F485030
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 896 | 431 | 1792 | 325 |
Family's Representative Sequence
| Representative Sequence | 3300050491|nmdc:mga00v17_27702_c1|nmdc:mga00v17_27702_c1_1937_3073 |
| Length | 378 |
| Sequence | MVCGLSSSKKALTGSTVGITARYAQPAPGNTDHQRFPLGFPDVPDTAADGAGALLIAGSIATDHLMSFGGRFEDSLVVEQLHKLSVSFLVDDLEIRRGGVAANMCFGLGRLGLTPVLVGCAGDDFADYRSWLERHGVDCDHVRISDTHHTARFVCTTDTTGAQFASFYPGAMSEARLVELAPIVAKVGAPSYVLIGADDPDGMLRHTEECRQRGYRFIADPSQQLAFGEGELIRNLIDGAAFLFSNEYESAMIEQKTGWSSDEVLSRVGIQVTTLGKDGVRVLRRGEEPIERPAAKDVRALEPTGVGDAFRAGFLGALAWGLSLEHAAEVGCVLAAYVVETVGPQDYTFTAEQFLGRLDASYGGEAAEAVRPHLTAVS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 2 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 3 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 4 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 5 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 6 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 7 | 3300003373 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 8 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 9 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 11 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 13 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 14 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 15 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 16 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 18 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 19 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 20 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 22 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 27 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 30 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 32 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 35 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 38 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 39 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 40 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 41 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 42 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 43 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 45 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 46 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 47 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 49 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 52 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 54 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 55 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 56 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 58 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 59 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 60 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 61 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 62 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 63 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 64 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 65 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 66 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 67 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 68 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 69 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 71 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 72 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 73 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 74 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 75 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 76 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 77 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 78 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 79 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 81 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 82 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 83 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 84 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 85 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 86 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 87 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 88 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 89 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 90 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 91 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 92 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 116 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 120 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 121 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 122 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 123 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 124 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 180 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 181 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 185 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 186 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 187 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 188 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 189 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 190 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 191 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 192 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 193 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 194 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 195 | 3300031838 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM | Metagenome | Unclassified |
| 196 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 197 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 198 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 199 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 200 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 201 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 202 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 203 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 204 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 205 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 206 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 207 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 208 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 209 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 210 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 211 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 212 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 213 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 214 | 3300037588 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA | Metagenome | Rhizosphere |
| 215 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 216 | 3300038741 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 | Metagenome | Unclassified |
| 217 | 3300038742 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 | Metagenome | Unclassified |
| 218 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 219 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 220 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 221 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 222 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 223 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 224 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 225 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 226 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 227 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 228 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 229 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 230 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 231 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 232 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 233 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 234 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 235 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 236 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 237 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 238 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 239 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 240 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 241 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 242 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 255 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 256 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 257 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 258 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 259 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 260 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 261 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 262 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 263 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 264 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 265 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 266 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 267 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 268 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 269 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 270 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 271 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 272 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 273 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 274 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 275 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 276 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 277 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 278 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 279 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 280 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 281 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 282 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 283 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 284 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 285 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 286 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 287 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 288 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 289 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 290 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 291 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 292 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 293 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 294 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 295 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 296 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 297 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 298 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 299 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 300 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 301 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 302 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 303 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 304 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 305 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 306 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 307 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 308 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 309 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 310 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 311 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 312 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 313 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 314 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 315 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 316 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 317 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 318 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 322 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 323 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 324 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 325 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 326 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 327 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 328 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 329 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 330 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 331 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 332 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 333 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 334 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 335 | 2501939600 | Micromonospora sp. L5 | Isolate | Unclassified |
| 336 | 2515154088 | Salinispora arenicola CNT800 | Isolate | Rhizosphere |
| 337 | 2515154129 | Salinispora pacifica CNS103 | Isolate | Rhizosphere |
| 338 | 2515154137 | Salinispora arenicola CNX482 | Isolate | Rhizosphere |
| 339 | 2515154202 | Salinispora pacifica CNT084 | Isolate | Rhizosphere |
| 340 | 2515154203 | Salinispora arenicola CNR921 | Isolate | Rhizosphere |
| 341 | 2585427649 | Amycolatopsis japonica MG417-CF17, DSM 44213 | Isolate | Unclassified |
| 342 | 2622736626 | Micromonospora rhizosphaerae DSM 45431 | Isolate | Rhizosphere |
| 343 | 2643221561 | Nocardioides sp. Root151 | Isolate | Unclassified |
| 344 | 2643221567 | Phycicoccus sp. Root563 | Isolate | Unclassified |
| 345 | 2643221576 | Nocardioides sp. Root614 | Isolate | Unclassified |
| 346 | 2643221587 | Streptomyces sp. Root66D1 | Isolate | Unclassified |
| 347 | 2643221590 | Nocardioides sp. Root682 | Isolate | Unclassified |
| 348 | 2643221604 | Nocardioides sp. Root190 | Isolate | Unclassified |
| 349 | 2643221615 | Nocardioides sp. Root224 | Isolate | Unclassified |
| 350 | 2643221617 | Nocardioides sp. Root79 | Isolate | Unclassified |
| 351 | 2643221620 | Nocardioides sp. Root240 | Isolate | Unclassified |
| 352 | 2643221624 | Phycicoccus sp. Root101 | Isolate | Unclassified |
| 353 | 2643221657 | Nocardioides sp. Root1257 | Isolate | Unclassified |
| 354 | 2643221670 | Streptomyces sp. Root431 | Isolate | Unclassified |
| 355 | 2643221677 | Streptomyces sp. Root1304 | Isolate | Unclassified |
| 356 | 2643221678 | Streptomyces sp. Root1310 | Isolate | Unclassified |
| 357 | 2643221696 | Nocardioides sp. Root140 | Isolate | Unclassified |
| 358 | 2643221714 | Streptomyces sp. Root264 | Isolate | Unclassified |
| 359 | 2675903058 | Actinopolymorpha cephalotaxi CPCC 202808 | Isolate | Rhizosphere |
| 360 | 2738541305 | Nocardioides sp. CF167 | Isolate | Unclassified |
| 361 | 2739367898 | Nocardioides sp. CF479 | Isolate | Unclassified |
| 362 | 2751185782 | Actinoplanes subtropicus NRRL B-24665 | Isolate | Rhizosphere |
| 363 | 2767802112 | Streptomyces avicenniae NRRL B-24776 | Isolate | Rhizosphere |
| 364 | 2772190715 | Micromonospora chokoriensis NRRL B-24750 | Isolate | Unclassified |
| 365 | 2773857762 | Nocardioides sp. SAI-095 | Isolate | Unclassified |
| 366 | 2784132109 | Dermacoccus sp. DS28 SAI-028 | Isolate | Unclassified |
| 367 | 2795385470 | Labedaea rhizosphaerae DSM 45361 | Isolate | Rhizosphere |
| 368 | 2808606359 | Streptomyces sp. RJA2910 | Isolate | Unclassified |
| 369 | 2808606365 | Phycicoccus sp. SLBN-51 | Isolate | Unclassified |
| 370 | 2808606439 | Nocardioides sp. SLBN-172 | Isolate | Unclassified |
| 371 | 2808606522 | Amycolatopsis sp. BJA-103 | Isolate | Unclassified |
| 372 | 2811994874 | Nocardioides sp. SLBN-35 | Isolate | Unclassified |
| 373 | 2811994878 | Nocardioides sp. SLBN-169 | Isolate | Unclassified |
| 374 | 2818991318 | Humibacillus xanthopallidus SLBN-155 | Isolate | Unclassified |
| 375 | 2827628540 | Actinopolymorpha cephalotaxi DSM 45117 | Isolate | Rhizosphere |
| 376 | 2831935698 | Jishengella sp. AZ1-13 | Isolate | Unclassified |
| 377 | 2832004796 | Micromonospora endophytica JCM 18317 | Isolate | Unclassified |
| 378 | 2855386786 | Nocardioides ferulae EGI 63112 | Isolate | Unclassified |
| 379 | 2855670206 | Micromonospora noduli Lupac 07 | Isolate | Nodule |
| 380 | 2855676851 | Micromonospora saelicesensis GAR05 | Isolate | Unclassified |
| 381 | 2855683550 | Micromonospora sp. RP3T | Isolate | Unclassified |
| 382 | 2856741275 | Microbispora triticiradicis NEAU-HRDPA2-9 | Isolate | Unclassified |
| 383 | 2856858025 | Micromonospora aurantiaca 110B(2018) | Isolate | Unclassified |
| 384 | 2857288857 | Micromonospora noduli ONO23 | Isolate | Unclassified |
| 385 | 2857481737 | Nocardioides sp. R-74106 | Isolate | Unclassified |
| 386 | 2858848962 | Micromonospora saelicesensis GAR06 | Isolate | Unclassified |
| 387 | 2858868258 | Micromonospora sp. MH33 | Isolate | Unclassified |
| 388 | 2858882152 | Micromonospora noduli MED15 | Isolate | Nodule |
| 389 | 2858888857 | Micromonospora saelicesensis Lupac 06 | Isolate | Unclassified |
| 390 | 2858895516 | Micromonospora saelicesensis PSN13 | Isolate | Unclassified |
| 391 | 2858902515 | Micromonospora sp. MW-13 | Isolate | Rhizosphere |
| 392 | 2862705112 | Streptomyces triticirhizae NEAU-YY642 | Isolate | Rhizosphere |
| 393 | 2866065130 | Micromonospora endophytica DSM 45430 | Isolate | Unclassified |
| 394 | 2866552031 | Saccharopolyspora rhizosphaerae H219 | Isolate | Unclassified |
| 395 | 2867302475 | Micromonospora globbae WPS1-2 | Isolate | Unclassified |
| 396 | 2867312974 | Micromonospora musae NGC1-4 | Isolate | Unclassified |
| 397 | 2867319477 | Micromonospora musae MS1-9 | Isolate | Unclassified |
| 398 | 2867507094 | Micromonospora zingiberis PLAI 1-1 | Isolate | Unclassified |
| 399 | 2869048445 | Micromonospora saelicesensis PSN01 | Isolate | Unclassified |
| 400 | 2869061728 | Micromonospora noduli ONO86 | Isolate | Unclassified |
| 401 | 2869068681 | Micromonospora noduli GUI43 | Isolate | Unclassified |
| 402 | 2880489317 | Micromonospora ureilytica DSM 101692 | Isolate | Unclassified |
| 403 | 2880495981 | Micromonospora vinacea DSM 101695 | Isolate | Unclassified |
| 404 | 2884693830 | Nonomuraea phyllanthi WYY166 | Isolate | Unclassified |
| 405 | 2891395885 | Microbispora catharanthi CR1-09 | Isolate | Unclassified |
| 406 | 2891562705 | Microbispora tritici MT50 | Isolate | Unclassified |
| 407 | 2891968417 | Nocardioides luteus SAI-037 | Isolate | Unclassified |
| 408 | 2895427314 | Nonomuraea sp. PA05 | Isolate | Unclassified |
| 409 | 2895442618 | Nonomuraea phyllanthi PA1-10 | Isolate | Unclassified |
| 410 | 2902582711 | Micromonospora sp. AP08 | Isolate | Unclassified |
| 411 | 2915768154 | Amycolatopsis pittospori PIP199 | Isolate | Unclassified |
| 412 | 2918501144 | Streptomyces sp. PvR006 | Isolate | Rhizosphere |
| 413 | 2919446982 | Phycicoccus sp. 3266 | Isolate | Rhizosphere |
| 414 | 2929219909 | Micromonospora sp. R-75348 Hybrid assembly | Isolate | Unclassified |
| 415 | 2929226422 | Micromonospora sp. R-74116 Hybrid assembly | Isolate | Unclassified |
| 416 | 2954691527 | Streptomyces sp. SAI-127 | Isolate | Rhizosphere |
| 417 | 2954701450 | Streptomyces sp. SAI-144 | Isolate | Rhizosphere |
| 418 | 2984576629 | Nocardioides zeae SORGH_AS913 | Isolate | Aerial Root |
| 419 | 2990256926 | Nocardioides zeae SORGH_AS885 | Isolate | Aerial Root |
| 420 | 2996221748 | Micromonospora veneta CAP181 | Isolate | Unclassified |
| 421 | 3001889506 | Janibacter sp. YIM B02568 | Isolate | Unclassified |
| 422 | 649633069 | Micromonospora sp. L5 | Isolate | Unclassified |
| 423 | 8001781756 | Catellatospora tritici NEAU-YM18 | Isolate | Rhizosphere |
| 424 | 8003830390 | Micromonospora parastrephiae STR1_7 | Isolate | Rhizosphere |
| 425 | 8003856774 | Micromonospora echinofusca MPMI6 | Isolate | Unclassified |
| 426 | 8003870546 | Micromonospora tarensis STR1s_6 | Isolate | Rhizosphere |
| 427 | 8054704163 | Micromonospora trifolii NIE79 | Isolate | Nodule |
| 428 | 8054727385 | Micromonospora alfalfae MED01 | Isolate | Nodule |
| 429 | 8054734606 | Micromonospora hortensis NIE111 | Isolate | Nodule |
| 430 | 8055412473 | Micromonospora phytophila DSM 105363 | Isolate | Nodule |
| 431 | 8056207758 | Saccharopolyspora indica KCTC 29208 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 86.38 |
| Metatranscriptomes | 1 |
| Isolates | 12.61 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.22 |
| Bulb | 0 |
| Endosphere | 5.47 |
| Nodule | 1.34 |
| Rhizoplane | 8.04 |
| Rhizosphere | 72.66 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | nmdc:mga00v17_27702_c1 | 3300050491 | Bacteria | 3311 |
| 2 | JGI24740J21852_10013057 | 3300001979 | Bacteria | 3114 |
| 3 | JGI24737J22298_10053044 | 3300001990 | Bacteria | 1229 |
| 4 | JGI24738J21930_10015359 | 3300002075 | Bacteria | 1630 |
| 5 | JGI24744J21845_10009530 | 3300002077 | Bacteria | 1992 |
| 6 | JGI25406J46586_10000292 | 3300003203 | Bacteria | 22443 |
| 7 | JGI25406J46586_10013791 | 3300003203 | Bacteria | 3456 |
| 8 | JGI25407J50210_10026054 | 3300003373 | Bacteria | 1516 |
| 9 | Ga0006562J51391_1031195 | 3300003578 | Bacteria | 3870 |
| 10 | Ga0070676_10029361 | 3300005328 | Bacteria | 3127 |
| 11 | Ga0070683_100004647 | 3300005329 | Bacteria | 11347 |
| 12 | Ga0070683_100005801 | 3300005329 | Bacteria | 10324 |
| 13 | Ga0070683_100008155 | 3300005329 | Bacteria | 8897 |
| 14 | Ga0070683_100463844 | 3300005329 | Bacteria | 1209 |
| 15 | Ga0070670_100074618 | 3300005331 | Bacteria | 2914 |
| 16 | Ga0068869_100004417 | 3300005334 | Bacteria | 8740 |
| 17 | Ga0068869_100007855 | 3300005334 | Bacteria | 6848 |
| 18 | Ga0068869_100030634 | 3300005334 | Bacteria | 3778 |
| 19 | Ga0070680_100036712 | 3300005336 | Bacteria | 3959 |
| 20 | Ga0070680_100042402 | 3300005336 | Bacteria | 3692 |
| 21 | Ga0070682_100010967 | 3300005337 | Bacteria | 5164 |
| 22 | Ga0070682_100035749 | 3300005337 | Bacteria | 3034 |
| 23 | Ga0070682_100250907 | 3300005337 | Bacteria | 1275 |
| 24 | Ga0068868_100047152 | 3300005338 | Bacteria | 3375 |
| 25 | Ga0068868_100100797 | 3300005338 | Bacteria | 2336 |
| 26 | Ga0068868_100121338 | 3300005338 | Bacteria | 2132 |
| 27 | Ga0070660_100025915 | 3300005339 | Bacteria | 4362 |
| 28 | Ga0070689_100023594 | 3300005340 | Bacteria | 4606 |
| 29 | Ga0070691_10000786 | 3300005341 | Bacteria | 12615 |
| 30 | Ga0070687_100047430 | 3300005343 | Bacteria | 2204 |
| 31 | Ga0070661_100344284 | 3300005344 | Bacteria | 1168 |
| 32 | Ga0070661_100362772 | 3300005344 | Bacteria | 1139 |
| 33 | Ga0070692_10005824 | 3300005345 | Bacteria | 5300 |
| 34 | Ga0070668_100001449 | 3300005347 | Bacteria | 17138 |
| 35 | Ga0070668_100055098 | 3300005347 | Bacteria | 3069 |
| 36 | Ga0070668_100091485 | 3300005347 | Bacteria | 2399 |
| 37 | Ga0070668_100196950 | 3300005347 | Bacteria | 1653 |
| 38 | Ga0070675_100001934 | 3300005354 | Bacteria | 15319 |
| 39 | Ga0070675_100087605 | 3300005354 | Bacteria | 2603 |
| 40 | Ga0070674_100012101 | 3300005356 | Bacteria | 5286 |
| 41 | Ga0070673_100075845 | 3300005364 | Bacteria | 2713 |
| 42 | Ga0070688_100054608 | 3300005365 | Bacteria | 2503 |
| 43 | Ga0070659_100139969 | 3300005366 | Bacteria | 1970 |
| 44 | Ga0070659_100434085 | 3300005366 | Bacteria | 1112 |
| 45 | Ga0070667_100056769 | 3300005367 | Bacteria | 3308 |
| 46 | Ga0070667_100162288 | 3300005367 | Bacteria | 1969 |
| 47 | Ga0070709_10000730 | 3300005434 | Bacteria | 18584 |
| 48 | Ga0070709_10065399 | 3300005434 | Bacteria | 2328 |
| 49 | Ga0070714_100001418 | 3300005435 | Bacteria | 17401 |
| 50 | Ga0070714_100003214 | 3300005435 | Bacteria | 12157 |
| 51 | Ga0070714_100086327 | 3300005435 | Bacteria | 2742 |
| 52 | Ga0070714_100093214 | 3300005435 | Bacteria | 2641 |
| 53 | Ga0070714_100096738 | 3300005435 | Bacteria | 2594 |
| 54 | Ga0070713_100001109 | 3300005436 | Bacteria | 17148 |
| 55 | Ga0070713_100012557 | 3300005436 | Bacteria | 6218 |
| 56 | Ga0070713_100082644 | 3300005436 | Bacteria | 2743 |
| 57 | Ga0070713_100249254 | 3300005436 | Bacteria | 1619 |
| 58 | Ga0070710_10000758 | 3300005437 | Bacteria | 15386 |
| 59 | Ga0070711_100000258 | 3300005439 | Bacteria | 27048 |
| 60 | Ga0070711_100011131 | 3300005439 | Bacteria | 5581 |
| 61 | Ga0070711_100031406 | 3300005439 | Bacteria | 3526 |
| 62 | Ga0070700_100006435 | 3300005441 | Bacteria | 6283 |
| 63 | Ga0070700_100031847 | 3300005441 | Bacteria | 3164 |
| 64 | Ga0070678_100386959 | 3300005456 | Bacteria | 1211 |
| 65 | Ga0070662_100040578 | 3300005457 | Bacteria | 3315 |
| 66 | Ga0070681_10027499 | 3300005458 | Bacteria | 5718 |
| 67 | Ga0070681_10100741 | 3300005458 | Bacteria | 2834 |
| 68 | Ga0068867_100030779 | 3300005459 | Bacteria | 3871 |
| 69 | Ga0070685_10011861 | 3300005466 | Bacteria | 4568 |
| 70 | Ga0070685_10252611 | 3300005466 | Bacteria | 1168 |
| 71 | Ga0070706_100009310 | 3300005467 | Bacteria | 9152 |
| 72 | Ga0070707_100012904 | 3300005468 | Bacteria | 7804 |
| 73 | Ga0070707_100417586 | 3300005468 | Bacteria | 1302 |
| 74 | Ga0070698_100000873 | 3300005471 | Bacteria | 33116 |
| 75 | Ga0070698_100010105 | 3300005471 | Bacteria | 10081 |
| 76 | Ga0070698_100290868 | 3300005471 | Bacteria | 1565 |
| 77 | Ga0070699_100363920 | 3300005518 | Bacteria | 1304 |
| 78 | Ga0070679_100077187 | 3300005530 | Bacteria | 3320 |
| 79 | Ga0070679_100086156 | 3300005530 | Bacteria | 3128 |
| 80 | Ga0070684_100007069 | 3300005535 | Bacteria | 8726 |
| 81 | Ga0070684_100086484 | 3300005535 | Bacteria | 2782 |
| 82 | Ga0070684_100116628 | 3300005535 | Bacteria | 2398 |
| 83 | Ga0070697_100223369 | 3300005536 | Bacteria | 1605 |
| 84 | Ga0070672_100007050 | 3300005543 | Bacteria | 7599 |
| 85 | Ga0070686_100279939 | 3300005544 | Bacteria | 1230 |
| 86 | Ga0070693_100001271 | 3300005547 | Bacteria | 11405 |
| 87 | Ga0070665_100000865 | 3300005548 | Bacteria | 39234 |
| 88 | Ga0070665_100125179 | 3300005548 | Bacteria | 2572 |
| 89 | Ga0068855_100399425 | 3300005563 | Bacteria | 1506 |
| 90 | Ga0070664_100003004 | 3300005564 | Bacteria | 13641 |
| 91 | Ga0070664_100053722 | 3300005564 | Bacteria | 3416 |
| 92 | Ga0070664_100302006 | 3300005564 | Bacteria | 1447 |
| 93 | Ga0068857_100058531 | 3300005577 | Bacteria | 3422 |
| 94 | Ga0068857_100389550 | 3300005577 | Bacteria | 1295 |
| 95 | Ga0068854_100355565 | 3300005578 | Bacteria | 1200 |
| 96 | Ga0068856_100055390 | 3300005614 | Bacteria | 3913 |
| 97 | Ga0068856_100176336 | 3300005614 | Bacteria | 2150 |
| 98 | Ga0068856_100592335 | 3300005614 | Bacteria | 1130 |
| 99 | Ga0070702_100003214 | 3300005615 | Bacteria | 7264 |
| 100 | Ga0070702_100024536 | 3300005615 | Bacteria | 3218 |
| 101 | Ga0070702_100037982 | 3300005615 | Bacteria | 2678 |
| 102 | Ga0068852_100040897 | 3300005616 | Bacteria | 3915 |
| 103 | Ga0068852_100134207 | 3300005616 | Bacteria | 2284 |
| 104 | Ga0068864_100008703 | 3300005618 | Bacteria | 8374 |
| 105 | Ga0068861_100003359 | 3300005719 | Bacteria | 10606 |
| 106 | Ga0068861_100071581 | 3300005719 | Bacteria | 2688 |
| 107 | Ga0068861_100156765 | 3300005719 | Bacteria | 1874 |
| 108 | Ga0068861_100169457 | 3300005719 | Bacteria | 1808 |
| 109 | Ga0068861_100174152 | 3300005719 | Bacteria | 1786 |
| 110 | Ga0068861_100221061 | 3300005719 | Bacteria | 1601 |
| 111 | Ga0068870_10001666 | 3300005840 | Bacteria | 9090 |
| 112 | Ga0068870_10014561 | 3300005840 | Bacteria | 3716 |
| 113 | Ga0068863_100059072 | 3300005841 | Bacteria | 3629 |
| 114 | Ga0068863_100268002 | 3300005841 | Bacteria | 1652 |
| 115 | Ga0068863_100531608 | 3300005841 | Bacteria | 1160 |
| 116 | Ga0068858_100074234 | 3300005842 | Bacteria | 3158 |
| 117 | Ga0068860_100002948 | 3300005843 | Bacteria | 17594 |
| 118 | Ga0068862_100027387 | 3300005844 | Bacteria | 4798 |
| 119 | Ga0081455_10002300 | 3300005937 | Bacteria | 22762 |
| 120 | Ga0081538_10004313 | 3300005981 | Bacteria | 13147 |
| 121 | Ga0081540_1002450 | 3300005983 | Bacteria | 15109 |
| 122 | Ga0081540_1027134 | 3300005983 | Bacteria | 3251 |
| 123 | Ga0081539_10000242 | 3300005985 | Bacteria | 127897 |
| 124 | Ga0081539_10000309 | 3300005985 | Bacteria | 109561 |
| 125 | Ga0081539_10000364 | 3300005985 | Bacteria | 99066 |
| 126 | Ga0081539_10000432 | 3300005985 | Bacteria | 89138 |
| 127 | Ga0081539_10002151 | 3300005985 | Bacteria | 29070 |
| 128 | Ga0081539_10011082 | 3300005985 | Bacteria | 7203 |
| 129 | Ga0081539_10061848 | 3300005985 | Bacteria | 2049 |
| 130 | Ga0081539_10072958 | 3300005985 | Bacteria | 1832 |
| 131 | Ga0081539_10130509 | 3300005985 | Bacteria | 1235 |
| 132 | Ga0070717_10039960 | 3300006028 | Bacteria | 3819 |
| 133 | Ga0070717_10104318 | 3300006028 | Bacteria | 2411 |
| 134 | Ga0070717_10233674 | 3300006028 | Bacteria | 1619 |
| 135 | Ga0075365_10002795 | 3300006038 | Bacteria | 8733 |
| 136 | Ga0075365_10014617 | 3300006038 | Bacteria | 4727 |
| 137 | Ga0075365_10019311 | 3300006038 | Bacteria | 4205 |
| 138 | Ga0075365_10048059 | 3300006038 | Bacteria | 2807 |
| 139 | Ga0075365_10050831 | 3300006038 | Bacteria | 2735 |
| 140 | Ga0075365_10112275 | 3300006038 | Bacteria | 1874 |
| 141 | Ga0075368_10013839 | 3300006042 | Bacteria | 2968 |
| 142 | Ga0075363_100011776 | 3300006048 | Bacteria | 4197 |
| 143 | Ga0075363_100085513 | 3300006048 | Bacteria | 1730 |
| 144 | Ga0075364_10005194 | 3300006051 | Bacteria | 7553 |
| 145 | Ga0075364_10007061 | 3300006051 | Bacteria | 6640 |
| 146 | Ga0075364_10022871 | 3300006051 | Bacteria | 3953 |
| 147 | Ga0070715_10025138 | 3300006163 | Bacteria | 2355 |
| 148 | Ga0070716_100000222 | 3300006173 | Bacteria | 22754 |
| 149 | Ga0070716_100051297 | 3300006173 | Bacteria | 2345 |
| 150 | Ga0070712_100002878 | 3300006175 | Bacteria | 10665 |
| 151 | Ga0070712_100017672 | 3300006175 | Bacteria | 4619 |
| 152 | Ga0070712_100152350 | 3300006175 | Bacteria | 1776 |
| 153 | Ga0075362_10100786 | 3300006177 | Bacteria | 1350 |
| 154 | Ga0075367_10131479 | 3300006178 | Bacteria | 1547 |
| 155 | Ga0097621_100017517 | 3300006237 | Bacteria | 5442 |
| 156 | Ga0075370_10008069 | 3300006353 | Bacteria | 5402 |
| 157 | Ga0075370_10074475 | 3300006353 | Bacteria | 1946 |
| 158 | Ga0075370_10082575 | 3300006353 | Bacteria | 1848 |
| 159 | Ga0075370_10082750 | 3300006353 | Bacteria | 1846 |
| 160 | Ga0068871_100042638 | 3300006358 | Bacteria | 3644 |
| 161 | Ga0075428_100001979 | 3300006844 | Bacteria | 22079 |
| 162 | Ga0075428_100060371 | 3300006844 | Bacteria | 4152 |
| 163 | Ga0075428_100413186 | 3300006844 | Bacteria | 1446 |
| 164 | Ga0075428_100529093 | 3300006844 | Bacteria | 1261 |
| 165 | Ga0075430_100000695 | 3300006846 | Bacteria | 25646 |
| 166 | Ga0075430_100007157 | 3300006846 | Bacteria | 9416 |
| 167 | Ga0075430_100037236 | 3300006846 | Bacteria | 4124 |
| 168 | Ga0075430_100292250 | 3300006846 | Bacteria | 1348 |
| 169 | Ga0075431_100001519 | 3300006847 | Bacteria | 21504 |
| 170 | Ga0075433_10004134 | 3300006852 | Bacteria | 11257 |
| 171 | Ga0075434_100016397 | 3300006871 | Bacteria | 7122 |
| 172 | Ga0075429_100030614 | 3300006880 | Bacteria | 4675 |
| 173 | Ga0075429_100132629 | 3300006880 | Bacteria | 2180 |
| 174 | Ga0075429_100143626 | 3300006880 | Bacteria | 2089 |
| 175 | Ga0068865_100269844 | 3300006881 | Bacteria | 1350 |
| 176 | Ga0075436_100009165 | 3300006914 | Bacteria | 6771 |
| 177 | Ga0099826_10146979 | 3300006948 | Bacteria | 1353 |
| 178 | Ga0075435_100003716 | 3300007076 | Bacteria | 10395 |
| 179 | Ga0105251_10034559 | 3300009011 | Bacteria | 2500 |
| 180 | Ga0111539_10001333 | 3300009094 | Bacteria | 32890 |
| 181 | Ga0111539_10018630 | 3300009094 | Bacteria | 8599 |
| 182 | Ga0111539_10020393 | 3300009094 | Bacteria | 8164 |
| 183 | Ga0105245_10033111 | 3300009098 | Bacteria | 4578 |
| 184 | Ga0105245_10038998 | 3300009098 | Bacteria | 4227 |
| 185 | Ga0105245_10040802 | 3300009098 | Bacteria | 4136 |
| 186 | Ga0105245_10186878 | 3300009098 | Bacteria | 1983 |
| 187 | Ga0105245_10388489 | 3300009098 | Bacteria | 1392 |
| 188 | Ga0105245_10664751 | 3300009098 | Bacteria | 1073 |
| 189 | Ga0105247_10093560 | 3300009101 | Bacteria | 1911 |
| 190 | Ga0114129_10000004 | 3300009147 | Bacteria | 160944 |
| 191 | Ga0114129_10006456 | 3300009147 | Bacteria | 16627 |
| 192 | Ga0114129_10043613 | 3300009147 | Bacteria | 6310 |
| 193 | Ga0114129_10214596 | 3300009147 | Bacteria | 2599 |
| 194 | Ga0114129_10359379 | 3300009147 | Bacteria | 1927 |
| 195 | Ga0105243_10038026 | 3300009148 | Bacteria | 3746 |
| 196 | Ga0105243_10107924 | 3300009148 | Bacteria | 2323 |
| 197 | Ga0105243_10177597 | 3300009148 | Bacteria | 1849 |
| 198 | Ga0105243_10221577 | 3300009148 | Bacteria | 1672 |
| 199 | Ga0105241_10012537 | 3300009174 | Bacteria | 6217 |
| 200 | Ga0105242_10008355 | 3300009176 | Bacteria | 7954 |
| 201 | Ga0105242_10297798 | 3300009176 | Bacteria | 1471 |
| 202 | Ga0105248_10156267 | 3300009177 | Bacteria | 2574 |
| 203 | Ga0105248_10775350 | 3300009177 | Bacteria | 1082 |
| 204 | Ga0105238_10103081 | 3300009551 | Bacteria | 2835 |
| 205 | Ga0105238_10107440 | 3300009551 | Bacteria | 2771 |
| 206 | Ga0105238_10109399 | 3300009551 | Bacteria | 2745 |
| 207 | Ga0105249_10077640 | 3300009553 | Bacteria | 3080 |
| 208 | Ga0105249_10411564 | 3300009553 | Bacteria | 1384 |
| 209 | Ga0105249_10431293 | 3300009553 | Bacteria | 1354 |
| 210 | Ga0105239_10003785 | 3300010375 | Bacteria | 18414 |
| 211 | Ga0105239_10012969 | 3300010375 | Bacteria | 9271 |
| 212 | Ga0105239_10148897 | 3300010375 | Bacteria | 2612 |
| 213 | Ga0105239_10151037 | 3300010375 | Bacteria | 2592 |
| 214 | Ga0105239_10432819 | 3300010375 | Bacteria | 1491 |
| 215 | Ga0105246_10003633 | 3300011119 | Bacteria | 9335 |
| 216 | Ga0105246_10006396 | 3300011119 | Bacteria | 7196 |
| 217 | Ga0105246_10092926 | 3300011119 | Bacteria | 2178 |
| 218 | Ga0157373_10016101 | 3300013100 | Bacteria | 5457 |
| 219 | Ga0157370_10046884 | 3300013104 | Bacteria | 4143 |
| 220 | Ga0157369_10198568 | 3300013105 | Bacteria | 2106 |
| 221 | Ga0157374_10017524 | 3300013296 | Bacteria | 6307 |
| 222 | Ga0157374_10570838 | 3300013296 | Bacteria | 1140 |
| 223 | Ga0157378_10077003 | 3300013297 | Bacteria | 3006 |
| 224 | Ga0163162_10021224 | 3300013306 | Bacteria | 6391 |
| 225 | Ga0157372_10014846 | 3300013307 | Bacteria | 8340 |
| 226 | Ga0157372_10091076 | 3300013307 | Bacteria | 3468 |
| 227 | Ga0157372_10108184 | 3300013307 | Bacteria | 3181 |
| 228 | Ga0157372_10184171 | 3300013307 | Bacteria | 2418 |
| 229 | Ga0157372_10373283 | 3300013307 | Bacteria | 1662 |
| 230 | Ga0157372_10422006 | 3300013307 | Bacteria | 1554 |
| 231 | Ga0157375_10035766 | 3300013308 | Bacteria | 4744 |
| 232 | Ga0157375_10036473 | 3300013308 | Bacteria | 4704 |
| 233 | Ga0157375_10052070 | 3300013308 | Bacteria | 4023 |
| 234 | Ga0157375_10102461 | 3300013308 | Bacteria | 2947 |
| 235 | Ga0157375_10158717 | 3300013308 | Bacteria | 2402 |
| 236 | Ga0163163_10006777 | 3300014325 | Bacteria | 10044 |
| 237 | Ga0163163_10021647 | 3300014325 | Bacteria | 6071 |
| 238 | Ga0163163_10215448 | 3300014325 | Bacteria | 1969 |
| 239 | Ga0163163_10412449 | 3300014325 | Bacteria | 1409 |
| 240 | Ga0157380_10008910 | 3300014326 | Bacteria | 7168 |
| 241 | Ga0157380_10045751 | 3300014326 | Bacteria | 3436 |
| 242 | Ga0157380_10361590 | 3300014326 | Bacteria | 1362 |
| 243 | Ga0182008_10027037 | 3300014497 | Bacteria | 2908 |
| 244 | Ga0157377_10007388 | 3300014745 | Bacteria | 5304 |
| 245 | Ga0157377_10044663 | 3300014745 | Bacteria | 2471 |
| 246 | Ga0157379_10008327 | 3300014968 | Bacteria | 9013 |
| 247 | Ga0157379_10025457 | 3300014968 | Bacteria | 5256 |
| 248 | Ga0157379_10050511 | 3300014968 | Bacteria | 3712 |
| 249 | Ga0163161_10076375 | 3300017792 | Bacteria | 2459 |
| 250 | Ga0163161_10234808 | 3300017792 | Bacteria | 1424 |
| 251 | Ga0197907_10762486 | 3300020069 | Bacteria | 2078 |
| 252 | Ga0206356_11171474 | 3300020070 | Bacteria | 1926 |
| 253 | Ga0206356_11313232 | 3300020070 | Bacteria | 1286 |
| 254 | Ga0206354_10671360 | 3300020081 | Bacteria | 2201 |
| 255 | Ga0206353_10204676 | 3300020082 | Bacteria | 2639 |
| 256 | Ga0206353_11294495 | 3300020082 | Bacteria | 1668 |
| 257 | Ga0206353_11492747 | 3300020082 | Bacteria | 1663 |
| 258 | Ga0224712_10073948 | 3300022467 | Bacteria | 1391 |
| 259 | Ga0207697_10034184 | 3300025315 | Bacteria | 2081 |
| 260 | Ga0207692_10000647 | 3300025898 | Bacteria | 12254 |
| 261 | Ga0207692_10001433 | 3300025898 | Bacteria | 8929 |
| 262 | Ga0207642_10047548 | 3300025899 | Bacteria | 1918 |
| 263 | Ga0207710_10026262 | 3300025900 | Bacteria | 2516 |
| 264 | Ga0207688_10043207 | 3300025901 | Bacteria | 2509 |
| 265 | Ga0207647_10077146 | 3300025904 | Bacteria | 2003 |
| 266 | Ga0207647_10095249 | 3300025904 | Bacteria | 1772 |
| 267 | Ga0207685_10014863 | 3300025905 | Bacteria | 2449 |
| 268 | Ga0207699_10000105 | 3300025906 | Bacteria | 59026 |
| 269 | Ga0207699_10009084 | 3300025906 | Bacteria | 4933 |
| 270 | Ga0207699_10235174 | 3300025906 | Bacteria | 1256 |
| 271 | Ga0207645_10021076 | 3300025907 | Bacteria | 4254 |
| 272 | Ga0207643_10000266 | 3300025908 | Bacteria | 36491 |
| 273 | Ga0207643_10016651 | 3300025908 | Bacteria | 4010 |
| 274 | Ga0207705_10023065 | 3300025909 | Bacteria | 4439 |
| 275 | Ga0207705_10057392 | 3300025909 | Bacteria | 2807 |
| 276 | Ga0207705_10110225 | 3300025909 | Bacteria | 2033 |
| 277 | Ga0207705_10216708 | 3300025909 | Bacteria | 1453 |
| 278 | Ga0207684_10037605 | 3300025910 | Bacteria | 4107 |
| 279 | Ga0207654_10021268 | 3300025911 | Bacteria | 3448 |
| 280 | Ga0207671_10046657 | 3300025914 | Bacteria | 3206 |
| 281 | Ga0207693_10001586 | 3300025915 | Bacteria | 20116 |
| 282 | Ga0207693_10085842 | 3300025915 | Bacteria | 2466 |
| 283 | Ga0207693_10293625 | 3300025915 | Bacteria | 1274 |
| 284 | Ga0207663_10000974 | 3300025916 | Bacteria | 13097 |
| 285 | Ga0207663_10008863 | 3300025916 | Bacteria | 5289 |
| 286 | Ga0207662_10016637 | 3300025918 | Bacteria | 4152 |
| 287 | Ga0207657_10040954 | 3300025919 | Bacteria | 4101 |
| 288 | Ga0207657_10145587 | 3300025919 | Bacteria | 1933 |
| 289 | Ga0207657_10149793 | 3300025919 | Bacteria | 1901 |
| 290 | Ga0207657_10226442 | 3300025919 | Bacteria | 1496 |
| 291 | Ga0207657_10235906 | 3300025919 | Bacteria | 1462 |
| 292 | Ga0207649_10301760 | 3300025920 | Bacteria | 1171 |
| 293 | Ga0207652_10011619 | 3300025921 | Bacteria | 7104 |
| 294 | Ga0207652_10126230 | 3300025921 | Bacteria | 2279 |
| 295 | Ga0207652_10131084 | 3300025921 | Bacteria | 2236 |
| 296 | Ga0207646_10019452 | 3300025922 | Bacteria | 6311 |
| 297 | Ga0207681_10217217 | 3300025923 | Bacteria | 1477 |
| 298 | Ga0207694_10159529 | 3300025924 | Bacteria | 1821 |
| 299 | Ga0207694_10188456 | 3300025924 | Bacteria | 1675 |
| 300 | Ga0207694_10229469 | 3300025924 | Bacteria | 1516 |
| 301 | Ga0207650_10023213 | 3300025925 | Bacteria | 4398 |
| 302 | Ga0207650_10142999 | 3300025925 | Bacteria | 1882 |
| 303 | Ga0207659_10002694 | 3300025926 | Bacteria | 10582 |
| 304 | Ga0207659_10057964 | 3300025926 | Bacteria | 2779 |
| 305 | Ga0207687_10009504 | 3300025927 | Bacteria | 6359 |
| 306 | Ga0207687_10071750 | 3300025927 | Bacteria | 2475 |
| 307 | Ga0207687_10087367 | 3300025927 | Bacteria | 2266 |
| 308 | Ga0207687_10121432 | 3300025927 | Bacteria | 1955 |
| 309 | Ga0207700_10000050 | 3300025928 | Bacteria | 79672 |
| 310 | Ga0207700_10018417 | 3300025928 | Bacteria | 4690 |
| 311 | Ga0207700_10022556 | 3300025928 | Bacteria | 4323 |
| 312 | Ga0207700_10044776 | 3300025928 | Bacteria | 3260 |
| 313 | Ga0207700_10060570 | 3300025928 | Bacteria | 2867 |
| 314 | Ga0207700_10175913 | 3300025928 | Bacteria | 1789 |
| 315 | Ga0207700_10230220 | 3300025928 | Bacteria | 1575 |
| 316 | Ga0207664_10000101 | 3300025929 | Bacteria | 79541 |
| 317 | Ga0207664_10007144 | 3300025929 | Bacteria | 7743 |
| 318 | Ga0207664_10017629 | 3300025929 | Bacteria | 5240 |
| 319 | Ga0207664_10097734 | 3300025929 | Bacteria | 2419 |
| 320 | Ga0207664_10185217 | 3300025929 | Bacteria | 1789 |
| 321 | Ga0207690_10019361 | 3300025932 | Bacteria | 4190 |
| 322 | Ga0207690_10025788 | 3300025932 | Bacteria | 3696 |
| 323 | Ga0207690_10065270 | 3300025932 | Bacteria | 2489 |
| 324 | Ga0207690_10361687 | 3300025932 | Bacteria | 1150 |
| 325 | Ga0207706_10082442 | 3300025933 | Bacteria | 2827 |
| 326 | Ga0207706_10248374 | 3300025933 | Bacteria | 1555 |
| 327 | Ga0207686_10065573 | 3300025934 | Bacteria | 2316 |
| 328 | Ga0207709_10017261 | 3300025935 | Bacteria | 4026 |
| 329 | Ga0207709_10079021 | 3300025935 | Bacteria | 2114 |
| 330 | Ga0207709_10103639 | 3300025935 | Bacteria | 1886 |
| 331 | Ga0207704_10022390 | 3300025938 | Bacteria | 3384 |
| 332 | Ga0207665_10000438 | 3300025939 | Bacteria | 28608 |
| 333 | Ga0207665_10018949 | 3300025939 | Bacteria | 4522 |
| 334 | Ga0207665_10332814 | 3300025939 | Bacteria | 1142 |
| 335 | Ga0207691_10009955 | 3300025940 | Bacteria | 9129 |
| 336 | Ga0207711_10099802 | 3300025941 | Bacteria | 2567 |
| 337 | Ga0207689_10005945 | 3300025942 | Bacteria | 10800 |
| 338 | Ga0207689_10023007 | 3300025942 | Bacteria | 5235 |
| 339 | Ga0207689_10034638 | 3300025942 | Bacteria | 4193 |
| 340 | Ga0207689_10051566 | 3300025942 | Bacteria | 3392 |
| 341 | Ga0207661_10016968 | 3300025944 | Bacteria | 5379 |
| 342 | Ga0207661_10070708 | 3300025944 | Bacteria | 2849 |
| 343 | Ga0207661_10114313 | 3300025944 | Bacteria | 2288 |
| 344 | Ga0207661_10260453 | 3300025944 | Bacteria | 1545 |
| 345 | Ga0207679_10003607 | 3300025945 | Bacteria | 9602 |
| 346 | Ga0207679_10022957 | 3300025945 | Bacteria | 4257 |
| 347 | Ga0207679_10117094 | 3300025945 | Bacteria | 2114 |
| 348 | Ga0207679_10375340 | 3300025945 | Bacteria | 1245 |
| 349 | Ga0207667_10294029 | 3300025949 | Bacteria | 1659 |
| 350 | Ga0207712_10200627 | 3300025961 | Bacteria | 1582 |
| 351 | Ga0207668_10007739 | 3300025972 | Bacteria | 6393 |
| 352 | Ga0207668_10059087 | 3300025972 | Bacteria | 2684 |
| 353 | Ga0207658_10043314 | 3300025986 | Bacteria | 3271 |
| 354 | Ga0207658_10163869 | 3300025986 | Bacteria | 1824 |
| 355 | Ga0207703_10019676 | 3300026035 | Bacteria | 5276 |
| 356 | Ga0207703_10034448 | 3300026035 | Bacteria | 4018 |
| 357 | Ga0207703_10058854 | 3300026035 | Bacteria | 3138 |
| 358 | Ga0207703_10365782 | 3300026035 | Bacteria | 1331 |
| 359 | Ga0207639_10166611 | 3300026041 | Bacteria | 1862 |
| 360 | Ga0207639_10239783 | 3300026041 | Bacteria | 1576 |
| 361 | Ga0207678_10006802 | 3300026067 | Bacteria | 10142 |
| 362 | Ga0207678_10337463 | 3300026067 | Bacteria | 1298 |
| 363 | Ga0207678_10455440 | 3300026067 | Bacteria | 1112 |
| 364 | Ga0207708_10001687 | 3300026075 | Bacteria | 16343 |
| 365 | Ga0207708_10005591 | 3300026075 | Bacteria | 9276 |
| 366 | Ga0207708_10005711 | 3300026075 | Bacteria | 9199 |
| 367 | Ga0207708_10091674 | 3300026075 | Bacteria | 2344 |
| 368 | Ga0207702_10021114 | 3300026078 | Bacteria | 5388 |
| 369 | Ga0207702_10586640 | 3300026078 | Bacteria | 1093 |
| 370 | Ga0207641_10082434 | 3300026088 | Bacteria | 2794 |
| 371 | Ga0207648_10014220 | 3300026089 | Bacteria | 7361 |
| 372 | Ga0207676_10077191 | 3300026095 | Bacteria | 2694 |
| 373 | Ga0207676_10215357 | 3300026095 | Bacteria | 1707 |
| 374 | Ga0207674_10021159 | 3300026116 | Bacteria | 7011 |
| 375 | Ga0207674_10068057 | 3300026116 | Bacteria | 3584 |
| 376 | Ga0207675_100001326 | 3300026118 | Bacteria | 24790 |
| 377 | Ga0207675_100054352 | 3300026118 | Bacteria | 3735 |
| 378 | Ga0207675_100079519 | 3300026118 | Bacteria | 3072 |
| 379 | Ga0207683_10002454 | 3300026121 | Bacteria | 16159 |
| 380 | Ga0207683_10032234 | 3300026121 | Bacteria | 4552 |
| 381 | Ga0207683_10462200 | 3300026121 | Bacteria | 1170 |
| 382 | Ga0207698_10054957 | 3300026142 | Bacteria | 3066 |
| 383 | Ga0207698_10112687 | 3300026142 | Bacteria | 2284 |
| 384 | Ga0207698_10146953 | 3300026142 | Bacteria | 2040 |
| 385 | Ga0207698_10292162 | 3300026142 | Bacteria | 1513 |
| 386 | Ga0209813_10002979 | 3300027866 | Bacteria | 3923 |
| 387 | Ga0209813_10023193 | 3300027866 | Bacteria | 1763 |
| 388 | Ga0207428_10021038 | 3300027907 | Bacteria | 5530 |
| 389 | Ga0207428_10022520 | 3300027907 | Bacteria | 5315 |
| 390 | Ga0207428_10102029 | 3300027907 | Bacteria | 2216 |
| 391 | Ga0268266_10001844 | 3300028379 | Bacteria | 23906 |
| 392 | Ga0268266_10052473 | 3300028379 | Bacteria | 3502 |
| 393 | Ga0268265_10011282 | 3300028380 | Bacteria | 6041 |
| 394 | Ga0268265_10143120 | 3300028380 | Bacteria | 2005 |
| 395 | Ga0268264_10000843 | 3300028381 | Bacteria | 32793 |
| 396 | Ga0307515_10004732 | 3300028794 | Bacteria | 27881 |
| 397 | Ga0307515_10006082 | 3300028794 | Bacteria | 24274 |
| 398 | Ga0307515_10033914 | 3300028794 | Bacteria | 8384 |
| 399 | Ga0307515_10164924 | 3300028794 | Bacteria | 2238 |
| 400 | Ga0307512_10002870 | 3300030522 | Bacteria | 20931 |
| 401 | Ga0307512_10025175 | 3300030522 | Bacteria | 5279 |
| 402 | Ga0307512_10036229 | 3300030522 | Bacteria | 4188 |
| 403 | Ga0307512_10184528 | 3300030522 | Bacteria | 1164 |
| 404 | Ga0316181_1035113 | 3300030744 | Bacteria | 2279 |
| 405 | Ga0265340_10001409 | 3300031247 | Bacteria | 13798 |
| 406 | Ga0307513_10002952 | 3300031456 | Bacteria | 23213 |
| 407 | Ga0307513_10026296 | 3300031456 | Bacteria | 6714 |
| 408 | Ga0307509_10111188 | 3300031507 | Bacteria | 2743 |
| 409 | Ga0307508_10002257 | 3300031616 | Bacteria | 20546 |
| 410 | Ga0307508_10003547 | 3300031616 | Bacteria | 15728 |
| 411 | Ga0307508_10053689 | 3300031616 | Bacteria | 3575 |
| 412 | Ga0316579_10000044 | 3300031691 | Bacteria | 29147 |
| 413 | Ga0307516_10045590 | 3300031730 | Bacteria | 4329 |
| 414 | Ga0307405_10165852 | 3300031731 | Bacteria | 1570 |
| 415 | Ga0307405_10223037 | 3300031731 | Bacteria | 1384 |
| 416 | Ga0307413_10008060 | 3300031824 | Bacteria | 4944 |
| 417 | Ga0307518_10000881 | 3300031838 | Bacteria | 22336 |
| 418 | Ga0307406_10205474 | 3300031901 | Bacteria | 1453 |
| 419 | Ga0307407_10183510 | 3300031903 | Bacteria | 1388 |
| 420 | Ga0307412_10053470 | 3300031911 | Bacteria | 2677 |
| 421 | Ga0307409_100003217 | 3300031995 | Bacteria | 8794 |
| 422 | Ga0307409_100038828 | 3300031995 | Bacteria | 3526 |
| 423 | Ga0307409_100046820 | 3300031995 | Bacteria | 3277 |
| 424 | Ga0307409_100093198 | 3300031995 | Bacteria | 2474 |
| 425 | Ga0307409_100183809 | 3300031995 | Bacteria | 1853 |
| 426 | Ga0307409_100198635 | 3300031995 | Bacteria | 1792 |
| 427 | Ga0307409_100261862 | 3300031995 | Bacteria | 1587 |
| 428 | Ga0307409_100268807 | 3300031995 | Bacteria | 1569 |
| 429 | Ga0307409_100329893 | 3300031995 | Bacteria | 1431 |
| 430 | Ga0307409_100330958 | 3300031995 | Bacteria | 1429 |
| 431 | Ga0307409_100348258 | 3300031995 | Bacteria | 1397 |
| 432 | Ga0307416_100076339 | 3300032002 | Bacteria | 2808 |
| 433 | Ga0307415_100021568 | 3300032126 | Bacteria | 3962 |
| 434 | Ga0307415_100102202 | 3300032126 | Bacteria | 2105 |
| 435 | Ga0307507_10014573 | 3300033179 | Bacteria | 9354 |
| 436 | Ga0373938_0016312 | 3300034957 | Bacteria | 1450 |
| 437 | Ga0373940_0001013 | 3300035088 | Bacteria | 4822 |
| 438 | Ga0373951_0000551 | 3300035091 | Bacteria | 10513 |
| 439 | Ga0373939_0057071 | 3300035114 | Bacteria | 1231 |
| 440 | Ga0373956_0005334 | 3300035119 | Bacteria | 5144 |
| 441 | Ga0373942_0005546 | 3300035207 | Bacteria | 2924 |
| 442 | Ga0316582_0118947 | 3300036647 | Bacteria | 1766 |
| 443 | Ga0395899_0025224 | 3300037312 | Bacteria | 4489 |
| 444 | Ga0395899_0069230 | 3300037312 | Bacteria | 2585 |
| 445 | Ga0395899_0141525 | 3300037312 | Bacteria | 1711 |
| 446 | Ga0395900_0101168 | 3300037418 | Bacteria | 2960 |
| 447 | Ga0395900_0130670 | 3300037418 | Bacteria | 2574 |
| 448 | Ga0395898_0037833 | 3300037466 | Bacteria | 4784 |
| 449 | Ga0395898_0051195 | 3300037466 | Bacteria | 4039 |
| 450 | Ga0395898_0099430 | 3300037466 | Bacteria | 2793 |
| 451 | Ga0395898_0217984 | 3300037466 | Bacteria | 1820 |
| 452 | Ga0395898_0330401 | 3300037466 | Bacteria | 1454 |
| 453 | Ga0395898_0423700 | 3300037466 | Bacteria | 1268 |
| 454 | Ga0395905_0169425 | 3300037471 | Bacteria | 2051 |
| 455 | Ga0395905_0502938 | 3300037471 | Bacteria | 1112 |
| 456 | Ga0316581_0001724 | 3300037588 | Bacteria | 5032 |
| 457 | Ga0395901_0024894 | 3300038443 | Bacteria | 6144 |
| 458 | Ga0395901_0062734 | 3300038443 | Bacteria | 3867 |
| 459 | Ga0395901_0072718 | 3300038443 | Bacteria | 3585 |
| 460 | Ga0395901_0106362 | 3300038443 | Bacteria | 2945 |
| 461 | Ga0395901_0303452 | 3300038443 | Bacteria | 1655 |
| 462 | Ga0395901_0571668 | 3300038443 | Bacteria | 1143 |
| 463 | Ga0400488_58753 | 3300038741 | Bacteria | 4845 |
| 464 | Ga0400486_24036 | 3300038742 | Bacteria | 3993 |
| 465 | Ga0436365_0829147 | 3300039437 | Bacteria | 2612 |
| 466 | Ga0436363_1319502 | 3300039450 | Bacteria | 2943 |
| 467 | Ga0439436_0000284 | 3300041404 | Bacteria | 12273 |
| 468 | Ga0439436_0057235 | 3300041404 | Bacteria | 1094 |
| 469 | Ga0439439_0020821 | 3300041406 | Bacteria | 1632 |
| 470 | Ga0451791_0528520 | 3300041451 | Bacteria | 1065 |
| 471 | Ga0451853_0209873 | 3300041512 | Bacteria | 3706 |
| 472 | Ga0451853_0556300 | 3300041512 | Bacteria | 4275 |
| 473 | Ga0451853_0639474 | 3300041512 | Bacteria | 3340 |
| 474 | Ga0451853_0656156 | 3300041512 | Bacteria | 1817 |
| 475 | Ga0451853_0776115 | 3300041512 | Bacteria | 2204 |
| 476 | Ga0451853_2948900 | 3300041512 | Bacteria | 22669 |
| 477 | Ga0439433_0001529 | 3300041999 | Bacteria | 4789 |
| 478 | Ga0439442_004161 | 3300042002 | Bacteria | 2869 |
| 479 | Ga0439449_0000051 | 3300042007 | Bacteria | 35687 |
| 480 | Ga0439449_0008738 | 3300042007 | Bacteria | 3843 |
| 481 | Ga0439457_000011 | 3300042014 | Bacteria | 39610 |
| 482 | Ga0439446_0006528 | 3300042156 | Bacteria | 3045 |
| 483 | Ga0439464_0011014 | 3300042439 | Bacteria | 2391 |
| 484 | Ga0466972_0050656 | 3300044658 | Bacteria | 2004 |
| 485 | Ga0466965_0026233 | 3300044683 | Bacteria | 2824 |
| 486 | Ga0466965_0048968 | 3300044683 | Bacteria | 2094 |
| 487 | Ga0466965_0131867 | 3300044683 | Bacteria | 1296 |
| 488 | Ga0466965_0195020 | 3300044683 | Bacteria | 1072 |
| 489 | Ga0466966_0009724 | 3300044684 | Bacteria | 6369 |
| 490 | Ga0466961_0116288 | 3300044693 | Bacteria | 1681 |
| 491 | Ga0466961_0143244 | 3300044693 | Bacteria | 1495 |
| 492 | Ga0466961_0182530 | 3300044693 | Bacteria | 1302 |
| 493 | Ga0466961_0235549 | 3300044693 | Bacteria | 1126 |
| 494 | Ga0466963_0083383 | 3300044694 | Bacteria | 2168 |
| 495 | Ga0466963_0122107 | 3300044694 | Bacteria | 1794 |
| 496 | Ga0466963_0165693 | 3300044694 | Bacteria | 1539 |
| 497 | Ga0466963_0193678 | 3300044694 | Bacteria | 1420 |
| 498 | Ga0466963_0279889 | 3300044694 | Bacteria | 1172 |
| 499 | Ga0466964_0005611 | 3300044706 | Bacteria | 4663 |
| 500 | Ga0466964_0016714 | 3300044706 | Bacteria | 2803 |
| 501 | Ga0466964_0111361 | 3300044706 | Bacteria | 1221 |
| 502 | Ga0466971_0057803 | 3300044719 | Bacteria | 1750 |
| 503 | Ga0466971_0122109 | 3300044719 | Bacteria | 1206 |
| 504 | Ga0466970_0007602 | 3300044765 | Bacteria | 5433 |
| 505 | Ga0466970_0012339 | 3300044765 | Bacteria | 4367 |
| 506 | Ga0466970_0026283 | 3300044765 | Bacteria | 3051 |
| 507 | Ga0466970_0051390 | 3300044765 | Bacteria | 2199 |
| 508 | Ga0466970_0080724 | 3300044765 | Bacteria | 1758 |
| 509 | Ga0466970_0114429 | 3300044765 | Bacteria | 1474 |
| 510 | Ga0466957_0006638 | 3300044842 | Bacteria | 6542 |
| 511 | Ga0466957_0008346 | 3300044842 | Bacteria | 5889 |
| 512 | Ga0466957_0030678 | 3300044842 | Bacteria | 3210 |
| 513 | Ga0466957_0158849 | 3300044842 | Bacteria | 1467 |
| 514 | Ga0466957_0222468 | 3300044842 | Bacteria | 1247 |
| 515 | Ga0466957_0224772 | 3300044842 | Bacteria | 1241 |
| 516 | Ga0466960_0005547 | 3300044901 | Bacteria | 5003 |
| 517 | Ga0466960_0005570 | 3300044901 | Bacteria | 4994 |
| 518 | Ga0466960_0020278 | 3300044901 | Bacteria | 2942 |
| 519 | Ga0466960_0023329 | 3300044901 | Bacteria | 2777 |
| 520 | Ga0466960_0026932 | 3300044901 | Bacteria | 2617 |
| 521 | Ga0466960_0043999 | 3300044901 | Bacteria | 2127 |
| 522 | Ga0466960_0044966 | 3300044901 | Bacteria | 2107 |
| 523 | Ga0466960_0059540 | 3300044901 | Bacteria | 1869 |
| 524 | Ga0466960_0100770 | 3300044901 | Bacteria | 1487 |
| 525 | Ga0466960_0117854 | 3300044901 | Bacteria | 1387 |
| 526 | Ga0466958_0121481 | 3300045836 | Bacteria | 1635 |
| 527 | Ga0466958_0121843 | 3300045836 | Bacteria | 1633 |
| 528 | Ga0466967_0001211 | 3300045976 | Bacteria | 14529 |
| 529 | Ga0466967_0010788 | 3300045976 | Bacteria | 6874 |
| 530 | Ga0466967_0022027 | 3300045976 | Bacteria | 5190 |
| 531 | Ga0466967_0033393 | 3300045976 | Bacteria | 4355 |
| 532 | Ga0466967_0036849 | 3300045976 | Bacteria | 4180 |
| 533 | Ga0466967_0047816 | 3300045976 | Bacteria | 3731 |
| 534 | Ga0466967_0090662 | 3300045976 | Bacteria | 2777 |
| 535 | Ga0466967_0196689 | 3300045976 | Bacteria | 1908 |
| 536 | Ga0466967_0468921 | 3300045976 | Bacteria | 1232 |
| 537 | Ga0466967_0521901 | 3300045976 | Bacteria | 1167 |
| 538 | Ga0495629_0254864 | 3300046459 | Bacteria | 1207 |
| 539 | Ga0495641_0056215 | 3300046461 | Bacteria | 1784 |
| 540 | Ga0495653_0303640 | 3300046463 | Bacteria | 1040 |
| 541 | Ga0495664_0153612 | 3300046477 | Bacteria | 1396 |
| 542 | Ga0495664_0173097 | 3300046477 | Bacteria | 1309 |
| 543 | Ga0495608_0123062 | 3300046511 | Bacteria | 1663 |
| 544 | Ga0495618_0031281 | 3300046514 | Bacteria | 3329 |
| 545 | Ga0495632_0055592 | 3300046519 | Bacteria | 1937 |
| 546 | Ga0495652_0196469 | 3300046529 | Bacteria | 1535 |
| 547 | Ga0495640_0208403 | 3300046533 | Bacteria | 1237 |
| 548 | Ga0495657_0169212 | 3300046675 | Bacteria | 1347 |
| 549 | Ga0495658_0044687 | 3300046683 | Bacteria | 2483 |
| 550 | Ga0495658_0103623 | 3300046683 | Bacteria | 1702 |
| 551 | Ga0495600_0186282 | 3300046809 | Bacteria | 1336 |
| 552 | Ga0496100_0026145 | 3300048903 | Bacteria | 3576 |
| 553 | Ga0496100_0110542 | 3300048903 | Bacteria | 1908 |
| 554 | Ga0496100_0112604 | 3300048903 | Bacteria | 1893 |
| 555 | Ga0496101_0089944 | 3300048904 | Bacteria | 2282 |
| 556 | Ga0496101_0106388 | 3300048904 | Bacteria | 2106 |
| 557 | Ga0496101_0109631 | 3300048904 | Bacteria | 2077 |
| 558 | Ga0496101_0157574 | 3300048904 | Bacteria | 1740 |
| 559 | Ga0496101_0377959 | 3300048904 | Bacteria | 1114 |
| 560 | Ga0496102_0001679 | 3300048905 | Bacteria | 19435 |
| 561 | Ga0496102_0003877 | 3300048905 | Bacteria | 12670 |
| 562 | Ga0496102_0023288 | 3300048905 | Bacteria | 5498 |
| 563 | Ga0496102_0024876 | 3300048905 | Bacteria | 5325 |
| 564 | Ga0496102_0028012 | 3300048905 | Bacteria | 5033 |
| 565 | Ga0496102_0076271 | 3300048905 | Bacteria | 3083 |
| 566 | Ga0496102_0161077 | 3300048905 | Bacteria | 2111 |
| 567 | Ga0496102_0268687 | 3300048905 | Bacteria | 1608 |
| 568 | Ga0496102_0309052 | 3300048905 | Bacteria | 1490 |
| 569 | Ga0496103_0030118 | 3300048906 | Bacteria | 3301 |
| 570 | Ga0496103_0160569 | 3300048906 | Bacteria | 1441 |
| 571 | Ga0496103_0203780 | 3300048906 | Bacteria | 1272 |
| 572 | Ga0496104_0068485 | 3300048907 | Bacteria | 3373 |
| 573 | Ga0496104_0261566 | 3300048907 | Bacteria | 1643 |
| 574 | Ga0496104_0334156 | 3300048907 | Bacteria | 1428 |
| 575 | Ga0496104_0461963 | 3300048907 | Bacteria | 1181 |
| 576 | Ga0496105_0003593 | 3300048908 | Bacteria | 11513 |
| 577 | Ga0496105_0008048 | 3300048908 | Bacteria | 8193 |
| 578 | Ga0496105_0301802 | 3300048908 | Bacteria | 1287 |
| 579 | Ga0496106_0015296 | 3300048909 | Bacteria | 5676 |
| 580 | Ga0496106_0018504 | 3300048909 | Bacteria | 5152 |
| 581 | Ga0496106_0134859 | 3300048909 | Bacteria | 1938 |
| 582 | Ga0496107_0035852 | 3300048910 | Bacteria | 3558 |
| 583 | Ga0496107_0213334 | 3300048910 | Bacteria | 1436 |
| 584 | Ga0496108_0000029 | 3300048911 | Bacteria | 167261 |
| 585 | Ga0496108_0021411 | 3300048911 | Bacteria | 5315 |
| 586 | Ga0496108_0053647 | 3300048911 | Bacteria | 3381 |
| 587 | Ga0496108_0165719 | 3300048911 | Bacteria | 1910 |
| 588 | Ga0496108_0194250 | 3300048911 | Bacteria | 1760 |
| 589 | Ga0496109_0019013 | 3300048912 | Bacteria | 6051 |
| 590 | Ga0496109_0060095 | 3300048912 | Bacteria | 3473 |
| 591 | Ga0496109_0078276 | 3300048912 | Bacteria | 3044 |
| 592 | Ga0496109_0139809 | 3300048912 | Bacteria | 2264 |
| 593 | Ga0496109_0190228 | 3300048912 | Bacteria | 1928 |
| 594 | Ga0496109_0218728 | 3300048912 | Bacteria | 1791 |
| 595 | Ga0496109_0411968 | 3300048912 | Bacteria | 1277 |
| 596 | Ga0496110_0083619 | 3300048913 | Bacteria | 2848 |
| 597 | Ga0496110_0084773 | 3300048913 | Bacteria | 2828 |
| 598 | Ga0496110_0159245 | 3300048913 | Bacteria | 2046 |
| 599 | Ga0496110_0262354 | 3300048913 | Bacteria | 1572 |
| 600 | Ga0496111_0078856 | 3300048914 | Bacteria | 2402 |
| 601 | Ga0496111_0084703 | 3300048914 | Bacteria | 2317 |
| 602 | Ga0496111_0114783 | 3300048914 | Bacteria | 1985 |
| 603 | Ga0496111_0188658 | 3300048914 | Bacteria | 1533 |
| 604 | Ga0496112_0075847 | 3300048915 | Bacteria | 3325 |
| 605 | Ga0496112_0127657 | 3300048915 | Bacteria | 2514 |
| 606 | Ga0496112_0248695 | 3300048915 | Bacteria | 1730 |
| 607 | Ga0496113_0021901 | 3300048916 | Bacteria | 4513 |
| 608 | Ga0496113_0065827 | 3300048916 | Bacteria | 2744 |
| 609 | Ga0496113_0187099 | 3300048916 | Bacteria | 1643 |
| 610 | Ga0496114_0004572 | 3300048917 | Bacteria | 10748 |
| 611 | Ga0496114_0012911 | 3300048917 | Bacteria | 6690 |
| 612 | Ga0496114_0014354 | 3300048917 | Bacteria | 6355 |
| 613 | Ga0496114_0015345 | 3300048917 | Bacteria | 6159 |
| 614 | Ga0496114_0072030 | 3300048917 | Bacteria | 2905 |
| 615 | Ga0496114_0082389 | 3300048917 | Bacteria | 2719 |
| 616 | Ga0496114_0088916 | 3300048917 | Bacteria | 2621 |
| 617 | Ga0496114_0175301 | 3300048917 | Bacteria | 1871 |
| 618 | Ga0496114_0242440 | 3300048917 | Bacteria | 1585 |
| 619 | Ga0496114_0290511 | 3300048917 | Bacteria | 1442 |
| 620 | Ga0496115_0001458 | 3300048918 | Bacteria | 16992 |
| 621 | Ga0496115_0074357 | 3300048918 | Bacteria | 2759 |
| 622 | Ga0496115_0077411 | 3300048918 | Bacteria | 2704 |
| 623 | Ga0496119_0001068 | 3300048922 | Bacteria | 34793 |
| 624 | Ga0496120_0000103 | 3300048923 | Bacteria | 141601 |
| 625 | Ga0496126_0237298 | 3300048929 | Bacteria | 1525 |
| 626 | Ga0501031_0017084 | 3300049568 | Bacteria | 4713 |
| 627 | Ga0501031_0105160 | 3300049568 | Bacteria | 1842 |
| 628 | Ga0501031_0115831 | 3300049568 | Bacteria | 1751 |
| 629 | Ga0501031_0134448 | 3300049568 | Bacteria | 1615 |
| 630 | Ga0501032_0005543 | 3300049569 | Bacteria | 9366 |
| 631 | Ga0501032_0020844 | 3300049569 | Bacteria | 4561 |
| 632 | Ga0501033_0002108 | 3300049570 | Bacteria | 17222 |
| 633 | Ga0501033_0028148 | 3300049570 | Bacteria | 4224 |
| 634 | Ga0501033_0104871 | 3300049570 | Bacteria | 2061 |
| 635 | Ga0501033_0112939 | 3300049570 | Bacteria | 1976 |
| 636 | Ga0501034_0023454 | 3300049571 | Bacteria | 6287 |
| 637 | Ga0501034_0053987 | 3300049571 | Bacteria | 4046 |
| 638 | Ga0501034_0412162 | 3300049571 | Bacteria | 1273 |
| 639 | Ga0501036_0008657 | 3300049572 | Bacteria | 8348 |
| 640 | Ga0501036_0008684 | 3300049572 | Bacteria | 8336 |
| 641 | Ga0501036_0009779 | 3300049572 | Bacteria | 7897 |
| 642 | Ga0501036_0036455 | 3300049572 | Bacteria | 4162 |
| 643 | Ga0501036_0072343 | 3300049572 | Bacteria | 2914 |
| 644 | Ga0501036_0226522 | 3300049572 | Bacteria | 1569 |
| 645 | Ga0501037_0007658 | 3300049573 | Bacteria | 7908 |
| 646 | Ga0501037_0008499 | 3300049573 | Bacteria | 7528 |
| 647 | Ga0501037_0024917 | 3300049573 | Bacteria | 4422 |
| 648 | Ga0501037_0026338 | 3300049573 | Bacteria | 4297 |
| 649 | Ga0501037_0027690 | 3300049573 | Bacteria | 4188 |
| 650 | Ga0501038_0001411 | 3300049574 | Bacteria | 22000 |
| 651 | Ga0501038_0005982 | 3300049574 | Bacteria | 11253 |
| 652 | Ga0501039_0004034 | 3300049575 | Bacteria | 11034 |
| 653 | Ga0501039_0073509 | 3300049575 | Bacteria | 2656 |
| 654 | Ga0501039_0137797 | 3300049575 | Bacteria | 1917 |
| 655 | Ga0501039_0410465 | 3300049575 | Bacteria | 1064 |
| 656 | Ga0501040_0010935 | 3300049576 | Bacteria | 5935 |
| 657 | Ga0501040_0214894 | 3300049576 | Bacteria | 1367 |
| 658 | Ga0501040_0229811 | 3300049576 | Bacteria | 1321 |
| 659 | Ga0501041_0005388 | 3300049577 | Bacteria | 7494 |
| 660 | Ga0501042_0004768 | 3300049578 | Bacteria | 8657 |
| 661 | Ga0501042_0011275 | 3300049578 | Bacteria | 6026 |
| 662 | Ga0501042_0014282 | 3300049578 | Bacteria | 5419 |
| 663 | Ga0501042_0169484 | 3300049578 | Bacteria | 1576 |
| 664 | Ga0501043_0003129 | 3300049579 | Bacteria | 13725 |
| 665 | Ga0501043_0098331 | 3300049579 | Bacteria | 2300 |
| 666 | Ga0501046_0000841 | 3300049580 | Bacteria | 29918 |
| 667 | Ga0501046_0016344 | 3300049580 | Bacteria | 6217 |
| 668 | Ga0501046_0061655 | 3300049580 | Bacteria | 2931 |
| 669 | Ga0501046_0232814 | 3300049580 | Bacteria | 1360 |
| 670 | Ga0501047_0004414 | 3300049581 | Bacteria | 13248 |
| 671 | Ga0501047_0086847 | 3300049581 | Bacteria | 3005 |
| 672 | Ga0501048_0002290 | 3300049582 | Bacteria | 14604 |
| 673 | Ga0501048_0034957 | 3300049582 | Bacteria | 3621 |
| 674 | Ga0501048_0112234 | 3300049582 | Bacteria | 1925 |
| 675 | Ga0501067_0049904 | 3300049583 | Bacteria | 2319 |
| 676 | Ga0501067_0071898 | 3300049583 | Bacteria | 1916 |
| 677 | Ga0501067_0179926 | 3300049583 | Bacteria | 1178 |
| 678 | Ga0501068_0030555 | 3300049584 | Bacteria | 3196 |
| 679 | Ga0501069_0011110 | 3300049585 | Bacteria | 4777 |
| 680 | Ga0501069_0070083 | 3300049585 | Bacteria | 1964 |
| 681 | Ga0501069_0080857 | 3300049585 | Bacteria | 1830 |
| 682 | Ga0501070_0013674 | 3300049586 | Bacteria | 6837 |
| 683 | Ga0501070_0108014 | 3300049586 | Bacteria | 2299 |
| 684 | Ga0501070_0148380 | 3300049586 | Bacteria | 1935 |
| 685 | Ga0501070_0196549 | 3300049586 | Bacteria | 1656 |
| 686 | Ga0501071_0026943 | 3300049587 | Bacteria | 4040 |
| 687 | Ga0501071_0080394 | 3300049587 | Bacteria | 2383 |
| 688 | Ga0501071_0169046 | 3300049587 | Bacteria | 1636 |
| 689 | Ga0501072_0013614 | 3300049588 | Bacteria | 6227 |
| 690 | Ga0501072_0077428 | 3300049588 | Bacteria | 2633 |
| 691 | Ga0501072_0184360 | 3300049588 | Bacteria | 1665 |
| 692 | Ga0501073_0254075 | 3300049589 | Bacteria | 1213 |
| 693 | Ga0501074_0027043 | 3300049590 | Bacteria | 4157 |
| 694 | Ga0501074_0080536 | 3300049590 | Bacteria | 2336 |
| 695 | Ga0501074_0104186 | 3300049590 | Bacteria | 2031 |
| 696 | Ga0501074_0117776 | 3300049590 | Bacteria | 1900 |
| 697 | Ga0501075_0005329 | 3300049591 | Bacteria | 8796 |
| 698 | Ga0501075_0022558 | 3300049591 | Bacteria | 4599 |
| 699 | Ga0501076_0003246 | 3300049592 | Bacteria | 11377 |
| 700 | Ga0501076_0009396 | 3300049592 | Bacteria | 7221 |
| 701 | Ga0501076_0160059 | 3300049592 | Bacteria | 1834 |
| 702 | Ga0501076_0268342 | 3300049592 | Bacteria | 1397 |
| 703 | Ga0501076_0410379 | 3300049592 | Bacteria | 1114 |
| 704 | Ga0501077_0017963 | 3300049593 | Bacteria | 4470 |
| 705 | Ga0501077_0081074 | 3300049593 | Bacteria | 2055 |
| 706 | Ga0501077_0284482 | 3300049593 | Bacteria | 1053 |
| 707 | Ga0501079_0018295 | 3300049741 | Bacteria | 5354 |
| 708 | Ga0501079_0019142 | 3300049741 | Bacteria | 5230 |
| 709 | Ga0501079_0039588 | 3300049741 | Bacteria | 3636 |
| 710 | Ga0501079_0056653 | 3300049741 | Bacteria | 3024 |
| 711 | Ga0501079_0427833 | 3300049741 | Bacteria | 1039 |
| 712 | Ga0501080_0051549 | 3300049742 | Bacteria | 3829 |
| 713 | Ga0501080_0051621 | 3300049742 | Bacteria | 3827 |
| 714 | Ga0501080_0167432 | 3300049742 | Bacteria | 2028 |
| 715 | Ga0501080_0221404 | 3300049742 | Bacteria | 1732 |
| 716 | Ga0501081_0021306 | 3300049743 | Bacteria | 4324 |
| 717 | Ga0501083_0033902 | 3300049744 | Bacteria | 3494 |
| 718 | Ga0501035_0012022 | 3300049822 | Bacteria | 8008 |
| 719 | Ga0501035_0042476 | 3300049822 | Bacteria | 4100 |
| 720 | Ga0501044_0017119 | 3300049823 | Bacteria | 7778 |
| 721 | Ga0501044_0096708 | 3300049823 | Bacteria | 2974 |
| 722 | Ga0501045_0049862 | 3300049824 | Bacteria | 3054 |
| 723 | Ga0501045_0095127 | 3300049824 | Bacteria | 2204 |
| 724 | Ga0501045_0116345 | 3300049824 | Bacteria | 1984 |
| 725 | Ga0501045_0129091 | 3300049824 | Bacteria | 1879 |
| 726 | nmdc:mga03n38_180901_c1 | 3300050490 | Bacteria | 1080 |
| 727 | nmdc:mga03n38_6635_c1 | 3300050490 | Bacteria | 4039 |
| 728 | nmdc:mga03n38_71204_c1 | 3300050490 | Bacteria | 1610 |
| 729 | nmdc:mga00v17_5910_c1 | 3300050491 | Bacteria | 6468 |
| 730 | nmdc:mga0yw44_10082_c1 | 3300050492 | Bacteria | 4810 |
| 731 | nmdc:mga0yw44_10882_c1 | 3300050492 | Bacteria | 4665 |
| 732 | nmdc:mga0yw44_126786_c1 | 3300050492 | Bacteria | 1649 |
| 733 | nmdc:mga0yw44_139929_c1 | 3300050492 | Bacteria | 1572 |
| 734 | nmdc:mga0yw44_14102_c2 | 3300050492 | Bacteria | 3629 |
| 735 | nmdc:mga0yw44_25005_c1 | 3300050492 | Bacteria | 3389 |
| 736 | nmdc:mga0yw44_26964_c1 | 3300050492 | Bacteria | 3286 |
| 737 | nmdc:mga0yw44_31193_c1 | 3300050492 | Bacteria | 3097 |
| 738 | nmdc:mga0yw44_37885_c1 | 3300050492 | Bacteria | 2850 |
| 739 | nmdc:mga0yw44_68788_c1 | 3300050492 | Bacteria | 2191 |
| 740 | nmdc:mga04h51_6015_c1 | 3300050495 | Bacteria | 3124 |
| 741 | nmdc:mga07m45_26650_c1 | 3300050496 | Bacteria | 3178 |
| 742 | nmdc:mga05p37_22251_c1 | 3300050507 | Bacteria | 7686 |
| 743 | nmdc:mga05p37_32742_c1 | 3300050507 | Bacteria | 6360 |
| 744 | nmdc:mga05p37_960_c2 | 3300050507 | Bacteria | 25827 |
| 745 | nmdc:mga09592_20_c1 | 3300050508 | Bacteria | 92890 |
| 746 | nmdc:mga09592_52005_c1 | 3300050508 | Bacteria | 3457 |
| 747 | nmdc:mga0qj67_1435_c1 | 3300050509 | Bacteria | 16696 |
| 748 | nmdc:mga0qj67_222730_c1 | 3300050509 | Bacteria | 1531 |
| 749 | nmdc:mga0qj67_38666_c1 | 3300050509 | Bacteria | 3744 |
| 750 | nmdc:mga0qj67_5065_c1 | 3300050509 | Bacteria | 9587 |
| 751 | nmdc:mga06r32_89_c1 | 3300050510 | Bacteria | 63337 |
| 752 | nmdc:mga08y16_2421_c1 | 3300050511 | Bacteria | 19173 |
| 753 | nmdc:mga08y16_250408_c1 | 3300050511 | Bacteria | 1830 |
| 754 | nmdc:mga08y16_3646_c1 | 3300050511 | Bacteria | 16009 |
| 755 | nmdc:mga08y16_4458_c1 | 3300050511 | Bacteria | 14639 |
| 756 | nmdc:mga0rr50_59006_c1 | 3300050513 | Bacteria | 2879 |
| 757 | nmdc:mga08x19_86882_c1 | 3300050514 | Bacteria | 2060 |
| 758 | nmdc:mga0a205_102345_c1 | 3300050515 | Bacteria | 2763 |
| 759 | nmdc:mga0a205_121873_c1 | 3300050515 | Bacteria | 2507 |
| 760 | Ga0495601_0152878 | 3300053077 | Bacteria | 1507 |
| 761 | Ga0495655_0047129 | 3300053083 | Bacteria | 1127 |
| 762 | Ga0495619_0082755 | 3300053085 | Bacteria | 2164 |
| 763 | Ga0500644_0004160 | 3300053088 | Bacteria | 3608 |
| 764 | Ga0500646_0000579 | 3300053090 | Bacteria | 10551 |
| 765 | Ga0500583_0166702 | 3300053092 | Bacteria | 1097 |
| 766 | Ga0500641_0025082 | 3300053096 | Bacteria | 2304 |
| 767 | Ga0500650_0063720 | 3300053098 | Bacteria | 1722 |
| 768 | Ga0500556_0001238 | 3300053104 | Bacteria | 11842 |
| 769 | Ga0500556_0045806 | 3300053104 | Bacteria | 1563 |
| 770 | Ga0500593_000208 | 3300053117 | Bacteria | 24074 |
| 771 | Ga0500652_048424 | 3300053131 | Bacteria | 1729 |
| 772 | Ga0500573_0025511 | 3300053140 | Bacteria | 3399 |
| 773 | Ga0500616_0001402 | 3300053153 | Bacteria | 23217 |
| 774 | Ga0500616_0032899 | 3300053153 | Bacteria | 2832 |
| 775 | Ga0501084_0015872 | 3300054114 | Bacteria | 6247 |
| 776 | Ga0501084_0057608 | 3300054114 | Bacteria | 3251 |
| 777 | Ga0501082_0010696 | 3300060353 | Bacteria | 7898 |
| 778 | Ga0501082_0036031 | 3300060353 | Bacteria | 4263 |
| 779 | Ga0501082_0460611 | 3300060353 | Bacteria | 1111 |
| 780 | Ga0466962_0103853 | 3300061719 | Bacteria | 1365 |
| 781 | Ga0466962_0139294 | 3300061719 | Bacteria | 1175 |
| 782 | Ga0530510_0003798 | 3300061734 | Bacteria | 10401 |
| 783 | Ga0530510_0050137 | 3300061734 | Bacteria | 3015 |
| 784 | 2501942198 | 2501939600 | Bacteria | 6907073 |
| 785 | 2515495052 | 2515154088 | Bacteria | 5526283 |
| 786 | 2515719056 | 2515154129 | Bacteria | 5584369 |
| 787 | 2515754992 | 2515154137 | Bacteria | 5711575 |
| 788 | 2516083262 | 2515154202 | Bacteria | 5471270 |
| 789 | 2516088636 | 2515154203 | Bacteria | 5458536 |
| 790 | 2586059491 | 2585427649 | Bacteria | 9053857 |
| 791 | 2623590903 | 2622736626 | Bacteria | 7181580 |
| 792 | 2643825479 | 2643221561 | Bacteria | 4984412 |
| 793 | 2643850486 | 2643221567 | Bacteria | 4163945 |
| 794 | 2643889076 | 2643221576 | Bacteria | 5214352 |
| 795 | 2643942298 | 2643221587 | Bacteria | 7586415 |
| 796 | 2643958131 | 2643221590 | Bacteria | 5214697 |
| 797 | 2644034611 | 2643221604 | Bacteria | 5014917 |
| 798 | 2644089685 | 2643221615 | Bacteria | 5487866 |
| 799 | 2644098982 | 2643221617 | Bacteria | 5139111 |
| 800 | 2644114863 | 2643221620 | Bacteria | 5134593 |
| 801 | 2644134243 | 2643221624 | Bacteria | 4384879 |
| 802 | 2644319530 | 2643221657 | Bacteria | 5490246 |
| 803 | 2644389952 | 2643221670 | Bacteria | 6497041 |
| 804 | 2644429379 | 2643221677 | Bacteria | 7584031 |
| 805 | 2644435823 | 2643221678 | Bacteria | 9540101 |
| 806 | 2644531475 | 2643221696 | Bacteria | 5431823 |
| 807 | 2644632288 | 2643221714 | Bacteria | 9015452 |
| 808 | 2676475072 | 2675903058 | Bacteria | 6822861 |
| 809 | 2738867978 | 2738541305 | Bacteria | 4910150 |
| 810 | 2740166899 | 2739367898 | Bacteria | 4367674 |
| 811 | 2753272289 | 2751185782 | Bacteria | 11227053 |
| 812 | 2768647542 | 2767802112 | Bacteria | 6465194 |
| 813 | 2772641604 | 2772190715 | Bacteria | 6959372 |
| 814 | 2772644123 | 2772190715 | Bacteria | 6959372 |
| 815 | 2774393477 | 2773857762 | Bacteria | 5971770 |
| 816 | 2784471936 | 2784132109 | Bacteria | 3141763 |
| 817 | 2795784400 | 2795385470 | Bacteria | 8317180 |
| 818 | 2808840634 | 2808606359 | Bacteria | 9866990 |
| 819 | 2808873786 | 2808606365 | Bacteria | 4301966 |
| 820 | 2809195629 | 2808606439 | Bacteria | 5952208 |
| 821 | 2809591747 | 2808606522 | Bacteria | 9488490 |
| 822 | 2812332293 | 2811994874 | Bacteria | 5367947 |
| 823 | 2812350535 | 2811994878 | Bacteria | 5992952 |
| 824 | 2819427239 | 2818991318 | Bacteria | 5266538 |
| 825 | 2827629996 | 2827628540 | Bacteria | 6858585 |
| 826 | 2831936376 | 2831935698 | Bacteria | 5963223 |
| 827 | 2832010596 | 2832004796 | Bacteria | 6538017 |
| 828 | 2855387717 | 2855386786 | Bacteria | 4752232 |
| 829 | 2855672180 | 2855670206 | Bacteria | 7120389 |
| 830 | 2855676345 | 2855670206 | Bacteria | 7120389 |
| 831 | 2855681483 | 2855676851 | Bacteria | 7063653 |
| 832 | 2855682773 | 2855676851 | Bacteria | 7063653 |
| 833 | 2855686788 | 2855683550 | Bacteria | 7134265 |
| 834 | 2856743596 | 2856741275 | Bacteria | 8096094 |
| 835 | 2856864576 | 2856858025 | Bacteria | 7255264 |
| 836 | 2857291860 | 2857288857 | Bacteria | 7189066 |
| 837 | 2857294765 | 2857288857 | Bacteria | 7189066 |
| 838 | 2857483064 | 2857481737 | Bacteria | 4761446 |
| 839 | 2858854430 | 2858848962 | Bacteria | 6963058 |
| 840 | 2858855251 | 2858848962 | Bacteria | 6963058 |
| 841 | 2858873895 | 2858868258 | Bacteria | 7683772 |
| 842 | 2858888489 | 2858882152 | Bacteria | 7230291 |
| 843 | 2858888817 | 2858882152 | Bacteria | 7230291 |
| 844 | 2858889090 | 2858888857 | Bacteria | 7060307 |
| 845 | 2858890813 | 2858888857 | Bacteria | 7060307 |
| 846 | 2858897335 | 2858895516 | Bacteria | 7378898 |
| 847 | 2858899255 | 2858895516 | Bacteria | 7378898 |
| 848 | 2858905850 | 2858902515 | Bacteria | 7086037 |
| 849 | 2862709787 | 2862705112 | Bacteria | 6563286 |
| 850 | 2866068247 | 2866065130 | Bacteria | 6518152 |
| 851 | 2866553742 | 2866552031 | Bacteria | 5824618 |
| 852 | 2867303449 | 2867302475 | Bacteria | 7087181 |
| 853 | 2867316195 | 2867312974 | Bacteria | 7058875 |
| 854 | 2867321061 | 2867319477 | Bacteria | 7069771 |
| 855 | 2867511677 | 2867507094 | Bacteria | 6506033 |
| 856 | 2869048676 | 2869048445 | Bacteria | 6875584 |
| 857 | 2869054122 | 2869048445 | Bacteria | 6875584 |
| 858 | 2869062344 | 2869061728 | Bacteria | 7112407 |
| 859 | 2869066086 | 2869061728 | Bacteria | 7112407 |
| 860 | 2869070732 | 2869068681 | Bacteria | 7205615 |
| 861 | 2869073158 | 2869068681 | Bacteria | 7205615 |
| 862 | 2880489596 | 2880489317 | Bacteria | 7096270 |
| 863 | 2880496108 | 2880495981 | Bacteria | 7340502 |
| 864 | 2880498522 | 2880495981 | Bacteria | 7340502 |
| 865 | 2884697395 | 2884693830 | Bacteria | 11273186 |
| 866 | 2891397796 | 2891395885 | Bacteria | 9251614 |
| 867 | 2891564898 | 2891562705 | Bacteria | 8039471 |
| 868 | 2891971866 | 2891968417 | Bacteria | 5821697 |
| 869 | 2895430981 | 2895427314 | Bacteria | 13147766 |
| 870 | 2895452903 | 2895442618 | Bacteria | 11027144 |
| 871 | 2902588071 | 2902582711 | Bacteria | 6187705 |
| 872 | 2915771797 | 2915768154 | Bacteria | 8424322 |
| 873 | 2918505543 | 2918501144 | Bacteria | 8668083 |
| 874 | 2919449929 | 2919446982 | Bacteria | 3994487 |
| 875 | 2929224785 | 2929219909 | Bacteria | 6984360 |
| 876 | 2929227108 | 2929226422 | Bacteria | 7248583 |
| 877 | 2929232280 | 2929226422 | Bacteria | 7248583 |
| 878 | 2954696952 | 2954691527 | Bacteria | 10720516 |
| 879 | 2954705182 | 2954701450 | Bacteria | 10834262 |
| 880 | 2984576990 | 2984576629 | Bacteria | 4248407 |
| 881 | 2990258737 | 2990256926 | Bacteria | 4252839 |
| 882 | 2996227482 | 2996221748 | Bacteria | 6799777 |
| 883 | 3001891240 | 3001889506 | Bacteria | 2975194 |
| 884 | 649813897 | 649633069 | Bacteria | 6962533 |
| 885 | 8001790020 | 8001781756 | Bacteria | 9586736 |
| 886 | 8003834570 | 8003830390 | Bacteria | 6541657 |
| 887 | 8003860585 | 8003856774 | Bacteria | 7675274 |
| 888 | 8003877110 | 8003870546 | Bacteria | 7396674 |
| 889 | 8054707685 | 8054704163 | Bacteria | 7247792 |
| 890 | 8054710221 | 8054704163 | Bacteria | 7247792 |
| 891 | 8054731037 | 8054727385 | Bacteria | 7558670 |
| 892 | 8054732869 | 8054727385 | Bacteria | 7558670 |
| 893 | 8054735169 | 8054734606 | Bacteria | 6947278 |
| 894 | 8054738941 | 8054734606 | Bacteria | 6947278 |
| 895 | 8055418423 | 8055412473 | Bacteria | 6257500 |
| 896 | 8056211136 | 8056207758 | Bacteria | 8639239 |
| 897 | nmdc:mga00v17_27702_c1 | |||
| 898 | JGI24740J21852_10013057 | |||
| 899 | JGI24737J22298_10053044 | |||
| 900 | JGI24738J21930_10015359 | |||
| 901 | JGI24744J21845_10009530 | |||
| 902 | JGI25406J46586_10000292 | |||
| 903 | JGI25406J46586_10013791 | |||
| 904 | JGI25407J50210_10026054 | |||
| 905 | Ga0006562J51391_1031195 | |||
| 906 | Ga0070676_10029361 | |||
| 907 | Ga0070683_100004647 | |||
| 908 | Ga0070683_100005801 | |||
| 909 | Ga0070683_100008155 | |||
| 910 | Ga0070683_100463844 | |||
| 911 | Ga0070670_100074618 | |||
| 912 | Ga0068869_100004417 | |||
| 913 | Ga0068869_100007855 | |||
| 914 | Ga0068869_100030634 | |||
| 915 | Ga0070680_100036712 | |||
| 916 | Ga0070680_100042402 | |||
| 917 | Ga0070682_100010967 | |||
| 918 | Ga0070682_100035749 | |||
| 919 | Ga0070682_100250907 | |||
| 920 | Ga0068868_100047152 | |||
| 921 | Ga0068868_100100797 | |||
| 922 | Ga0068868_100121338 | |||
| 923 | Ga0070660_100025915 | |||
| 924 | Ga0070689_100023594 | |||
| 925 | Ga0070691_10000786 | |||
| 926 | Ga0070687_100047430 | |||
| 927 | Ga0070661_100344284 | |||
| 928 | Ga0070661_100362772 | |||
| 929 | Ga0070692_10005824 | |||
| 930 | Ga0070668_100001449 | |||
| 931 | Ga0070668_100055098 | |||
| 932 | Ga0070668_100091485 | |||
| 933 | Ga0070668_100196950 | |||
| 934 | Ga0070675_100001934 | |||
| 935 | Ga0070675_100087605 | |||
| 936 | Ga0070674_100012101 | |||
| 937 | Ga0070673_100075845 | |||
| 938 | Ga0070688_100054608 | |||
| 939 | Ga0070659_100139969 | |||
| 940 | Ga0070659_100434085 | |||
| 941 | Ga0070667_100056769 | |||
| 942 | Ga0070667_100162288 | |||
| 943 | Ga0070709_10000730 | |||
| 944 | Ga0070709_10065399 | |||
| 945 | Ga0070714_100001418 | |||
| 946 | Ga0070714_100003214 | |||
| 947 | Ga0070714_100086327 | |||
| 948 | Ga0070714_100093214 | |||
| 949 | Ga0070714_100096738 | |||
| 950 | Ga0070713_100001109 | |||
| 951 | Ga0070713_100012557 | |||
| 952 | Ga0070713_100082644 | |||
| 953 | Ga0070713_100249254 | |||
| 954 | Ga0070710_10000758 | |||
| 955 | Ga0070711_100000258 | |||
| 956 | Ga0070711_100011131 | |||
| 957 | Ga0070711_100031406 | |||
| 958 | Ga0070700_100006435 | |||
| 959 | Ga0070700_100031847 | |||
| 960 | Ga0070678_100386959 | |||
| 961 | Ga0070662_100040578 | |||
| 962 | Ga0070681_10027499 | |||
| 963 | Ga0070681_10100741 | |||
| 964 | Ga0068867_100030779 | |||
| 965 | Ga0070685_10011861 | |||
| 966 | Ga0070685_10252611 | |||
| 967 | Ga0070706_100009310 | |||
| 968 | Ga0070707_100012904 | |||
| 969 | Ga0070707_100417586 | |||
| 970 | Ga0070698_100000873 | |||
| 971 | Ga0070698_100010105 | |||
| 972 | Ga0070698_100290868 | |||
| 973 | Ga0070699_100363920 | |||
| 974 | Ga0070679_100077187 | |||
| 975 | Ga0070679_100086156 | |||
| 976 | Ga0070684_100007069 | |||
| 977 | Ga0070684_100086484 | |||
| 978 | Ga0070684_100116628 | |||
| 979 | Ga0070697_100223369 | |||
| 980 | Ga0070672_100007050 | |||
| 981 | Ga0070686_100279939 | |||
| 982 | Ga0070693_100001271 | |||
| 983 | Ga0070665_100000865 | |||
| 984 | Ga0070665_100125179 | |||
| 985 | Ga0068855_100399425 | |||
| 986 | Ga0070664_100003004 | |||
| 987 | Ga0070664_100053722 | |||
| 988 | Ga0070664_100302006 | |||
| 989 | Ga0068857_100058531 | |||
| 990 | Ga0068857_100389550 | |||
| 991 | Ga0068854_100355565 | |||
| 992 | Ga0068856_100055390 | |||
| 993 | Ga0068856_100176336 | |||
| 994 | Ga0068856_100592335 | |||
| 995 | Ga0070702_100003214 | |||
| 996 | Ga0070702_100024536 | |||
| 997 | Ga0070702_100037982 | |||
| 998 | Ga0068852_100040897 | |||
| 999 | Ga0068852_100134207 | |||
| 1000 | Ga0068864_100008703 | |||
| 1001 | Ga0068861_100003359 | |||
| 1002 | Ga0068861_100071581 | |||
| 1003 | Ga0068861_100156765 | |||
| 1004 | Ga0068861_100169457 | |||
| 1005 | Ga0068861_100174152 | |||
| 1006 | Ga0068861_100221061 | |||
| 1007 | Ga0068870_10001666 | |||
| 1008 | Ga0068870_10014561 | |||
| 1009 | Ga0068863_100059072 | |||
| 1010 | Ga0068863_100268002 | |||
| 1011 | Ga0068863_100531608 | |||
| 1012 | Ga0068858_100074234 | |||
| 1013 | Ga0068860_100002948 | |||
| 1014 | Ga0068862_100027387 | |||
| 1015 | Ga0081455_10002300 | |||
| 1016 | Ga0081538_10004313 | |||
| 1017 | Ga0081540_1002450 | |||
| 1018 | Ga0081540_1027134 | |||
| 1019 | Ga0081539_10000242 | |||
| 1020 | Ga0081539_10000309 | |||
| 1021 | Ga0081539_10000364 | |||
| 1022 | Ga0081539_10000432 | |||
| 1023 | Ga0081539_10002151 | |||
| 1024 | Ga0081539_10011082 | |||
| 1025 | Ga0081539_10061848 | |||
| 1026 | Ga0081539_10072958 | |||
| 1027 | Ga0081539_10130509 | |||
| 1028 | Ga0070717_10039960 | |||
| 1029 | Ga0070717_10104318 | |||
| 1030 | Ga0070717_10233674 | |||
| 1031 | Ga0075365_10002795 | |||
| 1032 | Ga0075365_10014617 | |||
| 1033 | Ga0075365_10019311 | |||
| 1034 | Ga0075365_10048059 | |||
| 1035 | Ga0075365_10050831 | |||
| 1036 | Ga0075365_10112275 | |||
| 1037 | Ga0075368_10013839 | |||
| 1038 | Ga0075363_100011776 | |||
| 1039 | Ga0075363_100085513 | |||
| 1040 | Ga0075364_10005194 | |||
| 1041 | Ga0075364_10007061 | |||
| 1042 | Ga0075364_10022871 | |||
| 1043 | Ga0070715_10025138 | |||
| 1044 | Ga0070716_100000222 | |||
| 1045 | Ga0070716_100051297 | |||
| 1046 | Ga0070712_100002878 | |||
| 1047 | Ga0070712_100017672 | |||
| 1048 | Ga0070712_100152350 | |||
| 1049 | Ga0075362_10100786 | |||
| 1050 | Ga0075367_10131479 | |||
| 1051 | Ga0097621_100017517 | |||
| 1052 | Ga0075370_10008069 | |||
| 1053 | Ga0075370_10074475 | |||
| 1054 | Ga0075370_10082575 | |||
| 1055 | Ga0075370_10082750 | |||
| 1056 | Ga0068871_100042638 | |||
| 1057 | Ga0075428_100001979 | |||
| 1058 | Ga0075428_100060371 | |||
| 1059 | Ga0075428_100413186 | |||
| 1060 | Ga0075428_100529093 | |||
| 1061 | Ga0075430_100000695 | |||
| 1062 | Ga0075430_100007157 | |||
| 1063 | Ga0075430_100037236 | |||
| 1064 | Ga0075430_100292250 | |||
| 1065 | Ga0075431_100001519 | |||
| 1066 | Ga0075433_10004134 | |||
| 1067 | Ga0075434_100016397 | |||
| 1068 | Ga0075429_100030614 | |||
| 1069 | Ga0075429_100132629 | |||
| 1070 | Ga0075429_100143626 | |||
| 1071 | Ga0068865_100269844 | |||
| 1072 | Ga0075436_100009165 | |||
| 1073 | Ga0099826_10146979 | |||
| 1074 | Ga0075435_100003716 | |||
| 1075 | Ga0105251_10034559 | |||
| 1076 | Ga0111539_10001333 | |||
| 1077 | Ga0111539_10018630 | |||
| 1078 | Ga0111539_10020393 | |||
| 1079 | Ga0105245_10033111 | |||
| 1080 | Ga0105245_10038998 | |||
| 1081 | Ga0105245_10040802 | |||
| 1082 | Ga0105245_10186878 | |||
| 1083 | Ga0105245_10388489 | |||
| 1084 | Ga0105245_10664751 | |||
| 1085 | Ga0105247_10093560 | |||
| 1086 | Ga0114129_10000004 | |||
| 1087 | Ga0114129_10006456 | |||
| 1088 | Ga0114129_10043613 | |||
| 1089 | Ga0114129_10214596 | |||
| 1090 | Ga0114129_10359379 | |||
| 1091 | Ga0105243_10038026 | |||
| 1092 | Ga0105243_10107924 | |||
| 1093 | Ga0105243_10177597 | |||
| 1094 | Ga0105243_10221577 | |||
| 1095 | Ga0105241_10012537 | |||
| 1096 | Ga0105242_10008355 | |||
| 1097 | Ga0105242_10297798 | |||
| 1098 | Ga0105248_10156267 | |||
| 1099 | Ga0105248_10775350 | |||
| 1100 | Ga0105238_10103081 | |||
| 1101 | Ga0105238_10107440 | |||
| 1102 | Ga0105238_10109399 | |||
| 1103 | Ga0105249_10077640 | |||
| 1104 | Ga0105249_10411564 | |||
| 1105 | Ga0105249_10431293 | |||
| 1106 | Ga0105239_10003785 | |||
| 1107 | Ga0105239_10012969 | |||
| 1108 | Ga0105239_10148897 | |||
| 1109 | Ga0105239_10151037 | |||
| 1110 | Ga0105239_10432819 | |||
| 1111 | Ga0105246_10003633 | |||
| 1112 | Ga0105246_10006396 | |||
| 1113 | Ga0105246_10092926 | |||
| 1114 | Ga0157373_10016101 | |||
| 1115 | Ga0157370_10046884 | |||
| 1116 | Ga0157369_10198568 | |||
| 1117 | Ga0157374_10017524 | |||
| 1118 | Ga0157374_10570838 | |||
| 1119 | Ga0157378_10077003 | |||
| 1120 | Ga0163162_10021224 | |||
| 1121 | Ga0157372_10014846 | |||
| 1122 | Ga0157372_10091076 | |||
| 1123 | Ga0157372_10108184 | |||
| 1124 | Ga0157372_10184171 | |||
| 1125 | Ga0157372_10373283 | |||
| 1126 | Ga0157372_10422006 | |||
| 1127 | Ga0157375_10035766 | |||
| 1128 | Ga0157375_10036473 | |||
| 1129 | Ga0157375_10052070 | |||
| 1130 | Ga0157375_10102461 | |||
| 1131 | Ga0157375_10158717 | |||
| 1132 | Ga0163163_10006777 | |||
| 1133 | Ga0163163_10021647 | |||
| 1134 | Ga0163163_10215448 | |||
| 1135 | Ga0163163_10412449 | |||
| 1136 | Ga0157380_10008910 | |||
| 1137 | Ga0157380_10045751 | |||
| 1138 | Ga0157380_10361590 | |||
| 1139 | Ga0182008_10027037 | |||
| 1140 | Ga0157377_10007388 | |||
| 1141 | Ga0157377_10044663 | |||
| 1142 | Ga0157379_10008327 | |||
| 1143 | Ga0157379_10025457 | |||
| 1144 | Ga0157379_10050511 | |||
| 1145 | Ga0163161_10076375 | |||
| 1146 | Ga0163161_10234808 | |||
| 1147 | Ga0197907_10762486 | |||
| 1148 | Ga0206356_11171474 | |||
| 1149 | Ga0206356_11313232 | |||
| 1150 | Ga0206354_10671360 | |||
| 1151 | Ga0206353_10204676 | |||
| 1152 | Ga0206353_11294495 | |||
| 1153 | Ga0206353_11492747 | |||
| 1154 | Ga0224712_10073948 | |||
| 1155 | Ga0207697_10034184 | |||
| 1156 | Ga0207692_10000647 | |||
| 1157 | Ga0207692_10001433 | |||
| 1158 | Ga0207642_10047548 | |||
| 1159 | Ga0207710_10026262 | |||
| 1160 | Ga0207688_10043207 | |||
| 1161 | Ga0207647_10077146 | |||
| 1162 | Ga0207647_10095249 | |||
| 1163 | Ga0207685_10014863 | |||
| 1164 | Ga0207699_10000105 | |||
| 1165 | Ga0207699_10009084 | |||
| 1166 | Ga0207699_10235174 | |||
| 1167 | Ga0207645_10021076 | |||
| 1168 | Ga0207643_10000266 | |||
| 1169 | Ga0207643_10016651 | |||
| 1170 | Ga0207705_10023065 | |||
| 1171 | Ga0207705_10057392 | |||
| 1172 | Ga0207705_10110225 | |||
| 1173 | Ga0207705_10216708 | |||
| 1174 | Ga0207684_10037605 | |||
| 1175 | Ga0207654_10021268 | |||
| 1176 | Ga0207671_10046657 | |||
| 1177 | Ga0207693_10001586 | |||
| 1178 | Ga0207693_10085842 | |||
| 1179 | Ga0207693_10293625 | |||
| 1180 | Ga0207663_10000974 | |||
| 1181 | Ga0207663_10008863 | |||
| 1182 | Ga0207662_10016637 | |||
| 1183 | Ga0207657_10040954 | |||
| 1184 | Ga0207657_10145587 | |||
| 1185 | Ga0207657_10149793 | |||
| 1186 | Ga0207657_10226442 | |||
| 1187 | Ga0207657_10235906 | |||
| 1188 | Ga0207649_10301760 | |||
| 1189 | Ga0207652_10011619 | |||
| 1190 | Ga0207652_10126230 | |||
| 1191 | Ga0207652_10131084 | |||
| 1192 | Ga0207646_10019452 | |||
| 1193 | Ga0207681_10217217 | |||
| 1194 | Ga0207694_10159529 | |||
| 1195 | Ga0207694_10188456 | |||
| 1196 | Ga0207694_10229469 | |||
| 1197 | Ga0207650_10023213 | |||
| 1198 | Ga0207650_10142999 | |||
| 1199 | Ga0207659_10002694 | |||
| 1200 | Ga0207659_10057964 | |||
| 1201 | Ga0207687_10009504 | |||
| 1202 | Ga0207687_10071750 | |||
| 1203 | Ga0207687_10087367 | |||
| 1204 | Ga0207687_10121432 | |||
| 1205 | Ga0207700_10000050 | |||
| 1206 | Ga0207700_10018417 | |||
| 1207 | Ga0207700_10022556 | |||
| 1208 | Ga0207700_10044776 | |||
| 1209 | Ga0207700_10060570 | |||
| 1210 | Ga0207700_10175913 | |||
| 1211 | Ga0207700_10230220 | |||
| 1212 | Ga0207664_10000101 | |||
| 1213 | Ga0207664_10007144 | |||
| 1214 | Ga0207664_10017629 | |||
| 1215 | Ga0207664_10097734 | |||
| 1216 | Ga0207664_10185217 | |||
| 1217 | Ga0207690_10019361 | |||
| 1218 | Ga0207690_10025788 | |||
| 1219 | Ga0207690_10065270 | |||
| 1220 | Ga0207690_10361687 | |||
| 1221 | Ga0207706_10082442 | |||
| 1222 | Ga0207706_10248374 | |||
| 1223 | Ga0207686_10065573 | |||
| 1224 | Ga0207709_10017261 | |||
| 1225 | Ga0207709_10079021 | |||
| 1226 | Ga0207709_10103639 | |||
| 1227 | Ga0207704_10022390 | |||
| 1228 | Ga0207665_10000438 | |||
| 1229 | Ga0207665_10018949 | |||
| 1230 | Ga0207665_10332814 | |||
| 1231 | Ga0207691_10009955 | |||
| 1232 | Ga0207711_10099802 | |||
| 1233 | Ga0207689_10005945 | |||
| 1234 | Ga0207689_10023007 | |||
| 1235 | Ga0207689_10034638 | |||
| 1236 | Ga0207689_10051566 | |||
| 1237 | Ga0207661_10016968 | |||
| 1238 | Ga0207661_10070708 | |||
| 1239 | Ga0207661_10114313 | |||
| 1240 | Ga0207661_10260453 | |||
| 1241 | Ga0207679_10003607 | |||
| 1242 | Ga0207679_10022957 | |||
| 1243 | Ga0207679_10117094 | |||
| 1244 | Ga0207679_10375340 | |||
| 1245 | Ga0207667_10294029 | |||
| 1246 | Ga0207712_10200627 | |||
| 1247 | Ga0207668_10007739 | |||
| 1248 | Ga0207668_10059087 | |||
| 1249 | Ga0207658_10043314 | |||
| 1250 | Ga0207658_10163869 | |||
| 1251 | Ga0207703_10019676 | |||
| 1252 | Ga0207703_10034448 | |||
| 1253 | Ga0207703_10058854 | |||
| 1254 | Ga0207703_10365782 | |||
| 1255 | Ga0207639_10166611 | |||
| 1256 | Ga0207639_10239783 | |||
| 1257 | Ga0207678_10006802 | |||
| 1258 | Ga0207678_10337463 | |||
| 1259 | Ga0207678_10455440 | |||
| 1260 | Ga0207708_10001687 | |||
| 1261 | Ga0207708_10005591 | |||
| 1262 | Ga0207708_10005711 | |||
| 1263 | Ga0207708_10091674 | |||
| 1264 | Ga0207702_10021114 | |||
| 1265 | Ga0207702_10586640 | |||
| 1266 | Ga0207641_10082434 | |||
| 1267 | Ga0207648_10014220 | |||
| 1268 | Ga0207676_10077191 | |||
| 1269 | Ga0207676_10215357 | |||
| 1270 | Ga0207674_10021159 | |||
| 1271 | Ga0207674_10068057 | |||
| 1272 | Ga0207675_100001326 | |||
| 1273 | Ga0207675_100054352 | |||
| 1274 | Ga0207675_100079519 | |||
| 1275 | Ga0207683_10002454 | |||
| 1276 | Ga0207683_10032234 | |||
| 1277 | Ga0207683_10462200 | |||
| 1278 | Ga0207698_10054957 | |||
| 1279 | Ga0207698_10112687 | |||
| 1280 | Ga0207698_10146953 | |||
| 1281 | Ga0207698_10292162 | |||
| 1282 | Ga0209813_10002979 | |||
| 1283 | Ga0209813_10023193 | |||
| 1284 | Ga0207428_10021038 | |||
| 1285 | Ga0207428_10022520 | |||
| 1286 | Ga0207428_10102029 | |||
| 1287 | Ga0268266_10001844 | |||
| 1288 | Ga0268266_10052473 | |||
| 1289 | Ga0268265_10011282 | |||
| 1290 | Ga0268265_10143120 | |||
| 1291 | Ga0268264_10000843 | |||
| 1292 | Ga0307515_10004732 | |||
| 1293 | Ga0307515_10006082 | |||
| 1294 | Ga0307515_10033914 | |||
| 1295 | Ga0307515_10164924 | |||
| 1296 | Ga0307512_10002870 | |||
| 1297 | Ga0307512_10025175 | |||
| 1298 | Ga0307512_10036229 | |||
| 1299 | Ga0307512_10184528 | |||
| 1300 | Ga0316181_1035113 | |||
| 1301 | Ga0265340_10001409 | |||
| 1302 | Ga0307513_10002952 | |||
| 1303 | Ga0307513_10026296 | |||
| 1304 | Ga0307509_10111188 | |||
| 1305 | Ga0307508_10002257 | |||
| 1306 | Ga0307508_10003547 | |||
| 1307 | Ga0307508_10053689 | |||
| 1308 | Ga0316579_10000044 | |||
| 1309 | Ga0307516_10045590 | |||
| 1310 | Ga0307405_10165852 | |||
| 1311 | Ga0307405_10223037 | |||
| 1312 | Ga0307413_10008060 | |||
| 1313 | Ga0307518_10000881 | |||
| 1314 | Ga0307406_10205474 | |||
| 1315 | Ga0307407_10183510 | |||
| 1316 | Ga0307412_10053470 | |||
| 1317 | Ga0307409_100003217 | |||
| 1318 | Ga0307409_100038828 | |||
| 1319 | Ga0307409_100046820 | |||
| 1320 | Ga0307409_100093198 | |||
| 1321 | Ga0307409_100183809 | |||
| 1322 | Ga0307409_100198635 | |||
| 1323 | Ga0307409_100261862 | |||
| 1324 | Ga0307409_100268807 | |||
| 1325 | Ga0307409_100329893 | |||
| 1326 | Ga0307409_100330958 | |||
| 1327 | Ga0307409_100348258 | |||
| 1328 | Ga0307416_100076339 | |||
| 1329 | Ga0307415_100021568 | |||
| 1330 | Ga0307415_100102202 | |||
| 1331 | Ga0307507_10014573 | |||
| 1332 | Ga0373938_0016312 | |||
| 1333 | Ga0373940_0001013 | |||
| 1334 | Ga0373951_0000551 | |||
| 1335 | Ga0373939_0057071 | |||
| 1336 | Ga0373956_0005334 | |||
| 1337 | Ga0373942_0005546 | |||
| 1338 | Ga0316582_0118947 | |||
| 1339 | Ga0395899_0025224 | |||
| 1340 | Ga0395899_0069230 | |||
| 1341 | Ga0395899_0141525 | |||
| 1342 | Ga0395900_0101168 | |||
| 1343 | Ga0395900_0130670 | |||
| 1344 | Ga0395898_0037833 | |||
| 1345 | Ga0395898_0051195 | |||
| 1346 | Ga0395898_0099430 | |||
| 1347 | Ga0395898_0217984 | |||
| 1348 | Ga0395898_0330401 | |||
| 1349 | Ga0395898_0423700 | |||
| 1350 | Ga0395905_0169425 | |||
| 1351 | Ga0395905_0502938 | |||
| 1352 | Ga0316581_0001724 | |||
| 1353 | Ga0395901_0024894 | |||
| 1354 | Ga0395901_0062734 | |||
| 1355 | Ga0395901_0072718 | |||
| 1356 | Ga0395901_0106362 | |||
| 1357 | Ga0395901_0303452 | |||
| 1358 | Ga0395901_0571668 | |||
| 1359 | Ga0400488_58753 | |||
| 1360 | Ga0400486_24036 | |||
| 1361 | Ga0436365_0829147 | |||
| 1362 | Ga0436363_1319502 | |||
| 1363 | Ga0439436_0000284 | |||
| 1364 | Ga0439436_0057235 | |||
| 1365 | Ga0439439_0020821 | |||
| 1366 | Ga0451791_0528520 | |||
| 1367 | Ga0451853_0209873 | |||
| 1368 | Ga0451853_0556300 | |||
| 1369 | Ga0451853_0639474 | |||
| 1370 | Ga0451853_0656156 | |||
| 1371 | Ga0451853_0776115 | |||
| 1372 | Ga0451853_2948900 | |||
| 1373 | Ga0439433_0001529 | |||
| 1374 | Ga0439442_004161 | |||
| 1375 | Ga0439449_0000051 | |||
| 1376 | Ga0439449_0008738 | |||
| 1377 | Ga0439457_000011 | |||
| 1378 | Ga0439446_0006528 | |||
| 1379 | Ga0439464_0011014 | |||
| 1380 | Ga0466972_0050656 | |||
| 1381 | Ga0466965_0026233 | |||
| 1382 | Ga0466965_0048968 | |||
| 1383 | Ga0466965_0131867 | |||
| 1384 | Ga0466965_0195020 | |||
| 1385 | Ga0466966_0009724 | |||
| 1386 | Ga0466961_0116288 | |||
| 1387 | Ga0466961_0143244 | |||
| 1388 | Ga0466961_0182530 | |||
| 1389 | Ga0466961_0235549 | |||
| 1390 | Ga0466963_0083383 | |||
| 1391 | Ga0466963_0122107 | |||
| 1392 | Ga0466963_0165693 | |||
| 1393 | Ga0466963_0193678 | |||
| 1394 | Ga0466963_0279889 | |||
| 1395 | Ga0466964_0005611 | |||
| 1396 | Ga0466964_0016714 | |||
| 1397 | Ga0466964_0111361 | |||
| 1398 | Ga0466971_0057803 | |||
| 1399 | Ga0466971_0122109 | |||
| 1400 | Ga0466970_0007602 | |||
| 1401 | Ga0466970_0012339 | |||
| 1402 | Ga0466970_0026283 | |||
| 1403 | Ga0466970_0051390 | |||
| 1404 | Ga0466970_0080724 | |||
| 1405 | Ga0466970_0114429 | |||
| 1406 | Ga0466957_0006638 | |||
| 1407 | Ga0466957_0008346 | |||
| 1408 | Ga0466957_0030678 | |||
| 1409 | Ga0466957_0158849 | |||
| 1410 | Ga0466957_0222468 | |||
| 1411 | Ga0466957_0224772 | |||
| 1412 | Ga0466960_0005547 | |||
| 1413 | Ga0466960_0005570 | |||
| 1414 | Ga0466960_0020278 | |||
| 1415 | Ga0466960_0023329 | |||
| 1416 | Ga0466960_0026932 | |||
| 1417 | Ga0466960_0043999 | |||
| 1418 | Ga0466960_0044966 | |||
| 1419 | Ga0466960_0059540 | |||
| 1420 | Ga0466960_0100770 | |||
| 1421 | Ga0466960_0117854 | |||
| 1422 | Ga0466958_0121481 | |||
| 1423 | Ga0466958_0121843 | |||
| 1424 | Ga0466967_0001211 | |||
| 1425 | Ga0466967_0010788 | |||
| 1426 | Ga0466967_0022027 | |||
| 1427 | Ga0466967_0033393 | |||
| 1428 | Ga0466967_0036849 | |||
| 1429 | Ga0466967_0047816 | |||
| 1430 | Ga0466967_0090662 | |||
| 1431 | Ga0466967_0196689 | |||
| 1432 | Ga0466967_0468921 | |||
| 1433 | Ga0466967_0521901 | |||
| 1434 | Ga0495629_0254864 | |||
| 1435 | Ga0495641_0056215 | |||
| 1436 | Ga0495653_0303640 | |||
| 1437 | Ga0495664_0153612 | |||
| 1438 | Ga0495664_0173097 | |||
| 1439 | Ga0495608_0123062 | |||
| 1440 | Ga0495618_0031281 | |||
| 1441 | Ga0495632_0055592 | |||
| 1442 | Ga0495652_0196469 | |||
| 1443 | Ga0495640_0208403 | |||
| 1444 | Ga0495657_0169212 | |||
| 1445 | Ga0495658_0044687 | |||
| 1446 | Ga0495658_0103623 | |||
| 1447 | Ga0495600_0186282 | |||
| 1448 | Ga0496100_0026145 | |||
| 1449 | Ga0496100_0110542 | |||
| 1450 | Ga0496100_0112604 | |||
| 1451 | Ga0496101_0089944 | |||
| 1452 | Ga0496101_0106388 | |||
| 1453 | Ga0496101_0109631 | |||
| 1454 | Ga0496101_0157574 | |||
| 1455 | Ga0496101_0377959 | |||
| 1456 | Ga0496102_0001679 | |||
| 1457 | Ga0496102_0003877 | |||
| 1458 | Ga0496102_0023288 | |||
| 1459 | Ga0496102_0024876 | |||
| 1460 | Ga0496102_0028012 | |||
| 1461 | Ga0496102_0076271 | |||
| 1462 | Ga0496102_0161077 | |||
| 1463 | Ga0496102_0268687 | |||
| 1464 | Ga0496102_0309052 | |||
| 1465 | Ga0496103_0030118 | |||
| 1466 | Ga0496103_0160569 | |||
| 1467 | Ga0496103_0203780 | |||
| 1468 | Ga0496104_0068485 | |||
| 1469 | Ga0496104_0261566 | |||
| 1470 | Ga0496104_0334156 | |||
| 1471 | Ga0496104_0461963 | |||
| 1472 | Ga0496105_0003593 | |||
| 1473 | Ga0496105_0008048 | |||
| 1474 | Ga0496105_0301802 | |||
| 1475 | Ga0496106_0015296 | |||
| 1476 | Ga0496106_0018504 | |||
| 1477 | Ga0496106_0134859 | |||
| 1478 | Ga0496107_0035852 | |||
| 1479 | Ga0496107_0213334 | |||
| 1480 | Ga0496108_0000029 | |||
| 1481 | Ga0496108_0021411 | |||
| 1482 | Ga0496108_0053647 | |||
| 1483 | Ga0496108_0165719 | |||
| 1484 | Ga0496108_0194250 | |||
| 1485 | Ga0496109_0019013 | |||
| 1486 | Ga0496109_0060095 | |||
| 1487 | Ga0496109_0078276 | |||
| 1488 | Ga0496109_0139809 | |||
| 1489 | Ga0496109_0190228 | |||
| 1490 | Ga0496109_0218728 | |||
| 1491 | Ga0496109_0411968 | |||
| 1492 | Ga0496110_0083619 | |||
| 1493 | Ga0496110_0084773 | |||
| 1494 | Ga0496110_0159245 | |||
| 1495 | Ga0496110_0262354 | |||
| 1496 | Ga0496111_0078856 | |||
| 1497 | Ga0496111_0084703 | |||
| 1498 | Ga0496111_0114783 | |||
| 1499 | Ga0496111_0188658 | |||
| 1500 | Ga0496112_0075847 | |||
| 1501 | Ga0496112_0127657 | |||
| 1502 | Ga0496112_0248695 | |||
| 1503 | Ga0496113_0021901 | |||
| 1504 | Ga0496113_0065827 | |||
| 1505 | Ga0496113_0187099 | |||
| 1506 | Ga0496114_0004572 | |||
| 1507 | Ga0496114_0012911 | |||
| 1508 | Ga0496114_0014354 | |||
| 1509 | Ga0496114_0015345 | |||
| 1510 | Ga0496114_0072030 | |||
| 1511 | Ga0496114_0082389 | |||
| 1512 | Ga0496114_0088916 | |||
| 1513 | Ga0496114_0175301 | |||
| 1514 | Ga0496114_0242440 | |||
| 1515 | Ga0496114_0290511 | |||
| 1516 | Ga0496115_0001458 | |||
| 1517 | Ga0496115_0074357 | |||
| 1518 | Ga0496115_0077411 | |||
| 1519 | Ga0496119_0001068 | |||
| 1520 | Ga0496120_0000103 | |||
| 1521 | Ga0496126_0237298 | |||
| 1522 | Ga0501031_0017084 | |||
| 1523 | Ga0501031_0105160 | |||
| 1524 | Ga0501031_0115831 | |||
| 1525 | Ga0501031_0134448 | |||
| 1526 | Ga0501032_0005543 | |||
| 1527 | Ga0501032_0020844 | |||
| 1528 | Ga0501033_0002108 | |||
| 1529 | Ga0501033_0028148 | |||
| 1530 | Ga0501033_0104871 | |||
| 1531 | Ga0501033_0112939 | |||
| 1532 | Ga0501034_0023454 | |||
| 1533 | Ga0501034_0053987 | |||
| 1534 | Ga0501034_0412162 | |||
| 1535 | Ga0501036_0008657 | |||
| 1536 | Ga0501036_0008684 | |||
| 1537 | Ga0501036_0009779 | |||
| 1538 | Ga0501036_0036455 | |||
| 1539 | Ga0501036_0072343 | |||
| 1540 | Ga0501036_0226522 | |||
| 1541 | Ga0501037_0007658 | |||
| 1542 | Ga0501037_0008499 | |||
| 1543 | Ga0501037_0024917 | |||
| 1544 | Ga0501037_0026338 | |||
| 1545 | Ga0501037_0027690 | |||
| 1546 | Ga0501038_0001411 | |||
| 1547 | Ga0501038_0005982 | |||
| 1548 | Ga0501039_0004034 | |||
| 1549 | Ga0501039_0073509 | |||
| 1550 | Ga0501039_0137797 | |||
| 1551 | Ga0501039_0410465 | |||
| 1552 | Ga0501040_0010935 | |||
| 1553 | Ga0501040_0214894 | |||
| 1554 | Ga0501040_0229811 | |||
| 1555 | Ga0501041_0005388 | |||
| 1556 | Ga0501042_0004768 | |||
| 1557 | Ga0501042_0011275 | |||
| 1558 | Ga0501042_0014282 | |||
| 1559 | Ga0501042_0169484 | |||
| 1560 | Ga0501043_0003129 | |||
| 1561 | Ga0501043_0098331 | |||
| 1562 | Ga0501046_0000841 | |||
| 1563 | Ga0501046_0016344 | |||
| 1564 | Ga0501046_0061655 | |||
| 1565 | Ga0501046_0232814 | |||
| 1566 | Ga0501047_0004414 | |||
| 1567 | Ga0501047_0086847 | |||
| 1568 | Ga0501048_0002290 | |||
| 1569 | Ga0501048_0034957 | |||
| 1570 | Ga0501048_0112234 | |||
| 1571 | Ga0501067_0049904 | |||
| 1572 | Ga0501067_0071898 | |||
| 1573 | Ga0501067_0179926 | |||
| 1574 | Ga0501068_0030555 | |||
| 1575 | Ga0501069_0011110 | |||
| 1576 | Ga0501069_0070083 | |||
| 1577 | Ga0501069_0080857 | |||
| 1578 | Ga0501070_0013674 | |||
| 1579 | Ga0501070_0108014 | |||
| 1580 | Ga0501070_0148380 | |||
| 1581 | Ga0501070_0196549 | |||
| 1582 | Ga0501071_0026943 | |||
| 1583 | Ga0501071_0080394 | |||
| 1584 | Ga0501071_0169046 | |||
| 1585 | Ga0501072_0013614 | |||
| 1586 | Ga0501072_0077428 | |||
| 1587 | Ga0501072_0184360 | |||
| 1588 | Ga0501073_0254075 | |||
| 1589 | Ga0501074_0027043 | |||
| 1590 | Ga0501074_0080536 | |||
| 1591 | Ga0501074_0104186 | |||
| 1592 | Ga0501074_0117776 | |||
| 1593 | Ga0501075_0005329 | |||
| 1594 | Ga0501075_0022558 | |||
| 1595 | Ga0501076_0003246 | |||
| 1596 | Ga0501076_0009396 | |||
| 1597 | Ga0501076_0160059 | |||
| 1598 | Ga0501076_0268342 | |||
| 1599 | Ga0501076_0410379 | |||
| 1600 | Ga0501077_0017963 | |||
| 1601 | Ga0501077_0081074 | |||
| 1602 | Ga0501077_0284482 | |||
| 1603 | Ga0501079_0018295 | |||
| 1604 | Ga0501079_0019142 | |||
| 1605 | Ga0501079_0039588 | |||
| 1606 | Ga0501079_0056653 | |||
| 1607 | Ga0501079_0427833 | |||
| 1608 | Ga0501080_0051549 | |||
| 1609 | Ga0501080_0051621 | |||
| 1610 | Ga0501080_0167432 | |||
| 1611 | Ga0501080_0221404 | |||
| 1612 | Ga0501081_0021306 | |||
| 1613 | Ga0501083_0033902 | |||
| 1614 | Ga0501035_0012022 | |||
| 1615 | Ga0501035_0042476 | |||
| 1616 | Ga0501044_0017119 | |||
| 1617 | Ga0501044_0096708 | |||
| 1618 | Ga0501045_0049862 | |||
| 1619 | Ga0501045_0095127 | |||
| 1620 | Ga0501045_0116345 | |||
| 1621 | Ga0501045_0129091 | |||
| 1622 | nmdc:mga03n38_180901_c1 | |||
| 1623 | nmdc:mga03n38_6635_c1 | |||
| 1624 | nmdc:mga03n38_71204_c1 | |||
| 1625 | nmdc:mga00v17_5910_c1 | |||
| 1626 | nmdc:mga0yw44_10082_c1 | |||
| 1627 | nmdc:mga0yw44_10882_c1 | |||
| 1628 | nmdc:mga0yw44_126786_c1 | |||
| 1629 | nmdc:mga0yw44_139929_c1 | |||
| 1630 | nmdc:mga0yw44_14102_c2 | |||
| 1631 | nmdc:mga0yw44_25005_c1 | |||
| 1632 | nmdc:mga0yw44_26964_c1 | |||
| 1633 | nmdc:mga0yw44_31193_c1 | |||
| 1634 | nmdc:mga0yw44_37885_c1 | |||
| 1635 | nmdc:mga0yw44_68788_c1 | |||
| 1636 | nmdc:mga04h51_6015_c1 | |||
| 1637 | nmdc:mga07m45_26650_c1 | |||
| 1638 | nmdc:mga05p37_22251_c1 | |||
| 1639 | nmdc:mga05p37_32742_c1 | |||
| 1640 | nmdc:mga05p37_960_c2 | |||
| 1641 | nmdc:mga09592_20_c1 | |||
| 1642 | nmdc:mga09592_52005_c1 | |||
| 1643 | nmdc:mga0qj67_1435_c1 | |||
| 1644 | nmdc:mga0qj67_222730_c1 | |||
| 1645 | nmdc:mga0qj67_38666_c1 | |||
| 1646 | nmdc:mga0qj67_5065_c1 | |||
| 1647 | nmdc:mga06r32_89_c1 | |||
| 1648 | nmdc:mga08y16_2421_c1 | |||
| 1649 | nmdc:mga08y16_250408_c1 | |||
| 1650 | nmdc:mga08y16_3646_c1 | |||
| 1651 | nmdc:mga08y16_4458_c1 | |||
| 1652 | nmdc:mga0rr50_59006_c1 | |||
| 1653 | nmdc:mga08x19_86882_c1 | |||
| 1654 | nmdc:mga0a205_102345_c1 | |||
| 1655 | nmdc:mga0a205_121873_c1 | |||
| 1656 | Ga0495601_0152878 | |||
| 1657 | Ga0495655_0047129 | |||
| 1658 | Ga0495619_0082755 | |||
| 1659 | Ga0500644_0004160 | |||
| 1660 | Ga0500646_0000579 | |||
| 1661 | Ga0500583_0166702 | |||
| 1662 | Ga0500641_0025082 | |||
| 1663 | Ga0500650_0063720 | |||
| 1664 | Ga0500556_0001238 | |||
| 1665 | Ga0500556_0045806 | |||
| 1666 | Ga0500593_000208 | |||
| 1667 | Ga0500652_048424 | |||
| 1668 | Ga0500573_0025511 | |||
| 1669 | Ga0500616_0001402 | |||
| 1670 | Ga0500616_0032899 | |||
| 1671 | Ga0501084_0015872 | |||
| 1672 | Ga0501084_0057608 | |||
| 1673 | Ga0501082_0010696 | |||
| 1674 | Ga0501082_0036031 | |||
| 1675 | Ga0501082_0460611 | |||
| 1676 | Ga0466962_0103853 | |||
| 1677 | Ga0466962_0139294 | |||
| 1678 | Ga0530510_0003798 | |||
| 1679 | Ga0530510_0050137 | |||
| 1680 | 2501942198 | |||
| 1681 | 2515495052 | |||
| 1682 | 2515719056 | |||
| 1683 | 2515754992 | |||
| 1684 | 2516083262 | |||
| 1685 | 2516088636 | |||
| 1686 | 2586059491 | |||
| 1687 | 2623590903 | |||
| 1688 | 2643825479 | |||
| 1689 | 2643850486 | |||
| 1690 | 2643889076 | |||
| 1691 | 2643942298 | |||
| 1692 | 2643958131 | |||
| 1693 | 2644034611 | |||
| 1694 | 2644089685 | |||
| 1695 | 2644098982 | |||
| 1696 | 2644114863 | |||
| 1697 | 2644134243 | |||
| 1698 | 2644319530 | |||
| 1699 | 2644389952 | |||
| 1700 | 2644429379 | |||
| 1701 | 2644435823 | |||
| 1702 | 2644531475 | |||
| 1703 | 2644632288 | |||
| 1704 | 2676475072 | |||
| 1705 | 2738867978 | |||
| 1706 | 2740166899 | |||
| 1707 | 2753272289 | |||
| 1708 | 2768647542 | |||
| 1709 | 2772641604 | |||
| 1710 | 2772644123 | |||
| 1711 | 2774393477 | |||
| 1712 | 2784471936 | |||
| 1713 | 2795784400 | |||
| 1714 | 2808840634 | |||
| 1715 | 2808873786 | |||
| 1716 | 2809195629 | |||
| 1717 | 2809591747 | |||
| 1718 | 2812332293 | |||
| 1719 | 2812350535 | |||
| 1720 | 2819427239 | |||
| 1721 | 2827629996 | |||
| 1722 | 2831936376 | |||
| 1723 | 2832010596 | |||
| 1724 | 2855387717 | |||
| 1725 | 2855672180 | |||
| 1726 | 2855676345 | |||
| 1727 | 2855681483 | |||
| 1728 | 2855682773 | |||
| 1729 | 2855686788 | |||
| 1730 | 2856743596 | |||
| 1731 | 2856864576 | |||
| 1732 | 2857291860 | |||
| 1733 | 2857294765 | |||
| 1734 | 2857483064 | |||
| 1735 | 2858854430 | |||
| 1736 | 2858855251 | |||
| 1737 | 2858873895 | |||
| 1738 | 2858888489 | |||
| 1739 | 2858888817 | |||
| 1740 | 2858889090 | |||
| 1741 | 2858890813 | |||
| 1742 | 2858897335 | |||
| 1743 | 2858899255 | |||
| 1744 | 2858905850 | |||
| 1745 | 2862709787 | |||
| 1746 | 2866068247 | |||
| 1747 | 2866553742 | |||
| 1748 | 2867303449 | |||
| 1749 | 2867316195 | |||
| 1750 | 2867321061 | |||
| 1751 | 2867511677 | |||
| 1752 | 2869048676 | |||
| 1753 | 2869054122 | |||
| 1754 | 2869062344 | |||
| 1755 | 2869066086 | |||
| 1756 | 2869070732 | |||
| 1757 | 2869073158 | |||
| 1758 | 2880489596 | |||
| 1759 | 2880496108 | |||
| 1760 | 2880498522 | |||
| 1761 | 2884697395 | |||
| 1762 | 2891397796 | |||
| 1763 | 2891564898 | |||
| 1764 | 2891971866 | |||
| 1765 | 2895430981 | |||
| 1766 | 2895452903 | |||
| 1767 | 2902588071 | |||
| 1768 | 2915771797 | |||
| 1769 | 2918505543 | |||
| 1770 | 2919449929 | |||
| 1771 | 2929224785 | |||
| 1772 | 2929227108 | |||
| 1773 | 2929232280 | |||
| 1774 | 2954696952 | |||
| 1775 | 2954705182 | |||
| 1776 | 2984576990 | |||
| 1777 | 2990258737 | |||
| 1778 | 2996227482 | |||
| 1779 | 3001891240 | |||
| 1780 | 649813897 | |||
| 1781 | 8001790020 | |||
| 1782 | 8003834570 | |||
| 1783 | 8003860585 | |||
| 1784 | 8003877110 | |||
| 1785 | 8054707685 | |||
| 1786 | 8054710221 | |||
| 1787 | 8054731037 | |||
| 1788 | 8054732869 | |||
| 1789 | 8054735169 | |||
| 1790 | 8054738941 | |||
| 1791 | 8055418423 | |||
| 1792 | 8056211136 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4pvv-assembly1.cif.gz_A-2 | micobacterial adenosine kinase in complex with inhibitor | 0.9449 | 1 | 324 |
| 4pvv-assembly1.cif.gz_A-2 | micobacterial adenosine kinase in complex with inhibitor | 0.9421 | 1 | 324 |
| 6c9n-assembly1.cif.gz_A | mycobacterium tuberculosis adenosine kinase bound to sangivamycin | 0.9402 | 3 | 323 |
| 6c9s-assembly1.cif.gz_B | mycobacterium tuberculosis adenosine kinase bound to (2r,3r,4s,5r)-2-(6-([1,1'-biphenyl]-4-ylethynyl)-9h-purin-9-yl)-5-(hydroxymethyl)tetrahydrofuran-3,4-diol | 0.9374 | 3 | 323 |
| 6c9p-assembly1.cif.gz_B | mycobacterium tuberculosis adenosine kinase bound to 6-methylmercaptopurine riboside | 0.9362 | 3 | 323 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2pknA00 | Alpha Beta;3-Layer(aba) Sandwich;UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase;Ribokinase | 0.9338 | 1 | 323 | 3.40.1190.20 |
| 2pknA00 | Alpha Beta;3-Layer(aba) Sandwich;UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase;Ribokinase | 0.931 | 1 | 323 | 3.40.1190.20 |
| 2c4eA00 | Alpha Beta;3-Layer(aba) Sandwich;UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase;Ribokinase | 0.8902 | 2 | 308 | 3.40.1190.20 |
| 2c4eA00 | Alpha Beta;3-Layer(aba) Sandwich;UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase;Ribokinase | 0.8673 | 2 | 308 | 3.40.1190.20 |
| 3b1rD00 | Alpha Beta;3-Layer(aba) Sandwich;UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase;Ribokinase | 0.8671 | 3 | 313 | 3.40.1190.20 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2D9H4B3-F1-model_v4 | Carbohydrate kinase family protein | 0.9932 | 2 | 324 |
GO:0006796
GO:0016301 |
| AF-A0A5C8HHB2-F1-model_v4 | deleted | 0.9927 | 1 | 171 |
|
| AF-A0A6B2T8K4-F1-model_v4 | Carbohydrate kinase family protein | 0.9884 | 1 | 233 |
GO:0006796
GO:0016301 |
| AF-A0A2D9H4B3-F1-model_v4 | Carbohydrate kinase family protein | 0.9871 | 2 | 324 |
GO:0006796
GO:0016301 |
| AF-A0A5C8HHB2-F1-model_v4 | deleted | 0.9869 | 1 | 171 |
|