F485033

General Info

Members Datasets Scaffolds Average Seq Length
896 714 1792 212

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2881147464|2881154583
Length 237
Sequence ARIGEKSVLFVMAAEAEYGPHLKELFTPLMTGVGPVEAAVRLGAELATLKAEGALPDLVVSLGSAGSRTLEQTEIYQAVSVSYRDMDASPLGFEKGATPFLDLPVTVPLPFVIPGIKSATLSTGGAIVTGIAYDAIDADMVDMETFACLRACQLFGVPLVGLRGISDGAADLRHVGDWTEYLHVIDEKLAAAVGLLEQAIGGGLLDADCCPDQAARRCGSPKSMREMRPRTAPVASR

Samples

Sample ID Description Type Environment
1 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
6 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
7 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
8 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
9 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
10 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
11 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
12 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
13 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
14 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
15 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
16 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
23 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
24 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
25 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
26 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
27 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
28 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
29 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
30 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
31 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
32 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
33 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
34 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
35 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
36 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
37 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
38 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
39 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
40 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
41 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
42 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
43 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
44 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
45 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
46 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
47 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
48 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
49 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
50 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
51 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
52 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
53 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
54 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
55 3300022739 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules Metagenome Nodule
56 3300022740 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules Metagenome Nodule
57 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
58 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
59 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
60 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
61 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
62 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
63 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
64 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
65 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
66 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
67 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
88 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
89 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
90 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
91 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
93 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
94 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
95 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
96 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
97 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
98 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
99 3300031967 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules Metagenome Nodule
100 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
101 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
102 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
103 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
104 3300033430 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules Metagenome Nodule
105 3300033464 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules Metagenome Nodule
106 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
107 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
108 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
109 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
110 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
111 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
112 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
113 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
114 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
115 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
116 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
117 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
118 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
119 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
120 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
121 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
122 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
123 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
124 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
125 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
126 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
127 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
128 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
129 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
130 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
131 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
132 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
133 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
134 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
135 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
136 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
137 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
138 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
139 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
140 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
141 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
142 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
143 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
144 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
145 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
146 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
147 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
148 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
149 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
150 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
151 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
152 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
153 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
154 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
155 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
156 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
157 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
158 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
159 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
160 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
161 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
162 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
163 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
164 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
165 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
166 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
167 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
168 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
169 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
170 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
171 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
172 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
173 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
174 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
175 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
176 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
177 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
178 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
179 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
180 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
181 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
182 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
183 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
184 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
185 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
186 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
187 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
188 3300059605 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
189 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
190 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
191 2881147464 Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 Isolate Nodule
192 2503198000 Mesorhizobium opportunistum WSM2075 Isolate Nodule
193 2508501122 Ensifer yinggardensis WSM1721 Isolate Nodule
194 2508501123 Mesorhizobium sp. WSM3626 Isolate Nodule
195 2508501127 Mesorhizobium sp. WSM2561 Isolate Nodule
196 2509276018 Mesorhizobium ciceri CMG6 Isolate Nodule
197 2509276019 Ensifer aridi TW10 Isolate Nodule
198 2509276022 Mesorhizobium australicum WSM2073 Isolate Nodule
199 2510065057 Sinorhizobium meliloti WSM1022 Isolate Nodule
200 2510065059 Mesorhizobium ciceri WSM4083 Isolate Nodule
201 2511231027 Phyllobacterium sp. YR531 Isolate Rhizosphere
202 2511231052 Sinorhizobium meliloti AK58 Isolate Nodule
203 2512875016 Mesorhizobium japonicum R7A Isolate Nodule
204 2512875024
205 2512875026 Sinorhizobium medicae WSM1115 Isolate Nodule
206 2513237086 Sinorhizobium meliloti MVII-I Isolate Nodule
207 2513237087 Azorhizobium doebereinerae UFLA1-100 Isolate Nodule
208 2513237090 Mesorhizobium sp. WSM3224 Isolate Nodule
209 2513237091 Sinorhizobium meliloti RRI128 Isolate Nodule
210 2513237140 Sinorhizobium meliloti GVPV12 Isolate Nodule
211 2513237143 Sinorhizobium meliloti Mlalz-1 Isolate Nodule
212 2513237159 Rhizobium giardinii bv. giardinii H152 Isolate Nodule
213 2513237164 Mesorhizobium loti CJ3sym Isolate Nodule
214 2513237305 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
215 2513237351 Mesorhizobium alhagi CCNWXJ12-2 Isolate Nodule
216 2516653046 Sinorhizobium meliloti BO21CC Isolate Nodule
217 2524023207 Ensifer sp. USDA 6670 Isolate Nodule
218 2534681786 Brucella suis 92/29 Isolate Unclassified
219 2537561587 Agrobacterium tumefaciens Cherry 2E-2-2 Isolate Rhizosphere
220 2551306084 Sinorhizobium meliloti 5A14 Isolate Nodule
221 2551306085 Sinorhizobium meliloti AE608H Isolate Nodule
222 2551306086 Sinorhizobium meliloti AK11 Isolate Nodule
223 2551306087 Sinorhizobium meliloti A0643DD Isolate Nodule
224 2551306089 Sinorhizobium meliloti 1A42 Isolate Nodule
225 2551306090 Sinorhizobium meliloti A0641M Isolate Nodule
226 2551306091 Sinorhizobium meliloti C0431A Isolate Nodule
227 2551306092 Sinorhizobium meliloti AK75 Isolate Nodule
228 2551306093 Sinorhizobium meliloti C0438LL Isolate Nodule
229 2558860100 Sinorhizobium sp. PC2 Isolate Nodule
230 2582581306 Rhizobium sp. YR295 Isolate Rhizosphere
231 2582581865 Rhizobium sp. CF258 Isolate Rhizosphere
232 2582581866 Rhizobium sp. CF097 Isolate Rhizosphere
233 2588253730 Mesorhizobium huakuii 7653R Isolate Rhizosphere
234 2599185210 Rhizobium sp. NFACC06-2 Isolate Rhizoplane
235 2599185301 Mesorhizobium sp. NFR06 Isolate Rhizoplane
236 2599185352 Sinorhizobium sp. NFACC03 Isolate Rhizoplane
237 2643221550 Mesorhizobium sp. Root552 Isolate Unclassified
238 2643221551 Mesorhizobium sp. Root1471 Isolate Unclassified
239 2643221555 Mesorhizobium sp. Root554 Isolate Unclassified
240 2643221557 Ensifer sp. Root558 Isolate Unclassified
241 2643221558 Rhizobium sp. Root149 Isolate Unclassified
242 2643221582 Rhizobium sp. Root651 Isolate Unclassified
243 2643221591 Devosia sp. Root685 Isolate Unclassified
244 2643221595 Mesorhizobium sp. Root695 Isolate Unclassified
245 2643221610 Ensifer sp. Root74 Isolate Unclassified
246 2643221623 Aminobacter sp. DSM 101952 Root100 Isolate Unclassified
247 2643221627 Mesorhizobium sp. Root102 Isolate Unclassified
248 2643221668 Ensifer sp. Root423 Isolate Unclassified
249 2643221675 Ensifer sp. Root1298 Isolate Unclassified
250 2643221680 Ensifer sp. Root1312 Isolate Unclassified
251 2643221726 Ensifer sp. Root954 Isolate Unclassified
252 2687453392 Mesorhizobium ciceri biserrulae WSM1284 Isolate Unclassified
253 2690316117 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
254 2693429783 Mesorhizobium sp. LCM 4577 Isolate Rhizosphere
255 2693429784 Mesorhizobium sp. LCM 4576 Isolate Rhizosphere
256 2713897090 Paracoccus sphaerophysae HAMBI 3106 Isolate Nodule
257 2721755686 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
258 2738543024 Aminobacter sp. AP02 Isolate Unclassified
259 2751185800 Brucella pituitosa AA2 Isolate Unclassified
260 2751185821 Ensifer shofinae CCBAU 251167 Isolate Unclassified
261 2756170246 Mesorhizobium loti DSM 2626 Isolate Nodule
262 2757320392 Phyllobacterium leguminum ORS 1419 Isolate Nodule
263 2758568016 [Ochrobactrum] quorumnocens A44 Isolate Rhizosphere
264 2765235802 Phyllobacterium bourgognense 31-25a Isolate Rhizoplane
265 2767802442 Phyllobacterium brassicacearum 29-15 Isolate Rhizoplane
266 2775506902 Phyllobacterium zundukense Tri-48 Isolate Unclassified
267 2775506904 Phyllobacterium zundukense Tri-38 Isolate Unclassified
268 2791355091 Sinorhizobium sp. FG01 Isolate Nodule
269 2791355092 Sinorhizobium sp. NG07B Isolate Nodule
270 2791355123 Mesorhizobium sophorae ICMP 19535 Isolate Unclassified
271 2802428858 Sinorhizobium medicae M14-1 Isolate Nodule
272 2802428862 Sinorhizobium medicae M7-4 Isolate Nodule
273 2802428863 Sinorhizobium medicae M26-2 Isolate Nodule
274 2818991439 Agrobacterium tumefaciens 1187 Isolate Unclassified
275 2838675328 Agrobacterium radiobacter SEMIA 410 Isolate Nodule
276 2838714209 Agrobacterium radiobacter SEMIA 435 Isolate Nodule
277 2838719591 Agrobacterium radiobacter SEMIA 436 Isolate Nodule
278 2838724970 Agrobacterium radiobacter SEMIA 437 Isolate Nodule
279 2839993093 Phyllobacterium endophyticum PEPV15 Isolate Unclassified
280 2840764183 Phyllobacterium sophorae CCBAU 03422 Isolate Unclassified
281 2841734538 Mesorhizobium sp. M6A.T.Cr.TU.016.01.1.1 Isolate Nodule
282 2841846520 Agrobacterium radiobacter SEMIA 440 Isolate Nodule
283 2841859092 Agrobacterium radiobacter SEMIA 4026 Isolate Nodule
284 2842124991 Agrobacterium radiobacter SEMIA 434 Isolate Nodule
285 2842130223 Agrobacterium radiobacter SEMIA 441 Isolate Nodule
286 2842152218 Agrobacterium radiobacter SEMIA 457 Isolate Nodule
287 2842170452 Agrobacterium radiobacter SEMIA 461 Isolate Nodule
288 2842175837 Agrobacterium radiobacter SEMIA 462 Isolate Nodule
289 2842187318 Agrobacterium radiobacter SEMIA 464 Isolate Nodule
290 2842211629 Agrobacterium radiobacter SEMIA 472 Isolate Nodule
291 2842224351 Agrobacterium radiobacter SEMIA 480 Isolate Nodule
292 2842515876 Agrobacterium radiobacter SEMIA 4072 Isolate Nodule
293 2842521101 Rhizobium giardinii SEMIA 4084 Isolate Nodule
294 2842871566 Phyllobacterium sp. R-73111 Isolate Unclassified
295 2844002411 Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 Isolate Nodule
296 2844009547 Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1 Isolate Nodule
297 2847417321 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
298 2847670302 Mesorhizobium sp. M3A.F.Ca.ET.080.04.2.1 Isolate Nodule
299 2847686936 Mesorhizobium sp. M1A.F.Ca.IN.022.06.1.1 Isolate Nodule
300 2848992105 Sinorhizobium fredii CCBAU 25509 Isolate Unclassified
301 2850079185 Ensifer aridi JNVU TP6 Isolate Unclassified
302 2854911287 Brucella lupini LUP21 Isolate Unclassified
303 2855825444 Sinorhizobium meliloti CXM1-105 Isolate Nodule
304 2855839649 Sinorhizobium meliloti AK555 Isolate Unclassified
305 2855872281 Sinorhizobium fredii PCH1 Isolate Nodule
306 2856314179 Mesorhizobium sp. M3A.F.Ca.ET.175.01.1.1 Isolate Nodule
307 2856328259 Mesorhizobium sp. Primo-B Isolate Nodule
308 2856334872 Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 Isolate Nodule
309 2856342000 Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 Isolate Nodule
310 2856349417 Mesorhizobium sp. M4A.F.Ca.ET.090.04.2.1 Isolate Nodule
311 2856356410 Mesorhizobium sp. M4B.F.Ca.ET.088.02.2.1 Isolate Nodule
312 2856364286 Mesorhizobium sp. M00.F.Ca.ET.151.01.1.1 Isolate Nodule
313 2857349434 Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 Isolate Nodule
314 2857367948 Mesorhizobium sp. M7A.F.Ca.US.002.01.1.1 Isolate Nodule
315 2858800743 Sinorhizobium meliloti AK170 Isolate Unclassified
316 2869162929 Mesorhizobium sanjuanii BSA136 Isolate Nodule
317 2869249662 Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1 Isolate Nodule
318 2869256925 Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 Isolate Nodule
319 2869264136 Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 Isolate Nodule
320 2869271264 Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 Isolate Nodule
321 2869278585 Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 Isolate Nodule
322 2869285874 Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 Isolate Nodule
323 2871429161 Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 Isolate Nodule
324 2871435913 Mesorhizobium sp. M7A.F.Ca.MR.228.00.0.0 Isolate Nodule
325 2871444079 Mesorhizobium sp. M1A.F.Ca.IN.020.06.1.1 Isolate Nodule
326 2871451962 Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 Isolate Nodule
327 2871459585 Mesorhizobium sp. M7A.F.Ca.CA.001.09.1.1 Isolate Nodule
328 2871466892 Mesorhizobium sp. M7D.F.Ca.US.004.01.2.1 Isolate Nodule
329 2871474448 Mesorhizobium sp. M6A.T.Cr.TU.017.01.1.1 Isolate Nodule
330 2871481445 Mesorhizobium sp. M7A.F.Ca.CA.004.02.1.1 Isolate Nodule
331 2871488783 Mesorhizobium sp. M4B.F.Ca.ET.203.01.1.1 Isolate Nodule
332 2871495908 Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 Isolate Nodule
333 2874102143 Mesorhizobium sp. M1A.F.Ca.IN.022.04.1.1 Isolate Nodule
334 2874109183 Mesorhizobium sp. M7A.T.Ca.TU.009.02.1.1 Isolate Nodule
335 2874116593 Mesorhizobium sp. M7A.F.Ca.CA.004.08.2.1 Isolate Nodule
336 2874123672 Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 Isolate Nodule
337 2874139085 Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 Isolate Nodule
338 2874146452 Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 Isolate Nodule
339 2874155637 Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 Isolate Nodule
340 2874162495 Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 Isolate Nodule
341 2874168670 Mesorhizobium kowhaii Ach-343 Isolate Nodule
342 2876363079 Mesorhizobium loti R7ANS::ICEMlSym2042 Isolate Nodule
343 2876377896 Mesorhizobium sp. M2C.T.Ca.TU.009.01.2.1 Isolate Nodule
344 2876386047 Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 Isolate Nodule
345 2876392853 Mesorhizobium sp. M1D.F.Ca.ET.234.01.1.1 Isolate Nodule
346 2876399893 Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 Isolate Nodule
347 2876406927 Mesorhizobium sp. M7A.F.Ca.CA.002.03.2.1 Isolate Nodule
348 2876413966 Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 Isolate Nodule
349 2876420981 Mesorhizobium sp. M7A.F.Ca.CA.004.08.1.1 Isolate Nodule
350 2878035449 Mesorhizobium sp. M3A.F.Ca.ET.201.01.1.1 Isolate Nodule
351 2878738818 Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 Isolate Nodule
352 2878745973 Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 Isolate Nodule
353 2878753008 Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1 Isolate Nodule
354 2878760144 Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 Isolate Nodule
355 2878767105 Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 Isolate Nodule
356 2878774303 Mesorhizobium sp. M7A.F.Ca.CA.002.15.1.1 Isolate Nodule
357 2878781027 Mesorhizobium sp. M7A.F.Ca.CA.001.12.2.1 Isolate Nodule
358 2881161766 Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 Isolate Nodule
359 2881845957 Mesorhizobium sp. M4B.F.Ca.ET.019.03.1.1 Isolate Nodule
360 2881853255 Mesorhizobium sp. M4A.F.Ca.ET.020.02.1.1 Isolate Nodule
361 2881861095 Mesorhizobium sp. M4B.F.Ca.ET.049.02.1.2 Isolate Nodule
362 2882632389 Mesorhizobium waimense ICMP19557 Isolate Unclassified
363 2882912400 Mesorhizobium sp. M4B.F.Ca.ET.013.02.1.1 Isolate Nodule
364 2885305155 Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 Isolate Nodule
365 2885312484 Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 Isolate Nodule
366 2885342637 Mesorhizobium sp. M4A.F.Ca.ET.050.02.1.1 Isolate Nodule
367 2885350715 Mesorhizobium sp. M4A.F.Ca.ET.022.05.2.1 Isolate Nodule
368 2888337043 Mesorhizobium sp. M8A.F.Ca.ET.057.01.1.1 Isolate Nodule
369 2888343758 Mesorhizobium sp. AA22 Isolate Unclassified
370 2888350351 Mesorhizobium sp. M2A.F.Ca.ET.046.03.2.1 Isolate Nodule
371 2889010040 Mesorhizobium sp. M2A.F.Ca.ET.043.05.1.1 Isolate Nodule
372 2889016732 Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1 Isolate Nodule
373 2898795034 Rhodobacter sp. SGA-6-6 Isolate Rhizosphere
374 2899792073 Agrobacterium deltaense CNPSo 3391 Isolate Nodule
375 2903448605 Mesorhizobium japonicum Opo-235 Isolate Nodule
376 2903492973 Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 Isolate Nodule
377 2903513507 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.2 Isolate Nodule
378 2903521522 Mesorhizobium loti R7ANS::ICEMlSym2014 Isolate Nodule
379 2903528002 Mesorhizobium loti R7ANS::ICEMlSym2037 Isolate Nodule
380 2903540706 Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 Isolate Nodule
381 2904578770 Phyllobacterium sp. 586 Isolate Unclassified
382 2904659560 Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1 Isolate Nodule
383 2906308376 Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 Isolate Nodule
384 2906321335 Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 Isolate Nodule
385 2906328253 Mesorhizobium sp. M1A.T.Ca.IN.004.03.1.1 Isolate Nodule
386 2906354277 Mesorhizobium sp. M2A.F.Ca.ET.040.01.1.1 Isolate Nodule
387 2906363423 Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1 Isolate Nodule
388 2906370794 Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1 Isolate Nodule
389 2906378014 Mesorhizobium sp. M7D.F.Ca.US.004.03.1.1 Isolate Nodule
390 2906386501 Mesorhizobium sp. M7A.F.Ca.CA.003.01.2.1 Isolate Nodule
391 2906393657 Mesorhizobium sp. M7A.F.Ca.CA.001.11.2.1 Isolate Nodule
392 2906401398 Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 Isolate Nodule
393 2906408224 Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 Isolate Nodule
394 2906414383 Mesorhizobium sp. M3A.F.Ca.ET.174.01.1.1 Isolate Nodule
395 2913295892 Sinorhizobium kostiensis DSM 13372 Isolate Nodule
396 2915986958 Sinorhizobium meliloti USDA1659 Isolate Nodule
397 2915993759 Sinorhizobium meliloti USDA1336 Isolate Nodule
398 2916000859 Sinorhizobium meliloti USDA1562 Isolate Nodule
399 2916007675 Sinorhizobium meliloti USDA1289 Isolate Nodule
400 2916014648 Sinorhizobium meliloti USDA1583 Isolate Nodule
401 2916021584 Sinorhizobium meliloti USDA1550 Isolate Nodule
402 2916028427 Sinorhizobium meliloti USDA1613 Isolate Nodule
403 2916035215 Sinorhizobium meliloti 3011 Isolate Nodule
404 2916041962 Sinorhizobium meliloti USDA1795 Isolate Nodule
405 2916048683 Sinorhizobium meliloti USDA1796 Isolate Nodule
406 2916055098 Sinorhizobium meliloti USDA1770 Isolate Nodule
407 2916068649 Sinorhizobium meliloti USDA1220 Isolate Nodule
408 2916076590 Sinorhizobium meliloti USDA1661 Isolate Nodule
409 2919114240 Agrobacterium tumefaciens 1457 Isolate Rhizosphere
410 2919119836 Phyllobacterium sp. 1468 Isolate Rhizosphere
411 2919166419 Agrobacterium cavarae 2074 Isolate Unclassified
412 2921201388 Sinorhizobium meliloti USDA1692 Isolate Nodule
413 2921208531 Sinorhizobium meliloti USDA1660 Isolate Nodule
414 2921237296 Sinorhizobium meliloti USDA1508 Isolate Nodule
415 2921244191 Sinorhizobium meliloti 2119 Isolate Nodule
416 2921257292 Sinorhizobium meliloti USDA1320 Isolate Nodule
417 2921263974 Sinorhizobium meliloti USDA1107 Isolate Nodule
418 2921282425 Sinorhizobium meliloti USDA1203 Isolate Nodule
419 2921289301 Sinorhizobium meliloti USDA1730 Isolate Nodule
420 2921296804 Sinorhizobium meliloti USDA1200 Isolate Nodule
421 2922130491 Mesorhizobium sp. M00.F.Ca.ET.038.03.1.1 Isolate Nodule
422 2922151315 Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 Isolate Nodule
423 2922158528 Mesorhizobium sp. M1A.F.Ca.IN.022.05.2.1 Isolate Nodule
424 2922172374 Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 Isolate Nodule
425 2922178524 Mesorhizobium sp. M7A.F.Ca.CA.002.09.1.1 Isolate Nodule
426 2922185730 Mesorhizobium sp. M2A.F.Ca.ET.037.01.1.1 Isolate Nodule
427 2924144063 Sinorhizobium meliloti USDA1022 Isolate Nodule
428 2924150972 Sinorhizobium meliloti USDA1700 Isolate Nodule
429 2924158325 Sinorhizobium meliloti USDA1146 Isolate Nodule
430 2924165586 Sinorhizobium meliloti USDA1264 Isolate Nodule
431 2924172951 Sinorhizobium meliloti USDA1626 Isolate Nodule
432 2924179722 Sinorhizobium meliloti USDA1280 Isolate Nodule
433 2924186466 Sinorhizobium meliloti USDA1389 Isolate Nodule
434 2924193448 Sinorhizobium meliloti USDA1158 Isolate Nodule
435 2924200457 Sinorhizobium meliloti USDA1007 Isolate Nodule
436 2924207177 Sinorhizobium meliloti USDA1589 Isolate Nodule
437 2924214083 Sinorhizobium meliloti USDA1702 Isolate Nodule
438 2924221636 Sinorhizobium meliloti USDA1416 Isolate Nodule
439 2924228884 Sinorhizobium meliloti USDA1581 Isolate Nodule
440 2924710171 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.2 Isolate Nodule
441 2924726620 Mesorhizobium sp. M1A.F.Ca.IN.020.03.2.1 Isolate Nodule
442 2924733363 Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 Isolate Nodule
443 2924741084 Mesorhizobium sp. M7A.F.Ca.CA.004.09.1.2 Isolate Nodule
444 2924748358 Mesorhizobium sp. M7A.F.Ca.CA.002.14.1.2 Isolate Nodule
445 2924762789 Mesorhizobium sp. WSM4303 Isolate Unclassified
446 2924776078 Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 Isolate Nodule
447 2924784321 Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 Isolate Nodule
448 2926754445 Agrobacterium radiobacter SLBN-94 Isolate Rhizosphere
449 2928521798 Phyllobacterium ifriqiyense 1451 Isolate Rhizosphere
450 2933006813 Rhizobium sp. SEMIA 439 Isolate Unclassified
451 2933011516 Rhizobium sp. SEMIA 4032 Isolate Unclassified
452 2937002841 Sinorhizobium meliloti USDA1006 Isolate Nodule
453 2937009748 Sinorhizobium meliloti USDA1162 Isolate Nodule
454 2937016420 Sinorhizobium meliloti USDA1027 Isolate Nodule
455 2937023124 Sinorhizobium meliloti USDA1335 Isolate Nodule
456 2937036028 Sinorhizobium medicae USDA1608 Isolate Nodule
457 2937042894 Sinorhizobium meliloti USDA1687 Isolate Nodule
458 2937049772 Sinorhizobium meliloti USDA1691 Isolate Nodule
459 2937056579 Sinorhizobium meliloti USDA1357 Isolate Nodule
460 2937063883 Sinorhizobium meliloti USDA1808 Isolate Nodule
461 2937071275 Sinorhizobium meliloti USDA1623 Isolate Nodule
462 2937084907 Sinorhizobium medicae USDA1664 Isolate Nodule
463 2937091812 Sinorhizobium meliloti USDA1221 Isolate Nodule
464 2937098957 Sinorhizobium meliloti USDA1519 Isolate Nodule
465 2937106411 Sinorhizobium meliloti USDA1214 Isolate Nodule
466 2937113482 Sinorhizobium meliloti USDA1180 Isolate Nodule
467 2937119839 Sinorhizobium meliloti USDA1790 Isolate Nodule
468 2937126314 Sinorhizobium meliloti USDA1612 Isolate Nodule
469 2937813078 Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 Isolate Nodule
470 2937822353 Mesorhizobium neociceri CCANP35 Isolate Nodule
471 2937836603 Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 Isolate Nodule
472 2937848649 Mesorhizobium sp. WSM4310 Isolate Unclassified
473 2937861824 Mesorhizobium sp. M7A.F.Ca.CA.001.07.2.1 Isolate Nodule
474 2937868953 Mesorhizobium sp. M7A.F.Ca.CA.001.13.2.1 Isolate Nodule
475 2937891427 Mesorhizobium sp. M1A.F.Ca.IN.022.07.1.1 Isolate Nodule
476 2937972304 Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 Isolate Nodule
477 2937980651 Mesorhizobium sp. M7A.F.Ca.CA.004.04.2.1 Isolate Nodule
478 2937994558 Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 Isolate Nodule
479 2938014810 Mesorhizobium sp. M2C.T.Ca.TU.002.02.1.1 Isolate Nodule
480 2941499720 Ensifer sp. 4252 Isolate Rhizosphere
481 2954011201 Phyllobacterium ifrigiyense W4I11 Isolate Rhizosphere
482 2957382221 Sinorhizobium meliloti USDA1919 Isolate Nodule
483 2957388812 Sinorhizobium meliloti USDA1195 Isolate Nodule
484 2957395598 Sinorhizobium meliloti USDA1237 Isolate Nodule
485 2957402308 Sinorhizobium meliloti USDA1794 Isolate Nodule
486 2957408893 Sinorhizobium meliloti USDA1163 Isolate Nodule
487 2957415311 Sinorhizobium meliloti USDA1724 Isolate Nodule
488 2957422303 Sinorhizobium meliloti USDA1497 Isolate Nodule
489 2957430029 Sinorhizobium meliloti USDA1590 Isolate Nodule
490 2957437181 Sinorhizobium medicae USDA1694 Isolate Nodule
491 2957443900 Sinorhizobium meliloti USDA1734 Isolate Nodule
492 2957450854 Sinorhizobium meliloti USDA1655 Isolate Nodule
493 2957457609 Sinorhizobium meliloti USDA1751 Isolate Nodule
494 2957464669 Sinorhizobium meliloti USDA1520 Isolate Nodule
495 2957471148 Sinorhizobium meliloti USDA1204 Isolate Nodule
496 2957478035 Sinorhizobium meliloti USDA1171 Isolate Nodule
497 2957484790 Sinorhizobium meliloti USDA1464 Isolate Nodule
498 2957491536 Sinorhizobium meliloti USDA1804 Isolate Nodule
499 2957498199 Sinorhizobium meliloti USDA1561 Isolate Nodule
500 2957505466 Sinorhizobium meliloti USDA1696 Isolate Nodule
501 2958034702 Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 Isolate Nodule
502 2958041894 Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 Isolate Nodule
503 2958064165 Mesorhizobium sp. SARCC-RB16n Isolate Unclassified
504 2958071322 Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 Isolate Nodule
505 2958084443 Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 Isolate Nodule
506 2958092219 Mesorhizobium sp. M8A.F.Ca.ET.059.01.1.1 Isolate Nodule
507 2958100919 Mesorhizobium sp. M2A.F.Ca.ET.015.02.1.1 Isolate Nodule
508 2958108152 Mesorhizobium sp. M7A.F.Ca.CA.004.11.1.1 Isolate Nodule
509 2958115193 Mesorhizobium sp. M00.F.Ca.ET.217.01.1.1 Isolate Nodule
510 2958122699 Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 Isolate Nodule
511 2958130278 Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 Isolate Nodule
512 2958137437 Mesorhizobium sp. M7A.F.Ca.CA.002.04.1.1 Isolate Nodule
513 2958158011 Mesorhizobium sp. M7A.F.Ca.CA.002.15.2.1 Isolate Nodule
514 2958165035 Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 Isolate Nodule
515 2958179912 Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 Isolate Nodule
516 2960584000 Sinorhizobium meliloti USDA1530 Isolate Nodule
517 2960591022 Sinorhizobium medicae USDA1066 Isolate Nodule
518 2960597568 Sinorhizobium meliloti 3085 Isolate Nodule
519 2960603979 Sinorhizobium meliloti USDA1580 Isolate Nodule
520 2960610863 Sinorhizobium meliloti USDA1792 Isolate Nodule
521 2960617483 Sinorhizobium meliloti USDA1719 Isolate Nodule
522 2960624210 Sinorhizobium meliloti USDA1415 Isolate Nodule
523 2960637947 Sinorhizobium meliloti USDA1202 Isolate Nodule
524 2960645483 Sinorhizobium meliloti USDA1703 Isolate Nodule
525 2960652885 Sinorhizobium meliloti USDA1199 Isolate Nodule
526 2960660292 Sinorhizobium meliloti USDA1883 Isolate Nodule
527 2960667422 Sinorhizobium meliloti USDA1170 Isolate Nodule
528 2960674078 Sinorhizobium meliloti USDA1666 Isolate Nodule
529 2960687367 Sinorhizobium meliloti USDA1462 Isolate Nodule
530 2961077736 Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 Isolate Nodule
531 2961114664 Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 Isolate Nodule
532 2961127735 Mesorhizobium sp. M4A.F.Ca.ET.029.04.2.1 Isolate Nodule
533 2961136820 Mesorhizobium sp. M7A.F.Ca.AU.001.01.1.1 Isolate Nodule
534 2961163497 Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 Isolate Nodule
535 2961170736 Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 Isolate Nodule
536 2961183825 Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 Isolate Nodule
537 2963644680 Mesorhizobium japonicum R7A Isolate Nodule
538 2964607997 Sinorhizobium meliloti USDA1212 Isolate Nodule
539 2964615318 Sinorhizobium meliloti USDA1248 Isolate Nodule
540 2964621998 Sinorhizobium meliloti USDA1235 Isolate Nodule
541 2964636051 Sinorhizobium meliloti USDA1594 Isolate Nodule
542 2964643177 Sinorhizobium meliloti USDA1760 Isolate Nodule
543 2964649959 Sinorhizobium meliloti USDA1591 Isolate Nodule
544 2964656573 Sinorhizobium meliloti USDA1308 Isolate Nodule
545 2964663802 Sinorhizobium meliloti USDA1688 Isolate Nodule
546 2964670856 Sinorhizobium meliloti USDA1211 Isolate Nodule
547 2964678106 Sinorhizobium meliloti USDA1210 Isolate Nodule
548 2964685014 Sinorhizobium meliloti USDA1232 Isolate Nodule
549 2964691889 Sinorhizobium meliloti USDA1379 Isolate Nodule
550 2964698721 Sinorhizobium meliloti USDA1656 Isolate Nodule
551 2964705432 Sinorhizobium meliloti USDA1614 Isolate Nodule
552 2964712639 Sinorhizobium meliloti USDA1616 Isolate Nodule
553 2964719344 Sinorhizobium meliloti USDA1456 Isolate Nodule
554 2965018300 Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 Isolate Nodule
555 2965025482 Mesorhizobium sp. Primo-A Isolate Nodule
556 2965032056 Mesorhizobium sp. M7A.F.Ca.US.006.04.2.1 Isolate Nodule
557 2965040258 Mesorhizobium sp. M7A.F.Ca.CA.001.06.1.1 Isolate Nodule
558 2965047637 Mesorhizobium sp. M7A.F.Ca.US.014.04.1.1 Isolate Nodule
559 2965062239 Mesorhizobium sp. M1A.F.Ca.ET.072.01.1.1 Isolate Nodule
560 2965089291 Mesorhizobium sp. M7A.F.Ca.CA.001.04.1.1 Isolate Nodule
561 2965102966 Mesorhizobium sp. M7A.F.Ca.AU.002.02.1.1 Isolate Nodule
562 2965110997 Mesorhizobium sp. M7A.F.Ca.US.003.02.2.1 Isolate Nodule
563 2965119406 Mesorhizobium sp. M2A.F.Ca.ET.067.02.1.1 Isolate Nodule
564 2967664464 Sinorhizobium meliloti USDA1208 Isolate Nodule
565 2967671571 Sinorhizobium meliloti USDA1496 Isolate Nodule
566 2967678726 Sinorhizobium meliloti USDA1467 Isolate Nodule
567 2967693043 Sinorhizobium meliloti USDA1183 Isolate Nodule
568 2967699805 Sinorhizobium meliloti USDA1695 Isolate Nodule
569 2967706974 Sinorhizobium meliloti USDA1206 Isolate Nodule
570 2967714385 Sinorhizobium meliloti USDA1023 Isolate Nodule
571 2967721400 Sinorhizobium meliloti USDA1742 Isolate Nodule
572 2967728569 Sinorhizobium medicae USDA1607 Isolate Nodule
573 2967735183 Sinorhizobium meliloti USDA1710 Isolate Nodule
574 2967742019 Sinorhizobium meliloti USDA1676 Isolate Nodule
575 2967748971 Sinorhizobium meliloti USDA1024A Isolate Nodule
576 2967755722 Sinorhizobium meliloti USDA1302 Isolate Nodule
577 2967762386 Sinorhizobium meliloti USDA1397 Isolate Nodule
578 2967769361 Sinorhizobium meliloti USDA1005 Isolate Nodule
579 2967775926 Sinorhizobium meliloti USDA1678 Isolate Nodule
580 2967996073 Mesorhizobium sp. M4B.F.Ca.ET.169.01.1.1 Isolate Nodule
581 2968003550 Mesorhizobium sp. M4B.F.Ca.ET.215.01.1.1 Isolate Nodule
582 2968016561 Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 Isolate Nodule
583 2968083720 Mesorhizobium erdmanii Opo-242 Isolate Unclassified
584 2968091066 Mesorhizobium sp. AA23 Isolate Unclassified
585 2968097103 Mesorhizobium sp. M1A.F.Ca.IN.020.30.1.1 Isolate Nodule
586 2968110612 Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 Isolate Nodule
587 2968117919 Mesorhizobium atlanticum CNPSo 3140 Isolate Unclassified
588 2968128360 Mesorhizobium sp. WSM3873 Isolate Unclassified
589 2968138860 Mesorhizobium sp. M7A.F.Ca.ET.027.03.2.1 Isolate Nodule
590 2968171901 Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 Isolate Nodule
591 2970019648 Sinorhizobium meliloti USDA1603 Isolate Nodule
592 2970026789 Sinorhizobium medicae USDA1611 Isolate Nodule
593 2970033650 Sinorhizobium meliloti USDA1565 Isolate Nodule
594 2970040964 Sinorhizobium meliloti USDA1501 Isolate Nodule
595 2970047711 Sinorhizobium meliloti USDA1793 Isolate Nodule
596 2970054988 Sinorhizobium meliloti USDA1031 Isolate Nodule
597 2970061556 Sinorhizobium meliloti USDA1810 Isolate Nodule
598 2970068827 Sinorhizobium meliloti USDA1227 Isolate Nodule
599 2970076120 Sinorhizobium meliloti USDA1706 Isolate Nodule
600 2970082768 Sinorhizobium meliloti USDA1803 Isolate Nodule
601 2970088815 Sinorhizobium meliloti USDA1819 Isolate Nodule
602 2970095765 Sinorhizobium meliloti USDA1225 Isolate Nodule
603 2970102677 Sinorhizobium meliloti USDA1325 Isolate Nodule
604 2970109326 Sinorhizobium meliloti USDA1186 Isolate Nodule
605 2970116247 Sinorhizobium meliloti USDA1566 Isolate Nodule
606 2970129317 Sinorhizobium meliloti USDA1008 Isolate Nodule
607 2970136068 Sinorhizobium meliloti USDA1699 Isolate Nodule
608 2970143518 Sinorhizobium medicae USDA1652 Isolate Nodule
609 2970149975 Sinorhizobium meliloti USDA1215 Isolate Nodule
610 2970156795 Sinorhizobium meliloti USDA1491 Isolate Nodule
611 2970164137 Sinorhizobium meliloti USDA1018 Isolate Nodule
612 2970170962 Sinorhizobium meliloti USDA1571 Isolate Nodule
613 2970177841 Sinorhizobium meliloti USDA1533 Isolate Nodule
614 2970184632 Sinorhizobium meliloti USDA1593 Isolate Nodule
615 2970191845 Sinorhizobium meliloti USDA1187 Isolate Nodule
616 2970469710 Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 Isolate Nodule
617 2970489779 Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 Isolate Nodule
618 2970503327 Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 Isolate Nodule
619 2970510686 Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 Isolate Nodule
620 2970524798 Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1 Isolate Nodule
621 2970532167 Mesorhizobium sp. M7A.F.Ca.CA.002.05.1.1 Isolate Nodule
622 2970540015 Mesorhizobium sp. M5C.F.Ca.IN.020.29.1.1 Isolate Nodule
623 2970547951 Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 Isolate Nodule
624 2970554993 Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 Isolate Nodule
625 2970593180 Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 Isolate Nodule
626 2970619444 Mesorhizobium sp. M7A.F.Ca.ET.027.02.1.1 Isolate Nodule
627 2970627176 Mesorhizobium sp. M7A.F.Ca.US.006.01.2.1 Isolate Nodule
628 2977516862 Sinorhizobium meliloti USDA1791 Isolate Nodule
629 2977523885 Sinorhizobium meliloti USDA1777 Isolate Nodule
630 2977530762 Sinorhizobium medicae USDA1606 Isolate Nodule
631 2977537788 Sinorhizobium meliloti USDA1184 Isolate Nodule
632 2977551784 Sinorhizobium meliloti USDA1035 Isolate Nodule
633 2977558990 Sinorhizobium meliloti USDA1222 Isolate Nodule
634 2977565890 Sinorhizobium meliloti USDA1617 Isolate Nodule
635 2977572785 Sinorhizobium meliloti USDA1767 Isolate Nodule
636 2977579622 Sinorhizobium meliloti USDA1161 Isolate Nodule
637 2977821940 Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1 Isolate Nodule
638 2977843712 Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 Isolate Nodule
639 2977851361 Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 Isolate Nodule
640 2977858184 Mesorhizobium sp. M1A.F.Ca.IN.020.03.1.1 Isolate Nodule
641 2977864932 Mesorhizobium tamadayense DSM 28320 Isolate Nodule
642 2977872689 Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 Isolate Nodule
643 2977898635 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.1 Isolate Nodule
644 2977907340 Mesorhizobium sp. M7A.F.Ca.CA.004.12.1.1 Isolate Nodule
645 2977915119 Mesorhizobium sp. M7A.F.Ca.CA.001.09.2.1 Isolate Nodule
646 2977922695 Mesorhizobium sp. WSM4305 Isolate Unclassified
647 2977935797 Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 Isolate Nodule
648 2977942078 Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 Isolate Nodule
649 2977950692 Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 Isolate Nodule
650 2977957713 Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1 Isolate Nodule
651 2977971508 Mesorhizobium sp. M2A.F.Ca.ET.039.01.1.1 Isolate Nodule
652 2977986579 Mesorhizobium intechi BD68 Isolate Unclassified
653 2978969890 Agrobacterium sp. SORGH_AS 787 Isolate Unclassified
654 2979100975 Agrobacterium pusense SORGH_AS 755 Isolate Unclassified
655 2979710463 Mesorhizobium sp. M2A.F.Ca.ET.017.03.2.1 Isolate Nodule
656 2979742915 Mesorhizobium sp. M2A.F.Ca.ET.046.02.1.1 Isolate Nodule
657 2979764755 Mesorhizobium sp. M7A.F.Ca.CA.004.05.2.1 Isolate Nodule
658 2979772303 Mesorhizobium sp. M7A.F.Ca.CA.004.04.1.1 Isolate Nodule
659 2979793036 Mesorhizobium sp. M7A.F.Ca.US.007.01.1.1 Isolate Nodule
660 2979808191 Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 Isolate Nodule
661 2984509177 Agrobacterium pusense SORGH_AS260 Isolate Aerial Root
662 2984518228 Agrobacterium pusense SORGH_AS285 Isolate Aerial Root
663 2984537506 Agrobacterium sp. SORGH_AS440 Isolate Aerial Root
664 2984587000 Agrobacterium larrymoorei SORGH_AS974 Isolate Aerial Root
665 2984601300 Rhizobium pusense SORGH_AS1083 Isolate Aerial Root
666 2987636660 Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 Isolate Nodule
667 2987645492 Mesorhizobium sp. M7A.F.Ca.CA.002.10.1.1 Isolate Nodule
668 2987652177 Mesorhizobium sp. M2A.F.Ca.ET.042.01.1.1 Isolate Nodule
669 2987659509 Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 Isolate Nodule
670 2987666974 Mesorhizobium sp. WSM4306 Isolate Unclassified
671 2987673487 Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1 Isolate Nodule
672 2995392953 Martelella limonii NBRC 109441 Isolate Unclassified
673 2996310559 Mesorhizobium zhangyense CGMCC 1.15528 Isolate Unclassified
674 2996341866 Mesorhizobium sp. M1A.F.Ca.IN.020.32.1.1 Isolate Nodule
675 2996348954 Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 Isolate Nodule
676 2996386984 Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 Isolate Nodule
677 3000135777 Unclassified bacterium M00.F.Ca.ET.205.01.1.1 Isolate Unclassified
678 3002141150 Phyllobacterium sp. 628 Isolate Unclassified
679 3003930520 Sinorhizobium sp. BG8 Isolate Unclassified
680 3004167301 Mesorhizobium loti 582 Isolate Unclassified
681 3004188549 Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 Isolate Nodule
682 3004195979 Mesorhizobium sp. M7A.F.Ca.CA.001.08.2.1 Isolate Nodule
683 3004203850 Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 Isolate Nodule
684 3004211236 Mesorhizobium sp. WSM4307 Isolate Unclassified
685 3004218560 Mesorhizobium sp. WSM4315 Isolate Unclassified
686 3004232784 Mesorhizobium sp. M7A.T.Ca.US.000.02.1.1 Isolate Nodule
687 3004239961 Mesorhizobium sp. M7A.F.Ca.US.005.03.2.1 Isolate Nodule
688 3004248173 Mesorhizobium sp. M7A.F.Ca.CA.004.06.1.1 Isolate Nodule
689 3004268573 Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1 Isolate Nodule
690 3004275668 Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 Isolate Nodule
691 3004334049 Mesorhizobium huakuii 583 Isolate Unclassified
692 637000159 Mesorhizobium japonicum MAFF 303099 Isolate Unclassified
693 648276728 Sinorhizobium meliloti BL225C Isolate Nodule
694 649633066 Mesorhizobium ciceri bv. biserrulae WSM1271 Isolate Nodule
695 8002285264 Aminobacter anthyllidis LMG 26462 Isolate Nodule
696 8003570095 Agrobacterium rhizogenes GBBC3284 Isolate Unclassified
697 8003992118 Sinorhizobium meliloti RRI128 Isolate Nodule
698 8003999396 Sinorhizobium medicae WSM1115 Isolate Nodule
699 8004300914 Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 Isolate Nodule
700 8004312739 Mesorhizobium sp. M7A.F.Ca.MR.362.00.0.0 Isolate Nodule
701 8004361976 Mesorhizobium sp. M7A.F.Ca.CA.001.08.1.1 Isolate Nodule
702 8004374579 Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1 Isolate Nodule
703 8004387939 Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 Isolate Nodule
704 8004395343 Mesorhizobium sp. M5C.F.Ca.IN.020.14.1.1 Isolate Nodule
705 8004445564 Mesorhizobium sp. M1A.F.Ca.IN.020.04.1.1 Isolate Nodule
706 8004633249 Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1 Isolate Nodule
707 8004640170 Mesorhizobium sp. GbtcB19 Isolate Unclassified
708 8004703790 Mesorhizobium sp. M00.F.Ca.ET.158.01.1.1 Isolate Nodule
709 8004714634 Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 Isolate Nodule
710 8004727605 Mesorhizobium sp. M7A.F.Ca.CA.004.01.1.1 Isolate Nodule
711 8018150411 Rhizobium straminoryzae SM12 Isolate Rhizosphere
712 8054460903 Agrobacterium vaccinii B7.6 Isolate Unclassified
713 8054558443 Rhizobium alarense TRM95111 Isolate Nodule
714 8055617313 Mesorhizobium onobrychidis OM4 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 41.07
Metatranscriptomes 0.11
Isolates 58.82

Biome Distribution

Category Percentage (%)
Aerial Root 0.56
Bulb 0
Endosphere 8.26
Nodule 50.45
Rhizoplane 1.23
Rhizosphere 27.9
Stem 0
Stem Tuber 0
Unclassified 0.11

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24736J21556_1000604 3300001904 Bacteria 6567
2 JGI24740J21852_10005625 3300001979 Bacteria 5276
3 JGI24739J22299_10009416 3300001989 Bacteria 3640
4 JGI24737J22298_10021752 3300001990 Bacteria 2041
5 JGI24735J21928_10022976 3300002067 Bacteria 1893
6 JGI24738J21930_10000460 3300002075 Bacteria 11559
7 JGI25156J39149_1003677 3300002705 Bacteria 4926
8 JGI25157J39369_1000347 3300002741 Bacteria 32658
9 JGI25151J46595_10013540 3300003187 Bacteria 3666
10 JGI25165J46597_1000020 3300003214 Bacteria 370477
11 Ga0055542_1000516 3300003762 Bacteria 34984
12 Ga0055529_1001859 3300003763 Bacteria 4953
13 Ga0055524_1001144 3300003775 Bacteria 15980
14 Ga0055531_10010137 3300003794 Bacteria 4725
15 Ga0065707_10026222 3300005295 Bacteria 1598
16 Ga0070658_10027680 3300005327 Bacteria 4548
17 Ga0070661_100193526 3300005344 Bacteria 1551
18 Ga0070668_100226896 3300005347 Bacteria 1543
19 Ga0070668_100520382 3300005347 Bacteria 1032
20 Ga0070669_100254130 3300005353 Bacteria 1400
21 Ga0070674_100133706 3300005356 Bacteria 1853
22 Ga0070667_100155124 3300005367 Bacteria 2013
23 Ga0070663_100007173 3300005455 Bacteria 6770
24 Ga0070684_100774430 3300005535 Bacteria 896
25 Ga0068853_100046275 3300005539 Bacteria 3730
26 Ga0070665_100306506 3300005548 Bacteria 1591
27 Ga0070665_100310859 3300005548 Bacteria 1580
28 Ga0068855_100089250 3300005563 Bacteria 3559
29 Ga0068857_100346664 3300005577 Bacteria 1375
30 Ga0068857_100358512 3300005577 Bacteria 1351
31 Ga0068857_101062743 3300005577 Bacteria 781
32 Ga0068854_100171209 3300005578 Bacteria 1690
33 Ga0068856_100111381 3300005614 Bacteria 2734
34 Ga0068856_100186994 3300005614 Bacteria 2085
35 Ga0068852_100376932 3300005616 Bacteria 1391
36 Ga0068852_100617585 3300005616 Bacteria 1089
37 Ga0068851_10069493 3300005834 Bacteria 1819
38 Ga0075365_10001929 3300006038 Bacteria 9790
39 Ga0075365_10040892 3300006038 Bacteria 3025
40 Ga0075365_10043590 3300006038 Bacteria 2937
41 Ga0075365_10055747 3300006038 Bacteria 2625
42 Ga0075368_10044900 3300006042 Bacteria 1745
43 Ga0075364_10035265 3300006051 Bacteria 3233
44 Ga0075364_10039182 3300006051 Bacteria 3071
45 Ga0075362_10045337 3300006177 Bacteria 1952
46 Ga0075362_10305474 3300006177 Bacteria 790
47 Ga0075367_10004358 3300006178 Bacteria 6898
48 Ga0075367_10019011 3300006178 Bacteria 3802
49 Ga0075367_10039830 3300006178 Bacteria 2741
50 Ga0075367_10206281 3300006178 Bacteria 1228
51 Ga0075369_10005979 3300006186 Bacteria 4579
52 Ga0075369_10038049 3300006186 Bacteria 2051
53 Ga0075370_10230305 3300006353 Bacteria 1096
54 Ga0075370_10247450 3300006353 Bacteria 1056
55 Ga0079104_1004473 3300006946 Bacteria 5962
56 Ga0079104_1007226 3300006946 Bacteria 4064
57 Ga0099826_10009775 3300006948 Bacteria 7165
58 Ga0105240_10637479 3300009093 Bacteria 1169
59 Ga0105247_10406684 3300009101 Bacteria 971
60 Ga0105241_10291819 3300009174 Bacteria 1396
61 Ga0105237_10213315 3300009545 Bacteria 1930
62 Ga0105237_10244105 3300009545 Bacteria 1797
63 Ga0105238_10012176 3300009551 Bacteria 8671
64 Ga0105249_10518356 3300009553 Bacteria 1239
65 Ga0105239_10081120 3300010375 Bacteria 3570
66 Ga0105239_10222678 3300010375 Bacteria 2116
67 Ga0105239_10248558 3300010375 Bacteria 1997
68 Ga0105239_10361696 3300010375 Bacteria 1639
69 Ga0105239_11054413 3300010375 Bacteria 935
70 Ga0105246_10862399 3300011119 Bacteria 809
71 Ga0163163_10279239 3300014325 Bacteria 1722
72 Ga0157380_10763163 3300014326 Bacteria 980
73 Ga0182008_10049151 3300014497 Bacteria 2093
74 Ga0214544_1006450 3300021320 Bacteria 21631
75 Ga0214542_1000029 3300021321 Bacteria 174097
76 Ga0214542_1025934 3300021321 Bacteria 2958
77 Ga0214543_1000040 3300021327 Bacteria 174142
78 Ga0214543_1000049 3300021327 Bacteria 149506
79 Ga0228711_1003229 3300022739 Bacteria 25290
80 Ga0228710_1000004 3300022740 Bacteria 250560
81 Ga0209147_101667 3300025229 Bacteria 7306
82 Ga0209026_1000005 3300025250 Bacteria 731387
83 Ga0209148_1000078 3300025254 Bacteria 296101
84 Ga0209148_1024328 3300025254 Bacteria 957
85 Ga0209759_1000239 3300025256 Bacteria 81781
86 Ga0209233_1000047 3300025261 Bacteria 459614
87 Ga0209565_1015883 3300025263 Bacteria 1686
88 Ga0209455_1000194 3300025272 Bacteria 89837
89 Ga0209025_1000105 3300025294 Bacteria 224157
90 Ga0209025_1049819 3300025294 Bacteria 1681
91 Ga0209758_1018328 3300025297 Bacteria 3436
92 Ga0209758_1050254 3300025297 Bacteria 1464
93 Ga0209256_1000027 3300025299 Bacteria 423283
94 Ga0207656_10091644 3300025321 Bacteria 1380
95 Ga0207647_10017158 3300025904 Bacteria 4926
96 Ga0207647_10046213 3300025904 Bacteria 2714
97 Ga0207645_10236719 3300025907 Bacteria 1206
98 Ga0207705_10079956 3300025909 Bacteria 2381
99 Ga0207654_10161822 3300025911 Bacteria 1447
100 Ga0207695_10665938 3300025913 Bacteria 922
101 Ga0207671_10035087 3300025914 Bacteria 3725
102 Ga0207671_10103285 3300025914 Bacteria 2161
103 Ga0207657_10067581 3300025919 Bacteria 3039
104 Ga0207657_10253441 3300025919 Bacteria 1402
105 Ga0207694_10076577 3300025924 Bacteria 2620
106 Ga0207694_10123698 3300025924 Bacteria 2067
107 Ga0207690_10345533 3300025932 Bacteria 1175
108 Ga0207706_10076512 3300025933 Bacteria 2943
109 Ga0207669_10232391 3300025937 Bacteria 1361
110 Ga0207669_10558317 3300025937 Bacteria 925
111 Ga0207661_10371723 3300025944 Bacteria 1293
112 Ga0207639_10019079 3300026041 Bacteria 4883
113 Ga0207639_10028706 3300026041 Bacteria 4064
114 Ga0207639_10040125 3300026041 Bacteria 3492
115 Ga0207678_10128163 3300026067 Bacteria 2164
116 Ga0207702_10010044 3300026078 Bacteria 7936
117 Ga0207648_10153690 3300026089 Bacteria 2031
118 Ga0207674_10127654 3300026116 Bacteria 2508
119 Ga0207674_10174321 3300026116 Bacteria 2103
120 Ga0207683_10192707 3300026121 Bacteria 1851
121 Ga0207698_10148006 3300026142 Bacteria 2034
122 Ga0209281_1000134 3300027111 Bacteria 185406
123 Ga0209281_1000445 3300027111 Bacteria 59209
124 Ga0209371_1000009 3300027312 Bacteria 963030
125 Ga0209371_1001016 3300027312 Bacteria 21360
126 Ga0209282_1000029 3300027666 Bacteria 157883
127 Ga0209282_1025331 3300027666 Bacteria 3710
128 Ga0209813_10071784 3300027866 Bacteria 1127
129 Ga0268266_10039602 3300028379 Bacteria 4015
130 Ga0268266_10258402 3300028379 Bacteria 1613
131 Ga0307515_10000029 3300028794 Bacteria 365410
132 Ga0307515_10000277 3300028794 Bacteria 125765
133 Ga0307515_10005710 3300028794 Bacteria 25131
134 Ga0307515_10136809 3300028794 Bacteria 2657
135 Ga0268256_1000010 3300030500 Bacteria 963034
136 Ga0268256_1005318 3300030500 Bacteria 5090
137 Ga0307513_10003029 3300031456 Bacteria 22905
138 Ga0307408_100135017 3300031548 Bacteria 1929
139 Ga0307408_100425932 3300031548 Bacteria 1145
140 Ga0307410_10012335 3300031852 Bacteria 4938
141 Ga0307406_10043274 3300031901 Bacteria 2815
142 Ga0307406_10126124 3300031901 Bacteria 1789
143 Ga0307412_10090470 3300031911 Bacteria 2139
144 Ga0307412_10198393 3300031911 Bacteria 1522
145 Ga0307412_10350197 3300031911 Bacteria 1185
146 Ga0315914_1000004 3300031967 Bacteria 288534
147 Ga0307409_100247978 3300031995 Bacteria 1626
148 Ga0307416_100318575 3300032002 Bacteria 1556
149 Ga0307416_100413082 3300032002 Bacteria 1391
150 Ga0307416_100686042 3300032002 Bacteria 1112
151 Ga0307414_10230673 3300032004 Bacteria 1526
152 Ga0307414_10712960 3300032004 Bacteria 909
153 Ga0307411_10190578 3300032005 Bacteria 1565
154 Ga0315913_1000370 3300033430 Bacteria 38384
155 Ga0315915_1000003 3300033464 Bacteria 407996
156 Ga0373931_0160631 3300035691 Bacteria 1317
157 Ga0395900_0044321 3300037418 Bacteria 4584
158 Ga0395900_0373102 3300037418 Bacteria 1396
159 Ga0395900_0668407 3300037418 Bacteria 974
160 Ga0395898_0813450 3300037466 Bacteria 874
161 Ga0395905_0044744 3300037471 Bacteria 4153
162 Ga0395905_0047448 3300037471 Bacteria 4025
163 Ga0395905_0082924 3300037471 Bacteria 3004
164 Ga0395905_0172370 3300037471 Bacteria 2032
165 Ga0395905_0309335 3300037471 Bacteria 1468
166 Ga0395905_0746590 3300037471 Bacteria 881
167 Ga0395901_0055397 3300038443 Bacteria 4124
168 Ga0395901_0357364 3300038443 Bacteria 1507
169 Ga0395901_0377891 3300038443 Bacteria 1459
170 Ga0395901_0951536 3300038443 Bacteria 838
171 Ga0439465_0009030 3300041413 Bacteria 3142
172 Ga0439448_0120371 3300042005 Bacteria 901
173 Ga0450900_008873 3300042136 Bacteria 1265
174 Ga0466960_0018792 3300044901 Bacteria 3034
175 Ga0466967_0310148 3300045976 Bacteria 1520
176 Ga0495627_000757 3300046453 Bacteria 24076
177 Ga0495638_0006811 3300046460 Bacteria 8249
178 Ga0495638_0227171 3300046460 Bacteria 1040
179 Ga0495638_0291378 3300046460 Bacteria 883
180 Ga0495631_0123549 3300046518 Bacteria 1113
181 Ga0495668_0117288 3300046616 Bacteria 1456
182 Ga0495625_0025379 3300046660 Bacteria 4496
183 Ga0495625_0031385 3300046660 Bacteria 3953
184 Ga0495625_0078591 3300046660 Bacteria 2303
185 Ga0495588_0000559 3300046674 Bacteria 17899
186 Ga0495671_0013217 3300046692 Bacteria 4481
187 Ga0495681_0002200 3300047470 Bacteria 14067
188 Ga0495686_0213685 3300047472 Bacteria 1101
189 Ga0496102_0064051 3300048905 Bacteria 3367
190 Ga0496102_0410744 3300048905 Bacteria 1272
191 Ga0496109_0241754 3300048912 Bacteria 1699
192 Ga0496110_0213443 3300048913 Bacteria 1755
193 Ga0496111_0072083 3300048914 Bacteria 2514
194 Ga0496115_0212255 3300048918 Bacteria 1599
195 Ga0496116_0000026 3300048919 Bacteria 450803
196 Ga0496116_0016002 3300048919 Bacteria 5896
197 Ga0496118_0062119 3300048921 Bacteria 2761
198 Ga0496118_0134211 3300048921 Bacteria 1582
199 Ga0496119_0000827 3300048922 Bacteria 41250
200 Ga0496119_0049823 3300048922 Bacteria 2586
201 Ga0496120_0001220 3300048923 Bacteria 32486
202 Ga0496120_0041504 3300048923 Bacteria 2694
203 Ga0496121_0024486 3300048924 Bacteria 5769
204 Ga0496121_0451018 3300048924 Bacteria 829
205 Ga0496122_0001094 3300048925 Bacteria 46993
206 Ga0496122_0026504 3300048925 Bacteria 4994
207 Ga0496122_0083749 3300048925 Bacteria 2209
208 Ga0496122_0320707 3300048925 Bacteria 824
209 Ga0496123_0001198 3300048926 Bacteria 38067
210 Ga0496123_0134900 3300048926 Bacteria 1360
211 Ga0496124_0000083 3300048927 Bacteria 207798
212 Ga0496124_0095089 3300048927 Bacteria 2422
213 Ga0496124_0118629 3300048927 Bacteria 2118
214 Ga0496124_0530940 3300048927 Bacteria 781
215 Ga0496125_0000602 3300048928 Bacteria 61264
216 Ga0496125_0062487 3300048928 Bacteria 2977
217 Ga0496125_0079689 3300048928 Bacteria 2511
218 Ga0496125_0092750 3300048928 Bacteria 2256
219 Ga0496125_0183659 3300048928 Bacteria 1390
220 Ga0496125_0266816 3300048928 Bacteria 1069
221 Ga0496126_0000069 3300048929 Bacteria 246935
222 Ga0496126_0480828 3300048929 Bacteria 995
223 Ga0496126_0522218 3300048929 Bacteria 946
224 Ga0496126_0664556 3300048929 Bacteria 814
225 Ga0501031_0000003 3300049568 Bacteria 206821
226 Ga0501031_0110207 3300049568 Bacteria 1797
227 Ga0501031_0170555 3300049568 Bacteria 1422
228 Ga0501031_0205516 3300049568 Bacteria 1284
229 Ga0501031_0225275 3300049568 Bacteria 1220
230 Ga0501031_0227647 3300049568 Bacteria 1214
231 Ga0501031_0312302 3300049568 Bacteria 1018
232 Ga0501032_0000010 3300049569 Bacteria 206795
233 Ga0501032_0000546 3300049569 Bacteria 30501
234 Ga0501032_0038298 3300049569 Bacteria 3267
235 Ga0501032_0106271 3300049569 Bacteria 1859
236 Ga0501032_0433747 3300049569 Bacteria 842
237 Ga0501032_0433748 3300049569 Bacteria 842
238 Ga0501033_0000017 3300049570 Bacteria 206819
239 Ga0501033_0007011 3300049570 Bacteria 8799
240 Ga0501033_0075934 3300049570 Bacteria 2466
241 Ga0501033_0129466 3300049570 Bacteria 1829
242 Ga0501033_0160323 3300049570 Bacteria 1619
243 Ga0501033_0218163 3300049570 Bacteria 1358
244 Ga0501033_0498522 3300049570 Bacteria 842
245 Ga0501033_0498525 3300049570 Bacteria 842
246 Ga0501034_0000053 3300049571 Bacteria 206821
247 Ga0501034_0001507 3300049571 Bacteria 30558
248 Ga0501034_0137573 3300049571 Bacteria 2423
249 Ga0501034_0292788 3300049571 Bacteria 1565
250 Ga0501034_0371301 3300049571 Bacteria 1357
251 Ga0501034_0380632 3300049571 Bacteria 1336
252 Ga0501034_0477428 3300049571 Bacteria 1162
253 Ga0501034_0554374 3300049571 Bacteria 1058
254 Ga0501034_0789890 3300049571 Bacteria 842
255 Ga0501036_0000009 3300049572 Bacteria 206821
256 Ga0501036_0001029 3300049572 Bacteria 21072
257 Ga0501036_0145208 3300049572 Bacteria 2001
258 Ga0501036_0440654 3300049572 Bacteria 1085
259 Ga0501036_0692168 3300049572 Bacteria 842
260 Ga0501037_0000008 3300049573 Bacteria 206812
261 Ga0501037_0000838 3300049573 Bacteria 22953
262 Ga0501037_0029710 3300049573 Bacteria 4037
263 Ga0501037_0133871 3300049573 Bacteria 1776
264 Ga0501037_0278986 3300049573 Bacteria 1164
265 Ga0501038_0000008 3300049574 Bacteria 206821
266 Ga0501038_0002532 3300049574 Bacteria 17039
267 Ga0501038_0052723 3300049574 Bacteria 3506
268 Ga0501038_0588889 3300049574 Bacteria 842
269 Ga0501038_0588893 3300049574 Bacteria 842
270 Ga0501039_0000021 3300049575 Bacteria 162552
271 Ga0501039_0001378 3300049575 Bacteria 17825
272 Ga0501039_0081398 3300049575 Bacteria 2521
273 Ga0501039_0626571 3300049575 Bacteria 842
274 Ga0501040_0007087 3300049576 Bacteria 7265
275 Ga0501040_0240431 3300049576 Bacteria 1290
276 Ga0501043_0000043 3300049579 Bacteria 115410
277 Ga0501043_0000656 3300049579 Bacteria 30519
278 Ga0501043_0029929 3300049579 Bacteria 4277
279 Ga0501043_0044479 3300049579 Bacteria 3491
280 Ga0501043_0077343 3300049579 Bacteria 2614
281 Ga0501046_0074049 3300049580 Bacteria 2642
282 Ga0501046_0133477 3300049580 Bacteria 1881
283 Ga0501047_0004274 3300049581 Bacteria 13448
284 Ga0501047_0049899 3300049581 Bacteria 4040
285 Ga0501047_0111020 3300049581 Bacteria 2624
286 Ga0501047_0250744 3300049581 Bacteria 1619
287 Ga0501047_0693987 3300049581 Bacteria 835
288 Ga0501048_0008441 3300049582 Bacteria 7790
289 Ga0501048_0041326 3300049582 Bacteria 3303
290 Ga0501048_0142045 3300049582 Bacteria 1698
291 Ga0501068_0096943 3300049584 Bacteria 1824
292 Ga0501070_0007145 3300049586 Bacteria 9487
293 Ga0501070_0046063 3300049586 Bacteria 3626
294 Ga0501070_0510277 3300049586 Bacteria 965
295 Ga0501070_0670508 3300049586 Bacteria 822
296 Ga0501071_0071456 3300049587 Bacteria 2530
297 Ga0501071_0757966 3300049587 Unclassified 748
298 Ga0501072_0324716 3300049588 Bacteria 1223
299 Ga0501073_0039790 3300049589 Bacteria 3330
300 Ga0501073_0078669 3300049589 Bacteria 2295
301 Ga0501073_0102417 3300049589 Bacteria 1988
302 Ga0501074_0017395 3300049590 Bacteria 5216
303 Ga0501075_0011120 3300049591 Bacteria 6358
304 Ga0501079_0017789 3300049741 Bacteria 5431
305 Ga0501080_0040744 3300049742 Bacteria 4331
306 Ga0501080_0376960 3300049742 Bacteria 1279
307 Ga0501080_0530444 3300049742 Bacteria 1050
308 Ga0501083_0094228 3300049744 Bacteria 1977
309 Ga0501083_0216982 3300049744 Bacteria 1247
310 Ga0501035_0000023 3300049822 Bacteria 206821
311 Ga0501035_0000958 3300049822 Bacteria 30505
312 Ga0501035_0060685 3300049822 Bacteria 3366
313 Ga0501035_0082530 3300049822 Bacteria 2836
314 Ga0501035_0107342 3300049822 Bacteria 2448
315 Ga0501035_0196300 3300049822 Bacteria 1733
316 Ga0501035_0209854 3300049822 Bacteria 1666
317 Ga0501035_0337229 3300049822 Bacteria 1264
318 Ga0501035_0665820 3300049822 Bacteria 842
319 Ga0501035_0665824 3300049822 Bacteria 842
320 Ga0501044_0000021 3300049823 Bacteria 206821
321 Ga0501044_0018996 3300049823 Bacteria 7360
322 Ga0501044_0096604 3300049823 Bacteria 2976
323 Ga0501044_0224868 3300049823 Bacteria 1826
324 Ga0501044_0771201 3300049823 Bacteria 842
325 Ga0501044_0771202 3300049823 Bacteria 842
326 nmdc:mga03683_3508_c1 3300050489 Bacteria 4207
327 nmdc:mga03n38_222068_c1 3300050490 Bacteria 987
328 nmdc:mga03n38_24210_c1 3300050490 Bacteria 2480
329 nmdc:mga03n38_341903_c1 3300050490 Bacteria 812
330 nmdc:mga00v17_60381_c1 3300050491 Bacteria 2328
331 nmdc:mga0yw44_130983_c1 3300050492 Bacteria 1624
332 nmdc:mga0yw44_18598_c1 3300050492 Bacteria 3810
333 nmdc:mga0yw44_2158_c1 3300050492 Bacteria 8259
334 nmdc:mga0yw44_40990_c1 3300050492 Bacteria 2755
335 nmdc:mga0k408_285784_c1 3300050493 Bacteria 984
336 nmdc:mga06z11_108525_c1 3300050494 Bacteria 1534
337 nmdc:mga06z11_251023_c1 3300050494 Bacteria 1042
338 nmdc:mga06z11_389092_c1 3300050494 Bacteria 838
339 nmdc:mga06z11_482724_c1 3300050494 Bacteria 750
340 nmdc:mga07m45_164586_c1 3300050496 Bacteria 1288
341 nmdc:mga07m45_229652_c1 3300050496 Bacteria 1080
342 nmdc:mga0sz30_35723_c1 3300050516 Bacteria 2075
343 nmdc:mga0sz30_43965_c2 3300050516 Bacteria 1561
344 nmdc:mga0sz30_87632_c1 3300050516 Bacteria 1352
345 Ga0495655_0098972 3300053083 Bacteria 861
346 Ga0500556_0000124 3300053104 Bacteria 67080
347 Ga0500560_002097 3300053107 Bacteria 3715
348 Ga0500572_001261 3300053111 Bacteria 7133
349 Ga0500652_166684 3300053131 Bacteria 908
350 Ga0500568_0001216 3300053139 Bacteria 17178
351 Ga0500568_0139273 3300053139 Bacteria 900
352 Ga0500573_0296573 3300053140 Bacteria 810
353 Ga0500604_0089761 3300053151 Bacteria 1002
354 Ga0500616_0077825 3300053153 Bacteria 1674
355 Ga0500620_079823 3300053155 Bacteria 1132
356 Ga0500624_000477 3300053157 Bacteria 11906
357 Ga0500627_0088440 3300053158 Bacteria 1385
358 Ga0500627_0156522 3300053158 Bacteria 1029
359 Ga0500627_0185732 3300053158 Bacteria 934
360 Ga0500627_0271551 3300053158 Bacteria 746
361 Ga0500634_0013936 3300053161 Bacteria 4230
362 Ga0500634_0086605 3300053161 Bacteria 1600
363 Ga0500636_0000069 3300053177 Bacteria 50916
364 Ga0500636_0001346 3300053177 Bacteria 13338
365 Ga0500611_027556 3300053727 Bacteria 1145
366 Ga0587106_044095 3300059605 Bacteria 768
367 Ga0501082_0355897 3300060353 Bacteria 1277
368 Ga0501082_0453459 3300060353 Bacteria 1121
369 Ga0530510_0034914 3300061734 Bacteria 3623
370 2881154583 2881147464 Bacteria 7779814
371 2503200758 2503198000 Bacteria 6884444
372 2509111779 2508501122 Bacteria 6292184
373 2509118944 2508501123 Bacteria 6283661
374 2509141193 2508501127 Bacteria 7037543
375 2509146243 2508501127 Bacteria 7037543
376 2509369029 2509276018 Bacteria 6910194
377 2509375407 2509276019 Bacteria 6802256
378 2509395594 2509276022 Bacteria 6200534
379 2510308146 2510065057 Bacteria 6649661
380 2510316155 2510065059 Bacteria 6847884
381 2511390734 2511231027 Bacteria 5013807
382 2511498925 2511231052 Bacteria 6974333
383 2512929098 2512875016 Bacteria 6529530
384 2512963654 2512875024 Bacteria 7195110
385 2512973125 2512875026 Bacteria 6861065
386 2513587193 2513237086 Bacteria 7265287
387 2513594120 2513237087 Bacteria 5817514
388 2513607778 2513237090 Bacteria 7096802
389 2513616217 2513237091 Bacteria 6900273
390 2513882630 2513237140 Bacteria 7076289
391 2513904613 2513237143 Bacteria 6664116
392 2513996398 2513237159 Bacteria 6810126
393 2514039759 2513237164 Bacteria 7563725
394 2514421658 2513237305 Bacteria 7293571
395 2514590814 2513237351 Bacteria 6968952
396 2516895201 2516653046 Bacteria 6989037
397 2524450916 2524023207 Bacteria 6813453
398 2535486331 2534681786 Bacteria 3308809
399 2537873429 2537561587 Bacteria 5425293
400 2551675237 2551306084 Bacteria 8942552
401 2551686984 2551306085 Bacteria 7347181
402 2551696598 2551306086 Bacteria 6843938
403 2551704793 2551306087 Bacteria 7351905
404 2551709664 2551306089 Bacteria 7162724
405 2551716508 2551306090 Bacteria 7953713
406 2551726703 2551306091 Bacteria 7086830
407 2551737502 2551306092 Bacteria 6992595
408 2551743130 2551306093 Bacteria 7064773
409 2558866503 2558860100 Bacteria 8458965
410 2585264848 2582581306 Bacteria 6450535
411 2585386096 2582581865 Bacteria 6644329
412 2585394659 2582581866 Bacteria 6859583
413 2588514637 2588253730 Bacteria 6881675
414 2599604419 2599185210 Bacteria 5624189
415 2599940536 2599185301 Bacteria 6161860
416 2600197564 2599185352 Bacteria 7228948
417 2643772313 2643221550 Bacteria 4619371
418 2643774433 2643221551 Bacteria 3750538
419 2643792878 2643221555 Bacteria 3749717
420 2643805884 2643221557 Bacteria 7184309
421 2643812599 2643221558 Bacteria 5460675
422 2643920697 2643221582 Bacteria 5804683
423 2643963301 2643221591 Bacteria 4397626
424 2643988080 2643221595 Bacteria 6565519
425 2644066061 2643221610 Bacteria 7480339
426 2644132550 2643221623 Bacteria 5239945
427 2644155568 2643221627 Bacteria 6761570
428 2644380365 2643221668 Bacteria 7306521
429 2644417392 2643221675 Bacteria 7473456
430 2644450788 2643221680 Bacteria 7473610
431 2644692788 2643221726 Bacteria 7455827
432 2688597889 2687453392 Bacteria 6880454
433 2692317675 2690316117 Bacteria 6800650
434 2694628950 2693429783 Bacteria 7019804
435 2694637135 2693429784 Bacteria 7241525
436 2715498527 2713897090 Bacteria 3353799
437 2723578180 2721755686 Bacteria 7343952
438 2739309560 2738543024 Bacteria 5603683
439 2753357752 2751185800 Bacteria 5467370
440 2753459874 2751185821 Bacteria 6189929
441 2756676223 2756170246 Bacteria 7451806
442 2757569315 2757320392 Bacteria 3737298
443 2758640329 2758568016 Bacteria 5645291
444 2765464440 2765235802 Bacteria 5618596
445 2770194803 2767802442 Bacteria 5747986
446 2776272407 2775506902 Bacteria 6208009
447 2776284347 2775506904 Bacteria 5954060
448 2792621043 2791355091 Bacteria 6135441
449 2792625258 2791355092 Bacteria 6248105
450 2792750028 2791355123 Bacteria 8049106
451 2802718694 2802428858 Bacteria 6636079
452 2802742223 2802428862 Bacteria 6633353
453 2802748906 2802428863 Bacteria 6410669
454 2819556766 2818991439 Bacteria 6907412
455 2838677501 2838675328 Bacteria 4909118
456 2838716390 2838714209 Bacteria 5525906
457 2838719810 2838719591 Bacteria 5523910
458 2838727141 2838724970 Bacteria 4908691
459 2839994354 2839993093 Bacteria 5512535
460 2840764905 2840764183 Bacteria 6358399
461 2841735575 2841734538 Bacteria 6784580
462 2841846741 2841846520 Bacteria 5345850
463 2841860730 2841859092 Bacteria 5436171
464 2842127230 2842124991 Bacteria 5346824
465 2842132394 2842130223 Bacteria 4909145
466 2842152437 2842152218 Bacteria 4908957
467 2842172635 2842170452 Bacteria 5525737
468 2842176056 2842175837 Bacteria 4908771
469 2842189497 2842187318 Bacteria 5524014
470 2842213811 2842211629 Bacteria 5523832
471 2842224571 2842224351 Bacteria 5524473
472 2842517515 2842515876 Bacteria 5436280
473 2842521318 2842521101 Bacteria 6569494
474 2842873564 2842871566 Bacteria 4827117
475 2844004859 2844002411 Bacteria 7168230
476 2844009619 2844009547 Bacteria 6728125
477 2847421346 2847417321 Bacteria 6913799
478 2847672557 2847670302 Bacteria 6165597
479 2847691857 2847686936 Bacteria 6278406
480 2848996131 2848992105 Bacteria 6810864
481 2850079527 2850079185 Bacteria 6848280
482 2854914999 2854911287 Bacteria 5582813
483 2855827839 2855825444 Bacteria 6785811
484 2855843207 2855839649 Bacteria 7135830
485 2855877839 2855872281 Bacteria 6964271
486 2856315785 2856314179 Bacteria 6477897
487 2856329984 2856328259 Bacteria 6528202
488 2856337131 2856334872 Bacteria 7037011
489 2856347721 2856342000 Bacteria 7176905
490 2856355384 2856349417 Bacteria 6230045
491 2856358615 2856356410 Bacteria 6297484
492 2856367652 2856364286 Bacteria 6939991
493 2857353595 2857349434 Bacteria 7926032
494 2857374996 2857367948 Bacteria 6965560
495 2858802935 2858800743 Bacteria 6603254
496 2869163876 2869162929 Bacteria 6399702
497 2869254322 2869249662 Bacteria 6868783
498 2869263952 2869256925 Bacteria 6981691
499 2869270656 2869264136 Bacteria 6880765
500 2869277888 2869271264 Bacteria 6908218
501 2869284436 2869278585 Bacteria 7077053
502 2869286860 2869285874 Bacteria 6901219
503 2871434124 2871429161 Bacteria 6547891
504 2871439407 2871435913 Bacteria 6880295
505 2871449262 2871444079 Bacteria 6423508
506 2871452379 2871451962 Bacteria 7336357
507 2871465525 2871459585 Bacteria 6866887
508 2871472552 2871466892 Bacteria 6923287
509 2871479129 2871474448 Bacteria 6806570
510 2871481784 2871481445 Bacteria 6700002
511 2871490020 2871488783 Bacteria 6929816
512 2871501865 2871495908 Bacteria 6935695
513 2874102862 2874102143 Bacteria 6342645
514 2874111666 2874109183 Bacteria 6517025
515 2874121718 2874116593 Bacteria 6674494
516 2874126864 2874123672 Bacteria 7238285
517 2874139102 2874139085 Bacteria 7021506
518 2874147782 2874146452 Bacteria 7533118
519 2874156700 2874155637 Bacteria 6724144
520 2874163967 2874162495 Bacteria 6174670
521 2874169973 2874168670 Bacteria 8062617
522 2876369564 2876363079 Bacteria 6544991
523 2876382121 2876377896 Bacteria 6565995
524 2876392085 2876386047 Bacteria 6698674
525 2876393857 2876392853 Bacteria 6660880
526 2876401625 2876399893 Bacteria 6927900
527 2876412366 2876406927 Bacteria 6191900
528 2876414726 2876413966 Bacteria 6831344
529 2876423356 2876420981 Bacteria 6687741
530 2878042405 2878035449 Bacteria 6555736
531 2878739949 2878738818 Bacteria 7136951
532 2878746834 2878745973 Bacteria 6867388
533 2878756067 2878753008 Bacteria 6922523
534 2878765898 2878760144 Bacteria 6823465
535 2878772572 2878767105 Bacteria 6898628
536 2878775390 2878774303 Bacteria 6108671
537 2878786057 2878781027 Bacteria 6834456
538 2881163695 2881161766 Bacteria 7127907
539 2881846849 2881845957 Bacteria 6611900
540 2881857409 2881853255 Bacteria 6698367
541 2881866151 2881861095 Bacteria 7128710
542 2882634247 2882632389 Bacteria 8154593
543 2882917396 2882912400 Bacteria 6801539
544 2885308868 2885305155 Bacteria 7348390
545 2885318751 2885312484 Bacteria 6415165
546 2885345195 2885342637 Bacteria 7011821
547 2885356593 2885350715 Bacteria 6787678
548 2888342310 2888337043 Bacteria 6629336
549 2888346360 2888343758 Bacteria 6611049
550 2888351433 2888350351 Bacteria 7372807
551 2889013721 2889010040 Bacteria 6749192
552 2889021571 2889016732 Bacteria 6700763
553 2898796929 2898795034 Bacteria 4294459
554 2899794479 2899792073 Bacteria 4926588
555 2903453152 2903448605 Bacteria 7357801
556 2903497939 2903492973 Bacteria 13473544
557 2903500722 2903492973 Bacteria 13473544
558 2903519453 2903513507 Bacteria 6344008
559 2903526834 2903521522 Bacteria 6525694
560 2903530167 2903528002 Bacteria 6586099
561 2903546844 2903540706 Bacteria 7062119
562 2904578969 2904578770 Bacteria 5302906
563 2904660582 2904659560 Bacteria 6685615
564 2906309214 2906308376 Bacteria 6841989
565 2906326821 2906321335 Bacteria 6579571
566 2906331892 2906328253 Bacteria 6585166
567 2906359068 2906354277 Bacteria 6991324
568 2906368256 2906363423 Bacteria 6856682
569 2906373846 2906370794 Bacteria 6881062
570 2906385539 2906378014 Bacteria 6911440
571 2906393236 2906386501 Bacteria 5977019
572 2906400787 2906393657 Bacteria 6790866
573 2906407168 2906401398 Bacteria 6693206
574 2906409654 2906408224 Bacteria 6162342
575 2906415922 2906414383 Bacteria 6580790
576 2913298340 2913295892 Bacteria 6333755
577 2915989798 2915986958 Bacteria 6739310
578 2915998260 2915993759 Bacteria 7016183
579 2916004919 2916000859 Bacteria 6865702
580 2916014215 2916007675 Bacteria 6898660
581 2916016070 2916014648 Bacteria 6946486
582 2916027990 2916021584 Bacteria 6854472
583 2916029642 2916028427 Bacteria 6748433
584 2916040537 2916035215 Bacteria 6755766
585 2916047409 2916041962 Bacteria 6820487
586 2916054854 2916048683 Bacteria 6543552
587 2916058960 2916055098 Bacteria 6758838
588 2916072598 2916068649 Bacteria 6943657
589 2916078757 2916076590 Bacteria 6596108
590 2919116607 2919114240 Bacteria 5700270
591 2919122204 2919119836 Bacteria 5208557
592 2919168240 2919166419 Bacteria 4952238
593 2921207752 2921201388 Bacteria 6926299
594 2921211529 2921208531 Bacteria 6745326
595 2921243380 2921237296 Bacteria 6876710
596 2921249773 2921244191 Bacteria 6568419
597 2921263537 2921257292 Bacteria 6808382
598 2921269454 2921263974 Bacteria 6864552
599 2921285226 2921282425 Bacteria 6826397
600 2921291465 2921289301 Bacteria 7316391
601 2921299146 2921296804 Bacteria 7176999
602 2922136003 2922130491 Bacteria 7173936
603 2922156512 2922151315 Bacteria 6902399
604 2922160561 2922158528 Bacteria 6573167
605 2922175096 2922172374 Bacteria 6167644
606 2922181721 2922178524 Bacteria 6025201
607 2922189620 2922185730 Bacteria 7113964
608 2924149144 2924144063 Bacteria 6883928
609 2924153294 2924150972 Bacteria 7169444
610 2924164531 2924158325 Bacteria 7188855
611 2924171647 2924165586 Bacteria 7260590
612 2924177380 2924172951 Bacteria 6749356
613 2924185574 2924179722 Bacteria 6843264
614 2924191144 2924186466 Bacteria 6876637
615 2924198132 2924193448 Bacteria 6955718
616 2924204936 2924200457 Bacteria 6757188
617 2924211749 2924207177 Bacteria 6917007
618 2924216723 2924214083 Bacteria 7080103
619 2924227066 2924221636 Bacteria 7113495
620 2924229561 2924228884 Bacteria 6633132
621 2924713729 2924710171 Bacteria 6752351
622 2924728639 2924726620 Bacteria 6271473
623 2924740648 2924733363 Bacteria 7574837
624 2924746372 2924741084 Bacteria 6661321
625 2924750933 2924748358 Bacteria 6154725
626 2924767855 2924762789 Bacteria 6561353
627 2924777548 2924776078 Bacteria 7492003
628 2924791109 2924784321 Bacteria 7416538
629 2926754615 2926754445 Bacteria 5964435
630 2928521869 2928521798 Bacteria 4960112
631 2933007084 2933006813 Bacteria 4912075
632 2933015326 2933011516 Bacteria 5439334
633 2937008927 2937002841 Bacteria 6934057
634 2937013942 2937009748 Bacteria 6746052
635 2937020832 2937016420 Bacteria 6782579
636 2937025717 2937023124 Bacteria 6815156
637 2937038974 2937036028 Bacteria 6846469
638 2937048962 2937042894 Bacteria 6741576
639 2937054292 2937049772 Bacteria 6757901
640 2937061918 2937056579 Bacteria 7107896
641 2937071050 2937063883 Bacteria 7199456
642 2937073493 2937071275 Bacteria 6984483
643 2937088619 2937084907 Bacteria 6618516
644 2937097647 2937091812 Bacteria 6979387
645 2937100719 2937098957 Bacteria 7249374
646 2937112321 2937106411 Bacteria 6947143
647 2937118534 2937113482 Bacteria 6505872
648 2937121860 2937119839 Bacteria 6597547
649 2937127005 2937126314 Bacteria 6771275
650 2937813926 2937813078 Bacteria 7783518
651 2937824178 2937822353 Bacteria 7290551
652 2937842386 2937836603 Bacteria 6811263
653 2937851497 2937848649 Bacteria 6983481
654 2937862248 2937861824 Bacteria 6660327
655 2937875808 2937868953 Bacteria 6639878
656 2937894960 2937891427 Bacteria 6357007
657 2937976516 2937972304 Bacteria 7532020
658 2937981225 2937980651 Bacteria 6517427
659 2938000703 2937994558 Bacteria 7036190
660 2938019782 2938014810 Bacteria 6700592
661 2941501124 2941499720 Bacteria 7599444
662 2954014774 2954011201 Bacteria 4762601
663 2957386905 2957382221 Bacteria 6737050
664 2957393770 2957388812 Bacteria 6778072
665 2957401793 2957395598 Bacteria 6822399
666 2957405607 2957402308 Bacteria 6741770
667 2957413800 2957408893 Bacteria 6558585
668 2957421905 2957415311 Bacteria 6991633
669 2957425037 2957422303 Bacteria 7172205
670 2957434360 2957430029 Bacteria 7022557
671 2957438713 2957437181 Bacteria 6568994
672 2957449819 2957443900 Bacteria 6869977
673 2957451728 2957450854 Bacteria 6765715
674 2957462217 2957457609 Bacteria 6967680
675 2957469107 2957464669 Bacteria 6568877
676 2957475502 2957471148 Bacteria 6797643
677 2957482463 2957478035 Bacteria 6756658
678 2957486416 2957484790 Bacteria 6703082
679 2957493768 2957491536 Bacteria 6695180
680 2957498916 2957498199 Bacteria 7126688
681 2957510492 2957505466 Bacteria 7253085
682 2958038533 2958034702 Bacteria 6989922
683 2958042164 2958041894 Bacteria 13082850
684 2958056144 2958041894 Bacteria 13082850
685 2958069794 2958064165 Bacteria 7158582
686 2958075430 2958071322 Bacteria 6815895
687 2958091047 2958084443 Bacteria 7312792
688 2958093516 2958092219 Bacteria 6861151
689 2958103863 2958100919 Bacteria 6800575
690 2958111528 2958108152 Bacteria 6681128
691 2958121493 2958115193 Bacteria 6923548
692 2958125305 2958122699 Bacteria 7280457
693 2958131265 2958130278 Bacteria 6897202
694 2958141505 2958137437 Bacteria 6050276
695 2958162065 2958158011 Bacteria 6058449
696 2958171074 2958165035 Bacteria 6906348
697 2958180664 2958179912 Bacteria 6874908
698 2960588398 2960584000 Bacteria 6864594
699 2960593245 2960591022 Bacteria 6622873
700 2960598099 2960597568 Bacteria 6550735
701 2960605297 2960603979 Bacteria 6898737
702 2960615320 2960610863 Bacteria 6691244
703 2960622868 2960617483 Bacteria 6727748
704 2960625830 2960624210 Bacteria 6875384
705 2960638925 2960637947 Bacteria 7296468
706 2960646813 2960645483 Bacteria 7211087
707 2960659348 2960652885 Bacteria 7083688
708 2960666602 2960660292 Bacteria 7041660
709 2960673086 2960667422 Bacteria 6763020
710 2960677934 2960674078 Bacteria 6609048
711 2960688742 2960687367 Bacteria 6535474
712 2961078498 2961077736 Bacteria 7079850
713 2961120903 2961114664 Bacteria 6680456
714 2961132990 2961127735 Bacteria 7196641
715 2961144582 2961136820 Bacteria 6775228
716 2961169518 2961163497 Bacteria 6901077
717 2961174068 2961170736 Bacteria 7072258
718 2961185297 2961183825 Bacteria 6688536
719 2963650136 2963644680 Bacteria 6530403
720 2964609214 2964607997 Bacteria 7101408
721 2964621538 2964615318 Bacteria 6809089
722 2964627922 2964621998 Bacteria 6834995
723 2964641889 2964636051 Bacteria 7091832
724 2964648121 2964643177 Bacteria 6820887
725 2964655051 2964649959 Bacteria 6675118
726 2964661876 2964656573 Bacteria 7100150
727 2964668545 2964663802 Bacteria 7019362
728 2964673732 2964670856 Bacteria 6851364
729 2964678869 2964678106 Bacteria 6792020
730 2964686763 2964685014 Bacteria 6839111
731 2964697616 2964691889 Bacteria 6802758
732 2964700312 2964698721 Bacteria 6765331
733 2964708948 2964705432 Bacteria 7114648
734 2964718050 2964712639 Bacteria 6695970
735 2964720338 2964719344 Bacteria 7286602
736 2965023770 2965018300 Bacteria 6883036
737 2965031173 2965025482 Bacteria 6532201
738 2965036349 2965032056 Bacteria 6887443
739 2965045479 2965040258 Bacteria 6855979
740 2965049381 2965047637 Bacteria 6623551
741 2965070207 2965062239 Bacteria 7412989
742 2965091892 2965089291 Bacteria 6866420
743 2965107725 2965102966 Bacteria 6800987
744 2965116620 2965110997 Bacteria 6693150
745 2965126543 2965119406 Bacteria 6956431
746 2967665800 2967664464 Bacteria 6948836
747 2967673057 2967671571 Bacteria 7021409
748 2967680326 2967678726 Bacteria 7264382
749 2967697540 2967693043 Bacteria 6804451
750 2967702424 2967699805 Bacteria 6854538
751 2967713174 2967706974 Bacteria 7186053
752 2967720244 2967714385 Bacteria 7000047
753 2967727655 2967721400 Bacteria 7073753
754 2967732834 2967728569 Bacteria 6641507
755 2967735667 2967735183 Bacteria 6827012
756 2967744930 2967742019 Bacteria 6794534
757 2967749608 2967748971 Bacteria 6733771
758 2967758419 2967755722 Bacteria 6814706
759 2967763655 2967762386 Bacteria 6923502
760 2967774459 2967769361 Bacteria 6587838
761 2967781264 2967775926 Bacteria 6738189
762 2968002757 2967996073 Bacteria 6787468
763 2968005153 2968003550 Bacteria 6929263
764 2968021164 2968016561 Bacteria 7022047
765 2968086518 2968083720 Bacteria 7351627
766 2968095313 2968091066 Bacteria 6052692
767 2968101282 2968097103 Bacteria 6107094
768 2968111640 2968110612 Bacteria 6814636
769 2968120078 2968117919 Bacteria 6536078
770 2968128567 2968128360 Bacteria 6270294
771 2968147012 2968138860 Bacteria 6605449
772 2968177908 2968171901 Bacteria 6894245
773 2970021109 2970019648 Bacteria 7072033
774 2970031884 2970026789 Bacteria 6785236
775 2970039949 2970033650 Bacteria 7118744
776 2970046710 2970040964 Bacteria 6731123
777 2970051829 2970047711 Bacteria 7088379
778 2970060419 2970054988 Bacteria 6611507
779 2970063562 2970061556 Bacteria 7099761
780 2970075731 2970068827 Bacteria 7123112
781 2970082385 2970076120 Bacteria 6697332
782 2970085153 2970082768 Bacteria 6183754
783 2970093801 2970088815 Bacteria 6933825
784 2970101431 2970095765 Bacteria 6936963
785 2970106174 2970102677 Bacteria 6812532
786 2970115378 2970109326 Bacteria 6863976
787 2970116733 2970116247 Bacteria 6501857
788 2970133829 2970129317 Bacteria 6806560
789 2970139720 2970136068 Bacteria 7207982
790 2970145224 2970143518 Bacteria 6446480
791 2970154586 2970149975 Bacteria 6779706
792 2970158951 2970156795 Bacteria 7168044
793 2970169687 2970164137 Bacteria 6861252
794 2970174027 2970170962 Bacteria 6876229
795 2970182468 2970177841 Bacteria 6768001
796 2970186991 2970184632 Bacteria 7054431
797 2970197769 2970191845 Bacteria 7032787
798 2970476269 2970469710 Bacteria 6969209
799 2970491517 2970489779 Bacteria 6517260
800 2970506656 2970503327 Bacteria 7099517
801 2970517277 2970510686 Bacteria 7006402
802 2970527866 2970524798 Bacteria 6840927
803 2970533737 2970532167 Bacteria 6553173
804 2970543731 2970540015 Bacteria 6977556
805 2970549479 2970547951 Bacteria 6931819
806 2970560754 2970554993 Bacteria 6814252
807 2970599051 2970593180 Bacteria 7073582
808 2970625391 2970619444 Bacteria 6986144
809 2970628020 2970627176 Bacteria 6680862
810 2977518879 2977516862 Bacteria 6940108
811 2977527090 2977523885 Bacteria 6960446
812 2977530976 2977530762 Bacteria 6951399
813 2977542786 2977537788 Bacteria 6929320
814 2977557660 2977551784 Bacteria 7125765
815 2977564682 2977558990 Bacteria 6863948
816 2977569958 2977565890 Bacteria 6901543
817 2977573481 2977572785 Bacteria 6763888
818 2977584586 2977579622 Bacteria 6772100
819 2977825288 2977821940 Bacteria 6906439
820 2977847010 2977843712 Bacteria 6753583
821 2977854001 2977851361 Bacteria 6694324
822 2977860351 2977858184 Bacteria 6215359
823 2977868282 2977864932 Bacteria 7534097
824 2977874125 2977872689 Bacteria 7270173
825 2977902253 2977898635 Bacteria 6675551
826 2977909827 2977907340 Bacteria 6577984
827 2977915326 2977915119 Bacteria 6829656
828 2977923206 2977922695 Bacteria 6956781
829 2977937192 2977935797 Bacteria 6252826
830 2977945803 2977942078 Bacteria 7570577
831 2977955541 2977950692 Bacteria 6893264
832 2977960940 2977957713 Bacteria 6877875
833 2977973506 2977971508 Bacteria 7472917
834 2977992493 2977986579 Bacteria 6581278
835 2978970864 2978969890 Bacteria 5400756
836 2979104918 2979100975 Bacteria 5423623
837 2979711731 2979710463 Bacteria 6785254
838 2979747045 2979742915 Bacteria 7301278
839 2979768795 2979764755 Bacteria 6610066
840 2979775006 2979772303 Bacteria 6618277
841 2979796882 2979793036 Bacteria 6808957
842 2979811356 2979808191 Bacteria 7179355
843 2984513281 2984509177 Bacteria 5274802
844 2984520350 2984518228 Bacteria 5277463
845 2984539648 2984537506 Bacteria 5277481
846 2984587973 2984587000 Bacteria 5263363
847 2984601874 2984601300 Bacteria 5455244
848 2987642992 2987636660 Bacteria 8088555
849 2987649410 2987645492 Bacteria 6117018
850 2987655461 2987652177 Bacteria 6969023
851 2987665504 2987659509 Bacteria 6966464
852 2987672290 2987666974 Bacteria 6509233
853 2987673984 2987673487 Bacteria 6884027
854 2995395892 2995392953 Bacteria 4539380
855 2996312964 2996310559 Bacteria 6357320
856 2996348937 2996341866 Bacteria 6643098
857 2996355026 2996348954 Bacteria 7239054
858 2996389787 2996386984 Bacteria 6978667
859 3000142244 3000135777 Bacteria 6891109
860 3002142778 3002141150 Bacteria 5254435
861 3003931551 3003930520 Bacteria 5667563
862 3004171928 3004167301 Bacteria 8330599
863 3004194706 3004188549 Bacteria 6952365
864 3004198081 3004195979 Bacteria 6776956
865 3004210785 3004203850 Bacteria 7307914
866 3004213504 3004211236 Bacteria 7417683
867 3004221209 3004218560 Bacteria 7421728
868 3004239374 3004232784 Bacteria 6662140
869 3004243727 3004239961 Bacteria 6892290
870 3004251647 3004248173 Bacteria 6563236
871 3004271471 3004268573 Bacteria 7043476
872 3004281560 3004275668 Bacteria 7114440
873 3004338528 3004334049 Bacteria 8449246
874 637078818 637000159 Bacteria 7596297
875 648736662 648276728 Bacteria 6968865
876 649872419 649633066 Bacteria 6690028
877 8002288238 8002285264 Bacteria 6717907
878 8003572320 8003570095 Bacteria 5747666
879 8003995789 8003992118 Bacteria 7266902
880 8004003545 8003999396 Bacteria 7063185
881 8004305870 8004300914 Bacteria 6132239
882 8004320607 8004312739 Bacteria 7444653
883 8004363723 8004361976 Bacteria 6858373
884 8004377655 8004374579 Bacteria 6898112
885 8004388145 8004387939 Bacteria 7049250
886 8004395675 8004395343 Bacteria 6620908
887 8004451572 8004445564 Bacteria 6322258
888 8004636448 8004633249 Bacteria 6723080
889 8004643646 8004640170 Bacteria 6723001
890 8004713226 8004703790 Bacteria 8006957
891 8004715472 8004714634 Bacteria 6776161
892 8004729953 8004727605 Bacteria 6643904
893 8018152839 8018150411 Bacteria 5549903
894 8054461101 8054460903 Bacteria 4872905
895 8054561109 8054558443 Bacteria 5204801
896 8055619158 8055617313 Bacteria 7548464
897 JGI24736J21556_1000604
898 JGI24740J21852_10005625
899 JGI24739J22299_10009416
900 JGI24737J22298_10021752
901 JGI24735J21928_10022976
902 JGI24738J21930_10000460
903 JGI25156J39149_1003677
904 JGI25157J39369_1000347
905 JGI25151J46595_10013540
906 JGI25165J46597_1000020
907 Ga0055542_1000516
908 Ga0055529_1001859
909 Ga0055524_1001144
910 Ga0055531_10010137
911 Ga0065707_10026222
912 Ga0070658_10027680
913 Ga0070661_100193526
914 Ga0070668_100226896
915 Ga0070668_100520382
916 Ga0070669_100254130
917 Ga0070674_100133706
918 Ga0070667_100155124
919 Ga0070663_100007173
920 Ga0070684_100774430
921 Ga0068853_100046275
922 Ga0070665_100306506
923 Ga0070665_100310859
924 Ga0068855_100089250
925 Ga0068857_100346664
926 Ga0068857_100358512
927 Ga0068857_101062743
928 Ga0068854_100171209
929 Ga0068856_100111381
930 Ga0068856_100186994
931 Ga0068852_100376932
932 Ga0068852_100617585
933 Ga0068851_10069493
934 Ga0075365_10001929
935 Ga0075365_10040892
936 Ga0075365_10043590
937 Ga0075365_10055747
938 Ga0075368_10044900
939 Ga0075364_10035265
940 Ga0075364_10039182
941 Ga0075362_10045337
942 Ga0075362_10305474
943 Ga0075367_10004358
944 Ga0075367_10019011
945 Ga0075367_10039830
946 Ga0075367_10206281
947 Ga0075369_10005979
948 Ga0075369_10038049
949 Ga0075370_10230305
950 Ga0075370_10247450
951 Ga0079104_1004473
952 Ga0079104_1007226
953 Ga0099826_10009775
954 Ga0105240_10637479
955 Ga0105247_10406684
956 Ga0105241_10291819
957 Ga0105237_10213315
958 Ga0105237_10244105
959 Ga0105238_10012176
960 Ga0105249_10518356
961 Ga0105239_10081120
962 Ga0105239_10222678
963 Ga0105239_10248558
964 Ga0105239_10361696
965 Ga0105239_11054413
966 Ga0105246_10862399
967 Ga0163163_10279239
968 Ga0157380_10763163
969 Ga0182008_10049151
970 Ga0214544_1006450
971 Ga0214542_1000029
972 Ga0214542_1025934
973 Ga0214543_1000040
974 Ga0214543_1000049
975 Ga0228711_1003229
976 Ga0228710_1000004
977 Ga0209147_101667
978 Ga0209026_1000005
979 Ga0209148_1000078
980 Ga0209148_1024328
981 Ga0209759_1000239
982 Ga0209233_1000047
983 Ga0209565_1015883
984 Ga0209455_1000194
985 Ga0209025_1000105
986 Ga0209025_1049819
987 Ga0209758_1018328
988 Ga0209758_1050254
989 Ga0209256_1000027
990 Ga0207656_10091644
991 Ga0207647_10017158
992 Ga0207647_10046213
993 Ga0207645_10236719
994 Ga0207705_10079956
995 Ga0207654_10161822
996 Ga0207695_10665938
997 Ga0207671_10035087
998 Ga0207671_10103285
999 Ga0207657_10067581
1000 Ga0207657_10253441
1001 Ga0207694_10076577
1002 Ga0207694_10123698
1003 Ga0207690_10345533
1004 Ga0207706_10076512
1005 Ga0207669_10232391
1006 Ga0207669_10558317
1007 Ga0207661_10371723
1008 Ga0207639_10019079
1009 Ga0207639_10028706
1010 Ga0207639_10040125
1011 Ga0207678_10128163
1012 Ga0207702_10010044
1013 Ga0207648_10153690
1014 Ga0207674_10127654
1015 Ga0207674_10174321
1016 Ga0207683_10192707
1017 Ga0207698_10148006
1018 Ga0209281_1000134
1019 Ga0209281_1000445
1020 Ga0209371_1000009
1021 Ga0209371_1001016
1022 Ga0209282_1000029
1023 Ga0209282_1025331
1024 Ga0209813_10071784
1025 Ga0268266_10039602
1026 Ga0268266_10258402
1027 Ga0307515_10000029
1028 Ga0307515_10000277
1029 Ga0307515_10005710
1030 Ga0307515_10136809
1031 Ga0268256_1000010
1032 Ga0268256_1005318
1033 Ga0307513_10003029
1034 Ga0307408_100135017
1035 Ga0307408_100425932
1036 Ga0307410_10012335
1037 Ga0307406_10043274
1038 Ga0307406_10126124
1039 Ga0307412_10090470
1040 Ga0307412_10198393
1041 Ga0307412_10350197
1042 Ga0315914_1000004
1043 Ga0307409_100247978
1044 Ga0307416_100318575
1045 Ga0307416_100413082
1046 Ga0307416_100686042
1047 Ga0307414_10230673
1048 Ga0307414_10712960
1049 Ga0307411_10190578
1050 Ga0315913_1000370
1051 Ga0315915_1000003
1052 Ga0373931_0160631
1053 Ga0395900_0044321
1054 Ga0395900_0373102
1055 Ga0395900_0668407
1056 Ga0395898_0813450
1057 Ga0395905_0044744
1058 Ga0395905_0047448
1059 Ga0395905_0082924
1060 Ga0395905_0172370
1061 Ga0395905_0309335
1062 Ga0395905_0746590
1063 Ga0395901_0055397
1064 Ga0395901_0357364
1065 Ga0395901_0377891
1066 Ga0395901_0951536
1067 Ga0439465_0009030
1068 Ga0439448_0120371
1069 Ga0450900_008873
1070 Ga0466960_0018792
1071 Ga0466967_0310148
1072 Ga0495627_000757
1073 Ga0495638_0006811
1074 Ga0495638_0227171
1075 Ga0495638_0291378
1076 Ga0495631_0123549
1077 Ga0495668_0117288
1078 Ga0495625_0025379
1079 Ga0495625_0031385
1080 Ga0495625_0078591
1081 Ga0495588_0000559
1082 Ga0495671_0013217
1083 Ga0495681_0002200
1084 Ga0495686_0213685
1085 Ga0496102_0064051
1086 Ga0496102_0410744
1087 Ga0496109_0241754
1088 Ga0496110_0213443
1089 Ga0496111_0072083
1090 Ga0496115_0212255
1091 Ga0496116_0000026
1092 Ga0496116_0016002
1093 Ga0496118_0062119
1094 Ga0496118_0134211
1095 Ga0496119_0000827
1096 Ga0496119_0049823
1097 Ga0496120_0001220
1098 Ga0496120_0041504
1099 Ga0496121_0024486
1100 Ga0496121_0451018
1101 Ga0496122_0001094
1102 Ga0496122_0026504
1103 Ga0496122_0083749
1104 Ga0496122_0320707
1105 Ga0496123_0001198
1106 Ga0496123_0134900
1107 Ga0496124_0000083
1108 Ga0496124_0095089
1109 Ga0496124_0118629
1110 Ga0496124_0530940
1111 Ga0496125_0000602
1112 Ga0496125_0062487
1113 Ga0496125_0079689
1114 Ga0496125_0092750
1115 Ga0496125_0183659
1116 Ga0496125_0266816
1117 Ga0496126_0000069
1118 Ga0496126_0480828
1119 Ga0496126_0522218
1120 Ga0496126_0664556
1121 Ga0501031_0000003
1122 Ga0501031_0110207
1123 Ga0501031_0170555
1124 Ga0501031_0205516
1125 Ga0501031_0225275
1126 Ga0501031_0227647
1127 Ga0501031_0312302
1128 Ga0501032_0000010
1129 Ga0501032_0000546
1130 Ga0501032_0038298
1131 Ga0501032_0106271
1132 Ga0501032_0433747
1133 Ga0501032_0433748
1134 Ga0501033_0000017
1135 Ga0501033_0007011
1136 Ga0501033_0075934
1137 Ga0501033_0129466
1138 Ga0501033_0160323
1139 Ga0501033_0218163
1140 Ga0501033_0498522
1141 Ga0501033_0498525
1142 Ga0501034_0000053
1143 Ga0501034_0001507
1144 Ga0501034_0137573
1145 Ga0501034_0292788
1146 Ga0501034_0371301
1147 Ga0501034_0380632
1148 Ga0501034_0477428
1149 Ga0501034_0554374
1150 Ga0501034_0789890
1151 Ga0501036_0000009
1152 Ga0501036_0001029
1153 Ga0501036_0145208
1154 Ga0501036_0440654
1155 Ga0501036_0692168
1156 Ga0501037_0000008
1157 Ga0501037_0000838
1158 Ga0501037_0029710
1159 Ga0501037_0133871
1160 Ga0501037_0278986
1161 Ga0501038_0000008
1162 Ga0501038_0002532
1163 Ga0501038_0052723
1164 Ga0501038_0588889
1165 Ga0501038_0588893
1166 Ga0501039_0000021
1167 Ga0501039_0001378
1168 Ga0501039_0081398
1169 Ga0501039_0626571
1170 Ga0501040_0007087
1171 Ga0501040_0240431
1172 Ga0501043_0000043
1173 Ga0501043_0000656
1174 Ga0501043_0029929
1175 Ga0501043_0044479
1176 Ga0501043_0077343
1177 Ga0501046_0074049
1178 Ga0501046_0133477
1179 Ga0501047_0004274
1180 Ga0501047_0049899
1181 Ga0501047_0111020
1182 Ga0501047_0250744
1183 Ga0501047_0693987
1184 Ga0501048_0008441
1185 Ga0501048_0041326
1186 Ga0501048_0142045
1187 Ga0501068_0096943
1188 Ga0501070_0007145
1189 Ga0501070_0046063
1190 Ga0501070_0510277
1191 Ga0501070_0670508
1192 Ga0501071_0071456
1193 Ga0501071_0757966
1194 Ga0501072_0324716
1195 Ga0501073_0039790
1196 Ga0501073_0078669
1197 Ga0501073_0102417
1198 Ga0501074_0017395
1199 Ga0501075_0011120
1200 Ga0501079_0017789
1201 Ga0501080_0040744
1202 Ga0501080_0376960
1203 Ga0501080_0530444
1204 Ga0501083_0094228
1205 Ga0501083_0216982
1206 Ga0501035_0000023
1207 Ga0501035_0000958
1208 Ga0501035_0060685
1209 Ga0501035_0082530
1210 Ga0501035_0107342
1211 Ga0501035_0196300
1212 Ga0501035_0209854
1213 Ga0501035_0337229
1214 Ga0501035_0665820
1215 Ga0501035_0665824
1216 Ga0501044_0000021
1217 Ga0501044_0018996
1218 Ga0501044_0096604
1219 Ga0501044_0224868
1220 Ga0501044_0771201
1221 Ga0501044_0771202
1222 nmdc:mga03683_3508_c1
1223 nmdc:mga03n38_222068_c1
1224 nmdc:mga03n38_24210_c1
1225 nmdc:mga03n38_341903_c1
1226 nmdc:mga00v17_60381_c1
1227 nmdc:mga0yw44_130983_c1
1228 nmdc:mga0yw44_18598_c1
1229 nmdc:mga0yw44_2158_c1
1230 nmdc:mga0yw44_40990_c1
1231 nmdc:mga0k408_285784_c1
1232 nmdc:mga06z11_108525_c1
1233 nmdc:mga06z11_251023_c1
1234 nmdc:mga06z11_389092_c1
1235 nmdc:mga06z11_482724_c1
1236 nmdc:mga07m45_164586_c1
1237 nmdc:mga07m45_229652_c1
1238 nmdc:mga0sz30_35723_c1
1239 nmdc:mga0sz30_43965_c2
1240 nmdc:mga0sz30_87632_c1
1241 Ga0495655_0098972
1242 Ga0500556_0000124
1243 Ga0500560_002097
1244 Ga0500572_001261
1245 Ga0500652_166684
1246 Ga0500568_0001216
1247 Ga0500568_0139273
1248 Ga0500573_0296573
1249 Ga0500604_0089761
1250 Ga0500616_0077825
1251 Ga0500620_079823
1252 Ga0500624_000477
1253 Ga0500627_0088440
1254 Ga0500627_0156522
1255 Ga0500627_0185732
1256 Ga0500627_0271551
1257 Ga0500634_0013936
1258 Ga0500634_0086605
1259 Ga0500636_0000069
1260 Ga0500636_0001346
1261 Ga0500611_027556
1262 Ga0587106_044095
1263 Ga0501082_0355897
1264 Ga0501082_0453459
1265 Ga0530510_0034914
1266 2881154583
1267 2503200758
1268 2509111779
1269 2509118944
1270 2509141193
1271 2509146243
1272 2509369029
1273 2509375407
1274 2509395594
1275 2510308146
1276 2510316155
1277 2511390734
1278 2511498925
1279 2512929098
1280 2512963654
1281 2512973125
1282 2513587193
1283 2513594120
1284 2513607778
1285 2513616217
1286 2513882630
1287 2513904613
1288 2513996398
1289 2514039759
1290 2514421658
1291 2514590814
1292 2516895201
1293 2524450916
1294 2535486331
1295 2537873429
1296 2551675237
1297 2551686984
1298 2551696598
1299 2551704793
1300 2551709664
1301 2551716508
1302 2551726703
1303 2551737502
1304 2551743130
1305 2558866503
1306 2585264848
1307 2585386096
1308 2585394659
1309 2588514637
1310 2599604419
1311 2599940536
1312 2600197564
1313 2643772313
1314 2643774433
1315 2643792878
1316 2643805884
1317 2643812599
1318 2643920697
1319 2643963301
1320 2643988080
1321 2644066061
1322 2644132550
1323 2644155568
1324 2644380365
1325 2644417392
1326 2644450788
1327 2644692788
1328 2688597889
1329 2692317675
1330 2694628950
1331 2694637135
1332 2715498527
1333 2723578180
1334 2739309560
1335 2753357752
1336 2753459874
1337 2756676223
1338 2757569315
1339 2758640329
1340 2765464440
1341 2770194803
1342 2776272407
1343 2776284347
1344 2792621043
1345 2792625258
1346 2792750028
1347 2802718694
1348 2802742223
1349 2802748906
1350 2819556766
1351 2838677501
1352 2838716390
1353 2838719810
1354 2838727141
1355 2839994354
1356 2840764905
1357 2841735575
1358 2841846741
1359 2841860730
1360 2842127230
1361 2842132394
1362 2842152437
1363 2842172635
1364 2842176056
1365 2842189497
1366 2842213811
1367 2842224571
1368 2842517515
1369 2842521318
1370 2842873564
1371 2844004859
1372 2844009619
1373 2847421346
1374 2847672557
1375 2847691857
1376 2848996131
1377 2850079527
1378 2854914999
1379 2855827839
1380 2855843207
1381 2855877839
1382 2856315785
1383 2856329984
1384 2856337131
1385 2856347721
1386 2856355384
1387 2856358615
1388 2856367652
1389 2857353595
1390 2857374996
1391 2858802935
1392 2869163876
1393 2869254322
1394 2869263952
1395 2869270656
1396 2869277888
1397 2869284436
1398 2869286860
1399 2871434124
1400 2871439407
1401 2871449262
1402 2871452379
1403 2871465525
1404 2871472552
1405 2871479129
1406 2871481784
1407 2871490020
1408 2871501865
1409 2874102862
1410 2874111666
1411 2874121718
1412 2874126864
1413 2874139102
1414 2874147782
1415 2874156700
1416 2874163967
1417 2874169973
1418 2876369564
1419 2876382121
1420 2876392085
1421 2876393857
1422 2876401625
1423 2876412366
1424 2876414726
1425 2876423356
1426 2878042405
1427 2878739949
1428 2878746834
1429 2878756067
1430 2878765898
1431 2878772572
1432 2878775390
1433 2878786057
1434 2881163695
1435 2881846849
1436 2881857409
1437 2881866151
1438 2882634247
1439 2882917396
1440 2885308868
1441 2885318751
1442 2885345195
1443 2885356593
1444 2888342310
1445 2888346360
1446 2888351433
1447 2889013721
1448 2889021571
1449 2898796929
1450 2899794479
1451 2903453152
1452 2903497939
1453 2903500722
1454 2903519453
1455 2903526834
1456 2903530167
1457 2903546844
1458 2904578969
1459 2904660582
1460 2906309214
1461 2906326821
1462 2906331892
1463 2906359068
1464 2906368256
1465 2906373846
1466 2906385539
1467 2906393236
1468 2906400787
1469 2906407168
1470 2906409654
1471 2906415922
1472 2913298340
1473 2915989798
1474 2915998260
1475 2916004919
1476 2916014215
1477 2916016070
1478 2916027990
1479 2916029642
1480 2916040537
1481 2916047409
1482 2916054854
1483 2916058960
1484 2916072598
1485 2916078757
1486 2919116607
1487 2919122204
1488 2919168240
1489 2921207752
1490 2921211529
1491 2921243380
1492 2921249773
1493 2921263537
1494 2921269454
1495 2921285226
1496 2921291465
1497 2921299146
1498 2922136003
1499 2922156512
1500 2922160561
1501 2922175096
1502 2922181721
1503 2922189620
1504 2924149144
1505 2924153294
1506 2924164531
1507 2924171647
1508 2924177380
1509 2924185574
1510 2924191144
1511 2924198132
1512 2924204936
1513 2924211749
1514 2924216723
1515 2924227066
1516 2924229561
1517 2924713729
1518 2924728639
1519 2924740648
1520 2924746372
1521 2924750933
1522 2924767855
1523 2924777548
1524 2924791109
1525 2926754615
1526 2928521869
1527 2933007084
1528 2933015326
1529 2937008927
1530 2937013942
1531 2937020832
1532 2937025717
1533 2937038974
1534 2937048962
1535 2937054292
1536 2937061918
1537 2937071050
1538 2937073493
1539 2937088619
1540 2937097647
1541 2937100719
1542 2937112321
1543 2937118534
1544 2937121860
1545 2937127005
1546 2937813926
1547 2937824178
1548 2937842386
1549 2937851497
1550 2937862248
1551 2937875808
1552 2937894960
1553 2937976516
1554 2937981225
1555 2938000703
1556 2938019782
1557 2941501124
1558 2954014774
1559 2957386905
1560 2957393770
1561 2957401793
1562 2957405607
1563 2957413800
1564 2957421905
1565 2957425037
1566 2957434360
1567 2957438713
1568 2957449819
1569 2957451728
1570 2957462217
1571 2957469107
1572 2957475502
1573 2957482463
1574 2957486416
1575 2957493768
1576 2957498916
1577 2957510492
1578 2958038533
1579 2958042164
1580 2958056144
1581 2958069794
1582 2958075430
1583 2958091047
1584 2958093516
1585 2958103863
1586 2958111528
1587 2958121493
1588 2958125305
1589 2958131265
1590 2958141505
1591 2958162065
1592 2958171074
1593 2958180664
1594 2960588398
1595 2960593245
1596 2960598099
1597 2960605297
1598 2960615320
1599 2960622868
1600 2960625830
1601 2960638925
1602 2960646813
1603 2960659348
1604 2960666602
1605 2960673086
1606 2960677934
1607 2960688742
1608 2961078498
1609 2961120903
1610 2961132990
1611 2961144582
1612 2961169518
1613 2961174068
1614 2961185297
1615 2963650136
1616 2964609214
1617 2964621538
1618 2964627922
1619 2964641889
1620 2964648121
1621 2964655051
1622 2964661876
1623 2964668545
1624 2964673732
1625 2964678869
1626 2964686763
1627 2964697616
1628 2964700312
1629 2964708948
1630 2964718050
1631 2964720338
1632 2965023770
1633 2965031173
1634 2965036349
1635 2965045479
1636 2965049381
1637 2965070207
1638 2965091892
1639 2965107725
1640 2965116620
1641 2965126543
1642 2967665800
1643 2967673057
1644 2967680326
1645 2967697540
1646 2967702424
1647 2967713174
1648 2967720244
1649 2967727655
1650 2967732834
1651 2967735667
1652 2967744930
1653 2967749608
1654 2967758419
1655 2967763655
1656 2967774459
1657 2967781264
1658 2968002757
1659 2968005153
1660 2968021164
1661 2968086518
1662 2968095313
1663 2968101282
1664 2968111640
1665 2968120078
1666 2968128567
1667 2968147012
1668 2968177908
1669 2970021109
1670 2970031884
1671 2970039949
1672 2970046710
1673 2970051829
1674 2970060419
1675 2970063562
1676 2970075731
1677 2970082385
1678 2970085153
1679 2970093801
1680 2970101431
1681 2970106174
1682 2970115378
1683 2970116733
1684 2970133829
1685 2970139720
1686 2970145224
1687 2970154586
1688 2970158951
1689 2970169687
1690 2970174027
1691 2970182468
1692 2970186991
1693 2970197769
1694 2970476269
1695 2970491517
1696 2970506656
1697 2970517277
1698 2970527866
1699 2970533737
1700 2970543731
1701 2970549479
1702 2970560754
1703 2970599051
1704 2970625391
1705 2970628020
1706 2977518879
1707 2977527090
1708 2977530976
1709 2977542786
1710 2977557660
1711 2977564682
1712 2977569958
1713 2977573481
1714 2977584586
1715 2977825288
1716 2977847010
1717 2977854001
1718 2977860351
1719 2977868282
1720 2977874125
1721 2977902253
1722 2977909827
1723 2977915326
1724 2977923206
1725 2977937192
1726 2977945803
1727 2977955541
1728 2977960940
1729 2977973506
1730 2977992493
1731 2978970864
1732 2979104918
1733 2979711731
1734 2979747045
1735 2979768795
1736 2979775006
1737 2979796882
1738 2979811356
1739 2984513281
1740 2984520350
1741 2984539648
1742 2984587973
1743 2984601874
1744 2987642992
1745 2987649410
1746 2987655461
1747 2987665504
1748 2987672290
1749 2987673984
1750 2995395892
1751 2996312964
1752 2996348937
1753 2996355026
1754 2996389787
1755 3000142244
1756 3002142778
1757 3003931551
1758 3004171928
1759 3004194706
1760 3004198081
1761 3004210785
1762 3004213504
1763 3004221209
1764 3004239374
1765 3004243727
1766 3004251647
1767 3004271471
1768 3004281560
1769 3004338528
1770 637078818
1771 648736662
1772 649872419
1773 8002288238
1774 8003572320
1775 8003995789
1776 8004003545
1777 8004305870
1778 8004320607
1779 8004363723
1780 8004377655
1781 8004388145
1782 8004395675
1783 8004451572
1784 8004636448
1785 8004643646
1786 8004713226
1787 8004715472
1788 8004729953
1789 8018152839
1790 8054461101
1791 8054561109
1792 8055619158

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01048

PNP_UDP_1

Phosphorylase superfamily

128

200

0.75

Structural Annotation

Top 5 Hits

ID Description Score Start End
4pr3-assembly1.cif.gz_B crystal structure of brucella melitensis 5'-methylthioadenosine/s-adenosylhomocysteine nucleosidase 0.9468 4 205
4pr3-assembly1.cif.gz_B crystal structure of brucella melitensis 5'-methylthioadenosine/s-adenosylhomocysteine nucleosidase 0.9146 4 205
4pr3-assembly1.cif.gz_A crystal structure of brucella melitensis 5'-methylthioadenosine/s-adenosylhomocysteine nucleosidase 0.9139 4 210
4pr3-assembly1.cif.gz_A crystal structure of brucella melitensis 5'-methylthioadenosine/s-adenosylhomocysteine nucleosidase 0.8923 4 210
5dk6-assembly1.cif.gz_A crystal structure of a 5'-methylthioadenosine/s-adenosylhomocysteine (mta/sah) nucleosidase (mtan) from colwellia psychrerythraea 34h (cps_4743, target psi-029300) in complex with adenine at 2.27 a resolution 0.8035 12 203
ID Description Score Start End Superfamily
4pr3B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Nucleoside phosphorylase domain 0.9414 4 205 3.40.50.1580
4pr3B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Nucleoside phosphorylase domain 0.913 4 205 3.40.50.1580
af_Q69XD3_13_258_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.8318 40 66 3.40.50.2000
af_K7UNY3_10_282_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.8067 43 66 3.40.50.2000
af_Q4CYT0_175_370_3.40.1090.10 Alpha Beta;3-Layer(aba) Sandwich;Cytosolic phospholipase A2 catalytic domain;Cytosolic phospholipase A2 catalytic domain 0.7745 43 65 3.40.1090.10
ID Description Score Start End GO Terms
AF-A0A440E534-F1-model_v4 deleted 1.002 4 68
AF-A0A3S1SEQ8-F1-model_v4 deleted 0.9968 4 75
AF-A0A4Q3YJT3-F1-model_v4 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase (EC 3.2.2.9) 0.9961 4 80 GO:0008782
GO:0009116
AF-A0A258MY70-F1-model_v4 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase 0.9651 4 171 GO:0003824
GO:0009116
AF-A0A832PQ91-F1-model_v4 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase (EC 3.2.2.9) 0.9562 4 205 GO:0009116
GO:0016798

Map