F485030

General Info

Members Datasets Scaffolds Average Seq Length
896 431 1792 325

Family's Representative Sequence

Representative Sequence 3300050491|nmdc:mga00v17_27702_c1|nmdc:mga00v17_27702_c1_1937_3073
Length 378
Sequence MVCGLSSSKKALTGSTVGITARYAQPAPGNTDHQRFPLGFPDVPDTAADGAGALLIAGSIATDHLMSFGGRFEDSLVVEQLHKLSVSFLVDDLEIRRGGVAANMCFGLGRLGLTPVLVGCAGDDFADYRSWLERHGVDCDHVRISDTHHTARFVCTTDTTGAQFASFYPGAMSEARLVELAPIVAKVGAPSYVLIGADDPDGMLRHTEECRQRGYRFIADPSQQLAFGEGELIRNLIDGAAFLFSNEYESAMIEQKTGWSSDEVLSRVGIQVTTLGKDGVRVLRRGEEPIERPAAKDVRALEPTGVGDAFRAGFLGALAWGLSLEHAAEVGCVLAAYVVETVGPQDYTFTAEQFLGRLDASYGGEAAEAVRPHLTAVS

Samples

Sample ID Description Type Environment
1 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
5 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
6 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
7 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
8 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
18 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
19 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
20 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
21 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
22 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
23 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
24 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
25 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
26 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
27 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
28 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
29 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
30 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
31 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
32 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
33 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
34 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
35 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
36 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
37 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
38 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
39 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
40 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
41 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
42 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
43 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
44 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
45 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
46 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
47 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
48 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
49 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
50 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
51 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
52 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
53 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
54 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
55 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
56 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
57 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
58 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
59 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
60 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
61 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
62 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
63 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
64 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
65 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
66 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
67 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
68 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
69 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
70 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
71 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
72 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
73 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
74 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
75 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
76 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
77 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
78 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
79 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
80 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
81 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
82 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
83 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
84 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
85 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
86 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
87 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
88 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
89 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
90 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
91 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
92 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
93 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
94 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
95 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
96 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
97 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
98 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
99 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
100 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
101 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
102 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
103 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
104 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
105 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
106 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
107 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
108 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
109 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
110 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
111 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
112 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
113 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
114 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
115 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
116 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
117 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
118 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
119 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
120 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
121 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
122 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
123 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
124 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
180 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
181 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
185 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
186 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
187 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
188 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
189 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
190 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
191 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
192 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
193 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
194 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
195 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
196 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
197 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
198 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
199 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
200 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
201 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
202 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
203 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
204 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
205 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
206 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
207 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
208 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
209 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
210 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
211 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
212 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
213 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
214 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
215 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
216 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
217 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
218 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
219 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
220 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
221 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
222 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
223 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
224 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
225 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
226 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
227 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
228 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
229 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
230 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
231 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
232 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
233 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
234 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
235 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
236 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
237 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
238 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
239 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
240 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
241 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
242 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
243 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
244 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
245 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
246 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
247 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
248 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
249 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
250 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
251 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
252 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
253 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
254 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
255 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
256 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
257 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
258 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
259 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
260 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
261 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
262 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
263 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
264 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
265 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
266 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
267 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
268 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
269 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
270 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
271 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
272 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
273 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
274 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
275 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
276 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
277 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
278 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
279 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
280 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
281 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
282 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
283 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
284 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
285 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
286 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
287 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
288 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
289 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
290 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
291 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
292 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
293 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
294 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
295 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
296 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
297 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
298 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
299 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
300 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
301 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
302 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
303 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
304 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
305 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
306 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
307 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
308 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
309 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
310 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
311 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
312 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
313 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
314 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
315 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
316 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
317 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
318 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
319 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
320 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
321 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
322 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
323 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
324 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
325 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
326 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
327 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
328 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
329 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
330 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
331 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
332 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
333 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
334 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
335 2501939600 Micromonospora sp. L5 Isolate Unclassified
336 2515154088 Salinispora arenicola CNT800 Isolate Rhizosphere
337 2515154129 Salinispora pacifica CNS103 Isolate Rhizosphere
338 2515154137 Salinispora arenicola CNX482 Isolate Rhizosphere
339 2515154202 Salinispora pacifica CNT084 Isolate Rhizosphere
340 2515154203 Salinispora arenicola CNR921 Isolate Rhizosphere
341 2585427649 Amycolatopsis japonica MG417-CF17, DSM 44213 Isolate Unclassified
342 2622736626 Micromonospora rhizosphaerae DSM 45431 Isolate Rhizosphere
343 2643221561 Nocardioides sp. Root151 Isolate Unclassified
344 2643221567 Phycicoccus sp. Root563 Isolate Unclassified
345 2643221576 Nocardioides sp. Root614 Isolate Unclassified
346 2643221587 Streptomyces sp. Root66D1 Isolate Unclassified
347 2643221590 Nocardioides sp. Root682 Isolate Unclassified
348 2643221604 Nocardioides sp. Root190 Isolate Unclassified
349 2643221615 Nocardioides sp. Root224 Isolate Unclassified
350 2643221617 Nocardioides sp. Root79 Isolate Unclassified
351 2643221620 Nocardioides sp. Root240 Isolate Unclassified
352 2643221624 Phycicoccus sp. Root101 Isolate Unclassified
353 2643221657 Nocardioides sp. Root1257 Isolate Unclassified
354 2643221670 Streptomyces sp. Root431 Isolate Unclassified
355 2643221677 Streptomyces sp. Root1304 Isolate Unclassified
356 2643221678 Streptomyces sp. Root1310 Isolate Unclassified
357 2643221696 Nocardioides sp. Root140 Isolate Unclassified
358 2643221714 Streptomyces sp. Root264 Isolate Unclassified
359 2675903058 Actinopolymorpha cephalotaxi CPCC 202808 Isolate Rhizosphere
360 2738541305 Nocardioides sp. CF167 Isolate Unclassified
361 2739367898 Nocardioides sp. CF479 Isolate Unclassified
362 2751185782 Actinoplanes subtropicus NRRL B-24665 Isolate Rhizosphere
363 2767802112 Streptomyces avicenniae NRRL B-24776 Isolate Rhizosphere
364 2772190715 Micromonospora chokoriensis NRRL B-24750 Isolate Unclassified
365 2773857762 Nocardioides sp. SAI-095 Isolate Unclassified
366 2784132109 Dermacoccus sp. DS28 SAI-028 Isolate Unclassified
367 2795385470 Labedaea rhizosphaerae DSM 45361 Isolate Rhizosphere
368 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
369 2808606365 Phycicoccus sp. SLBN-51 Isolate Unclassified
370 2808606439 Nocardioides sp. SLBN-172 Isolate Unclassified
371 2808606522 Amycolatopsis sp. BJA-103 Isolate Unclassified
372 2811994874 Nocardioides sp. SLBN-35 Isolate Unclassified
373 2811994878 Nocardioides sp. SLBN-169 Isolate Unclassified
374 2818991318 Humibacillus xanthopallidus SLBN-155 Isolate Unclassified
375 2827628540 Actinopolymorpha cephalotaxi DSM 45117 Isolate Rhizosphere
376 2831935698 Jishengella sp. AZ1-13 Isolate Unclassified
377 2832004796 Micromonospora endophytica JCM 18317 Isolate Unclassified
378 2855386786 Nocardioides ferulae EGI 63112 Isolate Unclassified
379 2855670206 Micromonospora noduli Lupac 07 Isolate Nodule
380 2855676851 Micromonospora saelicesensis GAR05 Isolate Unclassified
381 2855683550 Micromonospora sp. RP3T Isolate Unclassified
382 2856741275 Microbispora triticiradicis NEAU-HRDPA2-9 Isolate Unclassified
383 2856858025 Micromonospora aurantiaca 110B(2018) Isolate Unclassified
384 2857288857 Micromonospora noduli ONO23 Isolate Unclassified
385 2857481737 Nocardioides sp. R-74106 Isolate Unclassified
386 2858848962 Micromonospora saelicesensis GAR06 Isolate Unclassified
387 2858868258 Micromonospora sp. MH33 Isolate Unclassified
388 2858882152 Micromonospora noduli MED15 Isolate Nodule
389 2858888857 Micromonospora saelicesensis Lupac 06 Isolate Unclassified
390 2858895516 Micromonospora saelicesensis PSN13 Isolate Unclassified
391 2858902515 Micromonospora sp. MW-13 Isolate Rhizosphere
392 2862705112 Streptomyces triticirhizae NEAU-YY642 Isolate Rhizosphere
393 2866065130 Micromonospora endophytica DSM 45430 Isolate Unclassified
394 2866552031 Saccharopolyspora rhizosphaerae H219 Isolate Unclassified
395 2867302475 Micromonospora globbae WPS1-2 Isolate Unclassified
396 2867312974 Micromonospora musae NGC1-4 Isolate Unclassified
397 2867319477 Micromonospora musae MS1-9 Isolate Unclassified
398 2867507094 Micromonospora zingiberis PLAI 1-1 Isolate Unclassified
399 2869048445 Micromonospora saelicesensis PSN01 Isolate Unclassified
400 2869061728 Micromonospora noduli ONO86 Isolate Unclassified
401 2869068681 Micromonospora noduli GUI43 Isolate Unclassified
402 2880489317 Micromonospora ureilytica DSM 101692 Isolate Unclassified
403 2880495981 Micromonospora vinacea DSM 101695 Isolate Unclassified
404 2884693830 Nonomuraea phyllanthi WYY166 Isolate Unclassified
405 2891395885 Microbispora catharanthi CR1-09 Isolate Unclassified
406 2891562705 Microbispora tritici MT50 Isolate Unclassified
407 2891968417 Nocardioides luteus SAI-037 Isolate Unclassified
408 2895427314 Nonomuraea sp. PA05 Isolate Unclassified
409 2895442618 Nonomuraea phyllanthi PA1-10 Isolate Unclassified
410 2902582711 Micromonospora sp. AP08 Isolate Unclassified
411 2915768154 Amycolatopsis pittospori PIP199 Isolate Unclassified
412 2918501144 Streptomyces sp. PvR006 Isolate Rhizosphere
413 2919446982 Phycicoccus sp. 3266 Isolate Rhizosphere
414 2929219909 Micromonospora sp. R-75348 Hybrid assembly Isolate Unclassified
415 2929226422 Micromonospora sp. R-74116 Hybrid assembly Isolate Unclassified
416 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
417 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
418 2984576629 Nocardioides zeae SORGH_AS913 Isolate Aerial Root
419 2990256926 Nocardioides zeae SORGH_AS885 Isolate Aerial Root
420 2996221748 Micromonospora veneta CAP181 Isolate Unclassified
421 3001889506 Janibacter sp. YIM B02568 Isolate Unclassified
422 649633069 Micromonospora sp. L5 Isolate Unclassified
423 8001781756 Catellatospora tritici NEAU-YM18 Isolate Rhizosphere
424 8003830390 Micromonospora parastrephiae STR1_7 Isolate Rhizosphere
425 8003856774 Micromonospora echinofusca MPMI6 Isolate Unclassified
426 8003870546 Micromonospora tarensis STR1s_6 Isolate Rhizosphere
427 8054704163 Micromonospora trifolii NIE79 Isolate Nodule
428 8054727385 Micromonospora alfalfae MED01 Isolate Nodule
429 8054734606 Micromonospora hortensis NIE111 Isolate Nodule
430 8055412473 Micromonospora phytophila DSM 105363 Isolate Nodule
431 8056207758 Saccharopolyspora indica KCTC 29208 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 86.38
Metatranscriptomes 1
Isolates 12.61

Biome Distribution

Category Percentage (%)
Aerial Root 0.22
Bulb 0
Endosphere 5.47
Nodule 1.34
Rhizoplane 8.04
Rhizosphere 72.66
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 nmdc:mga00v17_27702_c1 3300050491 Bacteria 3311
2 JGI24740J21852_10013057 3300001979 Bacteria 3114
3 JGI24737J22298_10053044 3300001990 Bacteria 1229
4 JGI24738J21930_10015359 3300002075 Bacteria 1630
5 JGI24744J21845_10009530 3300002077 Bacteria 1992
6 JGI25406J46586_10000292 3300003203 Bacteria 22443
7 JGI25406J46586_10013791 3300003203 Bacteria 3456
8 JGI25407J50210_10026054 3300003373 Bacteria 1516
9 Ga0006562J51391_1031195 3300003578 Bacteria 3870
10 Ga0070676_10029361 3300005328 Bacteria 3127
11 Ga0070683_100004647 3300005329 Bacteria 11347
12 Ga0070683_100005801 3300005329 Bacteria 10324
13 Ga0070683_100008155 3300005329 Bacteria 8897
14 Ga0070683_100463844 3300005329 Bacteria 1209
15 Ga0070670_100074618 3300005331 Bacteria 2914
16 Ga0068869_100004417 3300005334 Bacteria 8740
17 Ga0068869_100007855 3300005334 Bacteria 6848
18 Ga0068869_100030634 3300005334 Bacteria 3778
19 Ga0070680_100036712 3300005336 Bacteria 3959
20 Ga0070680_100042402 3300005336 Bacteria 3692
21 Ga0070682_100010967 3300005337 Bacteria 5164
22 Ga0070682_100035749 3300005337 Bacteria 3034
23 Ga0070682_100250907 3300005337 Bacteria 1275
24 Ga0068868_100047152 3300005338 Bacteria 3375
25 Ga0068868_100100797 3300005338 Bacteria 2336
26 Ga0068868_100121338 3300005338 Bacteria 2132
27 Ga0070660_100025915 3300005339 Bacteria 4362
28 Ga0070689_100023594 3300005340 Bacteria 4606
29 Ga0070691_10000786 3300005341 Bacteria 12615
30 Ga0070687_100047430 3300005343 Bacteria 2204
31 Ga0070661_100344284 3300005344 Bacteria 1168
32 Ga0070661_100362772 3300005344 Bacteria 1139
33 Ga0070692_10005824 3300005345 Bacteria 5300
34 Ga0070668_100001449 3300005347 Bacteria 17138
35 Ga0070668_100055098 3300005347 Bacteria 3069
36 Ga0070668_100091485 3300005347 Bacteria 2399
37 Ga0070668_100196950 3300005347 Bacteria 1653
38 Ga0070675_100001934 3300005354 Bacteria 15319
39 Ga0070675_100087605 3300005354 Bacteria 2603
40 Ga0070674_100012101 3300005356 Bacteria 5286
41 Ga0070673_100075845 3300005364 Bacteria 2713
42 Ga0070688_100054608 3300005365 Bacteria 2503
43 Ga0070659_100139969 3300005366 Bacteria 1970
44 Ga0070659_100434085 3300005366 Bacteria 1112
45 Ga0070667_100056769 3300005367 Bacteria 3308
46 Ga0070667_100162288 3300005367 Bacteria 1969
47 Ga0070709_10000730 3300005434 Bacteria 18584
48 Ga0070709_10065399 3300005434 Bacteria 2328
49 Ga0070714_100001418 3300005435 Bacteria 17401
50 Ga0070714_100003214 3300005435 Bacteria 12157
51 Ga0070714_100086327 3300005435 Bacteria 2742
52 Ga0070714_100093214 3300005435 Bacteria 2641
53 Ga0070714_100096738 3300005435 Bacteria 2594
54 Ga0070713_100001109 3300005436 Bacteria 17148
55 Ga0070713_100012557 3300005436 Bacteria 6218
56 Ga0070713_100082644 3300005436 Bacteria 2743
57 Ga0070713_100249254 3300005436 Bacteria 1619
58 Ga0070710_10000758 3300005437 Bacteria 15386
59 Ga0070711_100000258 3300005439 Bacteria 27048
60 Ga0070711_100011131 3300005439 Bacteria 5581
61 Ga0070711_100031406 3300005439 Bacteria 3526
62 Ga0070700_100006435 3300005441 Bacteria 6283
63 Ga0070700_100031847 3300005441 Bacteria 3164
64 Ga0070678_100386959 3300005456 Bacteria 1211
65 Ga0070662_100040578 3300005457 Bacteria 3315
66 Ga0070681_10027499 3300005458 Bacteria 5718
67 Ga0070681_10100741 3300005458 Bacteria 2834
68 Ga0068867_100030779 3300005459 Bacteria 3871
69 Ga0070685_10011861 3300005466 Bacteria 4568
70 Ga0070685_10252611 3300005466 Bacteria 1168
71 Ga0070706_100009310 3300005467 Bacteria 9152
72 Ga0070707_100012904 3300005468 Bacteria 7804
73 Ga0070707_100417586 3300005468 Bacteria 1302
74 Ga0070698_100000873 3300005471 Bacteria 33116
75 Ga0070698_100010105 3300005471 Bacteria 10081
76 Ga0070698_100290868 3300005471 Bacteria 1565
77 Ga0070699_100363920 3300005518 Bacteria 1304
78 Ga0070679_100077187 3300005530 Bacteria 3320
79 Ga0070679_100086156 3300005530 Bacteria 3128
80 Ga0070684_100007069 3300005535 Bacteria 8726
81 Ga0070684_100086484 3300005535 Bacteria 2782
82 Ga0070684_100116628 3300005535 Bacteria 2398
83 Ga0070697_100223369 3300005536 Bacteria 1605
84 Ga0070672_100007050 3300005543 Bacteria 7599
85 Ga0070686_100279939 3300005544 Bacteria 1230
86 Ga0070693_100001271 3300005547 Bacteria 11405
87 Ga0070665_100000865 3300005548 Bacteria 39234
88 Ga0070665_100125179 3300005548 Bacteria 2572
89 Ga0068855_100399425 3300005563 Bacteria 1506
90 Ga0070664_100003004 3300005564 Bacteria 13641
91 Ga0070664_100053722 3300005564 Bacteria 3416
92 Ga0070664_100302006 3300005564 Bacteria 1447
93 Ga0068857_100058531 3300005577 Bacteria 3422
94 Ga0068857_100389550 3300005577 Bacteria 1295
95 Ga0068854_100355565 3300005578 Bacteria 1200
96 Ga0068856_100055390 3300005614 Bacteria 3913
97 Ga0068856_100176336 3300005614 Bacteria 2150
98 Ga0068856_100592335 3300005614 Bacteria 1130
99 Ga0070702_100003214 3300005615 Bacteria 7264
100 Ga0070702_100024536 3300005615 Bacteria 3218
101 Ga0070702_100037982 3300005615 Bacteria 2678
102 Ga0068852_100040897 3300005616 Bacteria 3915
103 Ga0068852_100134207 3300005616 Bacteria 2284
104 Ga0068864_100008703 3300005618 Bacteria 8374
105 Ga0068861_100003359 3300005719 Bacteria 10606
106 Ga0068861_100071581 3300005719 Bacteria 2688
107 Ga0068861_100156765 3300005719 Bacteria 1874
108 Ga0068861_100169457 3300005719 Bacteria 1808
109 Ga0068861_100174152 3300005719 Bacteria 1786
110 Ga0068861_100221061 3300005719 Bacteria 1601
111 Ga0068870_10001666 3300005840 Bacteria 9090
112 Ga0068870_10014561 3300005840 Bacteria 3716
113 Ga0068863_100059072 3300005841 Bacteria 3629
114 Ga0068863_100268002 3300005841 Bacteria 1652
115 Ga0068863_100531608 3300005841 Bacteria 1160
116 Ga0068858_100074234 3300005842 Bacteria 3158
117 Ga0068860_100002948 3300005843 Bacteria 17594
118 Ga0068862_100027387 3300005844 Bacteria 4798
119 Ga0081455_10002300 3300005937 Bacteria 22762
120 Ga0081538_10004313 3300005981 Bacteria 13147
121 Ga0081540_1002450 3300005983 Bacteria 15109
122 Ga0081540_1027134 3300005983 Bacteria 3251
123 Ga0081539_10000242 3300005985 Bacteria 127897
124 Ga0081539_10000309 3300005985 Bacteria 109561
125 Ga0081539_10000364 3300005985 Bacteria 99066
126 Ga0081539_10000432 3300005985 Bacteria 89138
127 Ga0081539_10002151 3300005985 Bacteria 29070
128 Ga0081539_10011082 3300005985 Bacteria 7203
129 Ga0081539_10061848 3300005985 Bacteria 2049
130 Ga0081539_10072958 3300005985 Bacteria 1832
131 Ga0081539_10130509 3300005985 Bacteria 1235
132 Ga0070717_10039960 3300006028 Bacteria 3819
133 Ga0070717_10104318 3300006028 Bacteria 2411
134 Ga0070717_10233674 3300006028 Bacteria 1619
135 Ga0075365_10002795 3300006038 Bacteria 8733
136 Ga0075365_10014617 3300006038 Bacteria 4727
137 Ga0075365_10019311 3300006038 Bacteria 4205
138 Ga0075365_10048059 3300006038 Bacteria 2807
139 Ga0075365_10050831 3300006038 Bacteria 2735
140 Ga0075365_10112275 3300006038 Bacteria 1874
141 Ga0075368_10013839 3300006042 Bacteria 2968
142 Ga0075363_100011776 3300006048 Bacteria 4197
143 Ga0075363_100085513 3300006048 Bacteria 1730
144 Ga0075364_10005194 3300006051 Bacteria 7553
145 Ga0075364_10007061 3300006051 Bacteria 6640
146 Ga0075364_10022871 3300006051 Bacteria 3953
147 Ga0070715_10025138 3300006163 Bacteria 2355
148 Ga0070716_100000222 3300006173 Bacteria 22754
149 Ga0070716_100051297 3300006173 Bacteria 2345
150 Ga0070712_100002878 3300006175 Bacteria 10665
151 Ga0070712_100017672 3300006175 Bacteria 4619
152 Ga0070712_100152350 3300006175 Bacteria 1776
153 Ga0075362_10100786 3300006177 Bacteria 1350
154 Ga0075367_10131479 3300006178 Bacteria 1547
155 Ga0097621_100017517 3300006237 Bacteria 5442
156 Ga0075370_10008069 3300006353 Bacteria 5402
157 Ga0075370_10074475 3300006353 Bacteria 1946
158 Ga0075370_10082575 3300006353 Bacteria 1848
159 Ga0075370_10082750 3300006353 Bacteria 1846
160 Ga0068871_100042638 3300006358 Bacteria 3644
161 Ga0075428_100001979 3300006844 Bacteria 22079
162 Ga0075428_100060371 3300006844 Bacteria 4152
163 Ga0075428_100413186 3300006844 Bacteria 1446
164 Ga0075428_100529093 3300006844 Bacteria 1261
165 Ga0075430_100000695 3300006846 Bacteria 25646
166 Ga0075430_100007157 3300006846 Bacteria 9416
167 Ga0075430_100037236 3300006846 Bacteria 4124
168 Ga0075430_100292250 3300006846 Bacteria 1348
169 Ga0075431_100001519 3300006847 Bacteria 21504
170 Ga0075433_10004134 3300006852 Bacteria 11257
171 Ga0075434_100016397 3300006871 Bacteria 7122
172 Ga0075429_100030614 3300006880 Bacteria 4675
173 Ga0075429_100132629 3300006880 Bacteria 2180
174 Ga0075429_100143626 3300006880 Bacteria 2089
175 Ga0068865_100269844 3300006881 Bacteria 1350
176 Ga0075436_100009165 3300006914 Bacteria 6771
177 Ga0099826_10146979 3300006948 Bacteria 1353
178 Ga0075435_100003716 3300007076 Bacteria 10395
179 Ga0105251_10034559 3300009011 Bacteria 2500
180 Ga0111539_10001333 3300009094 Bacteria 32890
181 Ga0111539_10018630 3300009094 Bacteria 8599
182 Ga0111539_10020393 3300009094 Bacteria 8164
183 Ga0105245_10033111 3300009098 Bacteria 4578
184 Ga0105245_10038998 3300009098 Bacteria 4227
185 Ga0105245_10040802 3300009098 Bacteria 4136
186 Ga0105245_10186878 3300009098 Bacteria 1983
187 Ga0105245_10388489 3300009098 Bacteria 1392
188 Ga0105245_10664751 3300009098 Bacteria 1073
189 Ga0105247_10093560 3300009101 Bacteria 1911
190 Ga0114129_10000004 3300009147 Bacteria 160944
191 Ga0114129_10006456 3300009147 Bacteria 16627
192 Ga0114129_10043613 3300009147 Bacteria 6310
193 Ga0114129_10214596 3300009147 Bacteria 2599
194 Ga0114129_10359379 3300009147 Bacteria 1927
195 Ga0105243_10038026 3300009148 Bacteria 3746
196 Ga0105243_10107924 3300009148 Bacteria 2323
197 Ga0105243_10177597 3300009148 Bacteria 1849
198 Ga0105243_10221577 3300009148 Bacteria 1672
199 Ga0105241_10012537 3300009174 Bacteria 6217
200 Ga0105242_10008355 3300009176 Bacteria 7954
201 Ga0105242_10297798 3300009176 Bacteria 1471
202 Ga0105248_10156267 3300009177 Bacteria 2574
203 Ga0105248_10775350 3300009177 Bacteria 1082
204 Ga0105238_10103081 3300009551 Bacteria 2835
205 Ga0105238_10107440 3300009551 Bacteria 2771
206 Ga0105238_10109399 3300009551 Bacteria 2745
207 Ga0105249_10077640 3300009553 Bacteria 3080
208 Ga0105249_10411564 3300009553 Bacteria 1384
209 Ga0105249_10431293 3300009553 Bacteria 1354
210 Ga0105239_10003785 3300010375 Bacteria 18414
211 Ga0105239_10012969 3300010375 Bacteria 9271
212 Ga0105239_10148897 3300010375 Bacteria 2612
213 Ga0105239_10151037 3300010375 Bacteria 2592
214 Ga0105239_10432819 3300010375 Bacteria 1491
215 Ga0105246_10003633 3300011119 Bacteria 9335
216 Ga0105246_10006396 3300011119 Bacteria 7196
217 Ga0105246_10092926 3300011119 Bacteria 2178
218 Ga0157373_10016101 3300013100 Bacteria 5457
219 Ga0157370_10046884 3300013104 Bacteria 4143
220 Ga0157369_10198568 3300013105 Bacteria 2106
221 Ga0157374_10017524 3300013296 Bacteria 6307
222 Ga0157374_10570838 3300013296 Bacteria 1140
223 Ga0157378_10077003 3300013297 Bacteria 3006
224 Ga0163162_10021224 3300013306 Bacteria 6391
225 Ga0157372_10014846 3300013307 Bacteria 8340
226 Ga0157372_10091076 3300013307 Bacteria 3468
227 Ga0157372_10108184 3300013307 Bacteria 3181
228 Ga0157372_10184171 3300013307 Bacteria 2418
229 Ga0157372_10373283 3300013307 Bacteria 1662
230 Ga0157372_10422006 3300013307 Bacteria 1554
231 Ga0157375_10035766 3300013308 Bacteria 4744
232 Ga0157375_10036473 3300013308 Bacteria 4704
233 Ga0157375_10052070 3300013308 Bacteria 4023
234 Ga0157375_10102461 3300013308 Bacteria 2947
235 Ga0157375_10158717 3300013308 Bacteria 2402
236 Ga0163163_10006777 3300014325 Bacteria 10044
237 Ga0163163_10021647 3300014325 Bacteria 6071
238 Ga0163163_10215448 3300014325 Bacteria 1969
239 Ga0163163_10412449 3300014325 Bacteria 1409
240 Ga0157380_10008910 3300014326 Bacteria 7168
241 Ga0157380_10045751 3300014326 Bacteria 3436
242 Ga0157380_10361590 3300014326 Bacteria 1362
243 Ga0182008_10027037 3300014497 Bacteria 2908
244 Ga0157377_10007388 3300014745 Bacteria 5304
245 Ga0157377_10044663 3300014745 Bacteria 2471
246 Ga0157379_10008327 3300014968 Bacteria 9013
247 Ga0157379_10025457 3300014968 Bacteria 5256
248 Ga0157379_10050511 3300014968 Bacteria 3712
249 Ga0163161_10076375 3300017792 Bacteria 2459
250 Ga0163161_10234808 3300017792 Bacteria 1424
251 Ga0197907_10762486 3300020069 Bacteria 2078
252 Ga0206356_11171474 3300020070 Bacteria 1926
253 Ga0206356_11313232 3300020070 Bacteria 1286
254 Ga0206354_10671360 3300020081 Bacteria 2201
255 Ga0206353_10204676 3300020082 Bacteria 2639
256 Ga0206353_11294495 3300020082 Bacteria 1668
257 Ga0206353_11492747 3300020082 Bacteria 1663
258 Ga0224712_10073948 3300022467 Bacteria 1391
259 Ga0207697_10034184 3300025315 Bacteria 2081
260 Ga0207692_10000647 3300025898 Bacteria 12254
261 Ga0207692_10001433 3300025898 Bacteria 8929
262 Ga0207642_10047548 3300025899 Bacteria 1918
263 Ga0207710_10026262 3300025900 Bacteria 2516
264 Ga0207688_10043207 3300025901 Bacteria 2509
265 Ga0207647_10077146 3300025904 Bacteria 2003
266 Ga0207647_10095249 3300025904 Bacteria 1772
267 Ga0207685_10014863 3300025905 Bacteria 2449
268 Ga0207699_10000105 3300025906 Bacteria 59026
269 Ga0207699_10009084 3300025906 Bacteria 4933
270 Ga0207699_10235174 3300025906 Bacteria 1256
271 Ga0207645_10021076 3300025907 Bacteria 4254
272 Ga0207643_10000266 3300025908 Bacteria 36491
273 Ga0207643_10016651 3300025908 Bacteria 4010
274 Ga0207705_10023065 3300025909 Bacteria 4439
275 Ga0207705_10057392 3300025909 Bacteria 2807
276 Ga0207705_10110225 3300025909 Bacteria 2033
277 Ga0207705_10216708 3300025909 Bacteria 1453
278 Ga0207684_10037605 3300025910 Bacteria 4107
279 Ga0207654_10021268 3300025911 Bacteria 3448
280 Ga0207671_10046657 3300025914 Bacteria 3206
281 Ga0207693_10001586 3300025915 Bacteria 20116
282 Ga0207693_10085842 3300025915 Bacteria 2466
283 Ga0207693_10293625 3300025915 Bacteria 1274
284 Ga0207663_10000974 3300025916 Bacteria 13097
285 Ga0207663_10008863 3300025916 Bacteria 5289
286 Ga0207662_10016637 3300025918 Bacteria 4152
287 Ga0207657_10040954 3300025919 Bacteria 4101
288 Ga0207657_10145587 3300025919 Bacteria 1933
289 Ga0207657_10149793 3300025919 Bacteria 1901
290 Ga0207657_10226442 3300025919 Bacteria 1496
291 Ga0207657_10235906 3300025919 Bacteria 1462
292 Ga0207649_10301760 3300025920 Bacteria 1171
293 Ga0207652_10011619 3300025921 Bacteria 7104
294 Ga0207652_10126230 3300025921 Bacteria 2279
295 Ga0207652_10131084 3300025921 Bacteria 2236
296 Ga0207646_10019452 3300025922 Bacteria 6311
297 Ga0207681_10217217 3300025923 Bacteria 1477
298 Ga0207694_10159529 3300025924 Bacteria 1821
299 Ga0207694_10188456 3300025924 Bacteria 1675
300 Ga0207694_10229469 3300025924 Bacteria 1516
301 Ga0207650_10023213 3300025925 Bacteria 4398
302 Ga0207650_10142999 3300025925 Bacteria 1882
303 Ga0207659_10002694 3300025926 Bacteria 10582
304 Ga0207659_10057964 3300025926 Bacteria 2779
305 Ga0207687_10009504 3300025927 Bacteria 6359
306 Ga0207687_10071750 3300025927 Bacteria 2475
307 Ga0207687_10087367 3300025927 Bacteria 2266
308 Ga0207687_10121432 3300025927 Bacteria 1955
309 Ga0207700_10000050 3300025928 Bacteria 79672
310 Ga0207700_10018417 3300025928 Bacteria 4690
311 Ga0207700_10022556 3300025928 Bacteria 4323
312 Ga0207700_10044776 3300025928 Bacteria 3260
313 Ga0207700_10060570 3300025928 Bacteria 2867
314 Ga0207700_10175913 3300025928 Bacteria 1789
315 Ga0207700_10230220 3300025928 Bacteria 1575
316 Ga0207664_10000101 3300025929 Bacteria 79541
317 Ga0207664_10007144 3300025929 Bacteria 7743
318 Ga0207664_10017629 3300025929 Bacteria 5240
319 Ga0207664_10097734 3300025929 Bacteria 2419
320 Ga0207664_10185217 3300025929 Bacteria 1789
321 Ga0207690_10019361 3300025932 Bacteria 4190
322 Ga0207690_10025788 3300025932 Bacteria 3696
323 Ga0207690_10065270 3300025932 Bacteria 2489
324 Ga0207690_10361687 3300025932 Bacteria 1150
325 Ga0207706_10082442 3300025933 Bacteria 2827
326 Ga0207706_10248374 3300025933 Bacteria 1555
327 Ga0207686_10065573 3300025934 Bacteria 2316
328 Ga0207709_10017261 3300025935 Bacteria 4026
329 Ga0207709_10079021 3300025935 Bacteria 2114
330 Ga0207709_10103639 3300025935 Bacteria 1886
331 Ga0207704_10022390 3300025938 Bacteria 3384
332 Ga0207665_10000438 3300025939 Bacteria 28608
333 Ga0207665_10018949 3300025939 Bacteria 4522
334 Ga0207665_10332814 3300025939 Bacteria 1142
335 Ga0207691_10009955 3300025940 Bacteria 9129
336 Ga0207711_10099802 3300025941 Bacteria 2567
337 Ga0207689_10005945 3300025942 Bacteria 10800
338 Ga0207689_10023007 3300025942 Bacteria 5235
339 Ga0207689_10034638 3300025942 Bacteria 4193
340 Ga0207689_10051566 3300025942 Bacteria 3392
341 Ga0207661_10016968 3300025944 Bacteria 5379
342 Ga0207661_10070708 3300025944 Bacteria 2849
343 Ga0207661_10114313 3300025944 Bacteria 2288
344 Ga0207661_10260453 3300025944 Bacteria 1545
345 Ga0207679_10003607 3300025945 Bacteria 9602
346 Ga0207679_10022957 3300025945 Bacteria 4257
347 Ga0207679_10117094 3300025945 Bacteria 2114
348 Ga0207679_10375340 3300025945 Bacteria 1245
349 Ga0207667_10294029 3300025949 Bacteria 1659
350 Ga0207712_10200627 3300025961 Bacteria 1582
351 Ga0207668_10007739 3300025972 Bacteria 6393
352 Ga0207668_10059087 3300025972 Bacteria 2684
353 Ga0207658_10043314 3300025986 Bacteria 3271
354 Ga0207658_10163869 3300025986 Bacteria 1824
355 Ga0207703_10019676 3300026035 Bacteria 5276
356 Ga0207703_10034448 3300026035 Bacteria 4018
357 Ga0207703_10058854 3300026035 Bacteria 3138
358 Ga0207703_10365782 3300026035 Bacteria 1331
359 Ga0207639_10166611 3300026041 Bacteria 1862
360 Ga0207639_10239783 3300026041 Bacteria 1576
361 Ga0207678_10006802 3300026067 Bacteria 10142
362 Ga0207678_10337463 3300026067 Bacteria 1298
363 Ga0207678_10455440 3300026067 Bacteria 1112
364 Ga0207708_10001687 3300026075 Bacteria 16343
365 Ga0207708_10005591 3300026075 Bacteria 9276
366 Ga0207708_10005711 3300026075 Bacteria 9199
367 Ga0207708_10091674 3300026075 Bacteria 2344
368 Ga0207702_10021114 3300026078 Bacteria 5388
369 Ga0207702_10586640 3300026078 Bacteria 1093
370 Ga0207641_10082434 3300026088 Bacteria 2794
371 Ga0207648_10014220 3300026089 Bacteria 7361
372 Ga0207676_10077191 3300026095 Bacteria 2694
373 Ga0207676_10215357 3300026095 Bacteria 1707
374 Ga0207674_10021159 3300026116 Bacteria 7011
375 Ga0207674_10068057 3300026116 Bacteria 3584
376 Ga0207675_100001326 3300026118 Bacteria 24790
377 Ga0207675_100054352 3300026118 Bacteria 3735
378 Ga0207675_100079519 3300026118 Bacteria 3072
379 Ga0207683_10002454 3300026121 Bacteria 16159
380 Ga0207683_10032234 3300026121 Bacteria 4552
381 Ga0207683_10462200 3300026121 Bacteria 1170
382 Ga0207698_10054957 3300026142 Bacteria 3066
383 Ga0207698_10112687 3300026142 Bacteria 2284
384 Ga0207698_10146953 3300026142 Bacteria 2040
385 Ga0207698_10292162 3300026142 Bacteria 1513
386 Ga0209813_10002979 3300027866 Bacteria 3923
387 Ga0209813_10023193 3300027866 Bacteria 1763
388 Ga0207428_10021038 3300027907 Bacteria 5530
389 Ga0207428_10022520 3300027907 Bacteria 5315
390 Ga0207428_10102029 3300027907 Bacteria 2216
391 Ga0268266_10001844 3300028379 Bacteria 23906
392 Ga0268266_10052473 3300028379 Bacteria 3502
393 Ga0268265_10011282 3300028380 Bacteria 6041
394 Ga0268265_10143120 3300028380 Bacteria 2005
395 Ga0268264_10000843 3300028381 Bacteria 32793
396 Ga0307515_10004732 3300028794 Bacteria 27881
397 Ga0307515_10006082 3300028794 Bacteria 24274
398 Ga0307515_10033914 3300028794 Bacteria 8384
399 Ga0307515_10164924 3300028794 Bacteria 2238
400 Ga0307512_10002870 3300030522 Bacteria 20931
401 Ga0307512_10025175 3300030522 Bacteria 5279
402 Ga0307512_10036229 3300030522 Bacteria 4188
403 Ga0307512_10184528 3300030522 Bacteria 1164
404 Ga0316181_1035113 3300030744 Bacteria 2279
405 Ga0265340_10001409 3300031247 Bacteria 13798
406 Ga0307513_10002952 3300031456 Bacteria 23213
407 Ga0307513_10026296 3300031456 Bacteria 6714
408 Ga0307509_10111188 3300031507 Bacteria 2743
409 Ga0307508_10002257 3300031616 Bacteria 20546
410 Ga0307508_10003547 3300031616 Bacteria 15728
411 Ga0307508_10053689 3300031616 Bacteria 3575
412 Ga0316579_10000044 3300031691 Bacteria 29147
413 Ga0307516_10045590 3300031730 Bacteria 4329
414 Ga0307405_10165852 3300031731 Bacteria 1570
415 Ga0307405_10223037 3300031731 Bacteria 1384
416 Ga0307413_10008060 3300031824 Bacteria 4944
417 Ga0307518_10000881 3300031838 Bacteria 22336
418 Ga0307406_10205474 3300031901 Bacteria 1453
419 Ga0307407_10183510 3300031903 Bacteria 1388
420 Ga0307412_10053470 3300031911 Bacteria 2677
421 Ga0307409_100003217 3300031995 Bacteria 8794
422 Ga0307409_100038828 3300031995 Bacteria 3526
423 Ga0307409_100046820 3300031995 Bacteria 3277
424 Ga0307409_100093198 3300031995 Bacteria 2474
425 Ga0307409_100183809 3300031995 Bacteria 1853
426 Ga0307409_100198635 3300031995 Bacteria 1792
427 Ga0307409_100261862 3300031995 Bacteria 1587
428 Ga0307409_100268807 3300031995 Bacteria 1569
429 Ga0307409_100329893 3300031995 Bacteria 1431
430 Ga0307409_100330958 3300031995 Bacteria 1429
431 Ga0307409_100348258 3300031995 Bacteria 1397
432 Ga0307416_100076339 3300032002 Bacteria 2808
433 Ga0307415_100021568 3300032126 Bacteria 3962
434 Ga0307415_100102202 3300032126 Bacteria 2105
435 Ga0307507_10014573 3300033179 Bacteria 9354
436 Ga0373938_0016312 3300034957 Bacteria 1450
437 Ga0373940_0001013 3300035088 Bacteria 4822
438 Ga0373951_0000551 3300035091 Bacteria 10513
439 Ga0373939_0057071 3300035114 Bacteria 1231
440 Ga0373956_0005334 3300035119 Bacteria 5144
441 Ga0373942_0005546 3300035207 Bacteria 2924
442 Ga0316582_0118947 3300036647 Bacteria 1766
443 Ga0395899_0025224 3300037312 Bacteria 4489
444 Ga0395899_0069230 3300037312 Bacteria 2585
445 Ga0395899_0141525 3300037312 Bacteria 1711
446 Ga0395900_0101168 3300037418 Bacteria 2960
447 Ga0395900_0130670 3300037418 Bacteria 2574
448 Ga0395898_0037833 3300037466 Bacteria 4784
449 Ga0395898_0051195 3300037466 Bacteria 4039
450 Ga0395898_0099430 3300037466 Bacteria 2793
451 Ga0395898_0217984 3300037466 Bacteria 1820
452 Ga0395898_0330401 3300037466 Bacteria 1454
453 Ga0395898_0423700 3300037466 Bacteria 1268
454 Ga0395905_0169425 3300037471 Bacteria 2051
455 Ga0395905_0502938 3300037471 Bacteria 1112
456 Ga0316581_0001724 3300037588 Bacteria 5032
457 Ga0395901_0024894 3300038443 Bacteria 6144
458 Ga0395901_0062734 3300038443 Bacteria 3867
459 Ga0395901_0072718 3300038443 Bacteria 3585
460 Ga0395901_0106362 3300038443 Bacteria 2945
461 Ga0395901_0303452 3300038443 Bacteria 1655
462 Ga0395901_0571668 3300038443 Bacteria 1143
463 Ga0400488_58753 3300038741 Bacteria 4845
464 Ga0400486_24036 3300038742 Bacteria 3993
465 Ga0436365_0829147 3300039437 Bacteria 2612
466 Ga0436363_1319502 3300039450 Bacteria 2943
467 Ga0439436_0000284 3300041404 Bacteria 12273
468 Ga0439436_0057235 3300041404 Bacteria 1094
469 Ga0439439_0020821 3300041406 Bacteria 1632
470 Ga0451791_0528520 3300041451 Bacteria 1065
471 Ga0451853_0209873 3300041512 Bacteria 3706
472 Ga0451853_0556300 3300041512 Bacteria 4275
473 Ga0451853_0639474 3300041512 Bacteria 3340
474 Ga0451853_0656156 3300041512 Bacteria 1817
475 Ga0451853_0776115 3300041512 Bacteria 2204
476 Ga0451853_2948900 3300041512 Bacteria 22669
477 Ga0439433_0001529 3300041999 Bacteria 4789
478 Ga0439442_004161 3300042002 Bacteria 2869
479 Ga0439449_0000051 3300042007 Bacteria 35687
480 Ga0439449_0008738 3300042007 Bacteria 3843
481 Ga0439457_000011 3300042014 Bacteria 39610
482 Ga0439446_0006528 3300042156 Bacteria 3045
483 Ga0439464_0011014 3300042439 Bacteria 2391
484 Ga0466972_0050656 3300044658 Bacteria 2004
485 Ga0466965_0026233 3300044683 Bacteria 2824
486 Ga0466965_0048968 3300044683 Bacteria 2094
487 Ga0466965_0131867 3300044683 Bacteria 1296
488 Ga0466965_0195020 3300044683 Bacteria 1072
489 Ga0466966_0009724 3300044684 Bacteria 6369
490 Ga0466961_0116288 3300044693 Bacteria 1681
491 Ga0466961_0143244 3300044693 Bacteria 1495
492 Ga0466961_0182530 3300044693 Bacteria 1302
493 Ga0466961_0235549 3300044693 Bacteria 1126
494 Ga0466963_0083383 3300044694 Bacteria 2168
495 Ga0466963_0122107 3300044694 Bacteria 1794
496 Ga0466963_0165693 3300044694 Bacteria 1539
497 Ga0466963_0193678 3300044694 Bacteria 1420
498 Ga0466963_0279889 3300044694 Bacteria 1172
499 Ga0466964_0005611 3300044706 Bacteria 4663
500 Ga0466964_0016714 3300044706 Bacteria 2803
501 Ga0466964_0111361 3300044706 Bacteria 1221
502 Ga0466971_0057803 3300044719 Bacteria 1750
503 Ga0466971_0122109 3300044719 Bacteria 1206
504 Ga0466970_0007602 3300044765 Bacteria 5433
505 Ga0466970_0012339 3300044765 Bacteria 4367
506 Ga0466970_0026283 3300044765 Bacteria 3051
507 Ga0466970_0051390 3300044765 Bacteria 2199
508 Ga0466970_0080724 3300044765 Bacteria 1758
509 Ga0466970_0114429 3300044765 Bacteria 1474
510 Ga0466957_0006638 3300044842 Bacteria 6542
511 Ga0466957_0008346 3300044842 Bacteria 5889
512 Ga0466957_0030678 3300044842 Bacteria 3210
513 Ga0466957_0158849 3300044842 Bacteria 1467
514 Ga0466957_0222468 3300044842 Bacteria 1247
515 Ga0466957_0224772 3300044842 Bacteria 1241
516 Ga0466960_0005547 3300044901 Bacteria 5003
517 Ga0466960_0005570 3300044901 Bacteria 4994
518 Ga0466960_0020278 3300044901 Bacteria 2942
519 Ga0466960_0023329 3300044901 Bacteria 2777
520 Ga0466960_0026932 3300044901 Bacteria 2617
521 Ga0466960_0043999 3300044901 Bacteria 2127
522 Ga0466960_0044966 3300044901 Bacteria 2107
523 Ga0466960_0059540 3300044901 Bacteria 1869
524 Ga0466960_0100770 3300044901 Bacteria 1487
525 Ga0466960_0117854 3300044901 Bacteria 1387
526 Ga0466958_0121481 3300045836 Bacteria 1635
527 Ga0466958_0121843 3300045836 Bacteria 1633
528 Ga0466967_0001211 3300045976 Bacteria 14529
529 Ga0466967_0010788 3300045976 Bacteria 6874
530 Ga0466967_0022027 3300045976 Bacteria 5190
531 Ga0466967_0033393 3300045976 Bacteria 4355
532 Ga0466967_0036849 3300045976 Bacteria 4180
533 Ga0466967_0047816 3300045976 Bacteria 3731
534 Ga0466967_0090662 3300045976 Bacteria 2777
535 Ga0466967_0196689 3300045976 Bacteria 1908
536 Ga0466967_0468921 3300045976 Bacteria 1232
537 Ga0466967_0521901 3300045976 Bacteria 1167
538 Ga0495629_0254864 3300046459 Bacteria 1207
539 Ga0495641_0056215 3300046461 Bacteria 1784
540 Ga0495653_0303640 3300046463 Bacteria 1040
541 Ga0495664_0153612 3300046477 Bacteria 1396
542 Ga0495664_0173097 3300046477 Bacteria 1309
543 Ga0495608_0123062 3300046511 Bacteria 1663
544 Ga0495618_0031281 3300046514 Bacteria 3329
545 Ga0495632_0055592 3300046519 Bacteria 1937
546 Ga0495652_0196469 3300046529 Bacteria 1535
547 Ga0495640_0208403 3300046533 Bacteria 1237
548 Ga0495657_0169212 3300046675 Bacteria 1347
549 Ga0495658_0044687 3300046683 Bacteria 2483
550 Ga0495658_0103623 3300046683 Bacteria 1702
551 Ga0495600_0186282 3300046809 Bacteria 1336
552 Ga0496100_0026145 3300048903 Bacteria 3576
553 Ga0496100_0110542 3300048903 Bacteria 1908
554 Ga0496100_0112604 3300048903 Bacteria 1893
555 Ga0496101_0089944 3300048904 Bacteria 2282
556 Ga0496101_0106388 3300048904 Bacteria 2106
557 Ga0496101_0109631 3300048904 Bacteria 2077
558 Ga0496101_0157574 3300048904 Bacteria 1740
559 Ga0496101_0377959 3300048904 Bacteria 1114
560 Ga0496102_0001679 3300048905 Bacteria 19435
561 Ga0496102_0003877 3300048905 Bacteria 12670
562 Ga0496102_0023288 3300048905 Bacteria 5498
563 Ga0496102_0024876 3300048905 Bacteria 5325
564 Ga0496102_0028012 3300048905 Bacteria 5033
565 Ga0496102_0076271 3300048905 Bacteria 3083
566 Ga0496102_0161077 3300048905 Bacteria 2111
567 Ga0496102_0268687 3300048905 Bacteria 1608
568 Ga0496102_0309052 3300048905 Bacteria 1490
569 Ga0496103_0030118 3300048906 Bacteria 3301
570 Ga0496103_0160569 3300048906 Bacteria 1441
571 Ga0496103_0203780 3300048906 Bacteria 1272
572 Ga0496104_0068485 3300048907 Bacteria 3373
573 Ga0496104_0261566 3300048907 Bacteria 1643
574 Ga0496104_0334156 3300048907 Bacteria 1428
575 Ga0496104_0461963 3300048907 Bacteria 1181
576 Ga0496105_0003593 3300048908 Bacteria 11513
577 Ga0496105_0008048 3300048908 Bacteria 8193
578 Ga0496105_0301802 3300048908 Bacteria 1287
579 Ga0496106_0015296 3300048909 Bacteria 5676
580 Ga0496106_0018504 3300048909 Bacteria 5152
581 Ga0496106_0134859 3300048909 Bacteria 1938
582 Ga0496107_0035852 3300048910 Bacteria 3558
583 Ga0496107_0213334 3300048910 Bacteria 1436
584 Ga0496108_0000029 3300048911 Bacteria 167261
585 Ga0496108_0021411 3300048911 Bacteria 5315
586 Ga0496108_0053647 3300048911 Bacteria 3381
587 Ga0496108_0165719 3300048911 Bacteria 1910
588 Ga0496108_0194250 3300048911 Bacteria 1760
589 Ga0496109_0019013 3300048912 Bacteria 6051
590 Ga0496109_0060095 3300048912 Bacteria 3473
591 Ga0496109_0078276 3300048912 Bacteria 3044
592 Ga0496109_0139809 3300048912 Bacteria 2264
593 Ga0496109_0190228 3300048912 Bacteria 1928
594 Ga0496109_0218728 3300048912 Bacteria 1791
595 Ga0496109_0411968 3300048912 Bacteria 1277
596 Ga0496110_0083619 3300048913 Bacteria 2848
597 Ga0496110_0084773 3300048913 Bacteria 2828
598 Ga0496110_0159245 3300048913 Bacteria 2046
599 Ga0496110_0262354 3300048913 Bacteria 1572
600 Ga0496111_0078856 3300048914 Bacteria 2402
601 Ga0496111_0084703 3300048914 Bacteria 2317
602 Ga0496111_0114783 3300048914 Bacteria 1985
603 Ga0496111_0188658 3300048914 Bacteria 1533
604 Ga0496112_0075847 3300048915 Bacteria 3325
605 Ga0496112_0127657 3300048915 Bacteria 2514
606 Ga0496112_0248695 3300048915 Bacteria 1730
607 Ga0496113_0021901 3300048916 Bacteria 4513
608 Ga0496113_0065827 3300048916 Bacteria 2744
609 Ga0496113_0187099 3300048916 Bacteria 1643
610 Ga0496114_0004572 3300048917 Bacteria 10748
611 Ga0496114_0012911 3300048917 Bacteria 6690
612 Ga0496114_0014354 3300048917 Bacteria 6355
613 Ga0496114_0015345 3300048917 Bacteria 6159
614 Ga0496114_0072030 3300048917 Bacteria 2905
615 Ga0496114_0082389 3300048917 Bacteria 2719
616 Ga0496114_0088916 3300048917 Bacteria 2621
617 Ga0496114_0175301 3300048917 Bacteria 1871
618 Ga0496114_0242440 3300048917 Bacteria 1585
619 Ga0496114_0290511 3300048917 Bacteria 1442
620 Ga0496115_0001458 3300048918 Bacteria 16992
621 Ga0496115_0074357 3300048918 Bacteria 2759
622 Ga0496115_0077411 3300048918 Bacteria 2704
623 Ga0496119_0001068 3300048922 Bacteria 34793
624 Ga0496120_0000103 3300048923 Bacteria 141601
625 Ga0496126_0237298 3300048929 Bacteria 1525
626 Ga0501031_0017084 3300049568 Bacteria 4713
627 Ga0501031_0105160 3300049568 Bacteria 1842
628 Ga0501031_0115831 3300049568 Bacteria 1751
629 Ga0501031_0134448 3300049568 Bacteria 1615
630 Ga0501032_0005543 3300049569 Bacteria 9366
631 Ga0501032_0020844 3300049569 Bacteria 4561
632 Ga0501033_0002108 3300049570 Bacteria 17222
633 Ga0501033_0028148 3300049570 Bacteria 4224
634 Ga0501033_0104871 3300049570 Bacteria 2061
635 Ga0501033_0112939 3300049570 Bacteria 1976
636 Ga0501034_0023454 3300049571 Bacteria 6287
637 Ga0501034_0053987 3300049571 Bacteria 4046
638 Ga0501034_0412162 3300049571 Bacteria 1273
639 Ga0501036_0008657 3300049572 Bacteria 8348
640 Ga0501036_0008684 3300049572 Bacteria 8336
641 Ga0501036_0009779 3300049572 Bacteria 7897
642 Ga0501036_0036455 3300049572 Bacteria 4162
643 Ga0501036_0072343 3300049572 Bacteria 2914
644 Ga0501036_0226522 3300049572 Bacteria 1569
645 Ga0501037_0007658 3300049573 Bacteria 7908
646 Ga0501037_0008499 3300049573 Bacteria 7528
647 Ga0501037_0024917 3300049573 Bacteria 4422
648 Ga0501037_0026338 3300049573 Bacteria 4297
649 Ga0501037_0027690 3300049573 Bacteria 4188
650 Ga0501038_0001411 3300049574 Bacteria 22000
651 Ga0501038_0005982 3300049574 Bacteria 11253
652 Ga0501039_0004034 3300049575 Bacteria 11034
653 Ga0501039_0073509 3300049575 Bacteria 2656
654 Ga0501039_0137797 3300049575 Bacteria 1917
655 Ga0501039_0410465 3300049575 Bacteria 1064
656 Ga0501040_0010935 3300049576 Bacteria 5935
657 Ga0501040_0214894 3300049576 Bacteria 1367
658 Ga0501040_0229811 3300049576 Bacteria 1321
659 Ga0501041_0005388 3300049577 Bacteria 7494
660 Ga0501042_0004768 3300049578 Bacteria 8657
661 Ga0501042_0011275 3300049578 Bacteria 6026
662 Ga0501042_0014282 3300049578 Bacteria 5419
663 Ga0501042_0169484 3300049578 Bacteria 1576
664 Ga0501043_0003129 3300049579 Bacteria 13725
665 Ga0501043_0098331 3300049579 Bacteria 2300
666 Ga0501046_0000841 3300049580 Bacteria 29918
667 Ga0501046_0016344 3300049580 Bacteria 6217
668 Ga0501046_0061655 3300049580 Bacteria 2931
669 Ga0501046_0232814 3300049580 Bacteria 1360
670 Ga0501047_0004414 3300049581 Bacteria 13248
671 Ga0501047_0086847 3300049581 Bacteria 3005
672 Ga0501048_0002290 3300049582 Bacteria 14604
673 Ga0501048_0034957 3300049582 Bacteria 3621
674 Ga0501048_0112234 3300049582 Bacteria 1925
675 Ga0501067_0049904 3300049583 Bacteria 2319
676 Ga0501067_0071898 3300049583 Bacteria 1916
677 Ga0501067_0179926 3300049583 Bacteria 1178
678 Ga0501068_0030555 3300049584 Bacteria 3196
679 Ga0501069_0011110 3300049585 Bacteria 4777
680 Ga0501069_0070083 3300049585 Bacteria 1964
681 Ga0501069_0080857 3300049585 Bacteria 1830
682 Ga0501070_0013674 3300049586 Bacteria 6837
683 Ga0501070_0108014 3300049586 Bacteria 2299
684 Ga0501070_0148380 3300049586 Bacteria 1935
685 Ga0501070_0196549 3300049586 Bacteria 1656
686 Ga0501071_0026943 3300049587 Bacteria 4040
687 Ga0501071_0080394 3300049587 Bacteria 2383
688 Ga0501071_0169046 3300049587 Bacteria 1636
689 Ga0501072_0013614 3300049588 Bacteria 6227
690 Ga0501072_0077428 3300049588 Bacteria 2633
691 Ga0501072_0184360 3300049588 Bacteria 1665
692 Ga0501073_0254075 3300049589 Bacteria 1213
693 Ga0501074_0027043 3300049590 Bacteria 4157
694 Ga0501074_0080536 3300049590 Bacteria 2336
695 Ga0501074_0104186 3300049590 Bacteria 2031
696 Ga0501074_0117776 3300049590 Bacteria 1900
697 Ga0501075_0005329 3300049591 Bacteria 8796
698 Ga0501075_0022558 3300049591 Bacteria 4599
699 Ga0501076_0003246 3300049592 Bacteria 11377
700 Ga0501076_0009396 3300049592 Bacteria 7221
701 Ga0501076_0160059 3300049592 Bacteria 1834
702 Ga0501076_0268342 3300049592 Bacteria 1397
703 Ga0501076_0410379 3300049592 Bacteria 1114
704 Ga0501077_0017963 3300049593 Bacteria 4470
705 Ga0501077_0081074 3300049593 Bacteria 2055
706 Ga0501077_0284482 3300049593 Bacteria 1053
707 Ga0501079_0018295 3300049741 Bacteria 5354
708 Ga0501079_0019142 3300049741 Bacteria 5230
709 Ga0501079_0039588 3300049741 Bacteria 3636
710 Ga0501079_0056653 3300049741 Bacteria 3024
711 Ga0501079_0427833 3300049741 Bacteria 1039
712 Ga0501080_0051549 3300049742 Bacteria 3829
713 Ga0501080_0051621 3300049742 Bacteria 3827
714 Ga0501080_0167432 3300049742 Bacteria 2028
715 Ga0501080_0221404 3300049742 Bacteria 1732
716 Ga0501081_0021306 3300049743 Bacteria 4324
717 Ga0501083_0033902 3300049744 Bacteria 3494
718 Ga0501035_0012022 3300049822 Bacteria 8008
719 Ga0501035_0042476 3300049822 Bacteria 4100
720 Ga0501044_0017119 3300049823 Bacteria 7778
721 Ga0501044_0096708 3300049823 Bacteria 2974
722 Ga0501045_0049862 3300049824 Bacteria 3054
723 Ga0501045_0095127 3300049824 Bacteria 2204
724 Ga0501045_0116345 3300049824 Bacteria 1984
725 Ga0501045_0129091 3300049824 Bacteria 1879
726 nmdc:mga03n38_180901_c1 3300050490 Bacteria 1080
727 nmdc:mga03n38_6635_c1 3300050490 Bacteria 4039
728 nmdc:mga03n38_71204_c1 3300050490 Bacteria 1610
729 nmdc:mga00v17_5910_c1 3300050491 Bacteria 6468
730 nmdc:mga0yw44_10082_c1 3300050492 Bacteria 4810
731 nmdc:mga0yw44_10882_c1 3300050492 Bacteria 4665
732 nmdc:mga0yw44_126786_c1 3300050492 Bacteria 1649
733 nmdc:mga0yw44_139929_c1 3300050492 Bacteria 1572
734 nmdc:mga0yw44_14102_c2 3300050492 Bacteria 3629
735 nmdc:mga0yw44_25005_c1 3300050492 Bacteria 3389
736 nmdc:mga0yw44_26964_c1 3300050492 Bacteria 3286
737 nmdc:mga0yw44_31193_c1 3300050492 Bacteria 3097
738 nmdc:mga0yw44_37885_c1 3300050492 Bacteria 2850
739 nmdc:mga0yw44_68788_c1 3300050492 Bacteria 2191
740 nmdc:mga04h51_6015_c1 3300050495 Bacteria 3124
741 nmdc:mga07m45_26650_c1 3300050496 Bacteria 3178
742 nmdc:mga05p37_22251_c1 3300050507 Bacteria 7686
743 nmdc:mga05p37_32742_c1 3300050507 Bacteria 6360
744 nmdc:mga05p37_960_c2 3300050507 Bacteria 25827
745 nmdc:mga09592_20_c1 3300050508 Bacteria 92890
746 nmdc:mga09592_52005_c1 3300050508 Bacteria 3457
747 nmdc:mga0qj67_1435_c1 3300050509 Bacteria 16696
748 nmdc:mga0qj67_222730_c1 3300050509 Bacteria 1531
749 nmdc:mga0qj67_38666_c1 3300050509 Bacteria 3744
750 nmdc:mga0qj67_5065_c1 3300050509 Bacteria 9587
751 nmdc:mga06r32_89_c1 3300050510 Bacteria 63337
752 nmdc:mga08y16_2421_c1 3300050511 Bacteria 19173
753 nmdc:mga08y16_250408_c1 3300050511 Bacteria 1830
754 nmdc:mga08y16_3646_c1 3300050511 Bacteria 16009
755 nmdc:mga08y16_4458_c1 3300050511 Bacteria 14639
756 nmdc:mga0rr50_59006_c1 3300050513 Bacteria 2879
757 nmdc:mga08x19_86882_c1 3300050514 Bacteria 2060
758 nmdc:mga0a205_102345_c1 3300050515 Bacteria 2763
759 nmdc:mga0a205_121873_c1 3300050515 Bacteria 2507
760 Ga0495601_0152878 3300053077 Bacteria 1507
761 Ga0495655_0047129 3300053083 Bacteria 1127
762 Ga0495619_0082755 3300053085 Bacteria 2164
763 Ga0500644_0004160 3300053088 Bacteria 3608
764 Ga0500646_0000579 3300053090 Bacteria 10551
765 Ga0500583_0166702 3300053092 Bacteria 1097
766 Ga0500641_0025082 3300053096 Bacteria 2304
767 Ga0500650_0063720 3300053098 Bacteria 1722
768 Ga0500556_0001238 3300053104 Bacteria 11842
769 Ga0500556_0045806 3300053104 Bacteria 1563
770 Ga0500593_000208 3300053117 Bacteria 24074
771 Ga0500652_048424 3300053131 Bacteria 1729
772 Ga0500573_0025511 3300053140 Bacteria 3399
773 Ga0500616_0001402 3300053153 Bacteria 23217
774 Ga0500616_0032899 3300053153 Bacteria 2832
775 Ga0501084_0015872 3300054114 Bacteria 6247
776 Ga0501084_0057608 3300054114 Bacteria 3251
777 Ga0501082_0010696 3300060353 Bacteria 7898
778 Ga0501082_0036031 3300060353 Bacteria 4263
779 Ga0501082_0460611 3300060353 Bacteria 1111
780 Ga0466962_0103853 3300061719 Bacteria 1365
781 Ga0466962_0139294 3300061719 Bacteria 1175
782 Ga0530510_0003798 3300061734 Bacteria 10401
783 Ga0530510_0050137 3300061734 Bacteria 3015
784 2501942198 2501939600 Bacteria 6907073
785 2515495052 2515154088 Bacteria 5526283
786 2515719056 2515154129 Bacteria 5584369
787 2515754992 2515154137 Bacteria 5711575
788 2516083262 2515154202 Bacteria 5471270
789 2516088636 2515154203 Bacteria 5458536
790 2586059491 2585427649 Bacteria 9053857
791 2623590903 2622736626 Bacteria 7181580
792 2643825479 2643221561 Bacteria 4984412
793 2643850486 2643221567 Bacteria 4163945
794 2643889076 2643221576 Bacteria 5214352
795 2643942298 2643221587 Bacteria 7586415
796 2643958131 2643221590 Bacteria 5214697
797 2644034611 2643221604 Bacteria 5014917
798 2644089685 2643221615 Bacteria 5487866
799 2644098982 2643221617 Bacteria 5139111
800 2644114863 2643221620 Bacteria 5134593
801 2644134243 2643221624 Bacteria 4384879
802 2644319530 2643221657 Bacteria 5490246
803 2644389952 2643221670 Bacteria 6497041
804 2644429379 2643221677 Bacteria 7584031
805 2644435823 2643221678 Bacteria 9540101
806 2644531475 2643221696 Bacteria 5431823
807 2644632288 2643221714 Bacteria 9015452
808 2676475072 2675903058 Bacteria 6822861
809 2738867978 2738541305 Bacteria 4910150
810 2740166899 2739367898 Bacteria 4367674
811 2753272289 2751185782 Bacteria 11227053
812 2768647542 2767802112 Bacteria 6465194
813 2772641604 2772190715 Bacteria 6959372
814 2772644123 2772190715 Bacteria 6959372
815 2774393477 2773857762 Bacteria 5971770
816 2784471936 2784132109 Bacteria 3141763
817 2795784400 2795385470 Bacteria 8317180
818 2808840634 2808606359 Bacteria 9866990
819 2808873786 2808606365 Bacteria 4301966
820 2809195629 2808606439 Bacteria 5952208
821 2809591747 2808606522 Bacteria 9488490
822 2812332293 2811994874 Bacteria 5367947
823 2812350535 2811994878 Bacteria 5992952
824 2819427239 2818991318 Bacteria 5266538
825 2827629996 2827628540 Bacteria 6858585
826 2831936376 2831935698 Bacteria 5963223
827 2832010596 2832004796 Bacteria 6538017
828 2855387717 2855386786 Bacteria 4752232
829 2855672180 2855670206 Bacteria 7120389
830 2855676345 2855670206 Bacteria 7120389
831 2855681483 2855676851 Bacteria 7063653
832 2855682773 2855676851 Bacteria 7063653
833 2855686788 2855683550 Bacteria 7134265
834 2856743596 2856741275 Bacteria 8096094
835 2856864576 2856858025 Bacteria 7255264
836 2857291860 2857288857 Bacteria 7189066
837 2857294765 2857288857 Bacteria 7189066
838 2857483064 2857481737 Bacteria 4761446
839 2858854430 2858848962 Bacteria 6963058
840 2858855251 2858848962 Bacteria 6963058
841 2858873895 2858868258 Bacteria 7683772
842 2858888489 2858882152 Bacteria 7230291
843 2858888817 2858882152 Bacteria 7230291
844 2858889090 2858888857 Bacteria 7060307
845 2858890813 2858888857 Bacteria 7060307
846 2858897335 2858895516 Bacteria 7378898
847 2858899255 2858895516 Bacteria 7378898
848 2858905850 2858902515 Bacteria 7086037
849 2862709787 2862705112 Bacteria 6563286
850 2866068247 2866065130 Bacteria 6518152
851 2866553742 2866552031 Bacteria 5824618
852 2867303449 2867302475 Bacteria 7087181
853 2867316195 2867312974 Bacteria 7058875
854 2867321061 2867319477 Bacteria 7069771
855 2867511677 2867507094 Bacteria 6506033
856 2869048676 2869048445 Bacteria 6875584
857 2869054122 2869048445 Bacteria 6875584
858 2869062344 2869061728 Bacteria 7112407
859 2869066086 2869061728 Bacteria 7112407
860 2869070732 2869068681 Bacteria 7205615
861 2869073158 2869068681 Bacteria 7205615
862 2880489596 2880489317 Bacteria 7096270
863 2880496108 2880495981 Bacteria 7340502
864 2880498522 2880495981 Bacteria 7340502
865 2884697395 2884693830 Bacteria 11273186
866 2891397796 2891395885 Bacteria 9251614
867 2891564898 2891562705 Bacteria 8039471
868 2891971866 2891968417 Bacteria 5821697
869 2895430981 2895427314 Bacteria 13147766
870 2895452903 2895442618 Bacteria 11027144
871 2902588071 2902582711 Bacteria 6187705
872 2915771797 2915768154 Bacteria 8424322
873 2918505543 2918501144 Bacteria 8668083
874 2919449929 2919446982 Bacteria 3994487
875 2929224785 2929219909 Bacteria 6984360
876 2929227108 2929226422 Bacteria 7248583
877 2929232280 2929226422 Bacteria 7248583
878 2954696952 2954691527 Bacteria 10720516
879 2954705182 2954701450 Bacteria 10834262
880 2984576990 2984576629 Bacteria 4248407
881 2990258737 2990256926 Bacteria 4252839
882 2996227482 2996221748 Bacteria 6799777
883 3001891240 3001889506 Bacteria 2975194
884 649813897 649633069 Bacteria 6962533
885 8001790020 8001781756 Bacteria 9586736
886 8003834570 8003830390 Bacteria 6541657
887 8003860585 8003856774 Bacteria 7675274
888 8003877110 8003870546 Bacteria 7396674
889 8054707685 8054704163 Bacteria 7247792
890 8054710221 8054704163 Bacteria 7247792
891 8054731037 8054727385 Bacteria 7558670
892 8054732869 8054727385 Bacteria 7558670
893 8054735169 8054734606 Bacteria 6947278
894 8054738941 8054734606 Bacteria 6947278
895 8055418423 8055412473 Bacteria 6257500
896 8056211136 8056207758 Bacteria 8639239
897 nmdc:mga00v17_27702_c1
898 JGI24740J21852_10013057
899 JGI24737J22298_10053044
900 JGI24738J21930_10015359
901 JGI24744J21845_10009530
902 JGI25406J46586_10000292
903 JGI25406J46586_10013791
904 JGI25407J50210_10026054
905 Ga0006562J51391_1031195
906 Ga0070676_10029361
907 Ga0070683_100004647
908 Ga0070683_100005801
909 Ga0070683_100008155
910 Ga0070683_100463844
911 Ga0070670_100074618
912 Ga0068869_100004417
913 Ga0068869_100007855
914 Ga0068869_100030634
915 Ga0070680_100036712
916 Ga0070680_100042402
917 Ga0070682_100010967
918 Ga0070682_100035749
919 Ga0070682_100250907
920 Ga0068868_100047152
921 Ga0068868_100100797
922 Ga0068868_100121338
923 Ga0070660_100025915
924 Ga0070689_100023594
925 Ga0070691_10000786
926 Ga0070687_100047430
927 Ga0070661_100344284
928 Ga0070661_100362772
929 Ga0070692_10005824
930 Ga0070668_100001449
931 Ga0070668_100055098
932 Ga0070668_100091485
933 Ga0070668_100196950
934 Ga0070675_100001934
935 Ga0070675_100087605
936 Ga0070674_100012101
937 Ga0070673_100075845
938 Ga0070688_100054608
939 Ga0070659_100139969
940 Ga0070659_100434085
941 Ga0070667_100056769
942 Ga0070667_100162288
943 Ga0070709_10000730
944 Ga0070709_10065399
945 Ga0070714_100001418
946 Ga0070714_100003214
947 Ga0070714_100086327
948 Ga0070714_100093214
949 Ga0070714_100096738
950 Ga0070713_100001109
951 Ga0070713_100012557
952 Ga0070713_100082644
953 Ga0070713_100249254
954 Ga0070710_10000758
955 Ga0070711_100000258
956 Ga0070711_100011131
957 Ga0070711_100031406
958 Ga0070700_100006435
959 Ga0070700_100031847
960 Ga0070678_100386959
961 Ga0070662_100040578
962 Ga0070681_10027499
963 Ga0070681_10100741
964 Ga0068867_100030779
965 Ga0070685_10011861
966 Ga0070685_10252611
967 Ga0070706_100009310
968 Ga0070707_100012904
969 Ga0070707_100417586
970 Ga0070698_100000873
971 Ga0070698_100010105
972 Ga0070698_100290868
973 Ga0070699_100363920
974 Ga0070679_100077187
975 Ga0070679_100086156
976 Ga0070684_100007069
977 Ga0070684_100086484
978 Ga0070684_100116628
979 Ga0070697_100223369
980 Ga0070672_100007050
981 Ga0070686_100279939
982 Ga0070693_100001271
983 Ga0070665_100000865
984 Ga0070665_100125179
985 Ga0068855_100399425
986 Ga0070664_100003004
987 Ga0070664_100053722
988 Ga0070664_100302006
989 Ga0068857_100058531
990 Ga0068857_100389550
991 Ga0068854_100355565
992 Ga0068856_100055390
993 Ga0068856_100176336
994 Ga0068856_100592335
995 Ga0070702_100003214
996 Ga0070702_100024536
997 Ga0070702_100037982
998 Ga0068852_100040897
999 Ga0068852_100134207
1000 Ga0068864_100008703
1001 Ga0068861_100003359
1002 Ga0068861_100071581
1003 Ga0068861_100156765
1004 Ga0068861_100169457
1005 Ga0068861_100174152
1006 Ga0068861_100221061
1007 Ga0068870_10001666
1008 Ga0068870_10014561
1009 Ga0068863_100059072
1010 Ga0068863_100268002
1011 Ga0068863_100531608
1012 Ga0068858_100074234
1013 Ga0068860_100002948
1014 Ga0068862_100027387
1015 Ga0081455_10002300
1016 Ga0081538_10004313
1017 Ga0081540_1002450
1018 Ga0081540_1027134
1019 Ga0081539_10000242
1020 Ga0081539_10000309
1021 Ga0081539_10000364
1022 Ga0081539_10000432
1023 Ga0081539_10002151
1024 Ga0081539_10011082
1025 Ga0081539_10061848
1026 Ga0081539_10072958
1027 Ga0081539_10130509
1028 Ga0070717_10039960
1029 Ga0070717_10104318
1030 Ga0070717_10233674
1031 Ga0075365_10002795
1032 Ga0075365_10014617
1033 Ga0075365_10019311
1034 Ga0075365_10048059
1035 Ga0075365_10050831
1036 Ga0075365_10112275
1037 Ga0075368_10013839
1038 Ga0075363_100011776
1039 Ga0075363_100085513
1040 Ga0075364_10005194
1041 Ga0075364_10007061
1042 Ga0075364_10022871
1043 Ga0070715_10025138
1044 Ga0070716_100000222
1045 Ga0070716_100051297
1046 Ga0070712_100002878
1047 Ga0070712_100017672
1048 Ga0070712_100152350
1049 Ga0075362_10100786
1050 Ga0075367_10131479
1051 Ga0097621_100017517
1052 Ga0075370_10008069
1053 Ga0075370_10074475
1054 Ga0075370_10082575
1055 Ga0075370_10082750
1056 Ga0068871_100042638
1057 Ga0075428_100001979
1058 Ga0075428_100060371
1059 Ga0075428_100413186
1060 Ga0075428_100529093
1061 Ga0075430_100000695
1062 Ga0075430_100007157
1063 Ga0075430_100037236
1064 Ga0075430_100292250
1065 Ga0075431_100001519
1066 Ga0075433_10004134
1067 Ga0075434_100016397
1068 Ga0075429_100030614
1069 Ga0075429_100132629
1070 Ga0075429_100143626
1071 Ga0068865_100269844
1072 Ga0075436_100009165
1073 Ga0099826_10146979
1074 Ga0075435_100003716
1075 Ga0105251_10034559
1076 Ga0111539_10001333
1077 Ga0111539_10018630
1078 Ga0111539_10020393
1079 Ga0105245_10033111
1080 Ga0105245_10038998
1081 Ga0105245_10040802
1082 Ga0105245_10186878
1083 Ga0105245_10388489
1084 Ga0105245_10664751
1085 Ga0105247_10093560
1086 Ga0114129_10000004
1087 Ga0114129_10006456
1088 Ga0114129_10043613
1089 Ga0114129_10214596
1090 Ga0114129_10359379
1091 Ga0105243_10038026
1092 Ga0105243_10107924
1093 Ga0105243_10177597
1094 Ga0105243_10221577
1095 Ga0105241_10012537
1096 Ga0105242_10008355
1097 Ga0105242_10297798
1098 Ga0105248_10156267
1099 Ga0105248_10775350
1100 Ga0105238_10103081
1101 Ga0105238_10107440
1102 Ga0105238_10109399
1103 Ga0105249_10077640
1104 Ga0105249_10411564
1105 Ga0105249_10431293
1106 Ga0105239_10003785
1107 Ga0105239_10012969
1108 Ga0105239_10148897
1109 Ga0105239_10151037
1110 Ga0105239_10432819
1111 Ga0105246_10003633
1112 Ga0105246_10006396
1113 Ga0105246_10092926
1114 Ga0157373_10016101
1115 Ga0157370_10046884
1116 Ga0157369_10198568
1117 Ga0157374_10017524
1118 Ga0157374_10570838
1119 Ga0157378_10077003
1120 Ga0163162_10021224
1121 Ga0157372_10014846
1122 Ga0157372_10091076
1123 Ga0157372_10108184
1124 Ga0157372_10184171
1125 Ga0157372_10373283
1126 Ga0157372_10422006
1127 Ga0157375_10035766
1128 Ga0157375_10036473
1129 Ga0157375_10052070
1130 Ga0157375_10102461
1131 Ga0157375_10158717
1132 Ga0163163_10006777
1133 Ga0163163_10021647
1134 Ga0163163_10215448
1135 Ga0163163_10412449
1136 Ga0157380_10008910
1137 Ga0157380_10045751
1138 Ga0157380_10361590
1139 Ga0182008_10027037
1140 Ga0157377_10007388
1141 Ga0157377_10044663
1142 Ga0157379_10008327
1143 Ga0157379_10025457
1144 Ga0157379_10050511
1145 Ga0163161_10076375
1146 Ga0163161_10234808
1147 Ga0197907_10762486
1148 Ga0206356_11171474
1149 Ga0206356_11313232
1150 Ga0206354_10671360
1151 Ga0206353_10204676
1152 Ga0206353_11294495
1153 Ga0206353_11492747
1154 Ga0224712_10073948
1155 Ga0207697_10034184
1156 Ga0207692_10000647
1157 Ga0207692_10001433
1158 Ga0207642_10047548
1159 Ga0207710_10026262
1160 Ga0207688_10043207
1161 Ga0207647_10077146
1162 Ga0207647_10095249
1163 Ga0207685_10014863
1164 Ga0207699_10000105
1165 Ga0207699_10009084
1166 Ga0207699_10235174
1167 Ga0207645_10021076
1168 Ga0207643_10000266
1169 Ga0207643_10016651
1170 Ga0207705_10023065
1171 Ga0207705_10057392
1172 Ga0207705_10110225
1173 Ga0207705_10216708
1174 Ga0207684_10037605
1175 Ga0207654_10021268
1176 Ga0207671_10046657
1177 Ga0207693_10001586
1178 Ga0207693_10085842
1179 Ga0207693_10293625
1180 Ga0207663_10000974
1181 Ga0207663_10008863
1182 Ga0207662_10016637
1183 Ga0207657_10040954
1184 Ga0207657_10145587
1185 Ga0207657_10149793
1186 Ga0207657_10226442
1187 Ga0207657_10235906
1188 Ga0207649_10301760
1189 Ga0207652_10011619
1190 Ga0207652_10126230
1191 Ga0207652_10131084
1192 Ga0207646_10019452
1193 Ga0207681_10217217
1194 Ga0207694_10159529
1195 Ga0207694_10188456
1196 Ga0207694_10229469
1197 Ga0207650_10023213
1198 Ga0207650_10142999
1199 Ga0207659_10002694
1200 Ga0207659_10057964
1201 Ga0207687_10009504
1202 Ga0207687_10071750
1203 Ga0207687_10087367
1204 Ga0207687_10121432
1205 Ga0207700_10000050
1206 Ga0207700_10018417
1207 Ga0207700_10022556
1208 Ga0207700_10044776
1209 Ga0207700_10060570
1210 Ga0207700_10175913
1211 Ga0207700_10230220
1212 Ga0207664_10000101
1213 Ga0207664_10007144
1214 Ga0207664_10017629
1215 Ga0207664_10097734
1216 Ga0207664_10185217
1217 Ga0207690_10019361
1218 Ga0207690_10025788
1219 Ga0207690_10065270
1220 Ga0207690_10361687
1221 Ga0207706_10082442
1222 Ga0207706_10248374
1223 Ga0207686_10065573
1224 Ga0207709_10017261
1225 Ga0207709_10079021
1226 Ga0207709_10103639
1227 Ga0207704_10022390
1228 Ga0207665_10000438
1229 Ga0207665_10018949
1230 Ga0207665_10332814
1231 Ga0207691_10009955
1232 Ga0207711_10099802
1233 Ga0207689_10005945
1234 Ga0207689_10023007
1235 Ga0207689_10034638
1236 Ga0207689_10051566
1237 Ga0207661_10016968
1238 Ga0207661_10070708
1239 Ga0207661_10114313
1240 Ga0207661_10260453
1241 Ga0207679_10003607
1242 Ga0207679_10022957
1243 Ga0207679_10117094
1244 Ga0207679_10375340
1245 Ga0207667_10294029
1246 Ga0207712_10200627
1247 Ga0207668_10007739
1248 Ga0207668_10059087
1249 Ga0207658_10043314
1250 Ga0207658_10163869
1251 Ga0207703_10019676
1252 Ga0207703_10034448
1253 Ga0207703_10058854
1254 Ga0207703_10365782
1255 Ga0207639_10166611
1256 Ga0207639_10239783
1257 Ga0207678_10006802
1258 Ga0207678_10337463
1259 Ga0207678_10455440
1260 Ga0207708_10001687
1261 Ga0207708_10005591
1262 Ga0207708_10005711
1263 Ga0207708_10091674
1264 Ga0207702_10021114
1265 Ga0207702_10586640
1266 Ga0207641_10082434
1267 Ga0207648_10014220
1268 Ga0207676_10077191
1269 Ga0207676_10215357
1270 Ga0207674_10021159
1271 Ga0207674_10068057
1272 Ga0207675_100001326
1273 Ga0207675_100054352
1274 Ga0207675_100079519
1275 Ga0207683_10002454
1276 Ga0207683_10032234
1277 Ga0207683_10462200
1278 Ga0207698_10054957
1279 Ga0207698_10112687
1280 Ga0207698_10146953
1281 Ga0207698_10292162
1282 Ga0209813_10002979
1283 Ga0209813_10023193
1284 Ga0207428_10021038
1285 Ga0207428_10022520
1286 Ga0207428_10102029
1287 Ga0268266_10001844
1288 Ga0268266_10052473
1289 Ga0268265_10011282
1290 Ga0268265_10143120
1291 Ga0268264_10000843
1292 Ga0307515_10004732
1293 Ga0307515_10006082
1294 Ga0307515_10033914
1295 Ga0307515_10164924
1296 Ga0307512_10002870
1297 Ga0307512_10025175
1298 Ga0307512_10036229
1299 Ga0307512_10184528
1300 Ga0316181_1035113
1301 Ga0265340_10001409
1302 Ga0307513_10002952
1303 Ga0307513_10026296
1304 Ga0307509_10111188
1305 Ga0307508_10002257
1306 Ga0307508_10003547
1307 Ga0307508_10053689
1308 Ga0316579_10000044
1309 Ga0307516_10045590
1310 Ga0307405_10165852
1311 Ga0307405_10223037
1312 Ga0307413_10008060
1313 Ga0307518_10000881
1314 Ga0307406_10205474
1315 Ga0307407_10183510
1316 Ga0307412_10053470
1317 Ga0307409_100003217
1318 Ga0307409_100038828
1319 Ga0307409_100046820
1320 Ga0307409_100093198
1321 Ga0307409_100183809
1322 Ga0307409_100198635
1323 Ga0307409_100261862
1324 Ga0307409_100268807
1325 Ga0307409_100329893
1326 Ga0307409_100330958
1327 Ga0307409_100348258
1328 Ga0307416_100076339
1329 Ga0307415_100021568
1330 Ga0307415_100102202
1331 Ga0307507_10014573
1332 Ga0373938_0016312
1333 Ga0373940_0001013
1334 Ga0373951_0000551
1335 Ga0373939_0057071
1336 Ga0373956_0005334
1337 Ga0373942_0005546
1338 Ga0316582_0118947
1339 Ga0395899_0025224
1340 Ga0395899_0069230
1341 Ga0395899_0141525
1342 Ga0395900_0101168
1343 Ga0395900_0130670
1344 Ga0395898_0037833
1345 Ga0395898_0051195
1346 Ga0395898_0099430
1347 Ga0395898_0217984
1348 Ga0395898_0330401
1349 Ga0395898_0423700
1350 Ga0395905_0169425
1351 Ga0395905_0502938
1352 Ga0316581_0001724
1353 Ga0395901_0024894
1354 Ga0395901_0062734
1355 Ga0395901_0072718
1356 Ga0395901_0106362
1357 Ga0395901_0303452
1358 Ga0395901_0571668
1359 Ga0400488_58753
1360 Ga0400486_24036
1361 Ga0436365_0829147
1362 Ga0436363_1319502
1363 Ga0439436_0000284
1364 Ga0439436_0057235
1365 Ga0439439_0020821
1366 Ga0451791_0528520
1367 Ga0451853_0209873
1368 Ga0451853_0556300
1369 Ga0451853_0639474
1370 Ga0451853_0656156
1371 Ga0451853_0776115
1372 Ga0451853_2948900
1373 Ga0439433_0001529
1374 Ga0439442_004161
1375 Ga0439449_0000051
1376 Ga0439449_0008738
1377 Ga0439457_000011
1378 Ga0439446_0006528
1379 Ga0439464_0011014
1380 Ga0466972_0050656
1381 Ga0466965_0026233
1382 Ga0466965_0048968
1383 Ga0466965_0131867
1384 Ga0466965_0195020
1385 Ga0466966_0009724
1386 Ga0466961_0116288
1387 Ga0466961_0143244
1388 Ga0466961_0182530
1389 Ga0466961_0235549
1390 Ga0466963_0083383
1391 Ga0466963_0122107
1392 Ga0466963_0165693
1393 Ga0466963_0193678
1394 Ga0466963_0279889
1395 Ga0466964_0005611
1396 Ga0466964_0016714
1397 Ga0466964_0111361
1398 Ga0466971_0057803
1399 Ga0466971_0122109
1400 Ga0466970_0007602
1401 Ga0466970_0012339
1402 Ga0466970_0026283
1403 Ga0466970_0051390
1404 Ga0466970_0080724
1405 Ga0466970_0114429
1406 Ga0466957_0006638
1407 Ga0466957_0008346
1408 Ga0466957_0030678
1409 Ga0466957_0158849
1410 Ga0466957_0222468
1411 Ga0466957_0224772
1412 Ga0466960_0005547
1413 Ga0466960_0005570
1414 Ga0466960_0020278
1415 Ga0466960_0023329
1416 Ga0466960_0026932
1417 Ga0466960_0043999
1418 Ga0466960_0044966
1419 Ga0466960_0059540
1420 Ga0466960_0100770
1421 Ga0466960_0117854
1422 Ga0466958_0121481
1423 Ga0466958_0121843
1424 Ga0466967_0001211
1425 Ga0466967_0010788
1426 Ga0466967_0022027
1427 Ga0466967_0033393
1428 Ga0466967_0036849
1429 Ga0466967_0047816
1430 Ga0466967_0090662
1431 Ga0466967_0196689
1432 Ga0466967_0468921
1433 Ga0466967_0521901
1434 Ga0495629_0254864
1435 Ga0495641_0056215
1436 Ga0495653_0303640
1437 Ga0495664_0153612
1438 Ga0495664_0173097
1439 Ga0495608_0123062
1440 Ga0495618_0031281
1441 Ga0495632_0055592
1442 Ga0495652_0196469
1443 Ga0495640_0208403
1444 Ga0495657_0169212
1445 Ga0495658_0044687
1446 Ga0495658_0103623
1447 Ga0495600_0186282
1448 Ga0496100_0026145
1449 Ga0496100_0110542
1450 Ga0496100_0112604
1451 Ga0496101_0089944
1452 Ga0496101_0106388
1453 Ga0496101_0109631
1454 Ga0496101_0157574
1455 Ga0496101_0377959
1456 Ga0496102_0001679
1457 Ga0496102_0003877
1458 Ga0496102_0023288
1459 Ga0496102_0024876
1460 Ga0496102_0028012
1461 Ga0496102_0076271
1462 Ga0496102_0161077
1463 Ga0496102_0268687
1464 Ga0496102_0309052
1465 Ga0496103_0030118
1466 Ga0496103_0160569
1467 Ga0496103_0203780
1468 Ga0496104_0068485
1469 Ga0496104_0261566
1470 Ga0496104_0334156
1471 Ga0496104_0461963
1472 Ga0496105_0003593
1473 Ga0496105_0008048
1474 Ga0496105_0301802
1475 Ga0496106_0015296
1476 Ga0496106_0018504
1477 Ga0496106_0134859
1478 Ga0496107_0035852
1479 Ga0496107_0213334
1480 Ga0496108_0000029
1481 Ga0496108_0021411
1482 Ga0496108_0053647
1483 Ga0496108_0165719
1484 Ga0496108_0194250
1485 Ga0496109_0019013
1486 Ga0496109_0060095
1487 Ga0496109_0078276
1488 Ga0496109_0139809
1489 Ga0496109_0190228
1490 Ga0496109_0218728
1491 Ga0496109_0411968
1492 Ga0496110_0083619
1493 Ga0496110_0084773
1494 Ga0496110_0159245
1495 Ga0496110_0262354
1496 Ga0496111_0078856
1497 Ga0496111_0084703
1498 Ga0496111_0114783
1499 Ga0496111_0188658
1500 Ga0496112_0075847
1501 Ga0496112_0127657
1502 Ga0496112_0248695
1503 Ga0496113_0021901
1504 Ga0496113_0065827
1505 Ga0496113_0187099
1506 Ga0496114_0004572
1507 Ga0496114_0012911
1508 Ga0496114_0014354
1509 Ga0496114_0015345
1510 Ga0496114_0072030
1511 Ga0496114_0082389
1512 Ga0496114_0088916
1513 Ga0496114_0175301
1514 Ga0496114_0242440
1515 Ga0496114_0290511
1516 Ga0496115_0001458
1517 Ga0496115_0074357
1518 Ga0496115_0077411
1519 Ga0496119_0001068
1520 Ga0496120_0000103
1521 Ga0496126_0237298
1522 Ga0501031_0017084
1523 Ga0501031_0105160
1524 Ga0501031_0115831
1525 Ga0501031_0134448
1526 Ga0501032_0005543
1527 Ga0501032_0020844
1528 Ga0501033_0002108
1529 Ga0501033_0028148
1530 Ga0501033_0104871
1531 Ga0501033_0112939
1532 Ga0501034_0023454
1533 Ga0501034_0053987
1534 Ga0501034_0412162
1535 Ga0501036_0008657
1536 Ga0501036_0008684
1537 Ga0501036_0009779
1538 Ga0501036_0036455
1539 Ga0501036_0072343
1540 Ga0501036_0226522
1541 Ga0501037_0007658
1542 Ga0501037_0008499
1543 Ga0501037_0024917
1544 Ga0501037_0026338
1545 Ga0501037_0027690
1546 Ga0501038_0001411
1547 Ga0501038_0005982
1548 Ga0501039_0004034
1549 Ga0501039_0073509
1550 Ga0501039_0137797
1551 Ga0501039_0410465
1552 Ga0501040_0010935
1553 Ga0501040_0214894
1554 Ga0501040_0229811
1555 Ga0501041_0005388
1556 Ga0501042_0004768
1557 Ga0501042_0011275
1558 Ga0501042_0014282
1559 Ga0501042_0169484
1560 Ga0501043_0003129
1561 Ga0501043_0098331
1562 Ga0501046_0000841
1563 Ga0501046_0016344
1564 Ga0501046_0061655
1565 Ga0501046_0232814
1566 Ga0501047_0004414
1567 Ga0501047_0086847
1568 Ga0501048_0002290
1569 Ga0501048_0034957
1570 Ga0501048_0112234
1571 Ga0501067_0049904
1572 Ga0501067_0071898
1573 Ga0501067_0179926
1574 Ga0501068_0030555
1575 Ga0501069_0011110
1576 Ga0501069_0070083
1577 Ga0501069_0080857
1578 Ga0501070_0013674
1579 Ga0501070_0108014
1580 Ga0501070_0148380
1581 Ga0501070_0196549
1582 Ga0501071_0026943
1583 Ga0501071_0080394
1584 Ga0501071_0169046
1585 Ga0501072_0013614
1586 Ga0501072_0077428
1587 Ga0501072_0184360
1588 Ga0501073_0254075
1589 Ga0501074_0027043
1590 Ga0501074_0080536
1591 Ga0501074_0104186
1592 Ga0501074_0117776
1593 Ga0501075_0005329
1594 Ga0501075_0022558
1595 Ga0501076_0003246
1596 Ga0501076_0009396
1597 Ga0501076_0160059
1598 Ga0501076_0268342
1599 Ga0501076_0410379
1600 Ga0501077_0017963
1601 Ga0501077_0081074
1602 Ga0501077_0284482
1603 Ga0501079_0018295
1604 Ga0501079_0019142
1605 Ga0501079_0039588
1606 Ga0501079_0056653
1607 Ga0501079_0427833
1608 Ga0501080_0051549
1609 Ga0501080_0051621
1610 Ga0501080_0167432
1611 Ga0501080_0221404
1612 Ga0501081_0021306
1613 Ga0501083_0033902
1614 Ga0501035_0012022
1615 Ga0501035_0042476
1616 Ga0501044_0017119
1617 Ga0501044_0096708
1618 Ga0501045_0049862
1619 Ga0501045_0095127
1620 Ga0501045_0116345
1621 Ga0501045_0129091
1622 nmdc:mga03n38_180901_c1
1623 nmdc:mga03n38_6635_c1
1624 nmdc:mga03n38_71204_c1
1625 nmdc:mga00v17_5910_c1
1626 nmdc:mga0yw44_10082_c1
1627 nmdc:mga0yw44_10882_c1
1628 nmdc:mga0yw44_126786_c1
1629 nmdc:mga0yw44_139929_c1
1630 nmdc:mga0yw44_14102_c2
1631 nmdc:mga0yw44_25005_c1
1632 nmdc:mga0yw44_26964_c1
1633 nmdc:mga0yw44_31193_c1
1634 nmdc:mga0yw44_37885_c1
1635 nmdc:mga0yw44_68788_c1
1636 nmdc:mga04h51_6015_c1
1637 nmdc:mga07m45_26650_c1
1638 nmdc:mga05p37_22251_c1
1639 nmdc:mga05p37_32742_c1
1640 nmdc:mga05p37_960_c2
1641 nmdc:mga09592_20_c1
1642 nmdc:mga09592_52005_c1
1643 nmdc:mga0qj67_1435_c1
1644 nmdc:mga0qj67_222730_c1
1645 nmdc:mga0qj67_38666_c1
1646 nmdc:mga0qj67_5065_c1
1647 nmdc:mga06r32_89_c1
1648 nmdc:mga08y16_2421_c1
1649 nmdc:mga08y16_250408_c1
1650 nmdc:mga08y16_3646_c1
1651 nmdc:mga08y16_4458_c1
1652 nmdc:mga0rr50_59006_c1
1653 nmdc:mga08x19_86882_c1
1654 nmdc:mga0a205_102345_c1
1655 nmdc:mga0a205_121873_c1
1656 Ga0495601_0152878
1657 Ga0495655_0047129
1658 Ga0495619_0082755
1659 Ga0500644_0004160
1660 Ga0500646_0000579
1661 Ga0500583_0166702
1662 Ga0500641_0025082
1663 Ga0500650_0063720
1664 Ga0500556_0001238
1665 Ga0500556_0045806
1666 Ga0500593_000208
1667 Ga0500652_048424
1668 Ga0500573_0025511
1669 Ga0500616_0001402
1670 Ga0500616_0032899
1671 Ga0501084_0015872
1672 Ga0501084_0057608
1673 Ga0501082_0010696
1674 Ga0501082_0036031
1675 Ga0501082_0460611
1676 Ga0466962_0103853
1677 Ga0466962_0139294
1678 Ga0530510_0003798
1679 Ga0530510_0050137
1680 2501942198
1681 2515495052
1682 2515719056
1683 2515754992
1684 2516083262
1685 2516088636
1686 2586059491
1687 2623590903
1688 2643825479
1689 2643850486
1690 2643889076
1691 2643942298
1692 2643958131
1693 2644034611
1694 2644089685
1695 2644098982
1696 2644114863
1697 2644134243
1698 2644319530
1699 2644389952
1700 2644429379
1701 2644435823
1702 2644531475
1703 2644632288
1704 2676475072
1705 2738867978
1706 2740166899
1707 2753272289
1708 2768647542
1709 2772641604
1710 2772644123
1711 2774393477
1712 2784471936
1713 2795784400
1714 2808840634
1715 2808873786
1716 2809195629
1717 2809591747
1718 2812332293
1719 2812350535
1720 2819427239
1721 2827629996
1722 2831936376
1723 2832010596
1724 2855387717
1725 2855672180
1726 2855676345
1727 2855681483
1728 2855682773
1729 2855686788
1730 2856743596
1731 2856864576
1732 2857291860
1733 2857294765
1734 2857483064
1735 2858854430
1736 2858855251
1737 2858873895
1738 2858888489
1739 2858888817
1740 2858889090
1741 2858890813
1742 2858897335
1743 2858899255
1744 2858905850
1745 2862709787
1746 2866068247
1747 2866553742
1748 2867303449
1749 2867316195
1750 2867321061
1751 2867511677
1752 2869048676
1753 2869054122
1754 2869062344
1755 2869066086
1756 2869070732
1757 2869073158
1758 2880489596
1759 2880496108
1760 2880498522
1761 2884697395
1762 2891397796
1763 2891564898
1764 2891971866
1765 2895430981
1766 2895452903
1767 2902588071
1768 2915771797
1769 2918505543
1770 2919449929
1771 2929224785
1772 2929227108
1773 2929232280
1774 2954696952
1775 2954705182
1776 2984576990
1777 2990258737
1778 2996227482
1779 3001891240
1780 649813897
1781 8001790020
1782 8003834570
1783 8003860585
1784 8003877110
1785 8054707685
1786 8054710221
1787 8054731037
1788 8054732869
1789 8054735169
1790 8054738941
1791 8055418423
1792 8056211136

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00294

PfkB

pfkB family carbohydrate kinase

65

350

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
4pvv-assembly1.cif.gz_A-2 micobacterial adenosine kinase in complex with inhibitor 0.9449 1 324
4pvv-assembly1.cif.gz_A-2 micobacterial adenosine kinase in complex with inhibitor 0.9421 1 324
6c9n-assembly1.cif.gz_A mycobacterium tuberculosis adenosine kinase bound to sangivamycin 0.9402 3 323
6c9s-assembly1.cif.gz_B mycobacterium tuberculosis adenosine kinase bound to (2r,3r,4s,5r)-2-(6-([1,1'-biphenyl]-4-ylethynyl)-9h-purin-9-yl)-5-(hydroxymethyl)tetrahydrofuran-3,4-diol 0.9374 3 323
6c9p-assembly1.cif.gz_B mycobacterium tuberculosis adenosine kinase bound to 6-methylmercaptopurine riboside 0.9362 3 323
ID Description Score Start End Superfamily
2pknA00 Alpha Beta;3-Layer(aba) Sandwich;UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase;Ribokinase 0.9338 1 323 3.40.1190.20
2pknA00 Alpha Beta;3-Layer(aba) Sandwich;UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase;Ribokinase 0.931 1 323 3.40.1190.20
2c4eA00 Alpha Beta;3-Layer(aba) Sandwich;UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase;Ribokinase 0.8902 2 308 3.40.1190.20
2c4eA00 Alpha Beta;3-Layer(aba) Sandwich;UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase;Ribokinase 0.8673 2 308 3.40.1190.20
3b1rD00 Alpha Beta;3-Layer(aba) Sandwich;UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase;Ribokinase 0.8671 3 313 3.40.1190.20
ID Description Score Start End GO Terms
AF-A0A2D9H4B3-F1-model_v4 Carbohydrate kinase family protein 0.9932 2 324 GO:0006796
GO:0016301
AF-A0A5C8HHB2-F1-model_v4 deleted 0.9927 1 171
AF-A0A6B2T8K4-F1-model_v4 Carbohydrate kinase family protein 0.9884 1 233 GO:0006796
GO:0016301
AF-A0A2D9H4B3-F1-model_v4 Carbohydrate kinase family protein 0.9871 2 324 GO:0006796
GO:0016301
AF-A0A5C8HHB2-F1-model_v4 deleted 0.9869 1 171

Map