F485002

General Info

Members Datasets Scaffolds Average Seq Length
896 242 1792 147

Family's Representative Sequence

Representative Sequence 3300005337|Ga0070682_100645922|Ga0070682_1006459221
Length 165
Sequence VRSFSVAEYKHAYYIPLLMETLPFEIGETAHALRKAFDRRAVGLGVTRAQWKVLFKLERTPGLRQIELADLLDIEPITLSRIVDRLEEAGLVERASDPADRRAWRLHVTRKAQPLIEKLHSVADEMIAEAFAGIDTRHIEITRAVLGRVRENTARAAPMSRASNQ

Samples

Sample ID Description Type Environment
1 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
5 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
6 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
7 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
8 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
9 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
10 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
11 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
12 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
13 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
14 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
15 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
16 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
17 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
18 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
19 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
20 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
21 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
22 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
23 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
24 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
25 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
26 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
27 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
28 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
29 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
30 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
31 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
32 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
33 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
34 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
35 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
36 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
37 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
38 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
39 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
40 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
41 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
42 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
43 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
44 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
45 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
46 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
47 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
48 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
49 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
50 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
51 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
52 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
53 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
54 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
55 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
56 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
57 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
58 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
59 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
60 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
61 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
62 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
63 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
64 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
65 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
66 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
67 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
68 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
69 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
71 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
72 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
73 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
74 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
75 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
76 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
77 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
78 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
79 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
80 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
81 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
82 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
83 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
84 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
85 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
86 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
87 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
88 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
89 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
90 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
91 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
92 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
93 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
94 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
95 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
96 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
97 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
98 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
99 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
100 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
101 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
158 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
159 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
160 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
161 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
162 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
163 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
164 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
165 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
166 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
167 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
168 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
169 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
170 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
171 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
172 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
173 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
174 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
175 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
176 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
177 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
178 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
179 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
180 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
181 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
182 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
183 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
184 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
185 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
186 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
187 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
188 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
189 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
190 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
191 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
192 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
193 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
194 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
195 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
196 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
197 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
198 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
199 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
200 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
201 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
202 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
203 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
204 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
205 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
206 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
207 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
208 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
209 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
210 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
211 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
212 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
213 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
214 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
215 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
216 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
217 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
218 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
219 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
220 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
221 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
222 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
223 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
224 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
225 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
226 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
227 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
228 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
229 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
230 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
231 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
232 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
233 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
234 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
235 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
236 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
237 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
238 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
239 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
240 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
241 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
242 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.33
Nodule 0
Rhizoplane 5.92
Rhizosphere 93.19
Stem 0
Stem Tuber 0
Unclassified 9.71

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070682_100645922 3300005337 Bacteria 842
2 MBSR1b_contig_13686641 2162886012 Bacteria 1251
3 JGI24740J21852_10024667 3300001979 Bacteria 2038
4 JGI24739J22299_10005757 3300001989 Bacteria 4697
5 JGI24739J22299_10021619 3300001989 Bacteria 2288
6 JGI24737J22298_10017642 3300001990 Bacteria 2297
7 JGI24737J22298_10218047 3300001990 Bacteria 563
8 JGI24743J22301_10009110 3300001991 Bacteria 1753
9 JGI24735J21928_10004294 3300002067 Bacteria 4798
10 JGI24735J21928_10036266 3300002067 Unclassified 1447
11 JGI24738J21930_10038565 3300002075 Bacteria 971
12 JGI24738J21930_10052614 3300002075 Bacteria 831
13 JGI24738J21930_10120523 3300002075 Bacteria 570
14 JGI24744J21845_10000547 3300002077 Bacteria 6755
15 JGI24742J22300_10010397 3300002244 Bacteria 1541
16 rootH1_10138689 3300003323 Unclassified 1057
17 Ga0065715_10023351 3300005293 Bacteria 1781
18 Ga0065715_10097503 3300005293 Bacteria 3695
19 Ga0065715_10392911 3300005293 Bacteria 892
20 Ga0070658_10001557 3300005327 Bacteria 19440
21 Ga0070658_10010416 3300005327 Bacteria 7455
22 Ga0070658_10018360 3300005327 Bacteria 5600
23 Ga0070658_10053135 3300005327 Bacteria 3287
24 Ga0070658_10107335 3300005327 Bacteria 2310
25 Ga0070658_10153711 3300005327 Bacteria 1928
26 Ga0070658_11273692 3300005327 Bacteria 639
27 Ga0070676_10068013 3300005328 Bacteria 2132
28 Ga0070676_10152645 3300005328 Bacteria 1480
29 Ga0070676_10685905 3300005328 Bacteria 747
30 Ga0070676_11121903 3300005328 Bacteria 595
31 Ga0070683_100008063 3300005329 Bacteria 8943
32 Ga0070683_100214995 3300005329 Bacteria 1827
33 Ga0070690_100044483 3300005330 Bacteria 2818
34 Ga0070690_100346094 3300005330 Bacteria 1078
35 Ga0070670_100003815 3300005331 Bacteria 12558
36 Ga0070670_100014338 3300005331 Bacteria 6801
37 Ga0070670_100038160 3300005331 Bacteria 4131
38 Ga0070670_100057436 3300005331 Bacteria 3341
39 Ga0070670_100072166 3300005331 Bacteria 2965
40 Ga0070670_100116815 3300005331 Bacteria 2300
41 Ga0070670_100134709 3300005331 Bacteria 2134
42 Ga0070670_100185559 3300005331 Bacteria 1806
43 Ga0070670_100258911 3300005331 Bacteria 1516
44 Ga0070677_10038409 3300005333 Bacteria 1873
45 Ga0070677_10189914 3300005333 Bacteria 984
46 Ga0070677_10330681 3300005333 Bacteria 783
47 Ga0068869_100108253 3300005334 Bacteria 2111
48 Ga0068869_101650121 3300005334 Bacteria 571
49 Ga0070666_10000381 3300005335 Bacteria 27905
50 Ga0070666_10002547 3300005335 Bacteria 11024
51 Ga0070666_10004768 3300005335 Bacteria 8286
52 Ga0070666_10045936 3300005335 Bacteria 2928
53 Ga0070666_10066097 3300005335 Bacteria 2453
54 Ga0070666_10239550 3300005335 Bacteria 1283
55 Ga0070666_10473067 3300005335 Bacteria 907
56 Ga0070680_101053767 3300005336 Bacteria 703
57 Ga0070682_100025660 3300005337 Bacteria 3519
58 Ga0070682_101979317 3300005337 Bacteria 512
59 Ga0068868_100002486 3300005338 Bacteria 12791
60 Ga0068868_100030303 3300005338 Bacteria 4148
61 Ga0068868_100105162 3300005338 Bacteria 2288
62 Ga0068868_100105321 3300005338 Bacteria 2287
63 Ga0068868_100424278 3300005338 Bacteria 1152
64 Ga0068868_101193142 3300005338 Bacteria 703
65 Ga0070660_100000009 3300005339 Bacteria 145691
66 Ga0070660_100038962 3300005339 Bacteria 3611
67 Ga0070660_100134992 3300005339 Bacteria 1977
68 Ga0070660_100169117 3300005339 Bacteria 1765
69 Ga0070660_100201659 3300005339 Bacteria 1614
70 Ga0070660_100408691 3300005339 Bacteria 1123
71 Ga0070660_100437917 3300005339 Bacteria 1083
72 Ga0070660_100511907 3300005339 Bacteria 999
73 Ga0070660_100994618 3300005339 Bacteria 709
74 Ga0070687_100095557 3300005343 Bacteria 1653
75 Ga0070661_100001564 3300005344 Bacteria 15911
76 Ga0070661_100014885 3300005344 Bacteria 5488
77 Ga0070661_100022387 3300005344 Bacteria 4524
78 Ga0070661_100022856 3300005344 Bacteria 4477
79 Ga0070661_100073470 3300005344 Unclassified 2518
80 Ga0070661_100074276 3300005344 Bacteria 2504
81 Ga0070661_100098170 3300005344 Bacteria 2175
82 Ga0070661_100103459 3300005344 Bacteria 2121
83 Ga0070661_100246344 3300005344 Bacteria 1378
84 Ga0070668_100258717 3300005347 Bacteria 1447
85 Ga0070668_100873325 3300005347 Unclassified 803
86 Ga0070669_100111286 3300005353 Bacteria 2078
87 Ga0070669_100318032 3300005353 Unclassified 1256
88 Ga0070669_100534663 3300005353 Bacteria 976
89 Ga0070669_101041002 3300005353 Unclassified 703
90 Ga0070669_101743996 3300005353 Bacteria 543
91 Ga0070675_100000913 3300005354 Bacteria 20987
92 Ga0070675_100051464 3300005354 Bacteria 3385
93 Ga0070675_100101317 3300005354 Bacteria 2426
94 Ga0070675_100117114 3300005354 Bacteria 2260
95 Ga0070675_100135199 3300005354 Bacteria 2104
96 Ga0070675_100450985 3300005354 Bacteria 1154
97 Ga0070671_100000784 3300005355 Bacteria 22894
98 Ga0070671_100001033 3300005355 Bacteria 20484
99 Ga0070671_100005525 3300005355 Bacteria 10069
100 Ga0070671_100069911 3300005355 Bacteria 2928
101 Ga0070671_100089952 3300005355 Bacteria 2570
102 Ga0070671_100103018 3300005355 Bacteria 2395
103 Ga0070671_100113824 3300005355 Bacteria 2273
104 Ga0070671_100124230 3300005355 Bacteria 2172
105 Ga0070671_100470394 3300005355 Bacteria 1079
106 Ga0070671_100544282 3300005355 Bacteria 1001
107 Ga0070674_100045690 3300005356 Bacteria 2992
108 Ga0070674_100079772 3300005356 Bacteria 2336
109 Ga0070674_100118178 3300005356 Bacteria 1959
110 Ga0070674_100137475 3300005356 Bacteria 1830
111 Ga0070674_100145654 3300005356 Bacteria 1783
112 Ga0070674_100271906 3300005356 Bacteria 1339
113 Ga0070673_100003767 3300005364 Bacteria 9509
114 Ga0070673_100022395 3300005364 Bacteria 4598
115 Ga0070673_100022477 3300005364 Bacteria 4591
116 Ga0070673_100035527 3300005364 Bacteria 3780
117 Ga0070673_100049622 3300005364 Bacteria 3277
118 Ga0070673_100264176 3300005364 Bacteria 1504
119 Ga0070673_100345348 3300005364 Bacteria 1320
120 Ga0070673_100556713 3300005364 Unclassified 1042
121 Ga0070673_100748287 3300005364 Bacteria 900
122 Ga0070659_100001389 3300005366 Bacteria 17465
123 Ga0070659_100006367 3300005366 Bacteria 8526
124 Ga0070659_100019299 3300005366 Bacteria 5163
125 Ga0070659_100026012 3300005366 Bacteria 4501
126 Ga0070659_100130922 3300005366 Bacteria 2037
127 Ga0070659_100361580 3300005366 Bacteria 1219
128 Ga0070659_100482416 3300005366 Bacteria 1055
129 Ga0070659_100576079 3300005366 Bacteria 965
130 Ga0070659_100581633 3300005366 Unclassified 961
131 Ga0070667_100000915 3300005367 Bacteria 27247
132 Ga0070667_100027177 3300005367 Bacteria 4761
133 Ga0070667_100030757 3300005367 Bacteria 4477
134 Ga0070667_100061978 3300005367 Bacteria 3167
135 Ga0070667_100467413 3300005367 Unclassified 1154
136 Ga0070709_10111843 3300005434 Bacteria 1837
137 Ga0070714_100063184 3300005435 Bacteria 3183
138 Ga0070714_100136216 3300005435 Bacteria 2199
139 Ga0070713_100210795 3300005436 Bacteria 1759
140 Ga0070713_100530906 3300005436 Bacteria 1113
141 Ga0070663_100016637 3300005455 Bacteria 4783
142 Ga0070663_100051620 3300005455 Bacteria 2931
143 Ga0070663_100132287 3300005455 Bacteria 1896
144 Ga0070663_100184101 3300005455 Bacteria 1622
145 Ga0070663_100200408 3300005455 Bacteria 1557
146 Ga0070663_100385417 3300005455 Bacteria 1142
147 Ga0070663_100443872 3300005455 Bacteria 1068
148 Ga0070663_101177941 3300005455 Bacteria 672
149 Ga0070678_100000775 3300005456 Bacteria 16026
150 Ga0070678_100032098 3300005456 Bacteria 3631
151 Ga0070678_100041260 3300005456 Bacteria 3270
152 Ga0070678_100339411 3300005456 Bacteria 1288
153 Ga0070662_100002539 3300005457 Bacteria 11250
154 Ga0070662_100005907 3300005457 Bacteria 7853
155 Ga0070662_100008010 3300005457 Bacteria 6876
156 Ga0070662_100009832 3300005457 Bacteria 6267
157 Ga0070662_100015832 3300005457 Bacteria 5058
158 Ga0070662_100069884 3300005457 Bacteria 2586
159 Ga0070662_100090421 3300005457 Bacteria 2298
160 Ga0070662_100104107 3300005457 Bacteria 2153
161 Ga0070662_100120994 3300005457 Bacteria 2006
162 Ga0070662_100183684 3300005457 Bacteria 1650
163 Ga0070662_100294393 3300005457 Bacteria 1317
164 Ga0070662_100788003 3300005457 Bacteria 808
165 Ga0070662_100833198 3300005457 Bacteria 785
166 Ga0070662_101009558 3300005457 Bacteria 712
167 Ga0070681_10569961 3300005458 Unclassified 1046
168 Ga0070681_10612982 3300005458 Unclassified 1003
169 Ga0070681_11230017 3300005458 Bacteria 671
170 Ga0068867_100026024 3300005459 Bacteria 4197
171 Ga0068867_100127523 3300005459 Bacteria 1973
172 Ga0068867_100437726 3300005459 Unclassified 1111
173 Ga0070685_10894126 3300005466 Bacteria 660
174 Ga0070679_100466080 3300005530 Bacteria 1208
175 Ga0070679_100611730 3300005530 Unclassified 1033
176 Ga0070679_100656370 3300005530 Bacteria 992
177 Ga0070679_100777991 3300005530 Unclassified 900
178 Ga0070684_100029760 3300005535 Bacteria 4632
179 Ga0068853_100007625 3300005539 Bacteria 8670
180 Ga0068853_100072672 3300005539 Bacteria 2998
181 Ga0068853_100107157 3300005539 Bacteria 2478
182 Ga0068853_100224754 3300005539 Bacteria 1716
183 Ga0068853_100401677 3300005539 Bacteria 1283
184 Ga0068853_100472853 3300005539 Unclassified 1181
185 Ga0070672_100007391 3300005543 Bacteria 7449
186 Ga0070672_100028901 3300005543 Bacteria 4151
187 Ga0070672_100034180 3300005543 Bacteria 3857
188 Ga0070672_100073823 3300005543 Bacteria 2719
189 Ga0070672_100073924 3300005543 Bacteria 2718
190 Ga0070672_100080781 3300005543 Bacteria 2605
191 Ga0070672_100143927 3300005543 Bacteria 1969
192 Ga0070672_100161423 3300005543 Bacteria 1860
193 Ga0070672_100163580 3300005543 Bacteria 1848
194 Ga0070672_100547703 3300005543 Unclassified 1004
195 Ga0070672_100760698 3300005543 Bacteria 851
196 Ga0070686_100010300 3300005544 Bacteria 5267
197 Ga0070686_100200541 3300005544 Bacteria 1430
198 Ga0070686_101098602 3300005544 Unclassified 657
199 Ga0070693_100001083 3300005547 Bacteria 12194
200 Ga0070665_100035090 3300005548 Bacteria 5044
201 Ga0070665_100067794 3300005548 Bacteria 3578
202 Ga0070665_100121257 3300005548 Bacteria 2616
203 Ga0070665_100127103 3300005548 Bacteria 2551
204 Ga0070665_100565415 3300005548 Bacteria 1150
205 Ga0070665_100650953 3300005548 Bacteria 1067
206 Ga0070665_100721725 3300005548 Bacteria 1010
207 Ga0070665_101296302 3300005548 Bacteria 738
208 Ga0068855_100001099 3300005563 Bacteria 33610
209 Ga0068855_100273309 3300005563 Bacteria 1879
210 Ga0068855_101436334 3300005563 Bacteria 710
211 Ga0068855_101625872 3300005563 Unclassified 660
212 Ga0070664_100000103 3300005564 Bacteria 54853
213 Ga0070664_100006945 3300005564 Bacteria 9122
214 Ga0070664_100008493 3300005564 Bacteria 8304
215 Ga0070664_100011272 3300005564 Bacteria 7251
216 Ga0070664_100033104 3300005564 Bacteria 4326
217 Ga0070664_100042247 3300005564 Bacteria 3849
218 Ga0070664_100127289 3300005564 Bacteria 2235
219 Ga0070664_100327376 3300005564 Bacteria 1389
220 Ga0070664_100390743 3300005564 Bacteria 1271
221 Ga0070664_101618353 3300005564 Bacteria 613
222 Ga0070664_102177396 3300005564 Bacteria 526
223 Ga0068857_100322567 3300005577 Unclassified 1427
224 Ga0068857_100612471 3300005577 Bacteria 1030
225 Ga0068854_100054218 3300005578 Bacteria 2883
226 Ga0068854_100060832 3300005578 Bacteria 2734
227 Ga0068854_100066869 3300005578 Bacteria 2617
228 Ga0068854_100131248 3300005578 Bacteria 1913
229 Ga0068854_100777665 3300005578 Bacteria 833
230 Ga0068854_101451338 3300005578 Bacteria 622
231 Ga0068856_100000628 3300005614 Bacteria 38462
232 Ga0068856_100042565 3300005614 Bacteria 4468
233 Ga0068856_100816567 3300005614 Bacteria 952
234 Ga0070702_100204394 3300005615 Bacteria 1310
235 Ga0070702_100394487 3300005615 Bacteria 988
236 Ga0068852_100015079 3300005616 Bacteria 5979
237 Ga0068852_100058248 3300005616 Bacteria 3345
238 Ga0068852_100143994 3300005616 Bacteria 2209
239 Ga0068852_100177688 3300005616 Bacteria 2000
240 Ga0068852_100225682 3300005616 Bacteria 1783
241 Ga0068852_100935161 3300005616 Unclassified 885
242 Ga0068852_101507230 3300005616 Bacteria 695
243 Ga0068852_101691743 3300005616 Bacteria 655
244 Ga0068859_100036677 3300005617 Bacteria 4922
245 Ga0068859_100263305 3300005617 Bacteria 1816
246 Ga0068859_100287754 3300005617 Bacteria 1736
247 Ga0068859_100402051 3300005617 Bacteria 1466
248 Ga0068864_100000982 3300005618 Bacteria 23872
249 Ga0068864_100013401 3300005618 Bacteria 6794
250 Ga0068864_100021722 3300005618 Bacteria 5376
251 Ga0068864_100023474 3300005618 Bacteria 5180
252 Ga0068864_100027035 3300005618 Bacteria 4840
253 Ga0068864_100206237 3300005618 Bacteria 1808
254 Ga0068864_100305196 3300005618 Unclassified 1491
255 Ga0068864_100513102 3300005618 Unclassified 1155
256 Ga0068864_100533098 3300005618 Bacteria 1133
257 Ga0068864_100675550 3300005618 Bacteria 1007
258 Ga0068866_10009417 3300005718 Bacteria 4147
259 Ga0068866_10020297 3300005718 Bacteria 3043
260 Ga0068866_10068913 3300005718 Bacteria 1862
261 Ga0068866_10075656 3300005718 Bacteria 1793
262 Ga0068861_100126061 3300005719 Bacteria 2071
263 Ga0068861_100518874 3300005719 Bacteria 1080
264 Ga0068861_101021403 3300005719 Unclassified 790
265 Ga0068851_10001784 3300005834 Bacteria 9415
266 Ga0068851_10017472 3300005834 Bacteria 3446
267 Ga0068851_10044505 3300005834 Bacteria 2241
268 Ga0068851_10086284 3300005834 Bacteria 1646
269 Ga0068851_10416274 3300005834 Bacteria 793
270 Ga0068870_10514120 3300005840 Unclassified 800
271 Ga0068870_10548519 3300005840 Bacteria 778
272 Ga0068863_100023172 3300005841 Bacteria 5933
273 Ga0068863_100043208 3300005841 Bacteria 4279
274 Ga0068863_100062068 3300005841 Bacteria 3534
275 Ga0068863_100110949 3300005841 Bacteria 2612
276 Ga0068858_100009318 3300005842 Bacteria 9374
277 Ga0068858_100033683 3300005842 Bacteria 4751
278 Ga0068858_100185914 3300005842 Bacteria 1962
279 Ga0068858_100198779 3300005842 Bacteria 1895
280 Ga0068860_100117181 3300005843 Bacteria 2548
281 Ga0068860_100122827 3300005843 Bacteria 2488
282 Ga0068860_100628059 3300005843 Bacteria 1081
283 Ga0070717_10222704 3300006028 Bacteria 1659
284 Ga0075364_10221214 3300006051 Bacteria 1285
285 Ga0070712_100041924 3300006175 Bacteria 3145
286 Ga0097621_100024505 3300006237 Bacteria 4713
287 Ga0097621_100049726 3300006237 Bacteria 3407
288 Ga0097621_100147655 3300006237 Bacteria 2015
289 Ga0097621_100365636 3300006237 Bacteria 1286
290 Ga0068871_100034183 3300006358 Bacteria 4032
291 Ga0068871_100075941 3300006358 Bacteria 2774
292 Ga0068871_100084375 3300006358 Bacteria 2636
293 Ga0068871_100126959 3300006358 Bacteria 2160
294 Ga0068871_100186051 3300006358 Bacteria 1787
295 Ga0068871_100582499 3300006358 Bacteria 1016
296 Ga0068865_100011026 3300006881 Bacteria 5642
297 Ga0068865_100274501 3300006881 Bacteria 1340
298 Ga0097620_100036677 3300006931 Bacteria 4922
299 Ga0097620_100263309 3300006931 Bacteria 1816
300 Ga0097620_100287765 3300006931 Bacteria 1736
301 Ga0097620_100402010 3300006931 Bacteria 1466
302 Ga0105240_10234951 3300009093 Bacteria 2128
303 Ga0105240_10252554 3300009093 Bacteria 2038
304 Ga0105245_10021117 3300009098 Bacteria 5710
305 Ga0105245_10033176 3300009098 Bacteria 4575
306 Ga0105243_10055632 3300009148 Bacteria 3144
307 Ga0105241_10173796 3300009174 Bacteria 1781
308 Ga0105241_10852419 3300009174 Unclassified 843
309 Ga0105241_11526128 3300009174 Bacteria 644
310 Ga0105242_10049979 3300009176 Bacteria 3403
311 Ga0105242_10193647 3300009176 Bacteria 1802
312 Ga0105242_10480910 3300009176 Bacteria 1177
313 Ga0105248_10000673 3300009177 Bacteria 38736
314 Ga0105248_10000724 3300009177 Bacteria 37195
315 Ga0105248_10002105 3300009177 Bacteria 22055
316 Ga0105248_10014771 3300009177 Bacteria 8598
317 Ga0105248_10070039 3300009177 Bacteria 3939
318 Ga0105248_10145240 3300009177 Bacteria 2677
319 Ga0105248_11343271 3300009177 Bacteria 809
320 Ga0105248_12534153 3300009177 Unclassified 585
321 Ga0105237_10173424 3300009545 Bacteria 2157
322 Ga0105238_10072831 3300009551 Bacteria 3430
323 Ga0105238_10166595 3300009551 Bacteria 2179
324 Ga0105238_10451747 3300009551 Bacteria 1282
325 Ga0105238_10608585 3300009551 Unclassified 1101
326 Ga0105239_10754913 3300010375 Unclassified 1113
327 Ga0105239_10807366 3300010375 Unclassified 1075
328 Ga0105246_10075364 3300011119 Bacteria 2388
329 Ga0105246_10119099 3300011119 Bacteria 1953
330 Ga0157373_10016140 3300013100 Bacteria 5451
331 Ga0157373_10090457 3300013100 Bacteria 2155
332 Ga0157373_10092960 3300013100 Bacteria 2124
333 Ga0157373_10141560 3300013100 Bacteria 1692
334 Ga0157373_11333749 3300013100 Unclassified 544
335 Ga0157371_10002159 3300013102 Bacteria 19149
336 Ga0157371_10012009 3300013102 Bacteria 6640
337 Ga0157371_10022609 3300013102 Bacteria 4603
338 Ga0157371_10087053 3300013102 Bacteria 2212
339 Ga0157371_10169076 3300013102 Bacteria 1562
340 Ga0157371_11584157 3300013102 Bacteria 512
341 Ga0157370_10408617 3300013104 Bacteria 1249
342 Ga0157370_10619753 3300013104 Unclassified 990
343 Ga0157370_10631975 3300013104 Unclassified 979
344 Ga0157370_10876372 3300013104 Bacteria 815
345 Ga0157369_10043789 3300013105 Bacteria 4877
346 Ga0157369_10629395 3300013105 Unclassified 1107
347 Ga0157369_11086590 3300013105 Unclassified 818
348 Ga0157369_12064944 3300013105 Bacteria 578
349 Ga0157374_10000882 3300013296 Bacteria 26194
350 Ga0157374_10033137 3300013296 Bacteria 4711
351 Ga0157374_10073176 3300013296 Bacteria 3235
352 Ga0157374_10280377 3300013296 Unclassified 1645
353 Ga0157374_11745388 3300013296 Bacteria 647
354 Ga0157374_12459993 3300013296 Bacteria 548
355 Ga0157378_10107911 3300013297 Bacteria 2548
356 Ga0157378_10156187 3300013297 Bacteria 2130
357 Ga0163162_10002440 3300013306 Bacteria 17525
358 Ga0163162_10024974 3300013306 Bacteria 5903
359 Ga0163162_10026987 3300013306 Bacteria 5678
360 Ga0163162_10073566 3300013306 Bacteria 3473
361 Ga0163162_10493941 3300013306 Bacteria 1355
362 Ga0163162_10763107 3300013306 Bacteria 1086
363 Ga0157372_10134336 3300013307 Bacteria 2848
364 Ga0157372_10485941 3300013307 Bacteria 1440
365 Ga0157372_10660052 3300013307 Bacteria 1218
366 Ga0157372_12828863 3300013307 Bacteria 556
367 Ga0157375_10002611 3300013308 Bacteria 15620
368 Ga0157375_10116887 3300013308 Bacteria 2772
369 Ga0157375_10132936 3300013308 Bacteria 2609
370 Ga0157375_10161166 3300013308 Bacteria 2385
371 Ga0157375_10198953 3300013308 Bacteria 2159
372 Ga0157375_10792220 3300013308 Bacteria 1097
373 Ga0157375_11100643 3300013308 Bacteria 930
374 Ga0163163_10004607 3300014325 Bacteria 11773
375 Ga0163163_10041443 3300014325 Bacteria 4502
376 Ga0163163_10137433 3300014325 Bacteria 2485
377 Ga0163163_10146877 3300014325 Bacteria 2402
378 Ga0163163_11549356 3300014325 Bacteria 724
379 Ga0157380_11449458 3300014326 Unclassified 738
380 Ga0157380_11862643 3300014326 Unclassified 662
381 Ga0182008_10116022 3300014497 Bacteria 1328
382 Ga0157377_10413947 3300014745 Bacteria 921
383 Ga0157379_10040579 3300014968 Bacteria 4155
384 Ga0157379_10230149 3300014968 Bacteria 1680
385 Ga0157379_10242372 3300014968 Bacteria 1635
386 Ga0157376_10006910 3300014969 Bacteria 8041
387 Ga0157376_10181840 3300014969 Bacteria 1923
388 Ga0163161_10024348 3300017792 Bacteria 4276
389 Ga0163161_10046050 3300017792 Bacteria 3147
390 Ga0163161_10621887 3300017792 Bacteria 892
391 Ga0213876_10021022 3300021384 Bacteria 3451
392 Ga0213875_10006414 3300021388 Bacteria 6180
393 Ga0207697_10021874 3300025315 Bacteria 2620
394 Ga0207697_10024490 3300025315 Bacteria 2471
395 Ga0207697_10164760 3300025315 Bacteria 968
396 Ga0207697_10231137 3300025315 Bacteria 817
397 Ga0207656_10014429 3300025321 Bacteria 3044
398 Ga0207656_10046907 3300025321 Bacteria 1855
399 Ga0207656_10072170 3300025321 Bacteria 1536
400 Ga0207656_10158221 3300025321 Bacteria 1077
401 Ga0207682_10013128 3300025893 Bacteria 3229
402 Ga0207682_10172691 3300025893 Bacteria 984
403 Ga0207642_10008789 3300025899 Bacteria 3486
404 Ga0207642_10016286 3300025899 Bacteria 2796
405 Ga0207642_10067123 3300025899 Bacteria 1692
406 Ga0207642_10211599 3300025899 Bacteria 1078
407 Ga0207688_10104529 3300025901 Bacteria 1638
408 Ga0207688_10137748 3300025901 Bacteria 1435
409 Ga0207680_10004726 3300025903 Bacteria 6479
410 Ga0207680_10006248 3300025903 Bacteria 5749
411 Ga0207680_10014792 3300025903 Bacteria 4052
412 Ga0207680_10029108 3300025903 Bacteria 3099
413 Ga0207680_10040837 3300025903 Bacteria 2703
414 Ga0207680_10327008 3300025903 Bacteria 1073
415 Ga0207680_10327813 3300025903 Bacteria 1072
416 Ga0207680_10392440 3300025903 Bacteria 980
417 Ga0207647_10026290 3300025904 Bacteria 3810
418 Ga0207647_10043572 3300025904 Bacteria 2808
419 Ga0207647_10048937 3300025904 Bacteria 2623
420 Ga0207647_10066872 3300025904 Bacteria 2179
421 Ga0207647_10087582 3300025904 Bacteria 1860
422 Ga0207647_10563354 3300025904 Bacteria 631
423 Ga0207645_10134262 3300025907 Bacteria 1611
424 Ga0207645_10170030 3300025907 Bacteria 1428
425 Ga0207643_10586908 3300025908 Bacteria 717
426 Ga0207705_10000113 3300025909 Bacteria 90567
427 Ga0207705_10022419 3300025909 Bacteria 4502
428 Ga0207705_10025235 3300025909 Bacteria 4243
429 Ga0207705_10028813 3300025909 Bacteria 3957
430 Ga0207705_10044812 3300025909 Bacteria 3179
431 Ga0207705_10072157 3300025909 Bacteria 2504
432 Ga0207705_10205885 3300025909 Bacteria 1491
433 Ga0207705_10217047 3300025909 Bacteria 1452
434 Ga0207705_10280308 3300025909 Bacteria 1276
435 Ga0207654_10114587 3300025911 Bacteria 1682
436 Ga0207695_10191172 3300025913 Bacteria 1964
437 Ga0207695_10374635 3300025913 Bacteria 1310
438 Ga0207671_10414191 3300025914 Unclassified 1072
439 Ga0207693_10014652 3300025915 Bacteria 6300
440 Ga0207662_10016144 3300025918 Bacteria 4211
441 Ga0207662_11326284 3300025918 Unclassified 511
442 Ga0207657_10000328 3300025919 Bacteria 50486
443 Ga0207657_10012677 3300025919 Bacteria 8308
444 Ga0207657_10018921 3300025919 Bacteria 6556
445 Ga0207657_10022698 3300025919 Bacteria 5863
446 Ga0207657_10106512 3300025919 Bacteria 2320
447 Ga0207657_10117721 3300025919 Bacteria 2188
448 Ga0207657_10143045 3300025919 Bacteria 1953
449 Ga0207657_10246524 3300025919 Bacteria 1425
450 Ga0207657_10389514 3300025919 Bacteria 1097
451 Ga0207657_10896520 3300025919 Unclassified 683
452 Ga0207649_10000228 3300025920 Bacteria 45916
453 Ga0207649_10030809 3300025920 Bacteria 3181
454 Ga0207649_10051534 3300025920 Bacteria 2549
455 Ga0207649_10095091 3300025920 Bacteria 1960
456 Ga0207649_10163325 3300025920 Bacteria 1545
457 Ga0207649_10193208 3300025920 Bacteria 1433
458 Ga0207649_10215644 3300025920 Bacteria 1364
459 Ga0207649_10275246 3300025920 Bacteria 1222
460 Ga0207652_10503467 3300025921 Unclassified 1090
461 Ga0207652_10535378 3300025921 Bacteria 1053
462 Ga0207652_10865328 3300025921 Bacteria 800
463 Ga0207652_10971809 3300025921 Bacteria 747
464 Ga0207681_10096292 3300025923 Bacteria 2125
465 Ga0207681_10285687 3300025923 Unclassified 1301
466 Ga0207681_10465807 3300025923 Bacteria 1030
467 Ga0207681_10652904 3300025923 Unclassified 872
468 Ga0207681_10675964 3300025923 Bacteria 857
469 Ga0207694_10064456 3300025924 Bacteria 2856
470 Ga0207694_10318776 3300025924 Bacteria 1283
471 Ga0207694_10472494 3300025924 Unclassified 1048
472 Ga0207650_10016267 3300025925 Bacteria 5196
473 Ga0207650_10031702 3300025925 Bacteria 3818
474 Ga0207650_10038759 3300025925 Bacteria 3482
475 Ga0207650_10065821 3300025925 Bacteria 2717
476 Ga0207650_10341840 3300025925 Bacteria 1229
477 Ga0207650_10368537 3300025925 Bacteria 1184
478 Ga0207650_10508840 3300025925 Bacteria 1007
479 Ga0207650_10970464 3300025925 Bacteria 722
480 Ga0207659_10063329 3300025926 Bacteria 2673
481 Ga0207659_10080609 3300025926 Bacteria 2405
482 Ga0207659_10106840 3300025926 Bacteria 2120
483 Ga0207659_10588074 3300025926 Bacteria 948
484 Ga0207687_10034393 3300025927 Bacteria 3441
485 Ga0207687_10195619 3300025927 Bacteria 1577
486 Ga0207700_10808208 3300025928 Bacteria 839
487 Ga0207664_10356967 3300025929 Bacteria 1294
488 Ga0207644_10000181 3300025931 Bacteria 45051
489 Ga0207644_10001877 3300025931 Bacteria 13683
490 Ga0207644_10018566 3300025931 Bacteria 4707
491 Ga0207644_10049770 3300025931 Bacteria 3001
492 Ga0207644_10072793 3300025931 Bacteria 2518
493 Ga0207644_10088987 3300025931 Bacteria 2297
494 Ga0207644_10089398 3300025931 Bacteria 2292
495 Ga0207644_10227120 3300025931 Bacteria 1482
496 Ga0207644_10297286 3300025931 Bacteria 1300
497 Ga0207690_10000036 3300025932 Bacteria 143853
498 Ga0207690_10023844 3300025932 Bacteria 3825
499 Ga0207690_10042632 3300025932 Bacteria 2982
500 Ga0207690_10046139 3300025932 Bacteria 2884
501 Ga0207690_10100436 3300025932 Bacteria 2065
502 Ga0207690_10265632 3300025932 Bacteria 1331
503 Ga0207690_10472945 3300025932 Unclassified 1010
504 Ga0207706_10000343 3300025933 Bacteria 50497
505 Ga0207706_10006757 3300025933 Bacteria 10606
506 Ga0207706_10006809 3300025933 Bacteria 10568
507 Ga0207706_10008945 3300025933 Bacteria 9219
508 Ga0207706_10015817 3300025933 Bacteria 6821
509 Ga0207706_10021335 3300025933 Bacteria 5819
510 Ga0207706_10035527 3300025933 Bacteria 4430
511 Ga0207706_10045365 3300025933 Bacteria 3895
512 Ga0207706_10103783 3300025933 Bacteria 2501
513 Ga0207706_10185969 3300025933 Bacteria 1824
514 Ga0207706_10357078 3300025933 Unclassified 1270
515 Ga0207706_10618553 3300025933 Bacteria 929
516 Ga0207686_10052847 3300025934 Bacteria 2537
517 Ga0207686_10339310 3300025934 Bacteria 1128
518 Ga0207686_11458539 3300025934 Unclassified 564
519 Ga0207709_10166679 3300025935 Bacteria 1542
520 Ga0207709_10211090 3300025935 Bacteria 1393
521 Ga0207669_10052152 3300025937 Bacteria 2455
522 Ga0207669_10185729 3300025937 Bacteria 1495
523 Ga0207669_10340766 3300025937 Unclassified 1154
524 Ga0207669_10757133 3300025937 Unclassified 802
525 Ga0207669_10794325 3300025937 Bacteria 784
526 Ga0207704_10030292 3300025938 Bacteria 3032
527 Ga0207691_10011944 3300025940 Bacteria 8332
528 Ga0207691_10022187 3300025940 Bacteria 5988
529 Ga0207691_10026376 3300025940 Bacteria 5452
530 Ga0207691_10036392 3300025940 Bacteria 4560
531 Ga0207691_10043488 3300025940 Bacteria 4140
532 Ga0207691_10125061 3300025940 Bacteria 2276
533 Ga0207691_10170254 3300025940 Bacteria 1907
534 Ga0207691_10201930 3300025940 Bacteria 1730
535 Ga0207691_10204770 3300025940 Bacteria 1716
536 Ga0207691_10595482 3300025940 Bacteria 936
537 Ga0207711_10003972 3300025941 Bacteria 12722
538 Ga0207711_10015244 3300025941 Bacteria 6380
539 Ga0207711_10015793 3300025941 Bacteria 6264
540 Ga0207711_10046278 3300025941 Bacteria 3717
541 Ga0207711_10051335 3300025941 Bacteria 3531
542 Ga0207711_10117573 3300025941 Bacteria 2371
543 Ga0207711_10588963 3300025941 Bacteria 1038
544 Ga0207689_10031981 3300025942 Bacteria 4376
545 Ga0207661_10011054 3300025944 Bacteria 6525
546 Ga0207661_10254856 3300025944 Bacteria 1561
547 Ga0207661_11548672 3300025944 Bacteria 607
548 Ga0207679_10000093 3300025945 Bacteria 78331
549 Ga0207679_10001758 3300025945 Bacteria 13501
550 Ga0207679_10007795 3300025945 Bacteria 6805
551 Ga0207679_10014634 3300025945 Bacteria 5162
552 Ga0207679_10054269 3300025945 Bacteria 2949
553 Ga0207679_10069614 3300025945 Bacteria 2648
554 Ga0207679_10234046 3300025945 Bacteria 1553
555 Ga0207679_10366230 3300025945 Bacteria 1260
556 Ga0207679_11008438 3300025945 Bacteria 763
557 Ga0207679_11361267 3300025945 Unclassified 651
558 Ga0207679_11431991 3300025945 Unclassified 634
559 Ga0207667_10002944 3300025949 Bacteria 21130
560 Ga0207667_10058823 3300025949 Bacteria 4029
561 Ga0207667_10273263 3300025949 Bacteria 1727
562 Ga0207667_10739260 3300025949 Bacteria 984
563 Ga0207651_10003789 3300025960 Bacteria 7486
564 Ga0207651_10006757 3300025960 Bacteria 6044
565 Ga0207651_10008254 3300025960 Bacteria 5613
566 Ga0207651_10026202 3300025960 Bacteria 3637
567 Ga0207651_10088284 3300025960 Bacteria 2260
568 Ga0207651_10151837 3300025960 Bacteria 1804
569 Ga0207651_10189669 3300025960 Bacteria 1638
570 Ga0207651_10514587 3300025960 Unclassified 1036
571 Ga0207668_10664451 3300025972 Bacteria 913
572 Ga0207640_10056467 3300025981 Bacteria 2577
573 Ga0207640_10059021 3300025981 Bacteria 2530
574 Ga0207640_10083864 3300025981 Bacteria 2186
575 Ga0207640_10320251 3300025981 Unclassified 1234
576 Ga0207640_10759536 3300025981 Bacteria 837
577 Ga0207658_10000936 3300025986 Bacteria 24076
578 Ga0207658_10013597 3300025986 Bacteria 5566
579 Ga0207658_10016927 3300025986 Bacteria 5018
580 Ga0207658_10090420 3300025986 Bacteria 2372
581 Ga0207658_10331945 3300025986 Bacteria 1319
582 Ga0207658_10587094 3300025986 Unclassified 1000
583 Ga0207677_10003694 3300026023 Bacteria 8118
584 Ga0207677_10020322 3300026023 Bacteria 4029
585 Ga0207677_10103499 3300026023 Bacteria 2102
586 Ga0207677_10645846 3300026023 Bacteria 933
587 Ga0207677_10759254 3300026023 Bacteria 865
588 Ga0207703_10005275 3300026035 Bacteria 10418
589 Ga0207703_10012855 3300026035 Bacteria 6529
590 Ga0207703_10020733 3300026035 Bacteria 5143
591 Ga0207703_10117459 3300026035 Bacteria 2279
592 Ga0207703_10414604 3300026035 Unclassified 1252
593 Ga0207639_10002879 3300026041 Bacteria 11560
594 Ga0207639_10589346 3300026041 Unclassified 1024
595 Ga0207639_10620216 3300026041 Bacteria 999
596 Ga0207639_10987187 3300026041 Bacteria 788
597 Ga0207678_10006618 3300026067 Bacteria 10273
598 Ga0207678_10009022 3300026067 Bacteria 8779
599 Ga0207678_10012776 3300026067 Bacteria 7372
600 Ga0207678_10065064 3300026067 Bacteria 3132
601 Ga0207678_10074005 3300026067 Bacteria 2919
602 Ga0207678_10096806 3300026067 Unclassified 2522
603 Ga0207678_10115281 3300026067 Bacteria 2292
604 Ga0207678_10266347 3300026067 Bacteria 1469
605 Ga0207708_11446752 3300026075 Unclassified 603
606 Ga0207702_10000619 3300026078 Bacteria 39068
607 Ga0207702_10243503 3300026078 Bacteria 1686
608 Ga0207702_10286322 3300026078 Bacteria 1560
609 Ga0207702_10361761 3300026078 Bacteria 1391
610 Ga0207702_10554585 3300026078 Bacteria 1124
611 Ga0207702_11401230 3300026078 Bacteria 693
612 Ga0207641_10011857 3300026088 Bacteria 7154
613 Ga0207641_10023515 3300026088 Bacteria 5075
614 Ga0207641_10123333 3300026088 Bacteria 2315
615 Ga0207641_10145579 3300026088 Bacteria 2142
616 Ga0207648_10002532 3300026089 Bacteria 19611
617 Ga0207648_10011721 3300026089 Bacteria 8244
618 Ga0207648_10186172 3300026089 Bacteria 1839
619 Ga0207676_10003014 3300026095 Bacteria 12011
620 Ga0207676_10006459 3300026095 Bacteria 8281
621 Ga0207676_10032425 3300026095 Bacteria 3936
622 Ga0207676_10076654 3300026095 Bacteria 2702
623 Ga0207676_10172054 3300026095 Bacteria 1888
624 Ga0207676_10535596 3300026095 Bacteria 1117
625 Ga0207676_10644856 3300026095 Bacteria 1021
626 Ga0207676_10874228 3300026095 Bacteria 880
627 Ga0207674_10000132 3300026116 Bacteria 87692
628 Ga0207674_10244444 3300026116 Bacteria 1742
629 Ga0207674_10472744 3300026116 Bacteria 1212
630 Ga0207674_11281950 3300026116 Unclassified 702
631 Ga0207683_10007992 3300026121 Bacteria 9046
632 Ga0207683_10011570 3300026121 Bacteria 7533
633 Ga0207683_10057305 3300026121 Bacteria 3420
634 Ga0207683_10072639 3300026121 Bacteria 3043
635 Ga0207683_10138551 3300026121 Bacteria 2191
636 Ga0207698_10010281 3300026142 Bacteria 6001
637 Ga0207698_10095891 3300026142 Bacteria 2443
638 Ga0207698_10115760 3300026142 Bacteria 2258
639 Ga0207698_10130782 3300026142 Bacteria 2144
640 Ga0207698_10299581 3300026142 Bacteria 1496
641 Ga0207698_11566110 3300026142 Bacteria 674
642 Ga0207698_11793683 3300026142 Bacteria 629
643 Ga0268266_10017931 3300028379 Bacteria 6035
644 Ga0268266_10030004 3300028379 Bacteria 4621
645 Ga0268266_10157673 3300028379 Bacteria 2051
646 Ga0268266_10268011 3300028379 Bacteria 1584
647 Ga0268266_10379532 3300028379 Bacteria 1333
648 Ga0268266_10573797 3300028379 Bacteria 1082
649 Ga0268264_10098032 3300028381 Bacteria 2541
650 Ga0268264_10197775 3300028381 Bacteria 1837
651 Ga0268264_10654756 3300028381 Bacteria 1040
652 Ga0307408_100075623 3300031548 Bacteria 2503
653 Ga0307408_100248924 3300031548 Bacteria 1465
654 Ga0307405_10007143 3300031731 Bacteria 5554
655 Ga0307405_10135857 3300031731 Bacteria 1707
656 Ga0307413_10045791 3300031824 Bacteria 2596
657 Ga0307413_10603139 3300031824 Bacteria 899
658 Ga0307413_10635945 3300031824 Bacteria 878
659 Ga0307413_11632556 3300031824 Unclassified 573
660 Ga0307410_10011217 3300031852 Bacteria 5115
661 Ga0307410_10012882 3300031852 Bacteria 4855
662 Ga0307410_10177118 3300031852 Bacteria 1611
663 Ga0307410_10211986 3300031852 Unclassified 1485
664 Ga0307410_10939133 3300031852 Bacteria 743
665 Ga0307410_11005237 3300031852 Bacteria 719
666 Ga0307406_10322822 3300031901 Bacteria 1195
667 Ga0307407_10121166 3300031903 Unclassified 1658
668 Ga0307407_10520740 3300031903 Bacteria 875
669 Ga0307407_10667041 3300031903 Unclassified 780
670 Ga0307407_11310819 3300031903 Bacteria 568
671 Ga0307412_10954048 3300031911 Bacteria 755
672 Ga0307409_100004656 3300031995 Bacteria 7752
673 Ga0307409_100033957 3300031995 Bacteria 3720
674 Ga0307409_100171667 3300031995 Bacteria 1909
675 Ga0307409_100626221 3300031995 Bacteria 1067
676 Ga0307409_101575009 3300031995 Unclassified 685
677 Ga0307409_101758536 3300031995 Bacteria 649
678 Ga0307416_100004801 3300032002 Bacteria 8213
679 Ga0307416_100056142 3300032002 Bacteria 3176
680 Ga0307416_100226339 3300032002 Bacteria 1799
681 Ga0307416_100971884 3300032002 Bacteria 952
682 Ga0307416_101134306 3300032002 Bacteria 887
683 Ga0307416_101185365 3300032002 Bacteria 869
684 Ga0307414_10045411 3300032004 Bacteria 3008
685 Ga0307414_10048731 3300032004 Bacteria 2925
686 Ga0307414_10070467 3300032004 Bacteria 2518
687 Ga0307414_10072426 3300032004 Bacteria 2489
688 Ga0307414_10320960 3300032004 Bacteria 1318
689 Ga0307414_10546479 3300032004 Unclassified 1032
690 Ga0307414_12147776 3300032004 Bacteria 521
691 Ga0307411_10040192 3300032005 Bacteria 2965
692 Ga0307411_10072858 3300032005 Bacteria 2334
693 Ga0307411_10095117 3300032005 Bacteria 2091
694 Ga0307411_10261165 3300032005 Unclassified 1367
695 Ga0307411_10384429 3300032005 Bacteria 1155
696 Ga0307415_100004436 3300032126 Bacteria 7276
697 Ga0307415_100011638 3300032126 Bacteria 5046
698 Ga0307415_100014441 3300032126 Bacteria 4643
699 Ga0307415_100018715 3300032126 Bacteria 4190
700 Ga0307415_100087487 3300032126 Bacteria 2245
701 Ga0307415_100191250 3300032126 Bacteria 1615
702 Ga0307415_102170721 3300032126 Unclassified 543
703 Ga0373950_0066784 3300034818 Bacteria 731
704 Ga0373958_0094444 3300034819 Bacteria 694
705 Ga0373938_0177178 3300034957 Bacteria 580
706 Ga0373949_0078032 3300035090 Bacteria 878
707 Ga0373939_0052601 3300035114 Bacteria 1270
708 Ga0373941_0389358 3300035115 Unclassified 574
709 Ga0373960_0006755 3300035121 Bacteria 2700
710 Ga0373960_0091583 3300035121 Bacteria 973
711 Ga0373942_0044769 3300035207 Bacteria 1220
712 Ga0373962_0045739 3300035242 Bacteria 1247
713 Ga0373931_0036991 3300035691 Bacteria 2547
714 Ga0373931_0198722 3300035691 Bacteria 1196
715 Ga0373931_0230950 3300035691 Bacteria 1118
716 Ga0373931_0273058 3300035691 Bacteria 1036
717 Ga0373947_0383316 3300035725 Bacteria 947
718 Ga0373937_0166091 3300036401 Bacteria 2070
719 Ga0395899_0051869 3300037312 Bacteria 3043
720 Ga0395899_0063518 3300037312 Bacteria 2716
721 Ga0395899_0085583 3300037312 Bacteria 2290
722 Ga0395899_0087697 3300037312 Bacteria 2258
723 Ga0395899_0097811 3300037312 Bacteria 2121
724 Ga0395899_0115661 3300037312 Bacteria 1925
725 Ga0395899_0288729 3300037312 Bacteria 1113
726 Ga0395899_0323992 3300037312 Bacteria 1037
727 Ga0395899_0374852 3300037312 Bacteria 947
728 Ga0395899_0516649 3300037312 Unclassified 772
729 Ga0395899_0531097 3300037312 Bacteria 759
730 Ga0395900_0000530 3300037418 Bacteria 53919
731 Ga0395900_0035419 3300037418 Bacteria 5141
732 Ga0395900_0047919 3300037418 Bacteria 4402
733 Ga0395900_0057291 3300037418 Bacteria 4011
734 Ga0395900_0127555 3300037418 Bacteria 2608
735 Ga0395900_0142994 3300037418 Bacteria 2448
736 Ga0395900_0208799 3300037418 Bacteria 1972
737 Ga0395900_0209526 3300037418 Bacteria 1968
738 Ga0395900_0212857 3300037418 Bacteria 1951
739 Ga0395900_0241463 3300037418 Bacteria 1812
740 Ga0395900_0328665 3300037418 Unclassified 1507
741 Ga0395900_0548453 3300037418 Bacteria 1101
742 Ga0395900_0618040 3300037418 Bacteria 1023
743 Ga0395900_0766719 3300037418 Bacteria 894
744 Ga0395900_0947215 3300037418 Unclassified 782
745 Ga0395900_0977471 3300037418 Bacteria 767
746 Ga0395898_0019899 3300037466 Bacteria 6826
747 Ga0395898_0034350 3300037466 Bacteria 5055
748 Ga0395898_0108317 3300037466 Bacteria 2664
749 Ga0395898_0163504 3300037466 Bacteria 2129
750 Ga0395898_0169515 3300037466 Bacteria 2087
751 Ga0395898_0324705 3300037466 Bacteria 1468
752 Ga0395898_0610946 3300037466 Bacteria 1033
753 Ga0395898_0790396 3300037466 Bacteria 889
754 Ga0395905_0001285 3300037471 Bacteria 30925
755 Ga0395905_0002000 3300037471 Bacteria 23293
756 Ga0395905_0012346 3300037471 Bacteria 8223
757 Ga0395905_0016638 3300037471 Bacteria 6991
758 Ga0395905_0020055 3300037471 Bacteria 6335
759 Ga0395905_0040653 3300037471 Bacteria 4362
760 Ga0395905_0050007 3300037471 Bacteria 3917
761 Ga0395905_0063997 3300037471 Bacteria 3441
762 Ga0395905_0070728 3300037471 Bacteria 3270
763 Ga0395905_0076302 3300037471 Bacteria 3141
764 Ga0395905_0083650 3300037471 Bacteria 2990
765 Ga0395905_0268351 3300037471 Bacteria 1592
766 Ga0395905_0296571 3300037471 Bacteria 1504
767 Ga0395905_0449394 3300037471 Bacteria 1187
768 Ga0395905_0662307 3300037471 Bacteria 946
769 Ga0436364_1182596 3300037853 Bacteria 26080
770 Ga0395901_0002214 3300038443 Bacteria 19825
771 Ga0395901_0034525 3300038443 Bacteria 5223
772 Ga0395901_0058940 3300038443 Bacteria 3994
773 Ga0395901_0151827 3300038443 Bacteria 2434
774 Ga0395901_0153083 3300038443 Bacteria 2422
775 Ga0395901_0200715 3300038443 Bacteria 2090
776 Ga0395901_0215909 3300038443 Bacteria 2006
777 Ga0395901_0232696 3300038443 Bacteria 1923
778 Ga0395901_0416867 3300038443 Bacteria 1377
779 Ga0395901_0458290 3300038443 Bacteria 1303
780 Ga0395901_0680903 3300038443 Unclassified 1028
781 Ga0436365_1673329 3300039437 Bacteria 4150
782 Ga0439465_0168962 3300041413 Bacteria 787
783 Ga0451802_0202772 3300041460 Bacteria 719
784 Ga0439432_017692 3300042006 Bacteria 2390
785 Ga0439449_0031141 3300042007 Bacteria 1988
786 Ga0450889_013711 3300042144 Bacteria 859
787 Ga0439458_0009596 3300042157 Bacteria 2156
788 Ga0439458_0010913 3300042157 Bacteria 2027
789 Ga0466969_0249056 3300044656 Bacteria 805
790 Ga0466972_0239889 3300044658 Unclassified 848
791 Ga0466972_0437322 3300044658 Bacteria 614
792 Ga0466966_0017961 3300044684 Bacteria 4670
793 Ga0466966_0020650 3300044684 Bacteria 4328
794 Ga0466966_0113609 3300044684 Bacteria 1668
795 Ga0466961_0020251 3300044693 Bacteria 4280
796 Ga0466963_0097924 3300044694 Bacteria 2004
797 Ga0466963_0168877 3300044694 Bacteria 1524
798 Ga0466964_0071145 3300044706 Bacteria 1471
799 Ga0466971_0019546 3300044719 Bacteria 3009
800 Ga0466971_0053303 3300044719 Bacteria 1823
801 Ga0466971_0475424 3300044719 Bacteria 615
802 Ga0466970_0109101 3300044765 Bacteria 1511
803 Ga0466970_0153439 3300044765 Bacteria 1272
804 Ga0466970_0479640 3300044765 Bacteria 715
805 Ga0466957_0028508 3300044842 Bacteria 3325
806 Ga0466957_0251517 3300044842 Bacteria 1175
807 Ga0466959_0186737 3300045049 Bacteria 1448
808 Ga0466959_0243185 3300045049 Bacteria 1242
809 Ga0466958_0015179 3300045836 Bacteria 4409
810 Ga0466958_0119555 3300045836 Bacteria 1649
811 Ga0466967_0000133 3300045976 Bacteria 28499
812 Ga0466967_0016030 3300045976 Bacteria 5895
813 Ga0466967_0217624 3300045976 Bacteria 1814
814 Ga0466967_0928497 3300045976 Unclassified 866
815 Ga0466967_1904860 3300045976 Bacteria 591
816 Ga0495643_0099815 3300046522 Bacteria 1489
817 Ga0495663_0172079 3300046525 Unclassified 747
818 Ga0495598_0001143 3300046537 Bacteria 5101
819 Ga0495598_0095684 3300046537 Unclassified 975
820 Ga0495621_0001056 3300046539 Bacteria 7053
821 Ga0495633_0099202 3300046558 Unclassified 1352
822 Ga0495669_0006895 3300046684 Bacteria 4759
823 Ga0495669_0020688 3300046684 Bacteria 2850
824 Ga0495669_0166624 3300046684 Unclassified 1047
825 Ga0495669_0190206 3300046684 Bacteria 980
826 Ga0495669_0493800 3300046684 Bacteria 595
827 Ga0495670_0002211 3300046691 Bacteria 9613
828 Ga0495600_0209187 3300046809 Bacteria 1251
829 Ga0495677_0074862 3300047445 Bacteria 1264
830 Ga0496100_0053864 3300048903 Bacteria 2621
831 Ga0496100_0442067 3300048903 Unclassified 996
832 Ga0496101_0194474 3300048904 Bacteria 1566
833 Ga0496101_0273213 3300048904 Bacteria 1320
834 Ga0496101_0273706 3300048904 Bacteria 1318
835 Ga0496101_0424833 3300048904 Bacteria 1048
836 Ga0496101_0803287 3300048904 Unclassified 742
837 Ga0496102_0147832 3300048905 Bacteria 2206
838 Ga0496102_0753659 3300048905 Bacteria 896
839 Ga0496103_0052140 3300048906 Bacteria 2534
840 Ga0496104_0094439 3300048907 Bacteria 2861
841 Ga0496105_0085975 3300048908 Bacteria 2599
842 Ga0496105_0538191 3300048908 Bacteria 913
843 Ga0496106_0026741 3300048909 Bacteria 4297
844 Ga0496106_0211061 3300048909 Bacteria 1547
845 Ga0496106_0890964 3300048909 Bacteria 703
846 Ga0496107_0022684 3300048910 Bacteria 4437
847 Ga0496107_0063532 3300048910 Bacteria 2676
848 Ga0496107_0088032 3300048910 Bacteria 2267
849 Ga0496107_0283747 3300048910 Bacteria 1232
850 Ga0496108_0002219 3300048911 Bacteria 15552
851 Ga0496108_0027261 3300048911 Bacteria 4715
852 Ga0496108_0056962 3300048911 Bacteria 3284
853 Ga0496108_0063721 3300048911 Bacteria 3104
854 Ga0496108_0189562 3300048911 Bacteria 1782
855 Ga0496109_0004027 3300048912 Bacteria 12274
856 Ga0496109_0039886 3300048912 Bacteria 4251
857 Ga0496109_0128549 3300048912 Bacteria 2364
858 Ga0496109_0284555 3300048912 Bacteria 1558
859 Ga0496109_0460580 3300048912 Unclassified 1201
860 Ga0496109_0589191 3300048912 Bacteria 1048
861 Ga0496109_1317221 3300048912 Bacteria 658
862 Ga0496110_0039477 3300048913 Bacteria 4110
863 Ga0496110_0062847 3300048913 Bacteria 3280
864 Ga0496110_0066273 3300048913 Bacteria 3193
865 Ga0496110_0087018 3300048913 Bacteria 2790
866 Ga0496110_0362117 3300048913 Bacteria 1321
867 Ga0496110_0781276 3300048913 Bacteria 859
868 Ga0496111_0007256 3300048914 Bacteria 7253
869 Ga0496111_0009171 3300048914 Bacteria 6587
870 Ga0496111_0039141 3300048914 Bacteria 3398
871 Ga0496111_0041554 3300048914 Bacteria 3300
872 Ga0496111_0371955 3300048914 Bacteria 1057
873 Ga0496111_1119477 3300048914 Unclassified 560
874 Ga0496112_0034765 3300048915 Bacteria 4905
875 Ga0496112_0089098 3300048915 Bacteria 3053
876 Ga0496112_0110085 3300048915 Bacteria 2724
877 Ga0496113_0010984 3300048916 Bacteria 6017
878 Ga0496113_0076150 3300048916 Bacteria 2562
879 Ga0496114_0000023 3300048917 Bacteria 219092
880 Ga0496114_0165102 3300048917 Bacteria 1927
881 Ga0496114_0370472 3300048917 Bacteria 1268
882 Ga0501047_0382111 3300049581 Unclassified 1243
883 Ga0501068_0138345 3300049584 Bacteria 1526
884 Ga0501069_0009266 3300049585 Bacteria 5196
885 Ga0501074_0172965 3300049590 Bacteria 1541
886 Ga0501233_134127 3300049668 Bacteria 679
887 Ga0501080_1140263 3300049742 Unclassified 672
888 Ga0501035_0863910 3300049822 Unclassified 719
889 Ga0501044_0395742 3300049823 Unclassified 1295
890 Ga0501212_007233 3300049851 Bacteria 1517
891 nmdc:mga03683_446129_c1 3300050489 Bacteria 622
892 nmdc:mga0k408_109384_c1 3300050493 Bacteria 1633
893 Ga0466962_0012233 3300061719 Bacteria 4125
894 Ga0466962_0054321 3300061719 Bacteria 1914
895 Ga0466962_0233455 3300061719 Unclassified 902
896 Ga0530510_0902909 3300061734 Bacteria 675
897 Ga0070682_100645922
898 MBSR1b_contig_13686641
899 JGI24740J21852_10024667
900 JGI24739J22299_10005757
901 JGI24739J22299_10021619
902 JGI24737J22298_10017642
903 JGI24737J22298_10218047
904 JGI24743J22301_10009110
905 JGI24735J21928_10004294
906 JGI24735J21928_10036266
907 JGI24738J21930_10038565
908 JGI24738J21930_10052614
909 JGI24738J21930_10120523
910 JGI24744J21845_10000547
911 JGI24742J22300_10010397
912 rootH1_10138689
913 Ga0065715_10023351
914 Ga0065715_10097503
915 Ga0065715_10392911
916 Ga0070658_10001557
917 Ga0070658_10010416
918 Ga0070658_10018360
919 Ga0070658_10053135
920 Ga0070658_10107335
921 Ga0070658_10153711
922 Ga0070658_11273692
923 Ga0070676_10068013
924 Ga0070676_10152645
925 Ga0070676_10685905
926 Ga0070676_11121903
927 Ga0070683_100008063
928 Ga0070683_100214995
929 Ga0070690_100044483
930 Ga0070690_100346094
931 Ga0070670_100003815
932 Ga0070670_100014338
933 Ga0070670_100038160
934 Ga0070670_100057436
935 Ga0070670_100072166
936 Ga0070670_100116815
937 Ga0070670_100134709
938 Ga0070670_100185559
939 Ga0070670_100258911
940 Ga0070677_10038409
941 Ga0070677_10189914
942 Ga0070677_10330681
943 Ga0068869_100108253
944 Ga0068869_101650121
945 Ga0070666_10000381
946 Ga0070666_10002547
947 Ga0070666_10004768
948 Ga0070666_10045936
949 Ga0070666_10066097
950 Ga0070666_10239550
951 Ga0070666_10473067
952 Ga0070680_101053767
953 Ga0070682_100025660
954 Ga0070682_101979317
955 Ga0068868_100002486
956 Ga0068868_100030303
957 Ga0068868_100105162
958 Ga0068868_100105321
959 Ga0068868_100424278
960 Ga0068868_101193142
961 Ga0070660_100000009
962 Ga0070660_100038962
963 Ga0070660_100134992
964 Ga0070660_100169117
965 Ga0070660_100201659
966 Ga0070660_100408691
967 Ga0070660_100437917
968 Ga0070660_100511907
969 Ga0070660_100994618
970 Ga0070687_100095557
971 Ga0070661_100001564
972 Ga0070661_100014885
973 Ga0070661_100022387
974 Ga0070661_100022856
975 Ga0070661_100073470
976 Ga0070661_100074276
977 Ga0070661_100098170
978 Ga0070661_100103459
979 Ga0070661_100246344
980 Ga0070668_100258717
981 Ga0070668_100873325
982 Ga0070669_100111286
983 Ga0070669_100318032
984 Ga0070669_100534663
985 Ga0070669_101041002
986 Ga0070669_101743996
987 Ga0070675_100000913
988 Ga0070675_100051464
989 Ga0070675_100101317
990 Ga0070675_100117114
991 Ga0070675_100135199
992 Ga0070675_100450985
993 Ga0070671_100000784
994 Ga0070671_100001033
995 Ga0070671_100005525
996 Ga0070671_100069911
997 Ga0070671_100089952
998 Ga0070671_100103018
999 Ga0070671_100113824
1000 Ga0070671_100124230
1001 Ga0070671_100470394
1002 Ga0070671_100544282
1003 Ga0070674_100045690
1004 Ga0070674_100079772
1005 Ga0070674_100118178
1006 Ga0070674_100137475
1007 Ga0070674_100145654
1008 Ga0070674_100271906
1009 Ga0070673_100003767
1010 Ga0070673_100022395
1011 Ga0070673_100022477
1012 Ga0070673_100035527
1013 Ga0070673_100049622
1014 Ga0070673_100264176
1015 Ga0070673_100345348
1016 Ga0070673_100556713
1017 Ga0070673_100748287
1018 Ga0070659_100001389
1019 Ga0070659_100006367
1020 Ga0070659_100019299
1021 Ga0070659_100026012
1022 Ga0070659_100130922
1023 Ga0070659_100361580
1024 Ga0070659_100482416
1025 Ga0070659_100576079
1026 Ga0070659_100581633
1027 Ga0070667_100000915
1028 Ga0070667_100027177
1029 Ga0070667_100030757
1030 Ga0070667_100061978
1031 Ga0070667_100467413
1032 Ga0070709_10111843
1033 Ga0070714_100063184
1034 Ga0070714_100136216
1035 Ga0070713_100210795
1036 Ga0070713_100530906
1037 Ga0070663_100016637
1038 Ga0070663_100051620
1039 Ga0070663_100132287
1040 Ga0070663_100184101
1041 Ga0070663_100200408
1042 Ga0070663_100385417
1043 Ga0070663_100443872
1044 Ga0070663_101177941
1045 Ga0070678_100000775
1046 Ga0070678_100032098
1047 Ga0070678_100041260
1048 Ga0070678_100339411
1049 Ga0070662_100002539
1050 Ga0070662_100005907
1051 Ga0070662_100008010
1052 Ga0070662_100009832
1053 Ga0070662_100015832
1054 Ga0070662_100069884
1055 Ga0070662_100090421
1056 Ga0070662_100104107
1057 Ga0070662_100120994
1058 Ga0070662_100183684
1059 Ga0070662_100294393
1060 Ga0070662_100788003
1061 Ga0070662_100833198
1062 Ga0070662_101009558
1063 Ga0070681_10569961
1064 Ga0070681_10612982
1065 Ga0070681_11230017
1066 Ga0068867_100026024
1067 Ga0068867_100127523
1068 Ga0068867_100437726
1069 Ga0070685_10894126
1070 Ga0070679_100466080
1071 Ga0070679_100611730
1072 Ga0070679_100656370
1073 Ga0070679_100777991
1074 Ga0070684_100029760
1075 Ga0068853_100007625
1076 Ga0068853_100072672
1077 Ga0068853_100107157
1078 Ga0068853_100224754
1079 Ga0068853_100401677
1080 Ga0068853_100472853
1081 Ga0070672_100007391
1082 Ga0070672_100028901
1083 Ga0070672_100034180
1084 Ga0070672_100073823
1085 Ga0070672_100073924
1086 Ga0070672_100080781
1087 Ga0070672_100143927
1088 Ga0070672_100161423
1089 Ga0070672_100163580
1090 Ga0070672_100547703
1091 Ga0070672_100760698
1092 Ga0070686_100010300
1093 Ga0070686_100200541
1094 Ga0070686_101098602
1095 Ga0070693_100001083
1096 Ga0070665_100035090
1097 Ga0070665_100067794
1098 Ga0070665_100121257
1099 Ga0070665_100127103
1100 Ga0070665_100565415
1101 Ga0070665_100650953
1102 Ga0070665_100721725
1103 Ga0070665_101296302
1104 Ga0068855_100001099
1105 Ga0068855_100273309
1106 Ga0068855_101436334
1107 Ga0068855_101625872
1108 Ga0070664_100000103
1109 Ga0070664_100006945
1110 Ga0070664_100008493
1111 Ga0070664_100011272
1112 Ga0070664_100033104
1113 Ga0070664_100042247
1114 Ga0070664_100127289
1115 Ga0070664_100327376
1116 Ga0070664_100390743
1117 Ga0070664_101618353
1118 Ga0070664_102177396
1119 Ga0068857_100322567
1120 Ga0068857_100612471
1121 Ga0068854_100054218
1122 Ga0068854_100060832
1123 Ga0068854_100066869
1124 Ga0068854_100131248
1125 Ga0068854_100777665
1126 Ga0068854_101451338
1127 Ga0068856_100000628
1128 Ga0068856_100042565
1129 Ga0068856_100816567
1130 Ga0070702_100204394
1131 Ga0070702_100394487
1132 Ga0068852_100015079
1133 Ga0068852_100058248
1134 Ga0068852_100143994
1135 Ga0068852_100177688
1136 Ga0068852_100225682
1137 Ga0068852_100935161
1138 Ga0068852_101507230
1139 Ga0068852_101691743
1140 Ga0068859_100036677
1141 Ga0068859_100263305
1142 Ga0068859_100287754
1143 Ga0068859_100402051
1144 Ga0068864_100000982
1145 Ga0068864_100013401
1146 Ga0068864_100021722
1147 Ga0068864_100023474
1148 Ga0068864_100027035
1149 Ga0068864_100206237
1150 Ga0068864_100305196
1151 Ga0068864_100513102
1152 Ga0068864_100533098
1153 Ga0068864_100675550
1154 Ga0068866_10009417
1155 Ga0068866_10020297
1156 Ga0068866_10068913
1157 Ga0068866_10075656
1158 Ga0068861_100126061
1159 Ga0068861_100518874
1160 Ga0068861_101021403
1161 Ga0068851_10001784
1162 Ga0068851_10017472
1163 Ga0068851_10044505
1164 Ga0068851_10086284
1165 Ga0068851_10416274
1166 Ga0068870_10514120
1167 Ga0068870_10548519
1168 Ga0068863_100023172
1169 Ga0068863_100043208
1170 Ga0068863_100062068
1171 Ga0068863_100110949
1172 Ga0068858_100009318
1173 Ga0068858_100033683
1174 Ga0068858_100185914
1175 Ga0068858_100198779
1176 Ga0068860_100117181
1177 Ga0068860_100122827
1178 Ga0068860_100628059
1179 Ga0070717_10222704
1180 Ga0075364_10221214
1181 Ga0070712_100041924
1182 Ga0097621_100024505
1183 Ga0097621_100049726
1184 Ga0097621_100147655
1185 Ga0097621_100365636
1186 Ga0068871_100034183
1187 Ga0068871_100075941
1188 Ga0068871_100084375
1189 Ga0068871_100126959
1190 Ga0068871_100186051
1191 Ga0068871_100582499
1192 Ga0068865_100011026
1193 Ga0068865_100274501
1194 Ga0097620_100036677
1195 Ga0097620_100263309
1196 Ga0097620_100287765
1197 Ga0097620_100402010
1198 Ga0105240_10234951
1199 Ga0105240_10252554
1200 Ga0105245_10021117
1201 Ga0105245_10033176
1202 Ga0105243_10055632
1203 Ga0105241_10173796
1204 Ga0105241_10852419
1205 Ga0105241_11526128
1206 Ga0105242_10049979
1207 Ga0105242_10193647
1208 Ga0105242_10480910
1209 Ga0105248_10000673
1210 Ga0105248_10000724
1211 Ga0105248_10002105
1212 Ga0105248_10014771
1213 Ga0105248_10070039
1214 Ga0105248_10145240
1215 Ga0105248_11343271
1216 Ga0105248_12534153
1217 Ga0105237_10173424
1218 Ga0105238_10072831
1219 Ga0105238_10166595
1220 Ga0105238_10451747
1221 Ga0105238_10608585
1222 Ga0105239_10754913
1223 Ga0105239_10807366
1224 Ga0105246_10075364
1225 Ga0105246_10119099
1226 Ga0157373_10016140
1227 Ga0157373_10090457
1228 Ga0157373_10092960
1229 Ga0157373_10141560
1230 Ga0157373_11333749
1231 Ga0157371_10002159
1232 Ga0157371_10012009
1233 Ga0157371_10022609
1234 Ga0157371_10087053
1235 Ga0157371_10169076
1236 Ga0157371_11584157
1237 Ga0157370_10408617
1238 Ga0157370_10619753
1239 Ga0157370_10631975
1240 Ga0157370_10876372
1241 Ga0157369_10043789
1242 Ga0157369_10629395
1243 Ga0157369_11086590
1244 Ga0157369_12064944
1245 Ga0157374_10000882
1246 Ga0157374_10033137
1247 Ga0157374_10073176
1248 Ga0157374_10280377
1249 Ga0157374_11745388
1250 Ga0157374_12459993
1251 Ga0157378_10107911
1252 Ga0157378_10156187
1253 Ga0163162_10002440
1254 Ga0163162_10024974
1255 Ga0163162_10026987
1256 Ga0163162_10073566
1257 Ga0163162_10493941
1258 Ga0163162_10763107
1259 Ga0157372_10134336
1260 Ga0157372_10485941
1261 Ga0157372_10660052
1262 Ga0157372_12828863
1263 Ga0157375_10002611
1264 Ga0157375_10116887
1265 Ga0157375_10132936
1266 Ga0157375_10161166
1267 Ga0157375_10198953
1268 Ga0157375_10792220
1269 Ga0157375_11100643
1270 Ga0163163_10004607
1271 Ga0163163_10041443
1272 Ga0163163_10137433
1273 Ga0163163_10146877
1274 Ga0163163_11549356
1275 Ga0157380_11449458
1276 Ga0157380_11862643
1277 Ga0182008_10116022
1278 Ga0157377_10413947
1279 Ga0157379_10040579
1280 Ga0157379_10230149
1281 Ga0157379_10242372
1282 Ga0157376_10006910
1283 Ga0157376_10181840
1284 Ga0163161_10024348
1285 Ga0163161_10046050
1286 Ga0163161_10621887
1287 Ga0213876_10021022
1288 Ga0213875_10006414
1289 Ga0207697_10021874
1290 Ga0207697_10024490
1291 Ga0207697_10164760
1292 Ga0207697_10231137
1293 Ga0207656_10014429
1294 Ga0207656_10046907
1295 Ga0207656_10072170
1296 Ga0207656_10158221
1297 Ga0207682_10013128
1298 Ga0207682_10172691
1299 Ga0207642_10008789
1300 Ga0207642_10016286
1301 Ga0207642_10067123
1302 Ga0207642_10211599
1303 Ga0207688_10104529
1304 Ga0207688_10137748
1305 Ga0207680_10004726
1306 Ga0207680_10006248
1307 Ga0207680_10014792
1308 Ga0207680_10029108
1309 Ga0207680_10040837
1310 Ga0207680_10327008
1311 Ga0207680_10327813
1312 Ga0207680_10392440
1313 Ga0207647_10026290
1314 Ga0207647_10043572
1315 Ga0207647_10048937
1316 Ga0207647_10066872
1317 Ga0207647_10087582
1318 Ga0207647_10563354
1319 Ga0207645_10134262
1320 Ga0207645_10170030
1321 Ga0207643_10586908
1322 Ga0207705_10000113
1323 Ga0207705_10022419
1324 Ga0207705_10025235
1325 Ga0207705_10028813
1326 Ga0207705_10044812
1327 Ga0207705_10072157
1328 Ga0207705_10205885
1329 Ga0207705_10217047
1330 Ga0207705_10280308
1331 Ga0207654_10114587
1332 Ga0207695_10191172
1333 Ga0207695_10374635
1334 Ga0207671_10414191
1335 Ga0207693_10014652
1336 Ga0207662_10016144
1337 Ga0207662_11326284
1338 Ga0207657_10000328
1339 Ga0207657_10012677
1340 Ga0207657_10018921
1341 Ga0207657_10022698
1342 Ga0207657_10106512
1343 Ga0207657_10117721
1344 Ga0207657_10143045
1345 Ga0207657_10246524
1346 Ga0207657_10389514
1347 Ga0207657_10896520
1348 Ga0207649_10000228
1349 Ga0207649_10030809
1350 Ga0207649_10051534
1351 Ga0207649_10095091
1352 Ga0207649_10163325
1353 Ga0207649_10193208
1354 Ga0207649_10215644
1355 Ga0207649_10275246
1356 Ga0207652_10503467
1357 Ga0207652_10535378
1358 Ga0207652_10865328
1359 Ga0207652_10971809
1360 Ga0207681_10096292
1361 Ga0207681_10285687
1362 Ga0207681_10465807
1363 Ga0207681_10652904
1364 Ga0207681_10675964
1365 Ga0207694_10064456
1366 Ga0207694_10318776
1367 Ga0207694_10472494
1368 Ga0207650_10016267
1369 Ga0207650_10031702
1370 Ga0207650_10038759
1371 Ga0207650_10065821
1372 Ga0207650_10341840
1373 Ga0207650_10368537
1374 Ga0207650_10508840
1375 Ga0207650_10970464
1376 Ga0207659_10063329
1377 Ga0207659_10080609
1378 Ga0207659_10106840
1379 Ga0207659_10588074
1380 Ga0207687_10034393
1381 Ga0207687_10195619
1382 Ga0207700_10808208
1383 Ga0207664_10356967
1384 Ga0207644_10000181
1385 Ga0207644_10001877
1386 Ga0207644_10018566
1387 Ga0207644_10049770
1388 Ga0207644_10072793
1389 Ga0207644_10088987
1390 Ga0207644_10089398
1391 Ga0207644_10227120
1392 Ga0207644_10297286
1393 Ga0207690_10000036
1394 Ga0207690_10023844
1395 Ga0207690_10042632
1396 Ga0207690_10046139
1397 Ga0207690_10100436
1398 Ga0207690_10265632
1399 Ga0207690_10472945
1400 Ga0207706_10000343
1401 Ga0207706_10006757
1402 Ga0207706_10006809
1403 Ga0207706_10008945
1404 Ga0207706_10015817
1405 Ga0207706_10021335
1406 Ga0207706_10035527
1407 Ga0207706_10045365
1408 Ga0207706_10103783
1409 Ga0207706_10185969
1410 Ga0207706_10357078
1411 Ga0207706_10618553
1412 Ga0207686_10052847
1413 Ga0207686_10339310
1414 Ga0207686_11458539
1415 Ga0207709_10166679
1416 Ga0207709_10211090
1417 Ga0207669_10052152
1418 Ga0207669_10185729
1419 Ga0207669_10340766
1420 Ga0207669_10757133
1421 Ga0207669_10794325
1422 Ga0207704_10030292
1423 Ga0207691_10011944
1424 Ga0207691_10022187
1425 Ga0207691_10026376
1426 Ga0207691_10036392
1427 Ga0207691_10043488
1428 Ga0207691_10125061
1429 Ga0207691_10170254
1430 Ga0207691_10201930
1431 Ga0207691_10204770
1432 Ga0207691_10595482
1433 Ga0207711_10003972
1434 Ga0207711_10015244
1435 Ga0207711_10015793
1436 Ga0207711_10046278
1437 Ga0207711_10051335
1438 Ga0207711_10117573
1439 Ga0207711_10588963
1440 Ga0207689_10031981
1441 Ga0207661_10011054
1442 Ga0207661_10254856
1443 Ga0207661_11548672
1444 Ga0207679_10000093
1445 Ga0207679_10001758
1446 Ga0207679_10007795
1447 Ga0207679_10014634
1448 Ga0207679_10054269
1449 Ga0207679_10069614
1450 Ga0207679_10234046
1451 Ga0207679_10366230
1452 Ga0207679_11008438
1453 Ga0207679_11361267
1454 Ga0207679_11431991
1455 Ga0207667_10002944
1456 Ga0207667_10058823
1457 Ga0207667_10273263
1458 Ga0207667_10739260
1459 Ga0207651_10003789
1460 Ga0207651_10006757
1461 Ga0207651_10008254
1462 Ga0207651_10026202
1463 Ga0207651_10088284
1464 Ga0207651_10151837
1465 Ga0207651_10189669
1466 Ga0207651_10514587
1467 Ga0207668_10664451
1468 Ga0207640_10056467
1469 Ga0207640_10059021
1470 Ga0207640_10083864
1471 Ga0207640_10320251
1472 Ga0207640_10759536
1473 Ga0207658_10000936
1474 Ga0207658_10013597
1475 Ga0207658_10016927
1476 Ga0207658_10090420
1477 Ga0207658_10331945
1478 Ga0207658_10587094
1479 Ga0207677_10003694
1480 Ga0207677_10020322
1481 Ga0207677_10103499
1482 Ga0207677_10645846
1483 Ga0207677_10759254
1484 Ga0207703_10005275
1485 Ga0207703_10012855
1486 Ga0207703_10020733
1487 Ga0207703_10117459
1488 Ga0207703_10414604
1489 Ga0207639_10002879
1490 Ga0207639_10589346
1491 Ga0207639_10620216
1492 Ga0207639_10987187
1493 Ga0207678_10006618
1494 Ga0207678_10009022
1495 Ga0207678_10012776
1496 Ga0207678_10065064
1497 Ga0207678_10074005
1498 Ga0207678_10096806
1499 Ga0207678_10115281
1500 Ga0207678_10266347
1501 Ga0207708_11446752
1502 Ga0207702_10000619
1503 Ga0207702_10243503
1504 Ga0207702_10286322
1505 Ga0207702_10361761
1506 Ga0207702_10554585
1507 Ga0207702_11401230
1508 Ga0207641_10011857
1509 Ga0207641_10023515
1510 Ga0207641_10123333
1511 Ga0207641_10145579
1512 Ga0207648_10002532
1513 Ga0207648_10011721
1514 Ga0207648_10186172
1515 Ga0207676_10003014
1516 Ga0207676_10006459
1517 Ga0207676_10032425
1518 Ga0207676_10076654
1519 Ga0207676_10172054
1520 Ga0207676_10535596
1521 Ga0207676_10644856
1522 Ga0207676_10874228
1523 Ga0207674_10000132
1524 Ga0207674_10244444
1525 Ga0207674_10472744
1526 Ga0207674_11281950
1527 Ga0207683_10007992
1528 Ga0207683_10011570
1529 Ga0207683_10057305
1530 Ga0207683_10072639
1531 Ga0207683_10138551
1532 Ga0207698_10010281
1533 Ga0207698_10095891
1534 Ga0207698_10115760
1535 Ga0207698_10130782
1536 Ga0207698_10299581
1537 Ga0207698_11566110
1538 Ga0207698_11793683
1539 Ga0268266_10017931
1540 Ga0268266_10030004
1541 Ga0268266_10157673
1542 Ga0268266_10268011
1543 Ga0268266_10379532
1544 Ga0268266_10573797
1545 Ga0268264_10098032
1546 Ga0268264_10197775
1547 Ga0268264_10654756
1548 Ga0307408_100075623
1549 Ga0307408_100248924
1550 Ga0307405_10007143
1551 Ga0307405_10135857
1552 Ga0307413_10045791
1553 Ga0307413_10603139
1554 Ga0307413_10635945
1555 Ga0307413_11632556
1556 Ga0307410_10011217
1557 Ga0307410_10012882
1558 Ga0307410_10177118
1559 Ga0307410_10211986
1560 Ga0307410_10939133
1561 Ga0307410_11005237
1562 Ga0307406_10322822
1563 Ga0307407_10121166
1564 Ga0307407_10520740
1565 Ga0307407_10667041
1566 Ga0307407_11310819
1567 Ga0307412_10954048
1568 Ga0307409_100004656
1569 Ga0307409_100033957
1570 Ga0307409_100171667
1571 Ga0307409_100626221
1572 Ga0307409_101575009
1573 Ga0307409_101758536
1574 Ga0307416_100004801
1575 Ga0307416_100056142
1576 Ga0307416_100226339
1577 Ga0307416_100971884
1578 Ga0307416_101134306
1579 Ga0307416_101185365
1580 Ga0307414_10045411
1581 Ga0307414_10048731
1582 Ga0307414_10070467
1583 Ga0307414_10072426
1584 Ga0307414_10320960
1585 Ga0307414_10546479
1586 Ga0307414_12147776
1587 Ga0307411_10040192
1588 Ga0307411_10072858
1589 Ga0307411_10095117
1590 Ga0307411_10261165
1591 Ga0307411_10384429
1592 Ga0307415_100004436
1593 Ga0307415_100011638
1594 Ga0307415_100014441
1595 Ga0307415_100018715
1596 Ga0307415_100087487
1597 Ga0307415_100191250
1598 Ga0307415_102170721
1599 Ga0373950_0066784
1600 Ga0373958_0094444
1601 Ga0373938_0177178
1602 Ga0373949_0078032
1603 Ga0373939_0052601
1604 Ga0373941_0389358
1605 Ga0373960_0006755
1606 Ga0373960_0091583
1607 Ga0373942_0044769
1608 Ga0373962_0045739
1609 Ga0373931_0036991
1610 Ga0373931_0198722
1611 Ga0373931_0230950
1612 Ga0373931_0273058
1613 Ga0373947_0383316
1614 Ga0373937_0166091
1615 Ga0395899_0051869
1616 Ga0395899_0063518
1617 Ga0395899_0085583
1618 Ga0395899_0087697
1619 Ga0395899_0097811
1620 Ga0395899_0115661
1621 Ga0395899_0288729
1622 Ga0395899_0323992
1623 Ga0395899_0374852
1624 Ga0395899_0516649
1625 Ga0395899_0531097
1626 Ga0395900_0000530
1627 Ga0395900_0035419
1628 Ga0395900_0047919
1629 Ga0395900_0057291
1630 Ga0395900_0127555
1631 Ga0395900_0142994
1632 Ga0395900_0208799
1633 Ga0395900_0209526
1634 Ga0395900_0212857
1635 Ga0395900_0241463
1636 Ga0395900_0328665
1637 Ga0395900_0548453
1638 Ga0395900_0618040
1639 Ga0395900_0766719
1640 Ga0395900_0947215
1641 Ga0395900_0977471
1642 Ga0395898_0019899
1643 Ga0395898_0034350
1644 Ga0395898_0108317
1645 Ga0395898_0163504
1646 Ga0395898_0169515
1647 Ga0395898_0324705
1648 Ga0395898_0610946
1649 Ga0395898_0790396
1650 Ga0395905_0001285
1651 Ga0395905_0002000
1652 Ga0395905_0012346
1653 Ga0395905_0016638
1654 Ga0395905_0020055
1655 Ga0395905_0040653
1656 Ga0395905_0050007
1657 Ga0395905_0063997
1658 Ga0395905_0070728
1659 Ga0395905_0076302
1660 Ga0395905_0083650
1661 Ga0395905_0268351
1662 Ga0395905_0296571
1663 Ga0395905_0449394
1664 Ga0395905_0662307
1665 Ga0436364_1182596
1666 Ga0395901_0002214
1667 Ga0395901_0034525
1668 Ga0395901_0058940
1669 Ga0395901_0151827
1670 Ga0395901_0153083
1671 Ga0395901_0200715
1672 Ga0395901_0215909
1673 Ga0395901_0232696
1674 Ga0395901_0416867
1675 Ga0395901_0458290
1676 Ga0395901_0680903
1677 Ga0436365_1673329
1678 Ga0439465_0168962
1679 Ga0451802_0202772
1680 Ga0439432_017692
1681 Ga0439449_0031141
1682 Ga0450889_013711
1683 Ga0439458_0009596
1684 Ga0439458_0010913
1685 Ga0466969_0249056
1686 Ga0466972_0239889
1687 Ga0466972_0437322
1688 Ga0466966_0017961
1689 Ga0466966_0020650
1690 Ga0466966_0113609
1691 Ga0466961_0020251
1692 Ga0466963_0097924
1693 Ga0466963_0168877
1694 Ga0466964_0071145
1695 Ga0466971_0019546
1696 Ga0466971_0053303
1697 Ga0466971_0475424
1698 Ga0466970_0109101
1699 Ga0466970_0153439
1700 Ga0466970_0479640
1701 Ga0466957_0028508
1702 Ga0466957_0251517
1703 Ga0466959_0186737
1704 Ga0466959_0243185
1705 Ga0466958_0015179
1706 Ga0466958_0119555
1707 Ga0466967_0000133
1708 Ga0466967_0016030
1709 Ga0466967_0217624
1710 Ga0466967_0928497
1711 Ga0466967_1904860
1712 Ga0495643_0099815
1713 Ga0495663_0172079
1714 Ga0495598_0001143
1715 Ga0495598_0095684
1716 Ga0495621_0001056
1717 Ga0495633_0099202
1718 Ga0495669_0006895
1719 Ga0495669_0020688
1720 Ga0495669_0166624
1721 Ga0495669_0190206
1722 Ga0495669_0493800
1723 Ga0495670_0002211
1724 Ga0495600_0209187
1725 Ga0495677_0074862
1726 Ga0496100_0053864
1727 Ga0496100_0442067
1728 Ga0496101_0194474
1729 Ga0496101_0273213
1730 Ga0496101_0273706
1731 Ga0496101_0424833
1732 Ga0496101_0803287
1733 Ga0496102_0147832
1734 Ga0496102_0753659
1735 Ga0496103_0052140
1736 Ga0496104_0094439
1737 Ga0496105_0085975
1738 Ga0496105_0538191
1739 Ga0496106_0026741
1740 Ga0496106_0211061
1741 Ga0496106_0890964
1742 Ga0496107_0022684
1743 Ga0496107_0063532
1744 Ga0496107_0088032
1745 Ga0496107_0283747
1746 Ga0496108_0002219
1747 Ga0496108_0027261
1748 Ga0496108_0056962
1749 Ga0496108_0063721
1750 Ga0496108_0189562
1751 Ga0496109_0004027
1752 Ga0496109_0039886
1753 Ga0496109_0128549
1754 Ga0496109_0284555
1755 Ga0496109_0460580
1756 Ga0496109_0589191
1757 Ga0496109_1317221
1758 Ga0496110_0039477
1759 Ga0496110_0062847
1760 Ga0496110_0066273
1761 Ga0496110_0087018
1762 Ga0496110_0362117
1763 Ga0496110_0781276
1764 Ga0496111_0007256
1765 Ga0496111_0009171
1766 Ga0496111_0039141
1767 Ga0496111_0041554
1768 Ga0496111_0371955
1769 Ga0496111_1119477
1770 Ga0496112_0034765
1771 Ga0496112_0089098
1772 Ga0496112_0110085
1773 Ga0496113_0010984
1774 Ga0496113_0076150
1775 Ga0496114_0000023
1776 Ga0496114_0165102
1777 Ga0496114_0370472
1778 Ga0501047_0382111
1779 Ga0501068_0138345
1780 Ga0501069_0009266
1781 Ga0501074_0172965
1782 Ga0501233_134127
1783 Ga0501080_1140263
1784 Ga0501035_0863910
1785 Ga0501044_0395742
1786 Ga0501212_007233
1787 nmdc:mga03683_446129_c1
1788 nmdc:mga0k408_109384_c1
1789 Ga0466962_0012233
1790 Ga0466962_0054321
1791 Ga0466962_0233455
1792 Ga0530510_0902909

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01047

MarR

MarR family

46

104

0.98

PF12802

MarR_2

MarR family

44

103

0.98

PF13463

HTH_27

Winged helix DNA-binding domain

46

112

0.96

PF13412

HTH_24

Winged helix-turn-helix DNA-binding

47

93

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
5duk-assembly1.cif.gz_A n-terminal structure of putative dna binding transcription factor from thermoplasmatales archaeon scgc ab-539-n05 0.9648 32 81
4kmf-assembly1.cif.gz_A-2 crystal structure of zalpha domain from carassius auratus pkz in complex with z-dna 0.9552 31 91
4hob-assembly1.cif.gz_A the crystal structure of the zalpha domain from cyprinid herpes virus 3 0.9519 31 72
4hob-assembly2.cif.gz_C the crystal structure of the zalpha domain from cyprinid herpes virus 3 0.9453 31 72
4awx-assembly1.cif.gz_B moonlighting functions of feoc in the regulation of ferrous iron transport in feo 0.9435 32 90
ID Description Score Start End Superfamily
5dukB00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9719 32 71 1.10.10.10
af_Q57824_147_206_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9664 28 89 1.10.10.10
4kmfA00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9552 31 91 1.10.10.10
4hobA00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9519 31 72 1.10.10.10
af_P30852_292_361_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9519 44 75 1.10.10.10
ID Description Score Start End GO Terms
AF-K2K7R1-F1-model_v4 Transcriptional regulator, MarR family protein 0.9751 4 136 GO:0003677
GO:0003700
AF-A0A0T1WPN2-F1-model_v4 MarR family transcriptional regulator 0.965 1 137 GO:0003700
AF-A0A4R1RGL7-F1-model_v4 DNA-binding MarR family transcriptional regulator 0.9647 1 137 GO:0003677
GO:0003700
GO:0006950
AF-A0A537NP25-F1-model_v4 MarR family transcriptional regulator 0.9628 3 137 GO:0003677
GO:0003700
GO:0006950
AF-A0A845FRW5-F1-model_v4 MarR family transcriptional regulator 0.9609 2 136 GO:0003677
GO:0003700
GO:0006950

Map