | Ga0075366_100735303 | 264 |
| 85 | 3300009093 | Ga0105240_10215679 | Ga0105240_102156792 | 264 |
| 86 | 3300041486 | Ga0451807_1161842 | Ga0451807_1161842_126_920 | 264 |
| 87 | 3300006846 | Ga0075430_100113633 | Ga0075430_1001136333 | 265 |
| 88 | 3300031730 | Ga0307516_10181440 | Ga0307516_101814402 | 265 |
| 89 | 3300037471 | Ga0395905_0001290 | Ga0395905_0001290_23126_23980 | 265 |
| 90 | 3300038443 | Ga0395901_0184620 | Ga0395901_0184620_354_1211 | 266 |
| 91 | 3300042439 | Ga0439464_0009524 | Ga0439464_0009524_209_1063 | 267 |
| 92 | 3300014968 | Ga0157379_10187678 | Ga0157379_101876783 | 268 |
| 93 | 3300037471 | Ga0395905_0097083 | Ga0395905_0097083_327_1181 | 268 |
| 94 | 3300049571 | Ga0501034_0158146 | Ga0501034_0158146_1337_2194 | 268 |
| 95 | 3300059424 | Ga0590075_016697 | Ga0590075_016697_277_1134 | 268 |
| 96 | 3300031548 | Ga0307408_100665947 | Ga0307408_1006659471 | 269 |
| 97 | 3300031731 | Ga0307405_10140284 | Ga0307405_101402842 | 269 |
| 98 | 3300039447 | Ga0436361_0932343 | Ga0436361_0932343_10200_11054 | 269 |
| 99 | 3300045049 | Ga0466959_0197279 | Ga0466959_0197279_447_1304 | 269 |
| 100 | 3300006946 | Ga0079104_1000002 | Ga0079104_1000002165 | 270 |
| 101 | 3300009092 | Ga0105250_10001691 | Ga0105250_1000169110 | 270 |
| 102 | 3300009148 | Ga0105243_10004697 | Ga0105243_100046973 | 270 |
| 103 | 3300025935 | Ga0207709_10000015 | Ga0207709_10000015160 | 270 |
| 104 | 3300026023 | Ga0207677_10005131 | Ga0207677_100051316 | 270 |
| 105 | 3300027111 | Ga0209281_1000007 | Ga0209281_1000007383 | 270 |
| 106 | 3300037418 | Ga0395900_0104880 | Ga0395900_0104880_839_1696 | 270 |
| 107 | 3300037471 | Ga0395905_0108792 | Ga0395905_0108792_809_1666 | 270 |
| 108 | 3300038443 | Ga0395901_0348536 | Ga0395901_0348536_601_1458 | 270 |
| 109 | 3300003771 | Ga0055526_1012424 | Ga0055526_10124243 | 271 |
| 110 | 3300025295 | Ga0209564_1013541 | Ga0209564_10135413 | 271 |
| 111 | 3300037312 | Ga0395899_0015998 | Ga0395899_0015998_2310_3164 | 272 |
| 112 | 3300037312 | Ga0395899_0066645 | Ga0395899_0066645_1615_2469 | 272 |
| 113 | 3300037418 | Ga0395900_0163513 | Ga0395900_0163513_496_1353 | 272 |
| 114 | 3300037466 | Ga0395898_0016081 | Ga0395898_0016081_5756_6610 | 272 |
| 115 | 3300038443 | Ga0395901_0035513 | Ga0395901_0035513_2563_3417 | 272 |
| 116 | 3300005455 | Ga0070663_100043641 | Ga0070663_1000436412 | 273 |
| 117 | 3300026067 | Ga0207678_10059694 | Ga0207678_100596942 | 273 |
| 118 | 3300009174 | Ga0105241_10219704 | Ga0105241_102197042 | 274 |
| 119 | 3300009545 | Ga0105237_10022934 | Ga0105237_100229346 | 274 |
| 120 | 3300009551 | Ga0105238_10007213 | Ga0105238_1000721311 | 274 |
| 121 | 3300010375 | Ga0105239_10003789 | Ga0105239_100037894 | 274 |
| 122 | 3300025914 | Ga0207671_10017960 | Ga0207671_100179604 | 274 |
| 123 | 3300025935 | Ga0207709_10096765 | Ga0207709_100967653 | 274 |
| 124 | 3300028794 | Ga0307515_10199515 | Ga0307515_101995151 | 274 |
| 125 | 3300037471 | Ga0395905_0013446 | Ga0395905_0013446_3971_4828 | 274 |
| 126 | 3300005364 | Ga0070673_100101542 | Ga0070673_1001015422 | 275 |
| 127 | 3300005543 | Ga0070672_100127067 | Ga0070672_1001270671 | 275 |
| 128 | 3300025923 | Ga0207681_10222071 | Ga0207681_102220712 | 275 |
| 129 | 3300025940 | Ga0207691_10108677 | Ga0207691_101086773 | 275 |
| 130 | 3300025960 | Ga0207651_10463435 | Ga0207651_104634352 | 275 |
| 131 | 3300045051 | Ga0451576_0616456 | Ga0451576_0616456_87_944 | 275 |
| 132 | 3300002737 | JGI25162J39368_1000584 | JGI25162J39368_10005846 | 277 |
| 133 | 3300002741 | JGI25157J39369_1001620 | JGI25157J39369_10016203 | 277 |
| 134 | 3300002771 | JGI25163J39215_1000159 | JGI25163J39215_10001596 | 277 |
| 135 | 3300002772 | JGI25164J39214_1000028 | JGI25164J39214_10000286 | 277 |
| 136 | 3300003214 | JGI25165J46597_1000108 | JGI25165J46597_10001086 | 277 |
| 137 | 3300003751 | Ga0055538_1001470 | Ga0055538_10014701 | 277 |
| 138 | 3300003761 | Ga0055535_1000976 | Ga0055535_100097611 | 277 |
| 139 | 3300003762 | Ga0055542_1000691 | Ga0055542_10006916 | 277 |
| 140 | 3300003763 | Ga0055529_1000078 | Ga0055529_10000786 | 277 |
| 141 | 3300003775 | Ga0055524_1000080 | Ga0055524_100008069 | 278 |
| 142 | 3300005262 | Ga0065165_1034706 | Ga0065165_10347062 | 278 |
| 143 | 3300025263 | Ga0209565_1014281 | Ga0209565_10142812 | 278 |
| 144 | 3300025299 | Ga0209256_1000011 | Ga0209256_1000011636 | 278 |
| 145 | 3300026035 | Ga0207703_10179316 | Ga0207703_101793162 | 278 |
| 146 | 3300031238 | Ga0265332_10000009 | Ga0265332_10000009195 | 278 |
| 147 | 3300035171 | Ga0373946_0071269 | Ga0373946_0071269_205_1041 | 278 |
| 148 | 3300048917 | Ga0496114_0106832 | Ga0496114_0106832_975_1832 | 278 |
| 149 | 3300006946 | Ga0079104_1000017 | Ga0079104_1000017201 | 280 |
| 150 | 3300027111 | Ga0209281_1000042 | Ga0209281_1000042148 | 280 |
| 151 | 3300037471 | Ga0395905_0000431 | Ga0395905_0000431_54716_55573 | 280 |
| 152 | iso_pu_bacteria | 2547132374 | 2548500112 | 280 |
| 153 | iso_pu_bacteria | 2588253510 | 2588293134 | 280 |
| 154 | iso_pu_bacteria | 2643221717 | 2644644568 | 280 |
| 155 | iso_pu_bacteria | 2808606418 | 2809144884 | 280 |
| 156 | iso_pu_bacteria | 2919462493 | 2919464027 | 280 |
| 157 | iso_pu_bacteria | 2919704043 | 2919705121 | 280 |
| 158 | iso_pu_bacteria | 2945945610 | 2945946839 | 280 |
| 159 | iso_pu_bacteria | 2945972063 | 2945976556 | 280 |
| 160 | iso_pu_bacteria | 2511231002 | 2511246406 | 281 |
| 161 | iso_pu_bacteria | 2585428062 | 2587755595 | 281 |
| 162 | iso_pu_bacteria | 2643221544 | 2643745518 | 281 |
| 163 | iso_pu_bacteria | 2643221570 | 2643864848 | 281 |
| 164 | iso_pu_bacteria | 2643221585 | 2643935915 | 281 |
| 165 | iso_pu_bacteria | 2643221596 | 2643991211 | 281 |
| 166 | iso_pu_bacteria | 2643221609 | 2644059892 | 281 |
| 167 | iso_pu_bacteria | 2643221611 | 2644074487 | 281 |
| 168 | iso_pu_bacteria | 2643221628 | 2644162803 | 281 |
| 169 | iso_pu_bacteria | 2643221639 | 2644221380 | 281 |
| 170 | iso_pu_bacteria | 2643221644 | 2644245710 | 281 |
| 171 | iso_pu_bacteria | 2643221646 | 2644257863 | 281 |
| 172 | iso_pu_bacteria | 2643221652 | 2644293916 | 281 |
| 173 | iso_pu_bacteria | 2643221656 | 2644317698 | 281 |
| 174 | iso_pu_bacteria | 2643221660 | 2644338345 | 281 |
| 175 | iso_pu_bacteria | 2643221683 | 2644469192 | 281 |
| 176 | iso_pu_bacteria | 2721755523 | 2722882383 | 281 |
| 177 | iso_pu_bacteria | 2738541337 | 2739057890 | 281 |
| 178 | iso_pu_bacteria | 2738543012 | 2739241417 | 281 |
| 179 | iso_pu_bacteria | 2738543013 | 2739249867 | 281 |
| 180 | iso_pu_bacteria | 2816332133 | 2816473581 | 281 |
| 181 | iso_pu_bacteria | 2834641062 | 2834641820 | 281 |
| 182 | iso_pu_bacteria | 2839138175 | 2839142148 | 281 |
| 183 | iso_pu_bacteria | 2842677519 | 2842682591 | 281 |
| 184 | iso_pu_bacteria | 2842718218 | 2842719024 | 281 |
| 185 | iso_pu_bacteria | 2842733646 | 2842735310 | 281 |
| 186 | iso_pu_bacteria | 2842747753 | 2842749079 | 281 |
| 187 | iso_pu_bacteria | 2885192300 | 2885196176 | 281 |
| 188 | iso_pu_bacteria | 2894023352 | 2894024525 | 281 |
| 189 | iso_pu_bacteria | 2904449895 | 2904454841 | 281 |
| 190 | iso_pu_bacteria | 2904456579 | 2904462586 | 281 |
| 191 | iso_pu_bacteria | 2928115317 | 2928119235 | 281 |
| 192 | iso_pu_bacteria | 2929520902 | 2929523876 | 281 |
| 193 | iso_pu_bacteria | 2932422444 | 2932425100 | 281 |
| 194 | iso_pu_bacteria | 2939631187 | 2939635662 | 281 |
| 195 | iso_pu_bacteria | 2945909444 | 2945913058 | 281 |
| 196 | iso_pu_bacteria | 2945984333 | 2945984658 | 281 |
| 197 | iso_pu_bacteria | 2954767861 | 2954771589 | 281 |
| 198 | iso_pu_bacteria | 2990710928 | 2990711707 | 281 |
| 199 | iso_pu_bacteria | 8003400568 | 8003404636 | 281 |
| 200 | 3300039447 | Ga0436361_1028268 | Ga0436361_1028268_276_1127 | 283 |
| 201 | 3300049589 | Ga0501073_0191128 | Ga0501073_0191128_485_1336 | 283 |
| 202 | iso_pu_bacteria | 2904434214 | 2904438027 | 283 |
| 203 | 3300003773 | Ga0055537_1000490 | Ga0055537_100049018 | 284 |
| 204 | 3300003784 | Ga0055534_1000042 | Ga0055534_100004279 | 284 |
| 205 | 3300003790 | Ga0055528_1000242 | Ga0055528_100024234 | 284 |
| 206 | 3300005331 | Ga0070670_100203386 | Ga0070670_1002033862 | 284 |
| 207 | 3300006048 | Ga0075363_100049080 | Ga0075363_1000490802 | 284 |
| 208 | 3300006195 | Ga0075366_10032117 | Ga0075366_100321172 | 284 |
| 209 | 3300006353 | Ga0075370_10006682 | Ga0075370_100066827 | 284 |
| 210 | 3300025263 | Ga0209565_1000083 | Ga0209565_100008380 | 284 |
| 211 | 3300025273 | Ga0209673_1000323 | Ga0209673_100032377 | 284 |
| 212 | 3300025291 | Ga0209675_1000081 | Ga0209675_100008180 | 284 |
| 213 | 3300025942 | Ga0207689_10303026 | Ga0207689_103030262 | 284 |
| 214 | 3300027666 | Ga0209282_1001276 | Ga0209282_10012763 | 284 |
| 215 | 3300028794 | Ga0307515_10001283 | Ga0307515_1000128325 | 284 |
| 216 | 3300031456 | Ga0307513_10034868 | Ga0307513_100348682 | 284 |
| 217 | 3300031548 | Ga0307408_100007215 | Ga0307408_1000072153 | 284 |
| 218 | 3300031649 | Ga0307514_10001840 | Ga0307514_100018402 | 284 |
| 219 | 3300031730 | Ga0307516_10056935 | Ga0307516_100569352 | 284 |
| 220 | 3300031911 | Ga0307412_10034925 | Ga0307412_100349252 | 284 |
| 221 | 3300041404 | Ga0439436_0006977 | Ga0439436_0006977_854_1708 | 284 |
| 222 | 3300042007 | Ga0439449_0002109 | Ga0439449_0002109_6488_7342 | 284 |
| 223 | 3300042184 | Ga0450908_011224 | Ga0450908_011224_685_1539 | 284 |
| 224 | 3300044683 | Ga0466965_0057196 | Ga0466965_0057196_552_1406 | 284 |
| 225 | 3300046615 | Ga0495656_0069636 | Ga0495656_0069636_254_1108 | 284 |
| 226 | 3300048913 | Ga0496110_0120261 | Ga0496110_0120261_1366_2220 | 284 |
| 227 | 3300050496 | nmdc:mga07m45_898_c1 | nmdc:mga07m45_898_c1_3376_4230 | 284 |
| 228 | 2162886007 | SwRhRL2b_contig_2165666 | SwRhRL2b_0062.00001360 | 285 |
| 229 | 3300001989 | JGI24739J22299_10013960 | JGI24739J22299_100139603 | 285 |
| 230 | 3300002704 | JGI25155J39150_1000079 | JGI25155J39150_100007940 | 285 |
| 231 | 3300002705 | JGI25156J39149_1000125 | JGI25156J39149_100012540 | 285 |
| 232 | 3300002738 | JGI25154J39366_1000141 | JGI25154J39366_100014114 | 285 |
| 233 | 3300002741 | JGI25157J39369_1000159 | JGI25157J39369_100015940 | 285 |
| 234 | 3300002774 | JGI25150J39212_1001816 | JGI25150J39212_10018166 | 285 |
| 235 | 3300002987 | JGI25159J45721_1000098 | JGI25159J45721_10000982 | 285 |
| 236 | 3300003187 | JGI25151J46595_10015062 | JGI25151J46595_100150623 | 285 |
| 237 | 3300003187 | JGI25151J46595_10017307 | JGI25151J46595_100173073 | 285 |
| 238 | 3300003187 | JGI25151J46595_10026635 | JGI25151J46595_100266352 | 285 |
| 239 | 3300003322 | rootL2_10017768 | rootL2_100177683 | 285 |
| 240 | 3300003354 | JGI25160J50197_1000067 | JGI25160J50197_100006772 | 285 |
| 241 | 3300003374 | JGI25161J50226_1000035 | JGI25161J50226_100003593 | 285 |
| 242 | 3300003578 | Ga0006562J51391_1072863 | Ga0006562J51391_10728632 | 285 |
| 243 | 3300003759 | Ga0055525_1000011 | Ga0055525_10000112 | 285 |
| 244 | 3300003773 | Ga0055537_1008939 | Ga0055537_10089393 | 285 |
| 245 | 3300003781 | Ga0055536_1011365 | Ga0055536_10113652 | 285 |
| 246 | 3300003791 | Ga0055530_10018003 | Ga0055530_100180032 | 285 |
| 247 | 3300003792 | Ga0055540_1000002 | Ga0055540_1000002252 | 285 |
| 248 | 3300003792 | Ga0055540_1002002 | Ga0055540_100200213 | 285 |
| 249 | 3300003792 | Ga0055540_1009923 | Ga0055540_10099232 | 285 |
| 250 | 3300003794 | Ga0055531_10004641 | Ga0055531_100046418 | 285 |
| 251 | 3300004625 | Ga0055543_1001234 | Ga0055543_10012343 | 285 |
| 252 | 3300005262 | Ga0065165_1018365 | Ga0065165_10183651 | 285 |
| 253 | 3300005262 | Ga0065165_1025665 | Ga0065165_10256651 | 285 |
| 254 | 3300005262 | Ga0065165_1038846 | Ga0065165_10388462 | 285 |
| 255 | 3300005288 | Ga0065714_10005692 | Ga0065714_100056925 | 285 |
| 256 | 3300005288 | Ga0065714_10009585 | Ga0065714_100095853 | 285 |
| 257 | 3300005289 | Ga0065704_10078204 | Ga0065704_100782043 | 285 |
| 258 | 3300005290 | Ga0065712_10096751 | Ga0065712_100967512 | 285 |
| 259 | 3300005327 | Ga0070658_10295950 | Ga0070658_102959501 | 285 |
| 260 | 3300005328 | Ga0070676_10051123 | Ga0070676_100511232 | 285 |
| 261 | 3300005328 | Ga0070676_10074266 | Ga0070676_100742662 | 285 |
| 262 | 3300005328 | Ga0070676_10230831 | Ga0070676_102308312 | 285 |
| 263 | 3300005329 | Ga0070683_100144544 | Ga0070683_1001445442 | 285 |
| 264 | 3300005329 | Ga0070683_100195668 | Ga0070683_1001956682 | 285 |
| 265 | 3300005331 | Ga0070670_100001820 | Ga0070670_1000018202 | 285 |
| 266 | 3300005331 | Ga0070670_100016116 | Ga0070670_1000161167 | 285 |
| 267 | 3300005331 | Ga0070670_100133748 | Ga0070670_1001337482 | 285 |
| 268 | 3300005331 | Ga0070670_100182630 | Ga0070670_1001826302 | 285 |
| 269 | 3300005331 | Ga0070670_100428261 | Ga0070670_1004282612 | 285 |
| 270 | 3300005333 | Ga0070677_10001548 | Ga0070677_100015489 | 285 |
| 271 | 3300005333 | Ga0070677_10064149 | Ga0070677_100641492 | 285 |
| 272 | 3300005333 | Ga0070677_10162993 | Ga0070677_101629931 | 285 |
| 273 | 3300005334 | Ga0068869_100004736 | Ga0068869_1000047364 | 285 |
| 274 | 3300005334 | Ga0068869_100094453 | Ga0068869_1000944532 | 285 |
| 275 | 3300005334 | Ga0068869_100099494 | Ga0068869_1000994942 | 285 |
| 276 | 3300005334 | Ga0068869_100184867 | Ga0068869_1001848672 | 285 |
| 277 | 3300005334 | Ga0068869_100224294 | Ga0068869_1002242942 | 285 |
| 278 | 3300005335 | Ga0070666_10043187 | Ga0070666_100431872 | 285 |
| 279 | 3300005336 | Ga0070680_100001873 | Ga0070680_1000018736 | 285 |
| 280 | 3300005336 | Ga0070680_100098893 | Ga0070680_1000988933 | 285 |
| 281 | 3300005337 | Ga0070682_100013288 | Ga0070682_1000132883 | 285 |
| 282 | 3300005338 | Ga0068868_100019821 | Ga0068868_1000198214 | 285 |
| 283 | 3300005338 | Ga0068868_100038602 | Ga0068868_1000386022 | 285 |
| 284 | 3300005338 | Ga0068868_100044804 | Ga0068868_1000448043 | 285 |
| 285 | 3300005338 | Ga0068868_100223448 | Ga0068868_1002234481 | 285 |
| 286 | 3300005339 | Ga0070660_100087926 | Ga0070660_1000879262 | 285 |
| 287 | 3300005340 | Ga0070689_100034512 | Ga0070689_1000345124 | 285 |
| 288 | 3300005344 | Ga0070661_100070089 | Ga0070661_1000700892 | 285 |
| 289 | 3300005344 | Ga0070661_100141366 | Ga0070661_1001413662 | 285 |
| 290 | 3300005347 | Ga0070668_100009291 | Ga0070668_1000092918 | 285 |
| 291 | 3300005347 | Ga0070668_100152483 | Ga0070668_1001524832 | 285 |
| 292 | 3300005353 | Ga0070669_100021681 | Ga0070669_1000216816 | 285 |
| 293 | 3300005353 | Ga0070669_100035355 | Ga0070669_1000353553 | 285 |
| 294 | 3300005353 | Ga0070669_100056517 | Ga0070669_1000565173 | 285 |
| 295 | 3300005353 | Ga0070669_100248588 | Ga0070669_1002485882 | 285 |
| 296 | 3300005353 | Ga0070669_100304978 | Ga0070669_1003049782 | 285 |
| 297 | 3300005354 | Ga0070675_100005184 | Ga0070675_10000518412 | 285 |
| 298 | 3300005354 | Ga0070675_100017625 | Ga0070675_1000176254 | 285 |
| 299 | 3300005354 | Ga0070675_100019867 | Ga0070675_1000198674 | 285 |
| 300 | 3300005354 | Ga0070675_100047712 | Ga0070675_1000477122 | 285 |
| 301 | 3300005354 | Ga0070675_100140465 | Ga0070675_1001404651 | 285 |
| 302 | 3300005354 | Ga0070675_100240952 | Ga0070675_1002409522 | 285 |
| 303 | 3300005355 | Ga0070671_100020104 | Ga0070671_1000201045 | 285 |
| 304 | 3300005355 | Ga0070671_100021133 | Ga0070671_1000211338 | 285 |
| 305 | 3300005355 | Ga0070671_100051569 | Ga0070671_1000515692 | 285 |
| 306 | 3300005355 | Ga0070671_100104371 | Ga0070671_1001043712 | 285 |
| 307 | 3300005355 | Ga0070671_100250238 | Ga0070671_1002502381 | 285 |
| 308 | 3300005355 | Ga0070671_100256485 | Ga0070671_1002564852 | 285 |
| 309 | 3300005356 | Ga0070674_100047523 | Ga0070674_1000475232 | 285 |
| 310 | 3300005356 | Ga0070674_100052925 | Ga0070674_1000529252 | 285 |
| 311 | 3300005356 | Ga0070674_100332420 | Ga0070674_1003324202 | 285 |
| 312 | 3300005364 | Ga0070673_100016137 | Ga0070673_1000161373 | 285 |
| 313 | 3300005364 | Ga0070673_100118033 | Ga0070673_1001180332 | 285 |
| 314 | 3300005364 | Ga0070673_100125705 | Ga0070673_1001257052 | 285 |
| 315 | 3300005366 | Ga0070659_100105331 | Ga0070659_1001053312 | 285 |
| 316 | 3300005366 | Ga0070659_100167311 | Ga0070659_1001673111 | 285 |
| 317 | 3300005367 | Ga0070667_100001171 | Ga0070667_1000011719 | 285 |
| 318 | 3300005367 | Ga0070667_100003010 | Ga0070667_1000030108 | 285 |
| 319 | 3300005367 | Ga0070667_100070593 | Ga0070667_1000705932 | 285 |
| 320 | 3300005367 | Ga0070667_100202497 | Ga0070667_1002024972 | 285 |
| 321 | 3300005367 | Ga0070667_100244654 | Ga0070667_1002446543 | 285 |
| 322 | 3300005367 | Ga0070667_100253932 | Ga0070667_1002539322 | 285 |
| 323 | 3300005455 | Ga0070663_100288266 | Ga0070663_1002882661 | 285 |
| 324 | 3300005455 | Ga0070663_100395556 | Ga0070663_1003955561 | 285 |
| 325 | 3300005456 | Ga0070678_100001334 | Ga0070678_1000013345 | 285 |
| 326 | 3300005456 | Ga0070678_100009607 | Ga0070678_1000096076 | 285 |
| 327 | 3300005456 | Ga0070678_100119544 | Ga0070678_1001195442 | 285 |
| 328 | 3300005456 | Ga0070678_100376883 | Ga0070678_1003768832 | 285 |
| 329 | 3300005457 | Ga0070662_100010471 | Ga0070662_1000104718 | 285 |
| 330 | 3300005457 | Ga0070662_100026458 | Ga0070662_1000264582 | 285 |
| 331 | 3300005457 | Ga0070662_100042844 | Ga0070662_1000428443 | 285 |
| 332 | 3300005457 | Ga0070662_100118656 | Ga0070662_1001186562 | 285 |
| 333 | 3300005457 | Ga0070662_100177172 | Ga0070662_1001771722 | 285 |
| 334 | 3300005457 | Ga0070662_100264095 | Ga0070662_1002640951 | 285 |
| 335 | 3300005459 | Ga0068867_100000815 | Ga0068867_10000081512 | 285 |
| 336 | 3300005459 | Ga0068867_100002971 | Ga0068867_1000029712 | 285 |
| 337 | 3300005459 | Ga0068867_100019006 | Ga0068867_1000190063 | 285 |
| 338 | 3300005459 | Ga0068867_100030023 | Ga0068867_1000300232 | 285 |
| 339 | 3300005459 | Ga0068867_100157367 | Ga0068867_1001573672 | 285 |
| 340 | 3300005459 | Ga0068867_100382539 | Ga0068867_1003825392 | 285 |
| 341 | 3300005467 | Ga0070706_100003926 | Ga0070706_10000392610 | 285 |
| 342 | 3300005468 | Ga0070707_100206103 | Ga0070707_1002061032 | 285 |
| 343 | 3300005530 | Ga0070679_100032769 | Ga0070679_1000327693 | 285 |
| 344 | 3300005530 | Ga0070679_100257989 | Ga0070679_1002579892 | 285 |
| 345 | 3300005535 | Ga0070684_100077908 | Ga0070684_1000779083 | 285 |
| 346 | 3300005539 | Ga0068853_100046481 | Ga0068853_1000464813 | 285 |
| 347 | 3300005539 | Ga0068853_100108827 | Ga0068853_1001088272 | 285 |
| 348 | 3300005543 | Ga0070672_100002062 | Ga0070672_10000206212 | 285 |
| 349 | 3300005543 | Ga0070672_100010713 | Ga0070672_1000107138 | 285 |
| 350 | 3300005543 | Ga0070672_100055349 | Ga0070672_1000553493 | 285 |
| 351 | 3300005543 | Ga0070672_100094795 | Ga0070672_1000947952 | 285 |
| 352 | 3300005543 | Ga0070672_100208158 | Ga0070672_1002081582 | 285 |
| 353 | 3300005547 | Ga0070693_100135876 | Ga0070693_1001358762 | 285 |
| 354 | 3300005563 | Ga0068855_100010968 | Ga0068855_1000109688 | 285 |
| 355 | 3300005563 | Ga0068855_100242662 | Ga0068855_1002426622 | 285 |
| 356 | 3300005563 | Ga0068855_100245701 | Ga0068855_1002457012 | 285 |
| 357 | 3300005564 | Ga0070664_100071398 | Ga0070664_1000713982 | 285 |
| 358 | 3300005564 | Ga0070664_100133510 | Ga0070664_1001335102 | 285 |
| 359 | 3300005564 | Ga0070664_100444546 | Ga0070664_1004445462 | 285 |
| 360 | 3300005577 | Ga0068857_100123879 | Ga0068857_1001238792 | 285 |
| 361 | 3300005577 | Ga0068857_100190795 | Ga0068857_1001907952 | 285 |
| 362 | 3300005577 | Ga0068857_100200631 | Ga0068857_1002006312 | 285 |
| 363 | 3300005578 | Ga0068854_100043894 | Ga0068854_1000438942 | 285 |
| 364 | 3300005614 | Ga0068856_100034780 | Ga0068856_1000347804 | 285 |
| 365 | 3300005614 | Ga0068856_100298390 | Ga0068856_1002983903 | 285 |
| 366 | 3300005614 | Ga0068856_100553496 | Ga0068856_1005534962 | 285 |
| 367 | 3300005615 | Ga0070702_100097362 | Ga0070702_1000973622 | 285 |
| 368 | 3300005615 | Ga0070702_100271548 | Ga0070702_1002715482 | 285 |
| 369 | 3300005616 | Ga0068852_100012899 | Ga0068852_1000128996 | 285 |
| 370 | 3300005616 | Ga0068852_100096174 | Ga0068852_1000961742 | 285 |
| 371 | 3300005616 | Ga0068852_100102065 | Ga0068852_1001020652 | 285 |
| 372 | 3300005616 | Ga0068852_100222779 | Ga0068852_1002227792 | 285 |
| 373 | 3300005616 | Ga0068852_100348988 | Ga0068852_1003489882 | 285 |
| 374 | 3300005616 | Ga0068852_100514681 | Ga0068852_1005146812 | 285 |
| 375 | 3300005617 | Ga0068859_100002636 | Ga0068859_1000026362 | 285 |
| 376 | 3300005617 | Ga0068859_100187823 | Ga0068859_1001878232 | 285 |
| 377 | 3300005618 | Ga0068864_100020879 | Ga0068864_1000208798 | 285 |
| 378 | 3300005618 | Ga0068864_100040062 | Ga0068864_1000400622 | 285 |
| 379 | 3300005618 | Ga0068864_100058859 | Ga0068864_1000588592 | 285 |
| 380 | 3300005618 | Ga0068864_100091754 | Ga0068864_1000917542 | 285 |
| 381 | 3300005618 | Ga0068864_100169549 | Ga0068864_1001695492 | 285 |
| 382 | 3300005618 | Ga0068864_100181318 | Ga0068864_1001813182 | 285 |
| 383 | 3300005618 | Ga0068864_100221315 | Ga0068864_1002213152 | 285 |
| 384 | 3300005618 | Ga0068864_100289355 | Ga0068864_1002893552 | 285 |
| 385 | 3300005719 | Ga0068861_100005018 | Ga0068861_1000050188 | 285 |
| 386 | 3300005719 | Ga0068861_100045628 | Ga0068861_1000456282 | 285 |
| 387 | 3300005834 | Ga0068851_10049114 | Ga0068851_100491142 | 285 |
| 388 | 3300005834 | Ga0068851_10119189 | Ga0068851_101191892 | 285 |
| 389 | 3300005840 | Ga0068870_10045754 | Ga0068870_100457542 | 285 |
| 390 | 3300005841 | Ga0068863_100044253 | Ga0068863_1000442532 | 285 |
| 391 | 3300005841 | Ga0068863_100077587 | Ga0068863_1000775872 | 285 |
| 392 | 3300005841 | Ga0068863_100118573 | Ga0068863_1001185732 | 285 |
| 393 | 3300005841 | Ga0068863_100122546 | Ga0068863_1001225462 | 285 |
| 394 | 3300005841 | Ga0068863_100186160 | Ga0068863_1001861602 | 285 |
| 395 | 3300005842 | Ga0068858_100033970 | Ga0068858_1000339704 | 285 |
| 396 | 3300005842 | Ga0068858_100086630 | Ga0068858_1000866302 | 285 |
| 397 | 3300005843 | Ga0068860_100001433 | Ga0068860_1000014332 | 285 |
| 398 | 3300005843 | Ga0068860_100086627 | Ga0068860_1000866272 | 285 |
| 399 | 3300005844 | Ga0068862_100073189 | Ga0068862_1000731892 | 285 |
| 400 | 3300006038 | Ga0075365_10034142 | Ga0075365_100341422 | 285 |
| 401 | 3300006048 | Ga0075363_100027625 | Ga0075363_1000276253 | 285 |
| 402 | 3300006048 | Ga0075363_100075231 | Ga0075363_1000752312 | 285 |
| 403 | 3300006048 | Ga0075363_100130981 | Ga0075363_1001309812 | 285 |
| 404 | 3300006051 | Ga0075364_10036978 | Ga0075364_100369783 | 285 |
| 405 | 3300006058 | Ga0075432_10015651 | Ga0075432_100156513 | 285 |
| 406 | 3300006177 | Ga0075362_10034752 | Ga0075362_100347522 | 285 |
| 407 | 3300006177 | Ga0075362_10036357 | Ga0075362_100363572 | 285 |
| 408 | 3300006177 | Ga0075362_10058139 | Ga0075362_100581392 | 285 |
| 409 | 3300006177 | Ga0075362_10104534 | Ga0075362_101045343 | 285 |
| 410 | 3300006178 | Ga0075367_10020509 | Ga0075367_100205094 | 285 |
| 411 | 3300006178 | Ga0075367_10021504 | Ga0075367_100215042 | 285 |
| 412 | 3300006178 | Ga0075367_10055062 | Ga0075367_100550622 | 285 |
| 413 | 3300006195 | Ga0075366_10004084 | Ga0075366_100040849 | 285 |
| 414 | 3300006195 | Ga0075366_10010236 | Ga0075366_100102362 | 285 |
| 415 | 3300006195 | Ga0075366_10036620 | Ga0075366_100366202 | 285 |
| 416 | 3300006195 | Ga0075366_10037483 | Ga0075366_100374832 | 285 |
| 417 | 3300006195 | Ga0075366_10048963 | Ga0075366_100489632 | 285 |
| 418 | 3300006195 | Ga0075366_10079616 | Ga0075366_100796162 | 285 |
| 419 | 3300006237 | Ga0097621_100059305 | Ga0097621_1000593054 | 285 |
| 420 | 3300006237 | Ga0097621_100078866 | Ga0097621_1000788662 | 285 |
| 421 | 3300006237 | Ga0097621_100084493 | Ga0097621_1000844932 | 285 |
| 422 | 3300006237 | Ga0097621_100251520 | Ga0097621_1002515202 | 285 |
| 423 | 3300006353 | Ga0075370_10015610 | Ga0075370_100156102 | 285 |
| 424 | 3300006353 | Ga0075370_10020892 | Ga0075370_100208922 | 285 |
| 425 | 3300006353 | Ga0075370_10089462 | Ga0075370_100894622 | 285 |
| 426 | 3300006353 | Ga0075370_10150175 | Ga0075370_101501751 | 285 |
| 427 | 3300006358 | Ga0068871_100040812 | Ga0068871_1000408125 | 285 |
| 428 | 3300006358 | Ga0068871_100078969 | Ga0068871_1000789693 | 285 |
| 429 | 3300006358 | Ga0068871_100226750 | Ga0068871_1002267502 | 285 |
| 430 | 3300006846 | Ga0075430_100090622 | Ga0075430_1000906222 | 285 |
| 431 | 3300006880 | Ga0075429_100004495 | Ga0075429_1000044958 | 285 |
| 432 | 3300006881 | Ga0068865_100130144 | Ga0068865_1001301442 | 285 |
| 433 | 3300006881 | Ga0068865_100206821 | Ga0068865_1002068212 | 285 |
| 434 | 3300006881 | Ga0068865_100213969 | Ga0068865_1002139692 | 285 |
| 435 | 3300006931 | Ga0097620_100002636 | Ga0097620_1000026362 | 285 |
| 436 | 3300006931 | Ga0097620_100187829 | Ga0097620_1001878292 | 285 |
| 437 | 3300006948 | Ga0099826_10126482 | Ga0099826_101264823 | 285 |
| 438 | 3300006948 | Ga0099826_10130715 | Ga0099826_101307153 | 285 |
| 439 | 3300009093 | Ga0105240_10003241 | Ga0105240_1000324123 | 285 |
| 440 | 3300009093 | Ga0105240_10100781 | Ga0105240_101007812 | 285 |
| 441 | 3300009093 | Ga0105240_10495046 | Ga0105240_104950462 | 285 |
| 442 | 3300009098 | Ga0105245_10570985 | Ga0105245_105709852 | 285 |
| 443 | 3300009147 | Ga0114129_10506345 | Ga0114129_105063452 | 285 |
| 444 | 3300009148 | Ga0105243_10035673 | Ga0105243_100356732 | 285 |
| 445 | 3300009148 | Ga0105243_10036120 | Ga0105243_100361203 | 285 |
| 446 | 3300009148 | Ga0105243_10039925 | Ga0105243_100399252 | 285 |
| 447 | 3300009148 | Ga0105243_10051142 | Ga0105243_100511422 | 285 |
| 448 | 3300009148 | Ga0105243_10147809 | Ga0105243_101478092 | 285 |
| 449 | 3300009177 | Ga0105248_10340666 | Ga0105248_103406662 | 285 |
| 450 | 3300009177 | Ga0105248_10378942 | Ga0105248_103789422 | 285 |
| 451 | 3300009545 | Ga0105237_10129037 | Ga0105237_101290372 | 285 |
| 452 | 3300009545 | Ga0105237_10392414 | Ga0105237_103924142 | 285 |
| 453 | 3300009551 | Ga0105238_10055568 | Ga0105238_100555682 | 285 |
| 454 | 3300009551 | Ga0105238_10059028 | Ga0105238_100590285 | 285 |
| 455 | 3300009551 | Ga0105238_10145211 | Ga0105238_101452112 | 285 |
| 456 | 3300009553 | Ga0105249_10072632 | Ga0105249_100726322 | 285 |
| 457 | 3300010375 | Ga0105239_10085101 | Ga0105239_100851012 | 285 |
| 458 | 3300010375 | Ga0105239_10358062 | Ga0105239_103580622 | 285 |
| 459 | 3300013100 | Ga0157373_10037135 | Ga0157373_100371352 | 285 |
| 460 | 3300013104 | Ga0157370_10120358 | Ga0157370_101203583 | 285 |
| 461 | 3300013104 | Ga0157370_10265804 | Ga0157370_102658042 | 285 |
| 462 | 3300013105 | Ga0157369_10106740 | Ga0157369_101067402 | 285 |
| 463 | 3300013105 | Ga0157369_10212493 | Ga0157369_102124932 | 285 |
| 464 | 3300013296 | Ga0157374_10048034 | Ga0157374_100480344 | 285 |
| 465 | 3300013296 | Ga0157374_10171718 | Ga0157374_101717182 | 285 |
| 466 | 3300013306 | Ga0163162_10017076 | Ga0163162_100170763 | 285 |
| 467 | 3300013306 | Ga0163162_10094494 | Ga0163162_100944942 | 285 |
| 468 | 3300013306 | Ga0163162_10102728 | Ga0163162_101027283 | 285 |
| 469 | 3300013306 | Ga0163162_10495827 | Ga0163162_104958272 | 285 |
| 470 | 3300013307 | Ga0157372_10077049 | Ga0157372_100770492 | 285 |
| 471 | 3300013307 | Ga0157372_10246431 | Ga0157372_102464312 | 285 |
| 472 | 3300013308 | Ga0157375_10151253 | Ga0157375_101512533 | 285 |
| 473 | 3300013308 | Ga0157375_10242243 | Ga0157375_102422432 | 285 |
| 474 | 3300013308 | Ga0157375_10430043 | Ga0157375_104300432 | 285 |
| 475 | 3300014325 | Ga0163163_10313942 | Ga0163163_103139422 | 285 |
| 476 | 3300014326 | Ga0157380_10138554 | Ga0157380_101385542 | 285 |
| 477 | 3300014326 | Ga0157380_10150634 | Ga0157380_101506342 | 285 |
| 478 | 3300014497 | Ga0182008_10030116 | Ga0182008_100301164 | 285 |
| 479 | 3300014497 | Ga0182008_10039803 | Ga0182008_100398032 | 285 |
| 480 | 3300014745 | Ga0157377_10000382 | Ga0157377_1000038212 | 285 |
| 481 | 3300014745 | Ga0157377_10090589 | Ga0157377_100905892 | 285 |
| 482 | 3300014968 | Ga0157379_10013894 | Ga0157379_100138948 | 285 |
| 483 | 3300014968 | Ga0157379_10074533 | Ga0157379_100745332 | 285 |
| 484 | 3300014968 | Ga0157379_10111962 | Ga0157379_101119622 | 285 |
| 485 | 3300014968 | Ga0157379_10215996 | Ga0157379_102159962 | 285 |
| 486 | 3300014968 | Ga0157379_10235205 | Ga0157379_102352052 | 285 |
| 487 | 3300014968 | Ga0157379_10434370 | Ga0157379_104343702 | 285 |
| 488 | 3300014969 | Ga0157376_10016007 | Ga0157376_100160075 | 285 |
| 489 | 3300014969 | Ga0157376_10117911 | Ga0157376_101179112 | 285 |
| 490 | 3300014969 | Ga0157376_10292907 | Ga0157376_102929072 | 285 |
| 491 | 3300015261 | Ga0182006_1012764 | Ga0182006_10127642 | 285 |
| 492 | 3300015262 | Ga0182007_10013133 | Ga0182007_100131333 | 285 |
| 493 | 3300015683 | Ga0183362_10003 | Ga0183362_1000377 | 285 |
| 494 | 3300017792 | Ga0163161_10000166 | Ga0163161_1000016652 | 285 |
| 495 | 3300017792 | Ga0163161_10046164 | Ga0163161_100461643 | 285 |
| 496 | 3300017792 | Ga0163161_10119951 | Ga0163161_101199512 | 285 |
| 497 | 3300017792 | Ga0163161_10254311 | Ga0163161_102543111 | 285 |
| 498 | 3300021361 | Ga0213872_10000011 | Ga0213872_1000001176 | 285 |
| 499 | 3300021361 | Ga0213872_10073865 | Ga0213872_100738652 | 285 |
| 500 | 3300021377 | Ga0213874_10052812 | Ga0213874_100528122 | 285 |
| 501 | 3300025206 | Ga0209435_100001 | Ga0209435_10000113 | 285 |
| 502 | 3300025230 | Ga0209563_100005 | Ga0209563_100005327 | 285 |
| 503 | 3300025245 | Ga0207425_1004662 | Ga0207425_10046622 | 285 |
| 504 | 3300025246 | Ga0209646_1000001 | Ga0209646_1000001382 | 285 |
| 505 | 3300025250 | Ga0209026_1000003 | Ga0209026_100000313 | 285 |
| 506 | 3300025256 | Ga0209759_1000001 | Ga0209759_100000113 | 285 |
| 507 | 3300025258 | Ga0209129_1015901 | Ga0209129_10159012 | 285 |
| 508 | 3300025258 | Ga0209129_1016072 | Ga0209129_10160722 | 285 |
| 509 | 3300025263 | Ga0209565_1002553 | Ga0209565_10025532 | 285 |
| 510 | 3300025263 | Ga0209565_1006028 | Ga0209565_10060283 | 285 |
| 511 | 3300025284 | Ga0209130_1000241 | Ga0209130_100024172 | 285 |
| 512 | 3300025284 | Ga0209130_1001702 | Ga0209130_100170211 | 285 |
| 513 | 3300025291 | Ga0209675_1002145 | Ga0209675_10021454 | 285 |
| 514 | 3300025291 | Ga0209675_1013293 | Ga0209675_10132933 | 285 |
| 515 | 3300025292 | Ga0209676_1001036 | Ga0209676_100103627 | 285 |
| 516 | 3300025292 | Ga0209676_1011543 | Ga0209676_10115432 | 285 |
| 517 | 3300025292 | Ga0209676_1016039 | Ga0209676_10160392 | 285 |
| 518 | 3300025294 | Ga0209025_1001296 | Ga0209025_10012966 | 285 |
| 519 | 3300025294 | Ga0209025_1001745 | Ga0209025_10017452 | 285 |
| 520 | 3300025294 | Ga0209025_1004965 | Ga0209025_10049652 | 285 |
| 521 | 3300025294 | Ga0209025_1092425 | Ga0209025_10924251 | 285 |
| 522 | 3300025295 | Ga0209564_1022325 | Ga0209564_10223252 | 285 |
| 523 | 3300025297 | Ga0209758_1018074 | Ga0209758_10180742 | 285 |
| 524 | 3300025298 | Ga0209050_1006287 | Ga0209050_10062873 | 285 |
| 525 | 3300025298 | Ga0209050_1008094 | Ga0209050_10080942 | 285 |
| 526 | 3300025298 | Ga0209050_1009215 | Ga0209050_10092152 | 285 |
| 527 | 3300025299 | Ga0209256_1022688 | Ga0209256_10226883 | 285 |
| 528 | 3300025302 | Ga0207426_1000247 | Ga0207426_100024746 | 285 |
| 529 | 3300025303 | Ga0209051_1000024 | Ga0209051_1000024253 | 285 |
| 530 | 3300025303 | Ga0209051_1000373 | Ga0209051_100037325 | 285 |
| 531 | 3300025303 | Ga0209051_1002063 | Ga0209051_100206312 | 285 |
| 532 | 3300025304 | Ga0209257_1000079 | Ga0209257_1000079253 | 285 |
| 533 | 3300025315 | Ga0207697_10043396 | Ga0207697_100433962 | 285 |
| 534 | 3300025893 | Ga0207682_10001523 | Ga0207682_1000152312 | 285 |
| 535 | 3300025893 | Ga0207682_10025532 | Ga0207682_100255322 | 285 |
| 536 | 3300025893 | Ga0207682_10034969 | Ga0207682_100349693 | 285 |
| 537 | 3300025899 | Ga0207642_10006005 | Ga0207642_100060053 | 285 |
| 538 | 3300025900 | Ga0207710_10044146 | Ga0207710_100441462 | 285 |
| 539 | 3300025901 | Ga0207688_10049012 | Ga0207688_100490122 | 285 |
| 540 | 3300025903 | Ga0207680_10157086 | Ga0207680_101570862 | 285 |
| 541 | 3300025907 | Ga0207645_10060058 | Ga0207645_100600582 | 285 |
| 542 | 3300025907 | Ga0207645_10209487 | Ga0207645_102094871 | 285 |
| 543 | 3300025908 | Ga0207643_10035221 | Ga0207643_100352213 | 285 |
| 544 | 3300025908 | Ga0207643_10070522 | Ga0207643_100705222 | 285 |
| 545 | 3300025909 | Ga0207705_10168516 | Ga0207705_101685162 | 285 |
| 546 | 3300025909 | Ga0207705_10223921 | Ga0207705_102239212 | 285 |
| 547 | 3300025912 | Ga0207707_10063466 | Ga0207707_100634662 | 285 |
| 548 | 3300025917 | Ga0207660_10003088 | Ga0207660_100030888 | 285 |
| 549 | 3300025918 | Ga0207662_10033021 | Ga0207662_100330212 | 285 |
| 550 | 3300025918 | Ga0207662_10237245 | Ga0207662_102372452 | 285 |
| 551 | 3300025919 | Ga0207657_10098939 | Ga0207657_100989392 | 285 |
| 552 | 3300025919 | Ga0207657_10104544 | Ga0207657_101045442 | 285 |
| 553 | 3300025919 | Ga0207657_10191083 | Ga0207657_101910832 | 285 |
| 554 | 3300025919 | Ga0207657_10213280 | Ga0207657_102132802 | 285 |
| 555 | 3300025919 | Ga0207657_10287065 | Ga0207657_102870652 | 285 |
| 556 | 3300025920 | Ga0207649_10061414 | Ga0207649_100614142 | 285 |
| 557 | 3300025920 | Ga0207649_10065870 | Ga0207649_100658702 | 285 |
| 558 | 3300025921 | Ga0207652_10012428 | Ga0207652_100124282 | 285 |
| 559 | 3300025923 | Ga0207681_10033139 | Ga0207681_100331392 | 285 |
| 560 | 3300025923 | Ga0207681_10063806 | Ga0207681_100638062 | 285 |
| 561 | 3300025923 | Ga0207681_10110231 | Ga0207681_101102312 | 285 |
| 562 | 3300025924 | Ga0207694_10052371 | Ga0207694_100523712 | 285 |
| 563 | 3300025925 | Ga0207650_10002460 | Ga0207650_100024602 | 285 |
| 564 | 3300025925 | Ga0207650_10009009 | Ga0207650_100090092 | 285 |
| 565 | 3300025925 | Ga0207650_10066075 | Ga0207650_100660752 | 285 |
| 566 | 3300025925 | Ga0207650_10211125 | Ga0207650_102111253 | 285 |
| 567 | 3300025926 | Ga0207659_10008467 | Ga0207659_100084674 | 285 |
| 568 | 3300025926 | Ga0207659_10009925 | Ga0207659_100099253 | 285 |
| 569 | 3300025926 | Ga0207659_10021859 | Ga0207659_100218593 | 285 |
| 570 | 3300025926 | Ga0207659_10141592 | Ga0207659_101415922 | 285 |
| 571 | 3300025926 | Ga0207659_10271162 | Ga0207659_102711622 | 285 |
| 572 | 3300025927 | Ga0207687_10167859 | Ga0207687_101678592 | 285 |
| 573 | 3300025927 | Ga0207687_10371824 | Ga0207687_103718241 | 285 |
| 574 | 3300025931 | Ga0207644_10016645 | Ga0207644_100166455 | 285 |
| 575 | 3300025931 | Ga0207644_10092585 | Ga0207644_100925852 | 285 |
| 576 | 3300025932 | Ga0207690_10061279 | Ga0207690_100612792 | 285 |
| 577 | 3300025933 | Ga0207706_10021027 | Ga0207706_100210272 | 285 |
| 578 | 3300025933 | Ga0207706_10053240 | Ga0207706_100532402 | 285 |
| 579 | 3300025933 | Ga0207706_10060560 | Ga0207706_100605602 | 285 |
| 580 | 3300025933 | Ga0207706_10063023 | Ga0207706_100630232 | 285 |
| 581 | 3300025933 | Ga0207706_10063573 | Ga0207706_100635732 | 285 |
| 582 | 3300025933 | Ga0207706_10069481 | Ga0207706_100694814 | 285 |
| 583 | 3300025934 | Ga0207686_10065792 | Ga0207686_100657922 | 285 |
| 584 | 3300025935 | Ga0207709_10000424 | Ga0207709_1000042446 | 285 |
| 585 | 3300025935 | Ga0207709_10011879 | Ga0207709_100118797 | 285 |
| 586 | 3300025935 | Ga0207709_10016722 | Ga0207709_100167224 | 285 |
| 587 | 3300025935 | Ga0207709_10086004 | Ga0207709_100860042 | 285 |
| 588 | 3300025936 | Ga0207670_10114728 | Ga0207670_101147282 | 285 |
| 589 | 3300025936 | Ga0207670_10249727 | Ga0207670_102497271 | 285 |
| 590 | 3300025937 | Ga0207669_10073705 | Ga0207669_100737052 | 285 |
| 591 | 3300025937 | Ga0207669_10090249 | Ga0207669_100902492 | 285 |
| 592 | 3300025938 | Ga0207704_10023614 | Ga0207704_100236142 | 285 |
| 593 | 3300025938 | Ga0207704_10099319 | Ga0207704_100993192 | 285 |
| 594 | 3300025939 | Ga0207665_10080409 | Ga0207665_100804092 | 285 |
| 595 | 3300025940 | Ga0207691_10006082 | Ga0207691_100060822 | 285 |
| 596 | 3300025940 | Ga0207691_10007915 | Ga0207691_1000791511 | 285 |
| 597 | 3300025940 | Ga0207691_10054365 | Ga0207691_100543652 | 285 |
| 598 | 3300025940 | Ga0207691_10087220 | Ga0207691_100872202 | 285 |
| 599 | 3300025940 | Ga0207691_10109867 | Ga0207691_101098672 | 285 |
| 600 | 3300025940 | Ga0207691_10205047 | Ga0207691_102050472 | 285 |
| 601 | 3300025940 | Ga0207691_10306427 | Ga0207691_103064272 | 285 |
| 602 | 3300025941 | Ga0207711_10028966 | Ga0207711_100289662 | 285 |
| 603 | 3300025941 | Ga0207711_10067388 | Ga0207711_100673883 | 285 |
| 604 | 3300025941 | Ga0207711_10182188 | Ga0207711_101821882 | 285 |
| 605 | 3300025941 | Ga0207711_10273282 | Ga0207711_102732822 | 285 |
| 606 | 3300025942 | Ga0207689_10000225 | Ga0207689_1000022528 | 285 |
| 607 | 3300025942 | Ga0207689_10011178 | Ga0207689_100111788 | 285 |
| 608 | 3300025942 | Ga0207689_10014824 | Ga0207689_100148242 | 285 |
| 609 | 3300025942 | Ga0207689_10099591 | Ga0207689_100995912 | 285 |
| 610 | 3300025942 | Ga0207689_10120858 | Ga0207689_101208583 | 285 |
| 611 | 3300025942 | Ga0207689_10458555 | Ga0207689_104585551 | 285 |
| 612 | 3300025944 | Ga0207661_10071924 | Ga0207661_100719242 | 285 |
| 613 | 3300025944 | Ga0207661_10190549 | Ga0207661_101905492 | 285 |
| 614 | 3300025945 | Ga0207679_10221671 | Ga0207679_102216712 | 285 |
| 615 | 3300025949 | Ga0207667_10115644 | Ga0207667_101156442 | 285 |
| 616 | 3300025949 | Ga0207667_10147545 | Ga0207667_101475451 | 285 |
| 617 | 3300025949 | Ga0207667_10367606 | Ga0207667_103676062 | 285 |
| 618 | 3300025949 | Ga0207667_10482118 | Ga0207667_104821182 | 285 |
| 619 | 3300025960 | Ga0207651_10022218 | Ga0207651_100222183 | 285 |
| 620 | 3300025960 | Ga0207651_10022563 | Ga0207651_100225632 | 285 |
| 621 | 3300025960 | Ga0207651_10048057 | Ga0207651_100480572 | 285 |
| 622 | 3300025960 | Ga0207651_10241507 | Ga0207651_102415072 | 285 |
| 623 | 3300025961 | Ga0207712_10040982 | Ga0207712_100409822 | 285 |
| 624 | 3300025961 | Ga0207712_10062282 | Ga0207712_100622822 | 285 |
| 625 | 3300025972 | Ga0207668_10037660 | Ga0207668_100376602 | 285 |
| 626 | 3300025972 | Ga0207668_10104228 | Ga0207668_101042283 | 285 |
| 627 | 3300025972 | Ga0207668_10173140 | Ga0207668_101731402 | 285 |
| 628 | 3300025981 | Ga0207640_10182293 | Ga0207640_101822932 | 285 |
| 629 | 3300025981 | Ga0207640_10367989 | Ga0207640_103679892 | 285 |
| 630 | 3300025986 | Ga0207658_10000959 | Ga0207658_100009599 | 285 |
| 631 | 3300025986 | Ga0207658_10009082 | Ga0207658_100090822 | 285 |
| 632 | 3300025986 | Ga0207658_10095778 | Ga0207658_100957782 | 285 |
| 633 | 3300025986 | Ga0207658_10156383 | Ga0207658_101563831 | 285 |
| 634 | 3300026023 | Ga0207677_10007983 | Ga0207677_100079832 | 285 |
| 635 | 3300026023 | Ga0207677_10036090 | Ga0207677_100360903 | 285 |
| 636 | 3300026023 | Ga0207677_10082138 | Ga0207677_100821382 | 285 |
| 637 | 3300026035 | Ga0207703_10001350 | Ga0207703_100013502 | 285 |
| 638 | 3300026035 | Ga0207703_10016674 | Ga0207703_100166742 | 285 |
| 639 | 3300026035 | Ga0207703_10112459 | Ga0207703_101124592 | 285 |
| 640 | 3300026041 | Ga0207639_10137219 | Ga0207639_101372192 | 285 |
| 641 | 3300026041 | Ga0207639_10311087 | Ga0207639_103110872 | 285 |
| 642 | 3300026041 | Ga0207639_10321025 | Ga0207639_103210252 | 285 |
| 643 | 3300026067 | Ga0207678_10132667 | Ga0207678_101326672 | 285 |
| 644 | 3300026067 | Ga0207678_10139535 | Ga0207678_101395352 | 285 |
| 645 | 3300026078 | Ga0207702_10014241 | Ga0207702_100142417 | 285 |
| 646 | 3300026078 | Ga0207702_10201368 | Ga0207702_102013682 | 285 |
| 647 | 3300026088 | Ga0207641_10009363 | Ga0207641_100093632 | 285 |
| 648 | 3300026088 | Ga0207641_10159332 | Ga0207641_101593322 | 285 |
| 649 | 3300026089 | Ga0207648_10002629 | Ga0207648_1000262910 | 285 |
| 650 | 3300026089 | Ga0207648_10024680 | Ga0207648_100246803 | 285 |
| 651 | 3300026089 | Ga0207648_10093629 | Ga0207648_100936292 | 285 |
| 652 | 3300026089 | Ga0207648_10113433 | Ga0207648_101134332 | 285 |
| 653 | 3300026089 | Ga0207648_10131878 | Ga0207648_101318782 | 285 |
| 654 | 3300026089 | Ga0207648_10145231 | Ga0207648_101452312 | 285 |
| 655 | 3300026089 | Ga0207648_10149930 | Ga0207648_101499302 | 285 |
| 656 | 3300026089 | Ga0207648_10191397 | Ga0207648_101913971 | 285 |
| 657 | 3300026089 | Ga0207648_10215001 | Ga0207648_102150011 | 285 |
| 658 | 3300026095 | Ga0207676_10010315 | Ga0207676_100103152 | 285 |
| 659 | 3300026095 | Ga0207676_10015099 | Ga0207676_100150992 | 285 |
| 660 | 3300026095 | Ga0207676_10026111 | Ga0207676_100261115 | 285 |
| 661 | 3300026095 | Ga0207676_10026609 | Ga0207676_100266092 | 285 |
| 662 | 3300026095 | Ga0207676_10219278 | Ga0207676_102192781 | 285 |
| 663 | 3300026095 | Ga0207676_10274003 | Ga0207676_102740032 | 285 |
| 664 | 3300026116 | Ga0207674_10008218 | Ga0207674_100082182 | 285 |
| 665 | 3300026116 | Ga0207674_10022905 | Ga0207674_100229057 | 285 |
| 666 | 3300026116 | Ga0207674_10162897 | Ga0207674_101628972 | 285 |
| 667 | 3300026118 | Ga0207675_100001260 | Ga0207675_1000012606 | 285 |
| 668 | 3300026118 | Ga0207675_100094683 | Ga0207675_1000946832 | 285 |
| 669 | 3300026121 | Ga0207683_10103395 | Ga0207683_101033952 | 285 |
| 670 | 3300026121 | Ga0207683_10113119 | Ga0207683_101131192 | 285 |
| 671 | 3300026121 | Ga0207683_10161670 | Ga0207683_101616702 | 285 |
| 672 | 3300026121 | Ga0207683_10382882 | Ga0207683_103828822 | 285 |
| 673 | 3300026121 | Ga0207683_10400375 | Ga0207683_104003752 | 285 |
| 674 | 3300026142 | Ga0207698_10008850 | Ga0207698_100088506 | 285 |
| 675 | 3300026142 | Ga0207698_10200493 | Ga0207698_102004932 | 285 |
| 676 | 3300026142 | Ga0207698_10259193 | Ga0207698_102591932 | 285 |
| 677 | 3300026142 | Ga0207698_10300083 | Ga0207698_103000831 | 285 |
| 678 | 3300026142 | Ga0207698_10549191 | Ga0207698_105491911 | 285 |
| 679 | 3300027378 | Ga0209981_1005382 | Ga0209981_10053822 | 285 |
| 680 | 3300027526 | Ga0209968_1000691 | Ga0209968_10006914 | 285 |
| 681 | 3300027666 | Ga0209282_1108405 | Ga0209282_11084051 | 285 |
| 682 | 3300027695 | Ga0209966_1000036 | Ga0209966_100003625 | 285 |
| 683 | 3300027876 | Ga0209974_10012937 | Ga0209974_100129372 | 285 |
| 684 | 3300028379 | Ga0268266_10024378 | Ga0268266_100243784 | 285 |
| 685 | 3300028379 | Ga0268266_10175172 | Ga0268266_101751722 | 285 |
| 686 | 3300028380 | Ga0268265_10025246 | Ga0268265_100252465 | 285 |
| 687 | 3300028380 | Ga0268265_10036125 | Ga0268265_100361252 | 285 |
| 688 | 3300028380 | Ga0268265_10040812 | Ga0268265_100408122 | 285 |
| 689 | 3300028381 | Ga0268264_10004852 | Ga0268264_100048525 | 285 |
| 690 | 3300028381 | Ga0268264_10042982 | Ga0268264_100429822 | 285 |
| 691 | 3300028381 | Ga0268264_10262861 | Ga0268264_102628612 | 285 |
| 692 | 3300028786 | Ga0307517_10001871 | Ga0307517_100018714 | 285 |
| 693 | 3300028786 | Ga0307517_10107035 | Ga0307517_101070352 | 285 |
| 694 | 3300028794 | Ga0307515_10000020 | Ga0307515_10000020242 | 285 |
| 695 | 3300028794 | Ga0307515_10000051 | Ga0307515_10000051260 | 285 |
| 696 | 3300028794 | Ga0307515_10000101 | Ga0307515_10000101126 | 285 |
| 697 | 3300028794 | Ga0307515_10000152 | Ga0307515_1000015292 | 285 |
| 698 | 3300028794 | Ga0307515_10000991 | Ga0307515_1000099157 | 285 |
| 699 | 3300028794 | Ga0307515_10007242 | Ga0307515_1000724217 | 285 |
| 700 | 3300028794 | Ga0307515_10008378 | Ga0307515_100083786 | 285 |
| 701 | 3300028794 | Ga0307515_10036978 | Ga0307515_100369785 | 285 |
| 702 | 3300028794 | Ga0307515_10038740 | Ga0307515_100387403 | 285 |
| 703 | 3300028794 | Ga0307515_10075161 | Ga0307515_100751613 | 285 |
| 704 | 3300028794 | Ga0307515_10120000 | Ga0307515_101200002 | 285 |
| 705 | 3300028794 | Ga0307515_10307026 | Ga0307515_103070262 | 285 |
| 706 | 3300030522 | Ga0307512_10108096 | Ga0307512_101080962 | 285 |
| 707 | 3300030522 | Ga0307512_10116038 | Ga0307512_101160382 | 285 |
| 708 | 3300030731 | Ga0316177_1078761 | Ga0316177_10787612 | 285 |
| 709 | 3300030733 | Ga0314311_1107726 | Ga0314311_11077262 | 285 |
| 710 | 3300030734 | Ga0316179_1098911 | Ga0316179_10989112 | 285 |
| 711 | 3300030742 | Ga0316183_1077170 | Ga0316183_10771703 | 285 |
| 712 | 3300030744 | Ga0316181_1144972 | Ga0316181_11449727 | 285 |
| 713 | 3300030745 | Ga0316182_1067687 | Ga0316182_10676872 | 285 |
| 714 | 3300030745 | Ga0316182_1243175 | Ga0316182_12431752 | 285 |
| 715 | 3300031235 | Ga0265330_10000033 | Ga0265330_1000003362 | 285 |
| 716 | 3300031238 | Ga0265332_10000001 | Ga0265332_10000001186 | 285 |
| 717 | 3300031240 | Ga0265320_10040578 | Ga0265320_100405782 | 285 |
| 718 | 3300031247 | Ga0265340_10018855 | Ga0265340_100188555 | 285 |
| 719 | 3300031251 | Ga0265327_10001098 | Ga0265327_1000109835 | 285 |
| 720 | 3300031251 | Ga0265327_10005755 | Ga0265327_1000575511 | 285 |
| 721 | 3300031456 | Ga0307513_10000004 | Ga0307513_10000004336 | 285 |
| 722 | 3300031456 | Ga0307513_10000054 | Ga0307513_10000054100 | 285 |
| 723 | 3300031456 | Ga0307513_10001123 | Ga0307513_1000112335 | 285 |
| 724 | 3300031456 | Ga0307513_10010964 | Ga0307513_100109642 | 285 |
| 725 | 3300031456 | Ga0307513_10142897 | Ga0307513_101428972 | 285 |
| 726 | 3300031456 | Ga0307513_10145257 | Ga0307513_101452572 | 285 |
| 727 | 3300031456 | Ga0307513_10158749 | Ga0307513_101587492 | 285 |
| 728 | 3300031507 | Ga0307509_10025279 | Ga0307509_100252792 | 285 |
| 729 | 3300031507 | Ga0307509_10030443 | Ga0307509_100304432 | 285 |
| 730 | 3300031507 | Ga0307509_10035773 | Ga0307509_100357732 | 285 |
| 731 | 3300031507 | Ga0307509_10180175 | Ga0307509_101801752 | 285 |
| 732 | 3300031548 | Ga0307408_100000079 | Ga0307408_1000000792 | 285 |
| 733 | 3300031548 | Ga0307408_100009340 | Ga0307408_1000093402 | 285 |
| 734 | 3300031548 | Ga0307408_100080528 | Ga0307408_1000805283 | 285 |
| 735 | 3300031548 | Ga0307408_100114897 | Ga0307408_1001148972 | 285 |
| 736 | 3300031548 | Ga0307408_100187080 | Ga0307408_1001870803 | 285 |
| 737 | 3300031548 | Ga0307408_100201107 | Ga0307408_1002011072 | 285 |
| 738 | 3300031548 | Ga0307408_100259871 | Ga0307408_1002598712 | 285 |
| 739 | 3300031616 | Ga0307508_10000007 | Ga0307508_1000000733 | 285 |
| 740 | 3300031616 | Ga0307508_10000227 | Ga0307508_1000022720 | 285 |
| 741 | 3300031616 | Ga0307508_10038562 | Ga0307508_100385626 | 285 |
| 742 | 3300031649 | Ga0307514_10011126 | Ga0307514_100111265 | 285 |
| 743 | 3300031649 | Ga0307514_10062171 | Ga0307514_100621712 | 285 |
| 744 | 3300031711 | Ga0265314_10000022 | Ga0265314_10000022191 | 285 |
| 745 | 3300031730 | Ga0307516_10000497 | Ga0307516_1000049729 | 285 |
| 746 | 3300031730 | Ga0307516_10004946 | Ga0307516_100049466 | 285 |
| 747 | 3300031730 | Ga0307516_10012796 | Ga0307516_100127962 | 285 |
| 748 | 3300031730 | Ga0307516_10014242 | Ga0307516_100142423 | 285 |
| 749 | 3300031730 | Ga0307516_10016014 | Ga0307516_100160142 | 285 |
| 750 | 3300031730 | Ga0307516_10314341 | Ga0307516_103143412 | 285 |
| 751 | 3300031731 | Ga0307405_10047870 | Ga0307405_100478702 | 285 |
| 752 | 3300031731 | Ga0307405_10328208 | Ga0307405_103282082 | 285 |
| 753 | 3300031824 | Ga0307413_10023658 | Ga0307413_100236582 | 285 |
| 754 | 3300031901 | Ga0307406_10064183 | Ga0307406_100641832 | 285 |
| 755 | 3300031901 | Ga0307406_10229442 | Ga0307406_102294421 | 285 |
| 756 | 3300031901 | Ga0307406_10334584 | Ga0307406_103345842 | 285 |
| 757 | 3300031911 | Ga0307412_10067234 | Ga0307412_100672342 | 285 |
| 758 | 3300031911 | Ga0307412_10085767 | Ga0307412_100857673 | 285 |
| 759 | 3300031911 | Ga0307412_10086513 | Ga0307412_100865133 | 285 |
| 760 | 3300031995 | Ga0307409_100021883 | Ga0307409_1000218834 | 285 |
| 761 | 3300032002 | Ga0307416_100002560 | Ga0307416_1000025604 | 285 |
| 762 | 3300032002 | Ga0307416_100615376 | Ga0307416_1006153762 | 285 |
| 763 | 3300032126 | Ga0307415_100027466 | Ga0307415_1000274662 | 285 |
| 764 | 3300033180 | Ga0307510_10026627 | Ga0307510_100266272 | 285 |
| 765 | 3300033180 | Ga0307510_10111223 | Ga0307510_101112232 | 285 |
| 766 | 3300035112 | Ga0373932_0086323 | Ga0373932_0086323_111_968 | 285 |
| 767 | 3300035691 | Ga0373931_0016799 | Ga0373931_0016799_673_1530 | 285 |
| 768 | 3300035691 | Ga0373931_0017937 | Ga0373931_0017937_1739_2596 | 285 |
| 769 | 3300035725 | Ga0373947_0149989 | Ga0373947_0149989_242_1099 | 285 |
| 770 | 3300036401 | Ga0373937_0028691 | Ga0373937_0028691_1408_2265 | 285 |
| 771 | 3300037068 | Ga0373925_0327725 | Ga0373925_0327725_145_1002 | 285 |
| 772 | 3300037418 | Ga0395900_0000109 | Ga0395900_0000109_88007_88870 | 285 |
| 773 | 3300037466 | Ga0395898_0000868 | Ga0395898_0000868_35669_36532 | 285 |
| 774 | 3300037471 | Ga0395905_0008841 | Ga0395905_0008841_360_1217 | 285 |
| 775 | 3300037471 | Ga0395905_0009815 | Ga0395905_0009815_4319_5176 | 285 |
| 776 | 3300037471 | Ga0395905_0016819 | Ga0395905_0016819_5866_6723 | 285 |
| 777 | 3300038443 | Ga0395901_0066688 | Ga0395901_0066688_1198_2055 | 285 |
| 778 | 3300039447 | Ga0436361_0296121 | Ga0436361_0296121_12581_13447 | 285 |
| 779 | 3300039447 | Ga0436361_0416556 | Ga0436361_0416556_2798_3655 | 285 |
| 780 | 3300039447 | Ga0436361_1033023 | Ga0436361_1033023_1176_2033 | 285 |
| 781 | 3300039450 | Ga0436363_1441997 | Ga0436363_1441997_842_1699 | 285 |
| 782 | 3300041413 | Ga0439465_0010818 | Ga0439465_0010818_831_1688 | 285 |
| 783 | 3300041459 | Ga0451800_0898755 | Ga0451800_0898755_268_1125 | 285 |
| 784 | 3300041997 | Ga0439431_0011306 | Ga0439431_0011306_1029_1886 | 285 |
| 785 | 3300041999 | Ga0439433_0006439 | Ga0439433_0006439_990_1847 | 285 |
| 786 | 3300042002 | Ga0439442_005843 | Ga0439442_005843_763_1620 | 285 |
| 787 | 3300042004 | Ga0439445_0004163 | Ga0439445_0004163_1418_2275 | 285 |
| 788 | 3300042006 | Ga0439432_000677 | Ga0439432_000677_6814_7671 | 285 |
| 789 | 3300042007 | Ga0439449_0000924 | Ga0439449_0000924_9720_10577 | 285 |
| 790 | 3300042010 | Ga0439452_009127 | Ga0439452_009127_1355_2212 | 285 |
| 791 | 3300042125 | Ga0450923_015391 | Ga0450923_015391_421_1278 | 285 |
| 792 | 3300042133 | Ga0450896_012807 | Ga0450896_012807_56_913 | 285 |
| 793 | 3300042435 | Ga0439434_0001859 | Ga0439434_0001859_4869_5726 | 285 |
| 794 | 3300042439 | Ga0439464_0017013 | Ga0439464_0017013_168_1025 | 285 |
| 795 | 3300042531 | Ga0450918_002732 | Ga0450918_002732_1085_1942 | 285 |
| 796 | 3300042876 | Ga0451577_0002119 | Ga0451577_0002119_23218_24075 | 285 |
| 797 | 3300044656 | Ga0466969_0000385 | Ga0466969_0000385_1508_2365 | 285 |
| 798 | 3300044656 | Ga0466969_0019596 | Ga0466969_0019596_2610_3467 | 285 |
| 799 | 3300044673 | Ga0453683_0091346 | Ga0453683_0091346_91_948 | 285 |
| 800 | 3300044683 | Ga0466965_0065463 | Ga0466965_0065463_702_1559 | 285 |
| 801 | 3300044684 | Ga0466966_0009505 | Ga0466966_0009505_624_1481 | 285 |
| 802 | 3300044693 | Ga0466961_0002458 | Ga0466961_0002458_4420_5277 | 285 |
| 803 | 3300044712 | Ga0453684_0050727 | Ga0453684_0050727_3292_4149 | 285 |
| 804 | 3300044719 | Ga0466971_0042912 | Ga0466971_0042912_1129_1986 | 285 |
| 805 | 3300044719 | Ga0466971_0064696 | Ga0466971_0064696_184_1041 | 285 |
| 806 | 3300045049 | Ga0466959_0077189 | Ga0466959_0077189_892_1749 | 285 |
| 807 | 3300045051 | Ga0451576_0003324 | Ga0451576_0003324_809_1666 | 285 |
| 808 | 3300045051 | Ga0451576_0168393 | Ga0451576_0168393_584_1441 | 285 |
| 809 | 3300046454 | Ga0495592_0000028 | Ga0495592_0000028_53740_54597 | 285 |
| 810 | 3300046455 | Ga0495603_0162358 | Ga0495603_0162358_156_1013 | 285 |
| 811 | 3300046459 | Ga0495629_0166197 | Ga0495629_0166197_51_908 | 285 |
| 812 | 3300046472 | Ga0495580_0046417 | Ga0495580_0046417_1181_2038 | 285 |
| 813 | 3300046515 | Ga0495620_0023276 | Ga0495620_0023276_240_1097 | 285 |
| 814 | 3300046519 | Ga0495632_0055206 | Ga0495632_0055206_837_1694 | 285 |
| 815 | 3300046519 | Ga0495632_0073123 | Ga0495632_0073123_417_1274 | 285 |
| 816 | 3300046530 | Ga0495654_0079515 | Ga0495654_0079515_141_998 | 285 |
| 817 | 3300046530 | Ga0495654_0093905 | Ga0495654_0093905_243_1100 | 285 |
| 818 | 3300046536 | Ga0495587_0069353 | Ga0495587_0069353_15_872 | 285 |
| 819 | 3300046542 | Ga0495597_0025734 | Ga0495597_0025734_1350_2207 | 285 |
| 820 | 3300046542 | Ga0495597_0027421 | Ga0495597_0027421_896_1753 | 285 |
| 821 | 3300046559 | Ga0495667_0182381 | Ga0495667_0182381_30_887 | 285 |
| 822 | 3300046615 | Ga0495656_0000202 | Ga0495656_0000202_13142_13999 | 285 |
| 823 | 3300046615 | Ga0495656_0042224 | Ga0495656_0042224_559_1416 | 285 |
| 824 | 3300046660 | Ga0495625_0005344 | Ga0495625_0005344_10319_11176 | 285 |
| 825 | 3300046660 | Ga0495625_0013990 | Ga0495625_0013990_777_1634 | 285 |
| 826 | 3300046683 | Ga0495658_0083956 | Ga0495658_0083956_825_1682 | 285 |
| 827 | 3300046683 | Ga0495658_0106707 | Ga0495658_0106707_411_1268 | 285 |
| 828 | 3300046683 | Ga0495658_0203130 | Ga0495658_0203130_203_1063 | 285 |
| 829 | 3300046694 | Ga0495649_0035849 | Ga0495649_0035849_1095_1952 | 285 |
| 830 | 3300046694 | Ga0495649_0203375 | Ga0495649_0203375_145_1002 | 285 |
| 831 | 3300046810 | Ga0495660_0124699 | Ga0495660_0124699_201_1058 | 285 |
| 832 | 3300047443 | Ga0495687_040301 | Ga0495687_040301_985_1842 | 285 |
| 833 | 3300047472 | Ga0495686_0183357 | Ga0495686_0183357_122_979 | 285 |
| 834 | 3300047673 | Ga0495593_0053969 | Ga0495593_0053969_365_1222 | 285 |
| 835 | 3300048903 | Ga0496100_0151999 | Ga0496100_0151999_394_1251 | 285 |
| 836 | 3300048903 | Ga0496100_0250119 | Ga0496100_0250119_286_1143 | 285 |
| 837 | 3300048904 | Ga0496101_0001014 | Ga0496101_0001014_2615_3472 | 285 |
| 838 | 3300048905 | Ga0496102_0017154 | Ga0496102_0017154_617_1474 | 285 |
| 839 | 3300048905 | Ga0496102_0038214 | Ga0496102_0038214_1535_2392 | 285 |
| 840 | 3300048905 | Ga0496102_0092470 | Ga0496102_0092470_1237_2094 | 285 |
| 841 | 3300048907 | Ga0496104_0164500 | Ga0496104_0164500_155_1012 | 285 |
| 842 | 3300048908 | Ga0496105_0057169 | Ga0496105_0057169_491_1348 | 285 |
| 843 | 3300048908 | Ga0496105_0131760 | Ga0496105_0131760_103_963 | 285 |
| 844 | 3300048908 | Ga0496105_0430180 | Ga0496105_0430180_68_925 | 285 |
| 845 | 3300048909 | Ga0496106_0054602 | Ga0496106_0054602_956_1813 | 285 |
| 846 | 3300048909 | Ga0496106_0080771 | Ga0496106_0080771_536_1393 | 285 |
| 847 | 3300048910 | Ga0496107_0183594 | Ga0496107_0183594_209_1066 | 285 |
| 848 | 3300048911 | Ga0496108_0141293 | Ga0496108_0141293_1061_1918 | 285 |
| 849 | 3300048912 | Ga0496109_0629257 | Ga0496109_0629257_11_868 | 285 |
| 850 | 3300048913 | Ga0496110_0042297 | Ga0496110_0042297_154_1011 | 285 |
| 851 | 3300048914 | Ga0496111_0106565 | Ga0496111_0106565_686_1543 | 285 |
| 852 | 3300048914 | Ga0496111_0111522 | Ga0496111_0111522_419_1276 | 285 |
| 853 | 3300048925 | Ga0496122_0000985 | Ga0496122_0000985_48704_49561 | 285 |
| 854 | 3300048925 | Ga0496122_0089547 | Ga0496122_0089547_896_1753 | 285 |
| 855 | 3300048926 | Ga0496123_0000656 | Ga0496123_0000656_41172_42029 | 285 |
| 856 | 3300048926 | Ga0496123_0081490 | Ga0496123_0081490_479_1336 | 285 |
| 857 | 3300048927 | Ga0496124_0000317 | Ga0496124_0000317_19554_20411 | 285 |
| 858 | 3300048927 | Ga0496124_0081933 | Ga0496124_0081933_1474_2331 | 285 |
| 859 | 3300048928 | Ga0496125_0001040 | Ga0496125_0001040_748_1605 | 285 |
| 860 | 3300048929 | Ga0496126_0315896 | Ga0496126_0315896_347_1204 | 285 |
| 861 | 3300049568 | Ga0501031_0012766 | Ga0501031_0012766_438_1295 | 285 |
| 862 | 3300049579 | Ga0501043_0000004 | Ga0501043_0000004_147246_148103 | 285 |
| 863 | 3300049580 | Ga0501046_0000016 | Ga0501046_0000016_143733_144590 | 285 |
| 864 | 3300049581 | Ga0501047_0000012 | Ga0501047_0000012_143413_144270 | 285 |
| 865 | 3300049649 | Ga0501198_000005 | Ga0501198_000005_133802_134659 | 285 |
| 866 | 3300049662 | Ga0501222_000003 | Ga0501222_000003_134551_135408 | 285 |
| 867 | 3300049759 | Ga0501262_000797 | Ga0501262_000797_48_905 | 285 |
| 868 | 3300049822 | Ga0501035_0340835 | Ga0501035_0340835_130_987 | 285 |
| 869 | 3300050490 | nmdc:mga03n38_29940_c1 | nmdc:mga03n38_29940_c1_78_935 | 285 |
| 870 | 3300050491 | nmdc:mga00v17_183511_c1 | nmdc:mga00v17_183511_c1_328_1185 | 285 |
| 871 | 3300050491 | nmdc:mga00v17_84012_c1 | nmdc:mga00v17_84012_c1_170_1027 | 285 |
| 872 | 3300050492 | nmdc:mga0yw44_292201_c1 | nmdc:mga0yw44_292201_c1_172_1029 | 285 |
| 873 | 3300050493 | nmdc:mga0k408_156455_c1 | nmdc:mga0k408_156455_c1_255_1112 | 285 |
| 874 | 3300050493 | nmdc:mga0k408_162745_c1 | nmdc:mga0k408_162745_c1_359_1216 | 285 |
| 875 | 3300050493 | nmdc:mga0k408_23770_c1 | nmdc:mga0k408_23770_c1_168_1025 | 285 |
| 876 | 3300050493 | nmdc:mga0k408_41156_c1 | nmdc:mga0k408_41156_c1_1670_2527 | 285 |
| 877 | 3300050493 | nmdc:mga0k408_52323_c1 | nmdc:mga0k408_52323_c1_811_1668 | 285 |
| 878 | 3300050493 | nmdc:mga0k408_56668_c1 | nmdc:mga0k408_56668_c1_286_1143 | 285 |
| 879 | 3300050493 | nmdc:mga0k408_80001_c1 | nmdc:mga0k408_80001_c1_257_1114 | 285 |
| 880 | 3300050493 | nmdc:mga0k408_85470_c1 | nmdc:mga0k408_85470_c1_251_1108 | 285 |
| 881 | 3300050493 | nmdc:mga0k408_9344_c1 | nmdc:mga0k408_9344_c1_3294_4151 | 285 |
| 882 | 3300050496 | nmdc:mga07m45_134711_c1 | nmdc:mga07m45_134711_c1_528_1385 | 285 |
| 883 | 3300050496 | nmdc:mga07m45_14664_c1 | nmdc:mga07m45_14664_c1_1094_1951 | 285 |
| 884 | 3300050496 | nmdc:mga07m45_2993_c1 | nmdc:mga07m45_2993_c1_737_1594 | 285 |
| 885 | 3300050496 | nmdc:mga07m45_60107_c1 | nmdc:mga07m45_60107_c1_596_1453 | 285 |
| 886 | 3300050496 | nmdc:mga07m45_73331_c1 | nmdc:mga07m45_73331_c1_69_926 | 285 |
| 887 | 3300050516 | nmdc:mga0sz30_3098_c1 | nmdc:mga0sz30_3098_c1_2006_2863 | 285 |
| 888 | 3300053077 | Ga0495601_0135285 | Ga0495601_0135285_151_1008 | 285 |
| 889 | 3300053084 | Ga0495595_0181299 | Ga0495595_0181299_160_1017 | 285 |
| 890 | 3300053085 | Ga0495619_0088437 | Ga0495619_0088437_988_1845 | 285 |
| 891 | 3300053085 | Ga0495619_0230742 | Ga0495619_0230742_374_1231 | 285 |
| 892 | 3300053093 | Ga0500651_0122933 | Ga0500651_0122933_217_1074 | 285 |
| 893 | 3300053131 | Ga0500652_045576 | Ga0500652_045576_827_1684 | 285 |
| 894 | 3300053134 | Ga0500658_0044731 | Ga0500658_0044731_178_1035 | 285 |
| 895 | 3300053136 | Ga0500559_0011048 | Ga0500559_0011048_990_1847 | 285 |
| 896 | 3300053730 | Ga0500645_000413 | Ga0500645_000413_14262_15119 | 285 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3tml-assembly2.cif.gz_A | crystal structure of 2-dehydro-3-deoxyphosphooctonate aldolase from burkholderia cenocepacia | 0.9706 | 1 | 281 |
| 3tml-assembly1.cif.gz_B | crystal structure of 2-dehydro-3-deoxyphosphooctonate aldolase from burkholderia cenocepacia | 0.9677 | 1 | 281 |
| 6mdy-assembly1.cif.gz_A | crystal structure of a 2-dehydro-3-deoxyphosphooctonate aldolase from legionella pneumophila philadelphia 1 | 0.9667 | 1 | 275 |
| 6mdy-assembly1.cif.gz_B | crystal structure of a 2-dehydro-3-deoxyphosphooctonate aldolase from legionella pneumophila philadelphia 1 | 0.9661 | 1 | 277 |
| 6mdy-assembly1.cif.gz_C | crystal structure of a 2-dehydro-3-deoxyphosphooctonate aldolase from legionella pneumophila philadelphia 1 | 0.9566 | 1 | 277 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1fwtA00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.948 | 12 | 276 | 3.20.20.70 |
| 3t4cC00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9377 | 1 | 281 | 3.20.20.70 |
| 1fwtA00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9305 | 12 | 276 | 3.20.20.70 |
| 3t4cC00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9238 | 1 | 281 | 3.20.20.70 |
| 1o60D00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.915 | 2 | 274 | 3.20.20.70 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A536Y3N3-F1-model_v4 | 3-deoxy-8-phosphooctulonate synthase (EC 2.5.1.55) | 0.9838 | 1 | 130 |
GO:0005737
GO:0008676 GO:0009103 |
| AF-A0A257L132-F1-model_v4 | 3-deoxy-8-phosphooctulonate synthase (EC 2.5.1.55) | 0.9795 | 1 | 175 |
GO:0005737
GO:0008676 GO:0009103 |
| AF-A0A356HN51-F1-model_v4 | deleted | 0.9781 | 1 | 123 |
|
| AF-A0A382NXE0-F1-model_v4 | 3-deoxy-8-phosphooctulonate synthase (EC 2.5.1.55) | 0.9769 | 14 | 138 |
GO:0005737
GO:0008676 GO:0009058 |
| AF-A0A365VQ31-F1-model_v4 | deleted | 0.9769 | 1 | 119 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar