F485034

General Info

Members Datasets Scaffolds Average Seq Length
896 375 824 311

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2884634485|2884634839
Length 319
Sequence RNTRIYIAGHRGMVGSAIWRKLEAEGYTNLIGKTSAELDLRNQAAVQDFFKAEKPELVIDAAARVGGILANNTYPYQFLMENLQIQNNLIDTAFHSGVEKFIFLGSSCIYPKLAPQPLKEEYLLTAPLEPTNEWYAIAKIAGVKACEAIRKQYGKDYISLMPTNLYGPHDNFDLKTSHVLPSMIRKFHEAKQYAVGSKQSTVTLWGSGTPMREFLYVEDLAEAVVFAMENKFSDNLYNVGTGEDLTIKDLALLIQKIVGHTGEIIWDSTKPDGTPRKLMDVSKMEKAGWKAKTSLEDGIRKTYEWFLENQDSVKQVKMG

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2513020052 Flavobacterium sp. CF136 Isolate Rhizosphere
3 2513237088 Rhizobium mesoamericanum STM6155 Isolate Nodule
4 2519899754 Flavobacterium sp. F52 Isolate Rhizosphere
5 2522125168 Dyadobacter beijingensis DSM 21582 Isolate Rhizosphere
6 2582581873 Chryseobacterium sp. OV259 Isolate Rhizosphere
7 2585427687 Pedobacter borealis DSM 19626 Isolate Rhizosphere
8 2643221667 Flavobacterium sp. Root420 Isolate Unclassified
9 2643221725 Flavobacterium sp. Root935 Isolate Unclassified
10 2721755487 Sphingobacterium sp. B29 Isolate Rhizosphere
11 2738541283 Pedobacter sp. OK701 Isolate Unclassified
12 2738541284 Pedobacter sp. YR016 Isolate Unclassified
13 2738543023 Pedobacter sp. OK628 Isolate Unclassified
14 2739367651 Pedobacter sp. OK291 Isolate Unclassified
15 2739367857 Flavobacterium sp. GV029 Isolate Unclassified
16 2739367858 Flavobacterium sp. GV028 Isolate Unclassified
17 2775506987 Pedobacter ginsengisoli T01R-27 Isolate Unclassified
18 2802428842 Flavobacterium sp. S87F.05.LMB.W.Kidney.N Isolate Unclassified
19 2818991437 Pedobacter terrae 518 Isolate Unclassified
20 2818991442 Chitinophaga pinensis 1204 Isolate Unclassified
21 2818991444 Filimonas endophytica 3197 Isolate Unclassified
22 2818991460 Chitinophaga polysaccharea 1209 Isolate Unclassified
23 2821136567 Chitinophaga sancti 1232 Isolate Unclassified
24 2839989709 Pontibacter arcticus 2b14 Isolate Unclassified
25 2842722452 Pedobacter sp. R-72249 Isolate Unclassified
26 2842903701 Olivibacter sp. R-72191 Isolate Unclassified
27 2842909656 Pedobacter sp. R-72393 Isolate Unclassified
28 2849281842 Pedobacter sp. AK013 Isolate Rhizosphere
29 2852623160 Mucilaginibacter sp. AK015 Isolate Rhizosphere
30 2852627209 Pedobacter sp. AK017 Isolate Rhizosphere
31 2857618242 Flavobacterium sp. R-74482 Isolate Unclassified
32 2883068021 Chitinophaga rhizosphaerae T16R-86 Isolate Rhizosphere
33 2884634485 Algoriphagus kandeliae XY-J91 Isolate Unclassified
34 2884791551 Chitinophaga oryzae 1310 Isolate Unclassified
35 2884933994 Mucilaginibacter sp. 14171R-50 Isolate Rhizosphere
36 2896109856 Chitinophaga sp. SYP-B3965 Isolate Rhizosphere
37 2896344016 Sphingobacterium sp. SGL-16 Isolate Rhizosphere
38 2902048731 Pedobacter ureilyticus THG-T11 Isolate Rhizosphere
39 2904445276 Pedobacter terrae 1734 Isolate Rhizosphere
40 2904467357 Chitinophaga sancti 3198 Isolate Unclassified
41 2911138879 Spirosoma sp. KUDC1026 Isolate Rhizosphere
42 2919191525 Flavobacterium sp. 2755 Isolate Rhizosphere
43 2919683626 Flavobacterium piscis 4129 Isolate Unclassified
44 2919692658 Algoriphagus sp. 4150 Isolate Rhizosphere
45 2929150217 Flavobacterium sp. R-74510 Hybrid assembly Isolate Unclassified
46 2929154850 Filimonas sp. R-72421 Hybrid assembly Isolate Unclassified
47 2929177148 Chitinophaga sp. R-72269 Hybrid assembly Isolate Unclassified
48 2929921140 Chitinophaga sp. R-72609 Hybrid assembly Isolate Unclassified
49 2945977869 Chitinophaga sp. W2I13 Isolate Rhizosphere
50 2946013367 Chitinophaga sp. W3I9 Isolate Rhizosphere
51 2954016120 Flavobacterium sp. W4I14 Isolate Rhizosphere
52 2958512119 Flavobacterium sp. Sd200 Isolate Rhizosphere
53 2977243572 Chryseobacterium sp. SORGH_AS 447 Isolate Unclassified
54 2977268062 Flavobacterium sp. SORGH_AS 622 Isolate Unclassified
55 2984572630 Chryseobacterium sp. SORGH_AS909 Isolate Aerial Root
56 2984606641 Chryseobacterium sp. SORGH_AS1175 Isolate Aerial Root
57 2989349275 Shinella kummerowiae CCBAU 25048 Isolate Unclassified
58 3003233435 Sphingobacterium shayense CrR18 Isolate Unclassified
59 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
60 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
61 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
62 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
63 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
64 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
65 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
66 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
67 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
68 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
69 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
70 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
71 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
72 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
73 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
74 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
75 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
76 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
77 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
78 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
79 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
80 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
81 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
82 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
83 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
84 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
85 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
86 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
87 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
88 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
89 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
90 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
91 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
92 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
93 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
94 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
95 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
96 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
97 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
98 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
99 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
100 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
101 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
102 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
103 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
104 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
105 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
106 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
107 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
108 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
109 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
110 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
111 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
112 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
113 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
114 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
115 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
116 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
117 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
118 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
119 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
120 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
121 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
122 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
123 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
124 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
125 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
126 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
127 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
128 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
129 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
130 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
131 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
132 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
133 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
134 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
135 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
136 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
137 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
138 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
139 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
140 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
141 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
142 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
143 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
144 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
145 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
146 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
147 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
148 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
149 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
150 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
151 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
152 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
153 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
154 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
155 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
156 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
157 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
158 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
159 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
160 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
161 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
162 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
163 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
164 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
165 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
166 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
167 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
168 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
169 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
170 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
171 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
172 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
173 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
174 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
175 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
176 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
177 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
178 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
179 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
180 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
181 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
182 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
183 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
184 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
185 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
186 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
187 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
188 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
189 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
190 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
191 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
192 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
193 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
194 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
220 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
223 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
224 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
225 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
226 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
227 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
228 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
229 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
230 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
231 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
232 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
233 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
234 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
235 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
236 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
237 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
238 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
239 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
240 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
241 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
242 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
243 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
244 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
245 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
246 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
247 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
248 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
249 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
250 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
251 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
252 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
253 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
254 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
255 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
256 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
257 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
258 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
259 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
260 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
261 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
262 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
263 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
264 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
265 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
266 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
267 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
268 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
269 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
270 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
271 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
272 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
273 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
274 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
275 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
276 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
277 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
278 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
279 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
280 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
281 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
282 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
283 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
284 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
285 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
286 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
287 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
288 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
289 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
290 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
291 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
292 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
293 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
294 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
295 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
296 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
297 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
298 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
299 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
300 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
301 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
302 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
303 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
304 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
305 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
306 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
307 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
308 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
309 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
310 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
311 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
312 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
313 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
314 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
315 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
316 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
317 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
318 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
319 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
320 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
321 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
322 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
323 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
324 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
325 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
326 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
327 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
328 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
329 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
330 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
331 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
332 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
333 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
334 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
335 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
336 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
337 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
338 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
339 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
340 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
341 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
342 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
343 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
344 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
345 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
346 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
347 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
348 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
349 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
350 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
351 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
352 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
353 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
354 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
355 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
356 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
357 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
358 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
359 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
360 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
361 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
362 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
363 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
364 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
365 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
366 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
367 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
368 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
369 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
370 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
371 8003151029 Chitinophaga sp. GbtcB8 Isolate Unclassified
372 8055419101 Flavobacterium tyrosinilyticum KCTC 42726 Isolate Rhizosphere
373 8055588893 Parapedobacter lycopersici KACC 18788 Isolate Rhizosphere
374 8055592153 Flavobacterium panacis DCY106 Isolate Rhizosphere
375 8056440228 Flavobacterium hibisci THG-HG1.4 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 91.85
Metatranscriptomes 0
Isolates 8.15

Biome Distribution

Category Percentage (%)
Aerial Root 0.22
Bulb 0
Endosphere 10.38
Nodule 0.11
Rhizoplane 0.33
Rhizosphere 77.79
Stem 0
Stem Tuber 0
Unclassified 11.16

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_1524932 2162886007 Bacteria 15202
2 JGI24736J21556_1000844 3300001904 Bacteria 5654
3 JGI24740J21852_10000688 3300001979 Bacteria 14666
4 JGI24740J21852_10002889 3300001979 Bacteria 7682
5 JGI24740J21852_10006644 3300001979 Bacteria 4767
6 JGI24739J22299_10001392 3300001989 Bacteria 9093
7 JGI24739J22299_10053156 3300001989 Bacteria 1301
8 JGI24737J22298_10016126 3300001990 Bacteria 2413
9 JGI24735J21928_10043102 3300002067 Bacteria 1313
10 JGI25162J39368_1001124 3300002737 Bacteria 16113
11 JGI25162J39368_1001640 3300002737 Bacteria 11150
12 JGI25154J39366_1000003 3300002738 Bacteria 397627
13 JGI25154J39366_1000014 3300002738 Bacteria 265287
14 JGI25157J39369_1002583 3300002741 Bacteria 4322
15 JGI25164J39214_1001008 3300002772 Bacteria 8770
16 JGI25151J46595_10010532 3300003187 Bacteria 4289
17 JGI25165J46597_1000923 3300003214 Bacteria 20349
18 JGI25153J46596_10000539 3300003215 Bacteria 23685
19 JGI25153J46596_10002851 3300003215 Bacteria 9818
20 JGI25153J46596_10037146 3300003215 Bacteria 1552
21 rootH1_10018273 3300003316 Bacteria 26474
22 rootH1_10033731 3300003316 Bacteria 6741
23 rootH1_10101991 3300003316 Bacteria 3825
24 rootH2_10013030 3300003320 Bacteria 7264
25 rootH2_10036622 3300003320 Bacteria 17189
26 rootH2_10160054 3300003320 Bacteria 1458
27 rootL2_10004925 3300003322 Bacteria 14721
28 rootL2_10005069 3300003322 Bacteria 20828
29 rootL2_10022797 3300003322 Bacteria 7476
30 rootL2_10043862 3300003322 Bacteria 1900
31 rootL2_10131047 3300003322 Bacteria 4144
32 rootL2_10163672 3300003322 Bacteria 2548
33 rootL2_10173005 3300003322 Bacteria 3386
34 rootL2_10366376 3300003322 Bacteria 1400
35 rootH1_10003366 3300003316 Bacteria 5707
36 rootH1_10003366 3300003323 Bacteria 132108
37 rootH1_10004759 3300003323 Bacteria 40082
38 rootH1_10010201 3300003323 Bacteria 42291
39 rootH1_10010647 3300003323 Bacteria 12387
40 rootH1_10026775 3300003323 Bacteria 37408
41 rootH1_10027324 3300003323 Bacteria 28607
42 rootH1_10032632 3300003323 Bacteria 15899
43 rootH1_10072115 3300003323 Bacteria 3183
44 rootH1_10130033 3300003323 Bacteria 6041
45 rootH1_10131898 3300003323 Bacteria 4675
46 rootH1_10148682 3300003323 Bacteria 2949
47 rootH1_10190090 3300003323 Bacteria 2644
48 rootH1_10283993 3300003323 Bacteria 2232
49 rootH1_10330688 3300003323 Bacteria 4384
50 JGI25160J50197_1000175 3300003354 Bacteria 54393
51 JGI25160J50197_1002813 3300003354 Bacteria 7967
52 JGI25160J50197_1004550 3300003354 Bacteria 5976
53 JGI25160J50197_1008609 3300003354 Bacteria 3875
54 JGI25160J50197_1017025 3300003354 Bacteria 2319
55 JGI25160J50197_1032984 3300003354 Bacteria 1308
56 Ga0055526_1000270 3300003771 Bacteria 43854
57 Ga0055536_1000002 3300003781 Bacteria 605605
58 Ga0055528_1000108 3300003790 Bacteria 66828
59 Ga0055528_1001425 3300003790 Bacteria 14634
60 Ga0055530_10000183 3300003791 Bacteria 56206
61 Ga0055530_10000279 3300003791 Bacteria 46371
62 Ga0055531_10000093 3300003794 Bacteria 97901
63 Ga0055543_1011139 3300004625 Bacteria 1855
64 Ga0065165_1000036 3300005262 Bacteria 212900
65 Ga0065165_1000548 3300005262 Bacteria 56570
66 Ga0065165_1000814 3300005262 Bacteria 41379
67 Ga0065165_1007727 3300005262 Bacteria 5205
68 Ga0065714_10003215 3300005288 Bacteria 9296
69 Ga0065714_10004671 3300005288 Bacteria 7854
70 Ga0065714_10009252 3300005288 Bacteria 2961
71 Ga0065714_10014084 3300005288 Bacteria 3638
72 Ga0065714_10015372 3300005288 Bacteria 2871
73 Ga0065714_10064770 3300005288 Bacteria 19370
74 Ga0065714_10066377 3300005288 Bacteria 6973
75 Ga0065714_10073910 3300005288 Bacteria 3114
76 Ga0065704_10070374 3300005289 Bacteria 28734
77 Ga0065704_10084803 3300005289 Bacteria 3294
78 Ga0065704_10085422 3300005289 Bacteria 3224
79 Ga0065704_10087748 3300005289 Bacteria 2987
80 Ga0065704_10112032 3300005289 Unclassified 1943
81 Ga0065712_10176867 3300005290 Bacteria 1213
82 Ga0065715_10210627 3300005293 Unclassified 1316
83 Ga0065715_10241072 3300005293 Bacteria 1190
84 Ga0065715_10249931 3300005293 Bacteria 1170
85 Ga0070658_10011667 3300005327 Bacteria 7047
86 Ga0070658_10103291 3300005327 Bacteria 2357
87 Ga0070658_10358558 3300005327 Bacteria 1248
88 Ga0070676_10000001 3300005328 Bacteria 443830
89 Ga0070676_10016784 3300005328 Bacteria 4047
90 Ga0070683_100108393 3300005329 Bacteria 2619
91 Ga0070683_100138836 3300005329 Bacteria 2302
92 Ga0070683_100533197 3300005329 Bacteria 1122
93 Ga0070690_100062732 3300005330 Unclassified 2397
94 Ga0070670_100141298 3300005331 Bacteria 2082
95 Ga0070670_100286533 3300005331 Bacteria 1439
96 Ga0070670_100294650 3300005331 Bacteria 1418
97 Ga0070670_100363226 3300005331 Bacteria 1273
98 Ga0068869_100010053 3300005334 Bacteria 6154
99 Ga0068869_100013167 3300005334 Bacteria 5493
100 Ga0068869_100017619 3300005334 Bacteria 4846
101 Ga0068869_100045584 3300005334 Bacteria 3158
102 Ga0070666_10000197 3300005335 Bacteria 41178
103 Ga0070666_10002958 3300005335 Bacteria 10296
104 Ga0070666_10037488 3300005335 Bacteria 3223
105 Ga0070666_10046753 3300005335 Bacteria 2904
106 Ga0070666_10124625 3300005335 Unclassified 1788
107 Ga0068868_100000524 3300005338 Bacteria 25677
108 Ga0068868_100001711 3300005338 Bacteria 15014
109 Ga0068868_100115321 3300005338 Bacteria 2187
110 Ga0070660_100184903 3300005339 Bacteria 1687
111 Ga0070689_100004044 3300005340 Bacteria 9868
112 Ga0070687_100249012 3300005343 Bacteria 1103
113 Ga0070661_100013628 3300005344 Bacteria 5709
114 Ga0070661_100014545 3300005344 Bacteria 5545
115 Ga0070668_100112142 3300005347 Bacteria 2171
116 Ga0070668_100210207 3300005347 Unclassified 1600
117 Ga0070669_100022298 3300005353 Bacteria 4529
118 Ga0070669_100036725 3300005353 Bacteria 3552
119 Ga0070675_100052282 3300005354 Unclassified 3359
120 Ga0070675_100363984 3300005354 Bacteria 1285
121 Ga0070675_100555099 3300005354 Bacteria 1039
122 Ga0070671_100011735 3300005355 Bacteria 7047
123 Ga0070671_100141923 3300005355 Bacteria 2027
124 Ga0070671_100159186 3300005355 Bacteria 1909
125 Ga0070671_100219389 3300005355 Bacteria 1613
126 Ga0070674_100006908 3300005356 Bacteria 6653
127 Ga0070674_100057547 3300005356 Bacteria 2699
128 Ga0070674_100092842 3300005356 Bacteria 2183
129 Ga0070673_100030057 3300005364 Bacteria 4060
130 Ga0070673_100030968 3300005364 Bacteria 4010
131 Ga0070659_100000440 3300005366 Bacteria 31084
132 Ga0070659_100005539 3300005366 Bacteria 9073
133 Ga0070667_100003595 3300005367 Bacteria 13187
134 Ga0070667_100039396 3300005367 Bacteria 3961
135 Ga0070667_100101765 3300005367 Bacteria 2482
136 Ga0070667_100145408 3300005367 Bacteria 2079
137 Ga0070667_100196622 3300005367 Unclassified 1788
138 Ga0070667_100286201 3300005367 Bacteria 1481
139 Ga0070678_100013590 3300005456 Bacteria 5112
140 Ga0070678_100064289 3300005456 Bacteria 2719
141 Ga0070662_100002459 3300005457 Bacteria 11410
142 Ga0070662_100003891 3300005457 Bacteria 9359
143 Ga0070662_100377552 3300005457 Bacteria 1166
144 Ga0070681_10040017 3300005458 Bacteria 4700
145 Ga0068867_100007300 3300005459 Bacteria 7821
146 Ga0068867_100011441 3300005459 Bacteria 6260
147 Ga0068867_100094625 3300005459 Bacteria 2272
148 Ga0068867_100098880 3300005459 Bacteria 2225
149 Ga0070685_10018108 3300005466 Bacteria 3784
150 Ga0070685_10149589 3300005466 Bacteria 1478
151 Ga0070707_100051113 3300005468 Bacteria 3962
152 Ga0070698_100002653 3300005471 Bacteria 19726
153 Ga0070698_100005248 3300005471 Bacteria 14175
154 Ga0070699_100015745 3300005518 Bacteria 6492
155 Ga0070699_100221712 3300005518 Bacteria 1685
156 Ga0070679_100193804 3300005530 Bacteria 2000
157 Ga0070684_100000251 3300005535 Bacteria 37139
158 Ga0070684_100118192 3300005535 Bacteria 2382
159 Ga0068853_100001703 3300005539 Bacteria 16107
160 Ga0068853_100043110 3300005539 Bacteria 3861
161 Ga0068853_100094957 3300005539 Bacteria 2628
162 Ga0068853_100095956 3300005539 Unclassified 2616
163 Ga0068853_100166038 3300005539 Bacteria 1995
164 Ga0068853_100181628 3300005539 Bacteria 1908
165 Ga0070672_100008545 3300005543 Bacteria 7013
166 Ga0070672_100041655 3300005543 Bacteria 3532
167 Ga0070672_100193011 3300005543 Bacteria 1701
168 Ga0070672_100414180 3300005543 Bacteria 1157
169 Ga0070686_100270305 3300005544 Unclassified 1249
170 Ga0070665_100000014 3300005548 Bacteria 484881
171 Ga0070665_100010440 3300005548 Bacteria 9397
172 Ga0070665_100164206 3300005548 Bacteria 2223
173 Ga0068855_100000284 3300005563 Bacteria 62592
174 Ga0068855_100030687 3300005563 Bacteria 6426
175 Ga0068855_100042683 3300005563 Bacteria 5373
176 Ga0068855_100158197 3300005563 Bacteria 2573
177 Ga0068855_100163867 3300005563 Bacteria 2521
178 Ga0068855_100425518 3300005563 Bacteria 1452
179 Ga0070664_100006889 3300005564 Bacteria 9161
180 Ga0070664_100045872 3300005564 Bacteria 3691
181 Ga0070664_100117140 3300005564 Bacteria 2330
182 Ga0070664_100345430 3300005564 Unclassified 1352
183 Ga0068857_100028762 3300005577 Bacteria 4904
184 Ga0068857_100172459 3300005577 Bacteria 1966
185 Ga0068857_100621535 3300005577 Bacteria 1022
186 Ga0068854_100044728 3300005578 Bacteria 3145
187 Ga0068854_100060109 3300005578 Bacteria 2748
188 Ga0068854_100080831 3300005578 Bacteria 2399
189 Ga0068854_100086491 3300005578 Bacteria 2324
190 Ga0068854_100098459 3300005578 Bacteria 2188
191 Ga0068856_100000073 3300005614 Bacteria 95021
192 Ga0068856_100127236 3300005614 Bacteria 2551
193 Ga0068852_100019630 3300005616 Bacteria 5355
194 Ga0068852_100069555 3300005616 Bacteria 3086
195 Ga0068852_100103259 3300005616 Bacteria 2578
196 Ga0068852_100212367 3300005616 Bacteria 1836
197 Ga0068852_100216964 3300005616 Bacteria 1818
198 Ga0068852_100235703 3300005616 Bacteria 1747
199 Ga0068852_100247371 3300005616 Bacteria 1707
200 Ga0068859_100000007 3300005617 Bacteria 390070
201 Ga0068859_100007469 3300005617 Bacteria 11096
202 Ga0068859_100015705 3300005617 Bacteria 7609
203 Ga0068859_100269463 3300005617 Unclassified 1795
204 Ga0068859_100409536 3300005617 Bacteria 1452
205 Ga0068864_100009122 3300005618 Bacteria 8177
206 Ga0068864_100099104 3300005618 Bacteria 2581
207 Ga0068864_100164856 3300005618 Bacteria 2017
208 Ga0068866_10006035 3300005718 Bacteria 5041
209 Ga0068866_10025612 3300005718 Bacteria 2775
210 Ga0068861_100131124 3300005719 Unclassified 2035
211 Ga0068851_10009475 3300005834 Bacteria 4530
212 Ga0068851_10015736 3300005834 Bacteria 3609
213 Ga0068851_10040661 3300005834 Bacteria 2337
214 Ga0068863_100000444 3300005841 Bacteria 41977
215 Ga0068863_100000449 3300005841 Bacteria 41845
216 Ga0068863_100673028 3300005841 Unclassified 1027
217 Ga0068863_100702730 3300005841 Bacteria 1005
218 Ga0068858_100002218 3300005842 Bacteria 19660
219 Ga0068858_100048943 3300005842 Bacteria 3915
220 Ga0068858_100301170 3300005842 Bacteria 1530
221 Ga0068860_100000061 3300005843 Bacteria 192548
222 Ga0068860_100000661 3300005843 Bacteria 40073
223 Ga0068860_100005896 3300005843 Bacteria 12335
224 Ga0068860_100006071 3300005843 Bacteria 12160
225 Ga0068860_100031110 3300005843 Bacteria 5132
226 Ga0068860_100032987 3300005843 Bacteria 4972
227 Ga0068862_100187784 3300005844 Bacteria 1858
228 Ga0070712_100022318 3300006175 Bacteria 4169
229 Ga0075366_10000031 3300006195 Bacteria 49332
230 Ga0075366_10043061 3300006195 Bacteria 2674
231 Ga0075366_10163062 3300006195 Bacteria 1351
232 Ga0097621_100007495 3300006237 Bacteria 7812
233 Ga0097621_100025268 3300006237 Bacteria 4645
234 Ga0097621_100042264 3300006237 Bacteria 3671
235 Ga0075370_10101921 3300006353 Bacteria 1662
236 Ga0068871_100004610 3300006358 Bacteria 9622
237 Ga0068871_100004870 3300006358 Bacteria 9380
238 Ga0068871_100573780 3300006358 Bacteria 1024
239 Ga0075428_100010603 3300006844 Bacteria 10243
240 Ga0075428_100062501 3300006844 Bacteria 4076
241 Ga0075428_100119796 3300006844 Bacteria 2865
242 Ga0075428_100227894 3300006844 Bacteria 2011
243 Ga0075430_100016236 3300006846 Bacteria 6341
244 Ga0075431_100086675 3300006847 Bacteria 3231
245 Ga0075429_100105852 3300006880 Bacteria 2457
246 Ga0068865_100004575 3300006881 Bacteria 8348
247 Ga0068865_100053588 3300006881 Bacteria 2799
248 Ga0097620_100000007 3300006931 Bacteria 390070
249 Ga0097620_100007469 3300006931 Bacteria 11096
250 Ga0097620_100015704 3300006931 Bacteria 7609
251 Ga0097620_100269447 3300006931 Unclassified 1795
252 Ga0097620_100409528 3300006931 Bacteria 1452
253 Ga0105244_10047623 3300009036 Bacteria 2198
254 Ga0105240_10000198 3300009093 Bacteria 122388
255 Ga0105240_10026991 3300009093 Bacteria 7527
256 Ga0105240_10034852 3300009093 Bacteria 6489
257 Ga0105240_10048638 3300009093 Bacteria 5358
258 Ga0105240_10057327 3300009093 Bacteria 4867
259 Ga0105240_10065857 3300009093 Bacteria 4497
260 Ga0105240_10074083 3300009093 Bacteria 4203
261 Ga0105240_10091437 3300009093 Bacteria 3718
262 Ga0105240_10164711 3300009093 Bacteria 2630
263 Ga0111539_10198008 3300009094 Bacteria 2343
264 Ga0105245_10174559 3300009098 Bacteria 2049
265 Ga0114129_10031992 3300009147 Bacteria 7436
266 Ga0114129_10091477 3300009147 Bacteria 4215
267 Ga0114129_10247912 3300009147 Bacteria 2392
268 Ga0105241_10000137 3300009174 Bacteria 52153
269 Ga0105241_10000424 3300009174 Bacteria 31880
270 Ga0105241_10005687 3300009174 Bacteria 9202
271 Ga0105241_10019080 3300009174 Bacteria 5057
272 Ga0105241_10038039 3300009174 Bacteria 3628
273 Ga0105241_10066029 3300009174 Bacteria 2797
274 Ga0105242_10023601 3300009176 Bacteria 4848
275 Ga0105242_10070686 3300009176 Bacteria 2894
276 Ga0105242_10088094 3300009176 Bacteria 2607
277 Ga0105242_10184388 3300009176 Bacteria 1843
278 Ga0105237_10000409 3300009545 Bacteria 61096
279 Ga0105237_10000577 3300009545 Bacteria 51264
280 Ga0105237_10001142 3300009545 Bacteria 35679
281 Ga0105237_10001258 3300009545 Bacteria 33852
282 Ga0105237_10001360 3300009545 Bacteria 32389
283 Ga0105237_10001948 3300009545 Bacteria 26296
284 Ga0105237_10005617 3300009545 Bacteria 14137
285 Ga0105237_10273360 3300009545 Bacteria 1692
286 Ga0105237_10392588 3300009545 Bacteria 1392
287 Ga0105237_10418610 3300009545 Bacteria 1345
288 Ga0105238_10007301 3300009551 Bacteria 11064
289 Ga0105238_10062384 3300009551 Bacteria 3728
290 Ga0105249_10001357 3300009553 Bacteria 21397
291 Ga0105249_10030230 3300009553 Bacteria 4896
292 Ga0105249_10055907 3300009553 Bacteria 3613
293 Ga0105249_10176773 3300009553 Bacteria 2074
294 Ga0105249_10542628 3300009553 Bacteria 1213
295 Ga0105249_10593071 3300009553 Bacteria 1162
296 Ga0105249_10674694 3300009553 Bacteria 1092
297 Ga0105239_10000659 3300010375 Bacteria 49123
298 Ga0105239_10005875 3300010375 Bacteria 14303
299 Ga0105239_10012560 3300010375 Bacteria 9428
300 Ga0105239_10014750 3300010375 Bacteria 8665
301 Ga0105239_10041485 3300010375 Bacteria 5043
302 Ga0105239_10042514 3300010375 Bacteria 4980
303 Ga0105239_10070201 3300010375 Bacteria 3848
304 Ga0105239_10194055 3300010375 Bacteria 2274
305 Ga0105239_10216683 3300010375 Bacteria 2146
306 Ga0105239_10600789 3300010375 Bacteria 1255
307 Ga0105239_10654484 3300010375 Bacteria 1200
308 Ga0105246_10001938 3300011119 Bacteria 12496
309 Ga0105246_10067458 3300011119 Bacteria 2507
310 Ga0157373_10000453 3300013100 Bacteria 32441
311 Ga0157373_10000936 3300013100 Bacteria 22553
312 Ga0157373_10008808 3300013100 Bacteria 7476
313 Ga0157373_10010688 3300013100 Bacteria 6751
314 Ga0157373_10138419 3300013100 Bacteria 1712
315 Ga0157371_10000069 3300013102 Bacteria 165391
316 Ga0157371_10000713 3300013102 Bacteria 38893
317 Ga0157371_10003525 3300013102 Bacteria 14120
318 Ga0157371_10004170 3300013102 Bacteria 12736
319 Ga0157371_10013014 3300013102 Bacteria 6334
320 Ga0157371_10048536 3300013102 Bacteria 3017
321 Ga0157371_10058305 3300013102 Bacteria 2739
322 Ga0157371_10065708 3300013102 Bacteria 2569
323 Ga0157371_10093180 3300013102 Bacteria 2134
324 Ga0157371_10093567 3300013102 Bacteria 2130
325 Ga0157370_10001009 3300013104 Bacteria 35544
326 Ga0157370_10001014 3300013104 Bacteria 35409
327 Ga0157370_10003406 3300013104 Bacteria 18685
328 Ga0157370_10007076 3300013104 Bacteria 12255
329 Ga0157370_10010926 3300013104 Bacteria 9533
330 Ga0157370_10015818 3300013104 Bacteria 7656
331 Ga0157370_10019134 3300013104 Bacteria 6884
332 Ga0157370_10021662 3300013104 Bacteria 6403
333 Ga0157370_10035236 3300013104 Bacteria 4867
334 Ga0157370_10047458 3300013104 Bacteria 4117
335 Ga0157370_10059379 3300013104 Unclassified 3634
336 Ga0157370_10086005 3300013104 Bacteria 2954
337 Ga0157370_10097750 3300013104 Bacteria 2754
338 Ga0157370_10512195 3300013104 Bacteria 1102
339 Ga0157369_10000038 3300013105 Bacteria 189078
340 Ga0157369_10000952 3300013105 Bacteria 36747
341 Ga0157369_10003837 3300013105 Bacteria 17855
342 Ga0157369_10044786 3300013105 Bacteria 4815
343 Ga0157369_10229265 3300013105 Bacteria 1942
344 Ga0157374_10000011 3300013296 Bacteria 466749
345 Ga0157374_10008935 3300013296 Bacteria 8585
346 Ga0157374_10010333 3300013296 Bacteria 8028
347 Ga0157374_10124929 3300013296 Bacteria 2486
348 Ga0157374_10306121 3300013296 Bacteria 1573
349 Ga0157374_10420939 3300013296 Bacteria 1334
350 Ga0157378_10014702 3300013297 Bacteria 6856
351 Ga0157378_10021640 3300013297 Bacteria 5655
352 Ga0157378_10021840 3300013297 Bacteria 5627
353 Ga0157378_10131393 3300013297 Bacteria 2318
354 Ga0157378_10161016 3300013297 Bacteria 2099
355 Ga0157378_10251138 3300013297 Unclassified 1693
356 Ga0157378_10251840 3300013297 Bacteria 1691
357 Ga0157378_10331291 3300013297 Bacteria 1482
358 Ga0157378_10454093 3300013297 Bacteria 1272
359 Ga0163162_10000123 3300013306 Bacteria 68905
360 Ga0163162_10000151 3300013306 Bacteria 64454
361 Ga0163162_10000406 3300013306 Bacteria 39456
362 Ga0163162_10000827 3300013306 Bacteria 28791
363 Ga0163162_10001117 3300013306 Bacteria 24935
364 Ga0163162_10037543 3300013306 Bacteria 4834
365 Ga0163162_10098254 3300013306 Bacteria 3017
366 Ga0163162_10180651 3300013306 Bacteria 2236
367 Ga0157372_10000077 3300013307 Bacteria 102192
368 Ga0157372_10000254 3300013307 Bacteria 59194
369 Ga0157372_10020545 3300013307 Bacteria 7125
370 Ga0157372_10045539 3300013307 Bacteria 4867
371 Ga0157372_10048850 3300013307 Bacteria 4703
372 Ga0157372_10098575 3300013307 Bacteria 3334
373 Ga0157372_10155377 3300013307 Bacteria 2642
374 Ga0157372_10534867 3300013307 Bacteria 1366
375 Ga0157372_10697923 3300013307 Bacteria 1181
376 Ga0157372_10845670 3300013307 Bacteria 1062
377 Ga0157375_10034578 3300013308 Bacteria 4816
378 Ga0157375_10044269 3300013308 Bacteria 4323
379 Ga0157375_10055835 3300013308 Bacteria 3896
380 Ga0157375_10088940 3300013308 Bacteria 3144
381 Ga0157375_10091846 3300013308 Bacteria 3098
382 Ga0157375_10097917 3300013308 Bacteria 3009
383 Ga0157375_10134685 3300013308 Bacteria 2593
384 Ga0157375_10154784 3300013308 Bacteria 2431
385 Ga0157375_10170061 3300013308 Bacteria 2326
386 Ga0157375_10364637 3300013308 Bacteria 1611
387 Ga0163163_10038961 3300014325 Bacteria 4636
388 Ga0163163_10085648 3300014325 Bacteria 3159
389 Ga0163163_10091197 3300014325 Bacteria 3061
390 Ga0163163_10147104 3300014325 Bacteria 2400
391 Ga0163163_10233997 3300014325 Bacteria 1887
392 Ga0163163_10249412 3300014325 Bacteria 1826
393 Ga0157380_10000019 3300014326 Bacteria 116129
394 Ga0157380_10010574 3300014326 Bacteria 6637
395 Ga0157380_10104162 3300014326 Bacteria 2369
396 Ga0157380_10208766 3300014326 Bacteria 1739
397 Ga0157380_10625877 3300014326 Bacteria 1069
398 Ga0182008_10000025 3300014497 Bacteria 191222
399 Ga0182008_10000058 3300014497 Bacteria 100175
400 Ga0182008_10000461 3300014497 Bacteria 31061
401 Ga0182008_10063153 3300014497 Bacteria 1824
402 Ga0157377_10002753 3300014745 Bacteria 7827
403 Ga0157377_10002912 3300014745 Bacteria 7652
404 Ga0157376_10005885 3300014969 Bacteria 8605
405 Ga0157376_10015107 3300014969 Bacteria 5820
406 Ga0157376_10184522 3300014969 Bacteria 1909
407 Ga0182006_1000357 3300015261 Bacteria 38142
408 Ga0182006_1000645 3300015261 Bacteria 24732
409 Ga0182006_1000894 3300015261 Bacteria 19999
410 Ga0182006_1001592 3300015261 Bacteria 13422
411 Ga0182006_1002797 3300015261 Bacteria 9312
412 Ga0182006_1064751 3300015261 Bacteria 1370
413 Ga0182007_10000024 3300015262 Bacteria 181761
414 Ga0182005_1000039 3300015265 Bacteria 155210
415 Ga0163161_10000628 3300017792 Bacteria 28142
416 Ga0163161_10000979 3300017792 Bacteria 21853
417 Ga0163161_10002479 3300017792 Bacteria 13157
418 Ga0163161_10051791 3300017792 Bacteria 2975
419 Ga0163161_10108942 3300017792 Bacteria 2068
420 Ga0163161_10305670 3300017792 Bacteria 1254
421 Ga0163161_10314873 3300017792 Bacteria 1236
422 Ga0213876_10003317 3300021384 Bacteria 9232
423 Ga0209436_100536 3300025208 Bacteria 16457
424 Ga0209674_100329 3300025226 Bacteria 29551
425 Ga0207427_100236 3300025231 Bacteria 45297
426 Ga0209437_100034 3300025233 Bacteria 494007
427 Ga0209437_100719 3300025233 Bacteria 16878
428 Ga0209646_1000002 3300025246 Bacteria 1425781
429 Ga0209646_1000004 3300025246 Bacteria 786587
430 Ga0209026_1000132 3300025250 Bacteria 119048
431 Ga0209026_1000178 3300025250 Bacteria 96368
432 Ga0209026_1000239 3300025250 Bacteria 71740
433 Ga0209026_1002731 3300025250 Bacteria 6332
434 Ga0209233_1000038 3300025261 Bacteria 548972
435 Ga0209233_1001884 3300025261 Bacteria 8048
436 Ga0209673_1000183 3300025273 Bacteria 126175
437 Ga0209673_1000483 3300025273 Bacteria 66457
438 Ga0209130_1004353 3300025284 Bacteria 5425
439 Ga0209676_1000022 3300025292 Bacteria 605659
440 Ga0209676_1002361 3300025292 Bacteria 13605
441 Ga0209564_1000561 3300025295 Bacteria 59357
442 Ga0209758_1000912 3300025297 Bacteria 40017
443 Ga0209758_1001298 3300025297 Bacteria 30631
444 Ga0209758_1001642 3300025297 Bacteria 25398
445 Ga0209758_1006687 3300025297 Bacteria 8139
446 Ga0209050_1000020 3300025298 Bacteria 605671
447 Ga0209050_1000160 3300025298 Bacteria 157000
448 Ga0209050_1000305 3300025298 Bacteria 100790
449 Ga0209050_1024244 3300025298 Bacteria 2106
450 Ga0207426_1000051 3300025302 Bacteria 391700
451 Ga0207426_1000104 3300025302 Bacteria 249464
452 Ga0207426_1000360 3300025302 Bacteria 82007
453 Ga0207426_1000681 3300025302 Bacteria 41125
454 Ga0207426_1001364 3300025302 Bacteria 20704
455 Ga0207426_1001887 3300025302 Bacteria 15299
456 Ga0207426_1006794 3300025302 Bacteria 4896
457 Ga0209051_1012068 3300025303 Bacteria 4207
458 Ga0209051_1045884 3300025303 Bacteria 1508
459 Ga0209257_1000001 3300025304 Bacteria 2274655
460 Ga0209257_1001540 3300025304 Bacteria 26823
461 Ga0209257_1004420 3300025304 Bacteria 10909
462 Ga0207656_10028953 3300025321 Bacteria 2278
463 Ga0207656_10171817 3300025321 Bacteria 1036
464 Ga0207688_10029574 3300025901 Bacteria 3017
465 Ga0207680_10000177 3300025903 Bacteria 30942
466 Ga0207680_10013867 3300025903 Bacteria 4152
467 Ga0207680_10066601 3300025903 Unclassified 2216
468 Ga0207680_10308040 3300025903 Bacteria 1105
469 Ga0207647_10000299 3300025904 Bacteria 40747
470 Ga0207647_10021677 3300025904 Bacteria 4284
471 Ga0207645_10000001 3300025907 Bacteria 442754
472 Ga0207645_10000284 3300025907 Bacteria 42247
473 Ga0207645_10021073 3300025907 Bacteria 4255
474 Ga0207645_10043803 3300025907 Bacteria 2864
475 Ga0207643_10118054 3300025908 Bacteria 1569
476 Ga0207705_10158636 3300025909 Bacteria 1698
477 Ga0207654_10005471 3300025911 Bacteria 6422
478 Ga0207654_10007056 3300025911 Bacteria 5659
479 Ga0207654_10275318 3300025911 Bacteria 1137
480 Ga0207707_10200176 3300025912 Bacteria 1741
481 Ga0207707_10425829 3300025912 Bacteria 1137
482 Ga0207695_10000212 3300025913 Bacteria 156450
483 Ga0207695_10000276 3300025913 Bacteria 128924
484 Ga0207695_10000313 3300025913 Bacteria 117072
485 Ga0207695_10000346 3300025913 Bacteria 107028
486 Ga0207695_10019413 3300025913 Bacteria 7830
487 Ga0207695_10020573 3300025913 Bacteria 7554
488 Ga0207695_10036487 3300025913 Bacteria 5314
489 Ga0207695_10166215 3300025913 Bacteria 2134
490 Ga0207671_10000402 3300025914 Bacteria 60371
491 Ga0207671_10000987 3300025914 Bacteria 35078
492 Ga0207671_10001317 3300025914 Bacteria 29052
493 Ga0207671_10001776 3300025914 Bacteria 24234
494 Ga0207671_10002368 3300025914 Bacteria 20262
495 Ga0207671_10002977 3300025914 Bacteria 17383
496 Ga0207671_10004116 3300025914 Bacteria 14061
497 Ga0207671_10004651 3300025914 Bacteria 12997
498 Ga0207671_10254657 3300025914 Bacteria 1380
499 Ga0207662_10030020 3300025918 Bacteria 3152
500 Ga0207657_10047967 3300025919 Bacteria 3730
501 Ga0207649_10002116 3300025920 Bacteria 11250
502 Ga0207652_10028756 3300025921 Bacteria 4640
503 Ga0207652_10181113 3300025921 Bacteria 1894
504 Ga0207681_10036284 3300025923 Unclassified 3252
505 Ga0207681_10054871 3300025923 Bacteria 2711
506 Ga0207694_10006626 3300025924 Bacteria 8801
507 Ga0207694_10070024 3300025924 Bacteria 2740
508 Ga0207650_10004145 3300025925 Bacteria 9909
509 Ga0207650_10043496 3300025925 Bacteria 3297
510 Ga0207650_10117432 3300025925 Bacteria 2067
511 Ga0207650_10268998 3300025925 Bacteria 1385
512 Ga0207659_10037293 3300025926 Bacteria 3374
513 Ga0207659_10089587 3300025926 Bacteria 2294
514 Ga0207659_10460210 3300025926 Unclassified 1072
515 Ga0207690_10000235 3300025932 Bacteria 40691
516 Ga0207690_10003716 3300025932 Bacteria 9073
517 Ga0207706_10002489 3300025933 Bacteria 17951
518 Ga0207706_10007739 3300025933 Bacteria 9918
519 Ga0207686_10083451 3300025934 Bacteria 2091
520 Ga0207686_10153070 3300025934 Unclassified 1608
521 Ga0207670_10003877 3300025936 Bacteria 7974
522 Ga0207704_10025050 3300025938 Bacteria 3249
523 Ga0207704_10157061 3300025938 Bacteria 1613
524 Ga0207691_10278685 3300025940 Bacteria 1439
525 Ga0207689_10003255 3300025942 Bacteria 14889
526 Ga0207689_10004450 3300025942 Bacteria 12706
527 Ga0207689_10007607 3300025942 Bacteria 9491
528 Ga0207689_10016468 3300025942 Bacteria 6257
529 Ga0207689_10025014 3300025942 Bacteria 5005
530 Ga0207689_10098104 3300025942 Unclassified 2407
531 Ga0207661_10294898 3300025944 Bacteria 1452
532 Ga0207679_10000915 3300025945 Bacteria 18846
533 Ga0207679_10060688 3300025945 Bacteria 2811
534 Ga0207679_10128109 3300025945 Bacteria 2032
535 Ga0207679_10494408 3300025945 Unclassified 1091
536 Ga0207667_10000414 3300025949 Bacteria 57815
537 Ga0207667_10006159 3300025949 Bacteria 14576
538 Ga0207667_10036938 3300025949 Bacteria 5229
539 Ga0207667_10045845 3300025949 Bacteria 4629
540 Ga0207667_10168412 3300025949 Bacteria 2252
541 Ga0207667_10184386 3300025949 Bacteria 2143
542 Ga0207651_10007927 3300025960 Bacteria 5692
543 Ga0207651_10053860 3300025960 Bacteria 2753
544 Ga0207651_10200619 3300025960 Bacteria 1598
545 Ga0207651_10255186 3300025960 Bacteria 1437
546 Ga0207712_10003067 3300025961 Bacteria 10662
547 Ga0207712_10064573 3300025961 Bacteria 2610
548 Ga0207712_10071008 3300025961 Bacteria 2503
549 Ga0207712_10088045 3300025961 Bacteria 2279
550 Ga0207712_10309455 3300025961 Bacteria 1299
551 Ga0207668_10238644 3300025972 Bacteria 1469
552 Ga0207640_10029277 3300025981 Bacteria 3379
553 Ga0207640_10066244 3300025981 Bacteria 2413
554 Ga0207640_10079304 3300025981 Bacteria 2238
555 Ga0207658_10013982 3300025986 Bacteria 5494
556 Ga0207658_10041566 3300025986 Bacteria 3330
557 Ga0207658_10080217 3300025986 Bacteria 2499
558 Ga0207658_10251450 3300025986 Bacteria 1502
559 Ga0207677_10014564 3300026023 Bacteria 4598
560 Ga0207677_10042043 3300026023 Unclassified 3027
561 Ga0207677_10058309 3300026023 Bacteria 2657
562 Ga0207677_10152591 3300026023 Bacteria 1784
563 Ga0207703_10009385 3300026035 Bacteria 7690
564 Ga0207703_10015384 3300026035 Bacteria 5968
565 Ga0207703_10282803 3300026035 Bacteria 1507
566 Ga0207639_10021989 3300026041 Bacteria 4588
567 Ga0207639_10135971 3300026041 Bacteria 2041
568 Ga0207639_10157414 3300026041 Bacteria 1910
569 Ga0207639_10180301 3300026041 Bacteria 1796
570 Ga0207639_10196289 3300026041 Unclassified 1728
571 Ga0207708_10072648 3300026075 Bacteria 2636
572 Ga0207702_10001281 3300026078 Bacteria 25238
573 Ga0207702_10170260 3300026078 Bacteria 1996
574 Ga0207702_10346179 3300026078 Bacteria 1421
575 Ga0207641_10000090 3300026088 Bacteria 127735
576 Ga0207641_10000111 3300026088 Bacteria 120527
577 Ga0207641_10002912 3300026088 Bacteria 15494
578 Ga0207641_10216546 3300026088 Bacteria 1774
579 Ga0207648_10000383 3300026089 Bacteria 48959
580 Ga0207648_10022129 3300026089 Bacteria 5710
581 Ga0207648_10139222 3300026089 Bacteria 2139
582 Ga0207676_10007606 3300026095 Bacteria 7693
583 Ga0207676_10008833 3300026095 Bacteria 7171
584 Ga0207674_10004856 3300026116 Bacteria 16098
585 Ga0207674_10007260 3300026116 Bacteria 12917
586 Ga0207674_10089144 3300026116 Bacteria 3077
587 Ga0207674_10101451 3300026116 Bacteria 2858
588 Ga0207675_100012579 3300026118 Bacteria 7905
589 Ga0207675_100067386 3300026118 Bacteria 3346
590 Ga0207683_10002635 3300026121 Bacteria 15683
591 Ga0207683_10022617 3300026121 Bacteria 5399
592 Ga0207683_10023168 3300026121 Bacteria 5336
593 Ga0207698_10008226 3300026142 Bacteria 6581
594 Ga0207698_10036136 3300026142 Bacteria 3623
595 Ga0207698_10119007 3300026142 Bacteria 2231
596 Ga0207698_10132762 3300026142 Bacteria 2131
597 Ga0207698_10233651 3300026142 Unclassified 1671
598 Ga0207698_10290671 3300026142 Bacteria 1516
599 Ga0268266_10000068 3300028379 Bacteria 241100
600 Ga0268266_10056092 3300028379 Bacteria 3389
601 Ga0268266_10073432 3300028379 Bacteria 2968
602 Ga0268265_10530521 3300028380 Bacteria 1114
603 Ga0268264_10000079 3300028381 Bacteria 249516
604 Ga0268264_10004288 3300028381 Bacteria 12173
605 Ga0268264_10023200 3300028381 Bacteria 5063
606 Ga0268264_10047692 3300028381 Bacteria 3561
607 Ga0268264_10170640 3300028381 Bacteria 1967
608 Ga0307515_10000012 3300028794 Bacteria 582232
609 Ga0307515_10000078 3300028794 Bacteria 227988
610 Ga0307515_10000290 3300028794 Bacteria 123604
611 Ga0307515_10006021 3300028794 Bacteria 24408
612 Ga0307515_10011199 3300028794 Bacteria 17050
613 Ga0307511_10002426 3300030521 Bacteria 19480
614 Ga0316177_1183670 3300030731 Bacteria 2227
615 Ga0316176_1098279 3300030732 Bacteria 44333
616 Ga0316183_1030332 3300030742 Bacteria 25507
617 Ga0316181_1084052 3300030744 Bacteria 48491
618 Ga0265327_10036126 3300031251 Bacteria 2720
619 Ga0307513_10011825 3300031456 Bacteria 10818
620 Ga0307513_10063761 3300031456 Bacteria 3888
621 Ga0307509_10025814 3300031507 Bacteria 6561
622 Ga0307509_10262811 3300031507 Bacteria 1499
623 Ga0265313_10009958 3300031595 Bacteria 6099
624 Ga0307508_10000686 3300031616 Bacteria 40604
625 Ga0307516_10022679 3300031730 Bacteria 6444
626 Ga0307413_10000942 3300031824 Bacteria 10397
627 Ga0307407_10000018 3300031903 Bacteria 135979
628 Ga0307412_10000001 3300031911 Bacteria 822691
629 Ga0307412_10057868 3300031911 Bacteria 2590
630 Ga0307409_100023896 3300031995 Bacteria 4247
631 Ga0307416_100001355 3300032002 Bacteria 13215
632 Ga0307414_10000332 3300032004 Bacteria 26901
633 Ga0307414_10000502 3300032004 Bacteria 20406
634 Ga0307414_10000823 3300032004 Bacteria 15850
635 Ga0307414_10000903 3300032004 Bacteria 15224
636 Ga0307414_10003291 3300032004 Bacteria 8613
637 Ga0307414_10006443 3300032004 Bacteria 6547
638 Ga0307414_10007360 3300032004 Bacteria 6186
639 Ga0307414_10010074 3300032004 Bacteria 5463
640 Ga0307414_10029605 3300032004 Bacteria 3565
641 Ga0307414_10117073 3300032004 Bacteria 2041
642 Ga0307414_10171487 3300032004 Bacteria 1735
643 Ga0307414_10354131 3300032004 Bacteria 1261
644 Ga0307411_10000014 3300032005 Bacteria 134682
645 Ga0307411_10110350 3300032005 Bacteria 1967
646 Ga0307507_10000032 3300033179 Bacteria 194155
647 Ga0307510_10009375 3300033180 Bacteria 11661
648 Ga0307510_10185827 3300033180 Bacteria 1633
649 Ga0373955_0018775 3300035172 Bacteria 3446
650 Ga0373924_0081276 3300035410 Bacteria 1378
651 Ga0373937_0005416 3300036401 Bacteria 10921
652 Ga0395899_0000002 3300037312 Bacteria 1324310
653 Ga0395899_0000257 3300037312 Bacteria 69779
654 Ga0395899_0012334 3300037312 Bacteria 6546
655 Ga0395899_0065892 3300037312 Bacteria 2661
656 Ga0395900_0000284 3300037418 Bacteria 75852
657 Ga0395900_0000701 3300037418 Bacteria 44627
658 Ga0395900_0001869 3300037418 Bacteria 23970
659 Ga0395900_0003637 3300037418 Bacteria 16572
660 Ga0395900_0079340 3300037418 Bacteria 3373
661 Ga0395898_0003757 3300037466 Bacteria 16815
662 Ga0395898_0004276 3300037466 Bacteria 15662
663 Ga0395898_0022993 3300037466 Bacteria 6303
664 Ga0395898_0165690 3300037466 Bacteria 2114
665 Ga0395905_0001420 3300037471 Bacteria 28906
666 Ga0395905_0012719 3300037471 Bacteria 8094
667 Ga0395901_0005836 3300038443 Bacteria 12464
668 Ga0395901_0084967 3300038443 Bacteria 3308
669 Ga0395901_0346086 3300038443 Bacteria 1535
670 Ga0395901_0355930 3300038443 Bacteria 1510
671 Ga0436365_1399871 3300039437 Bacteria 18429
672 Ga0439447_000820 3300041407 Bacteria 11391
673 Ga0439447_001010 3300041407 Bacteria 10250
674 Ga0451843_0512378 3300041509 Bacteria 1528
675 Ga0439431_0009916 3300041997 Bacteria 2156
676 Ga0439448_0029676 3300042005 Bacteria 1732
677 Ga0439435_0012248 3300042436 Bacteria 2074
678 Ga0451577_0123359 3300042876 Bacteria 2321
679 Ga0451577_0156648 3300042876 Bacteria 2050
680 Ga0451577_0215713 3300042876 Bacteria 1734
681 Ga0451577_0318680 3300042876 Bacteria 1410
682 Ga0451577_0374137 3300042876 Bacteria 1292
683 Ga0466972_0000047 3300044658 Bacteria 122901
684 Ga0466972_0022806 3300044658 Bacteria 3115
685 Ga0453683_0000184 3300044673 Bacteria 86818
686 Ga0453683_0006615 3300044673 Bacteria 7939
687 Ga0453683_0059188 3300044673 Bacteria 2395
688 Ga0466966_0000047 3300044684 Bacteria 91962
689 Ga0453684_0004363 3300044712 Bacteria 30009
690 Ga0453684_0096555 3300044712 Bacteria 3630
691 Ga0453684_0142598 3300044712 Bacteria 2858
692 Ga0453684_0246880 3300044712 Bacteria 2052
693 Ga0453684_0495231 3300044712 Bacteria 1354
694 Ga0466970_0094577 3300044765 Bacteria 1624
695 Ga0466957_0146978 3300044842 Bacteria 1522
696 Ga0466959_0000065 3300045049 Bacteria 73931
697 Ga0466959_0010259 3300045049 Bacteria 6688
698 Ga0451576_0036117 3300045051 Bacteria 5241
699 Ga0451576_0076983 3300045051 Bacteria 3472
700 Ga0451576_0287306 3300045051 Bacteria 1719
701 Ga0466967_0254367 3300045976 Bacteria 1679
702 Ga0495627_004361 3300046453 Bacteria 5938
703 Ga0495627_037920 3300046453 Bacteria 1493
704 Ga0495638_0020710 3300046460 Bacteria 4342
705 Ga0495653_0077421 3300046463 Bacteria 2469
706 Ga0495650_0000162 3300046471 Bacteria 148927
707 Ga0495583_0033179 3300046506 Bacteria 2484
708 Ga0495606_0001495 3300046507 Bacteria 31082
709 Ga0495606_0070308 3300046507 Bacteria 2208
710 Ga0495608_0002063 3300046511 Bacteria 14459
711 Ga0495610_0006790 3300046512 Bacteria 7764
712 Ga0495618_0022330 3300046514 Bacteria 3908
713 Ga0495618_0062568 3300046514 Bacteria 2362
714 Ga0495628_0003469 3300046516 Bacteria 14104
715 Ga0495628_0042148 3300046516 Bacteria 3642
716 Ga0495630_0055754 3300046517 Bacteria 2961
717 Ga0495632_0061673 3300046519 Bacteria 1820
718 Ga0495648_0003925 3300046524 Bacteria 12873
719 Ga0495648_0035510 3300046524 Bacteria 3231
720 Ga0495652_0001518 3300046529 Bacteria 25469
721 Ga0495640_0037202 3300046533 Bacteria 3435
722 Ga0495587_0022367 3300046536 Bacteria 3893
723 Ga0495609_0026185 3300046538 Bacteria 2671
724 Ga0495609_0026969 3300046538 Bacteria 2627
725 Ga0495645_0059390 3300046543 Bacteria 2773
726 Ga0495633_0000005 3300046558 Bacteria 357644
727 Ga0495633_0014888 3300046558 Bacteria 4046
728 Ga0495667_0003320 3300046559 Bacteria 10772
729 Ga0495667_0164769 3300046559 Bacteria 1425
730 Ga0495668_0000009 3300046616 Bacteria 492623
731 Ga0495668_0002458 3300046616 Bacteria 15240
732 Ga0495634_0022653 3300046642 Bacteria 4425
733 Ga0495611_0000435 3300046648 Bacteria 25748
734 Ga0495625_0000515 3300046660 Bacteria 56971
735 Ga0495625_0000534 3300046660 Bacteria 55918
736 Ga0495625_0010378 3300046660 Bacteria 7713
737 Ga0495661_0005923 3300046665 Bacteria 8638
738 Ga0495661_0019164 3300046665 Bacteria 4489
739 Ga0495657_0002782 3300046675 Bacteria 14544
740 Ga0495657_0129231 3300046675 Bacteria 1584
741 Ga0495649_0000009 3300046694 Bacteria 451725
742 Ga0495649_0048434 3300046694 Bacteria 2309
743 Ga0495600_0001165 3300046809 Bacteria 14341
744 Ga0495604_0016121 3300047317 Bacteria 5970
745 Ga0495674_0005045 3300047319 Bacteria 12700
746 Ga0495672_0011690 3300047320 Bacteria 6177
747 Ga0495672_0018509 3300047320 Bacteria 4620
748 Ga0495680_0022796 3300047322 Bacteria 5214
749 Ga0495675_0000072 3300047444 Bacteria 70487
750 Ga0495681_0030281 3300047470 Bacteria 2758
751 Ga0495684_0000740 3300047471 Bacteria 26347
752 Ga0495684_0104206 3300047471 Bacteria 2144
753 Ga0495686_0000471 3300047472 Bacteria 60050
754 Ga0495686_0011123 3300047472 Bacteria 6357
755 Ga0495686_0051693 3300047472 Bacteria 2578
756 Ga0496101_0241454 3300048904 Bacteria 1406
757 Ga0496111_0046852 3300048914 Bacteria 3114
758 Ga0496114_0338270 3300048917 Bacteria 1331
759 Ga0496121_0007063 3300048924 Bacteria 13635
760 Ga0496122_0000668 3300048925 Bacteria 69054
761 Ga0496123_0000728 3300048926 Bacteria 53516
762 Ga0496124_0018530 3300048927 Bacteria 6516
763 Ga0496124_0037765 3300048927 Bacteria 4198
764 Ga0496125_0000018 3300048928 Bacteria 482390
765 Ga0496125_0101826 3300048928 Bacteria 2112
766 Ga0496126_0081511 3300048929 Bacteria 2860
767 Ga0501033_0011190 3300049570 Bacteria 6873
768 Ga0501034_0002811 3300049571 Bacteria 20358
769 Ga0501034_0016304 3300049571 Bacteria 7628
770 Ga0501034_0056617 3300049571 Bacteria 3944
771 Ga0501034_0167941 3300049571 Bacteria 2162
772 Ga0501037_0118881 3300049573 Bacteria 1901
773 Ga0501039_0460031 3300049575 Bacteria 999
774 Ga0501040_0119888 3300049576 Bacteria 1845
775 Ga0501043_0020117 3300049579 Bacteria 5238
776 Ga0501043_0256270 3300049579 Bacteria 1347
777 Ga0501223_016576 3300049663 Bacteria 1456
778 Ga0501235_028148 3300049669 Bacteria 1262
779 Ga0501249_000018 3300049679 Bacteria 113532
780 Ga0501249_002229 3300049679 Bacteria 3937
781 Ga0501261_010758 3300049690 Bacteria 1210
782 Ga0501080_0273511 3300049742 Bacteria 1537
783 Ga0501083_0133403 3300049744 Bacteria 1628
784 Ga0501241_000156 3300049758 Bacteria 15206
785 Ga0501266_000020 3300049763 Bacteria 101935
786 Ga0501035_0126679 3300049822 Bacteria 2229
787 Ga0501035_0138657 3300049822 Bacteria 2116
788 Ga0501044_0033875 3300049823 Bacteria 5363
789 Ga0501044_0126495 3300049823 Bacteria 2553
790 Ga0501044_0497785 3300049823 Bacteria 1120
791 nmdc:mga0k408_144193_c1 3300050493 Bacteria 1417
792 nmdc:mga0k408_85_c1 3300050493 Bacteria 43890
793 nmdc:mga07m45_110018_c1 3300050496 Bacteria 1586
794 nmdc:mga07m45_115720_c1 3300050496 Bacteria 1546
795 nmdc:mga05p37_160869_c1 3300050507 Bacteria 2742
796 nmdc:mga09592_39180_c1 3300050508 Bacteria 3980
797 nmdc:mga09592_48509_c1 3300050508 Bacteria 3580
798 Ga0500635_0000586 3300053080 Bacteria 9656
799 Ga0495619_0061084 3300053085 Bacteria 2507
800 Ga0500578_0000765 3300053086 Bacteria 37890
801 Ga0500646_0006420 3300053090 Bacteria 2990
802 Ga0500646_0007519 3300053090 Bacteria 2786
803 Ga0500583_0062394 3300053092 Bacteria 1762
804 Ga0500651_0000230 3300053093 Bacteria 34750
805 Ga0500651_0118206 3300053093 Bacteria 1612
806 Ga0500641_0000007 3300053096 Bacteria 206510
807 Ga0500641_0000016 3300053096 Bacteria 134532
808 Ga0500641_0001850 3300053096 Bacteria 7507
809 Ga0500641_0099399 3300053096 Bacteria 1247
810 Ga0500562_000098 3300053108 Bacteria 33851
811 Ga0500562_028356 3300053108 Bacteria 1471
812 Ga0500594_0018846 3300053118 Bacteria 1705
813 Ga0500618_008553 3300053125 Bacteria 2849
814 Ga0500642_0033770 3300053130 Bacteria 2158
815 Ga0500658_0000010 3300053134 Bacteria 248149
816 Ga0500568_0020257 3300053139 Bacteria 2880
817 Ga0500568_0024275 3300053139 Bacteria 2569
818 Ga0500568_0060527 3300053139 Bacteria 1466
819 Ga0500616_0040112 3300053153 Bacteria 2520
820 Ga0500622_0000371 3300053156 Bacteria 43288
821 Ga0500622_0002797 3300053156 Bacteria 12259
822 Ga0500627_0093212 3300053158 Bacteria 1349
823 Ga0500611_000024 3300053727 Bacteria 101593
824 Ga0500645_005153 3300053730 Bacteria 4872

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300053158 Ga0500627_0093212 Ga0500627_0093212_508_1305 257
2 3300025907 Ga0207645_10021073 Ga0207645_100210735 278
3 3300049575 Ga0501039_0460031 Ga0501039_0460031_130_981 282
4 3300013104 Ga0157370_10512195 Ga0157370_105121952 285
5 3300046463 Ga0495653_0077421 Ga0495653_0077421_976_1872 288
6 3300046511 Ga0495608_0002063 Ga0495608_0002063_5002_5898 288
7 3300046514 Ga0495618_0022330 Ga0495618_0022330_983_1879 288
8 3300046516 Ga0495628_0003469 Ga0495628_0003469_1558_2454 288
9 3300046529 Ga0495652_0001518 Ga0495652_0001518_6505_7401 288
10 3300046533 Ga0495640_0037202 Ga0495640_0037202_1079_1975 288
11 3300046543 Ga0495645_0059390 Ga0495645_0059390_1541_2437 288
12 3300046559 Ga0495667_0003320 Ga0495667_0003320_8899_9795 288
13 3300046675 Ga0495657_0002782 Ga0495657_0002782_12415_13311 288
14 3300046809 Ga0495600_0001165 Ga0495600_0001165_25_921 288
15 3300047317 Ga0495604_0016121 Ga0495604_0016121_4285_5181 288
16 3300047319 Ga0495674_0005045 Ga0495674_0005045_7473_8369 288
17 3300047322 Ga0495680_0022796 Ga0495680_0022796_942_1838 288
18 3300047444 Ga0495675_0000072 Ga0495675_0000072_24835_25731 288
19 3300047471 Ga0495684_0000740 Ga0495684_0000740_269_1165 288
20 3300049570 Ga0501033_0011190 Ga0501033_0011190_181_1065 293
21 3300049571 Ga0501034_0002811 Ga0501034_0002811_12501_13385 293
22 3300049573 Ga0501037_0118881 Ga0501037_0118881_806_1690 293
23 3300049822 Ga0501035_0126679 Ga0501035_0126679_816_1700 293
24 3300049823 Ga0501044_0033875 Ga0501044_0033875_4185_5069 293
25 3300003323 rootH1_10026775 rootH1_1002677533 294
26 3300014497 Ga0182008_10063153 Ga0182008_100631532 294
27 3300025949 Ga0207667_10184386 Ga0207667_101843863 294
28 3300026041 Ga0207639_10021989 Ga0207639_100219894 294
29 3300049576 Ga0501040_0119888 Ga0501040_0119888_906_1823 294
30 3300053153 Ga0500616_0040112 Ga0500616_0040112_483_1382 294
31 3300001979 JGI24740J21852_10006644 JGI24740J21852_100066443 295
32 3300005330 Ga0070690_100062732 Ga0070690_1000627324 295
33 3300005331 Ga0070670_100141298 Ga0070670_1001412982 295
34 3300005335 Ga0070666_10124625 Ga0070666_101246251 295
35 3300005340 Ga0070689_100004044 Ga0070689_1000040444 295
36 3300005344 Ga0070661_100013628 Ga0070661_1000136287 295
37 3300005344 Ga0070661_100014545 Ga0070661_1000145453 295
38 3300005354 Ga0070675_100052282 Ga0070675_1000522824 295
39 3300005367 Ga0070667_100196622 Ga0070667_1001966222 295
40 3300005458 Ga0070681_10040017 Ga0070681_100400172 295
41 3300005466 Ga0070685_10018108 Ga0070685_100181083 295
42 3300005466 Ga0070685_10149589 Ga0070685_101495891 295
43 3300005535 Ga0070684_100000251 Ga0070684_1000002511 295
44 3300005539 Ga0068853_100001703 Ga0068853_10000170310 295
45 3300005539 Ga0068853_100095956 Ga0068853_1000959561 295
46 3300005539 Ga0068853_100181628 Ga0068853_1001816283 295
47 3300005544 Ga0070686_100270305 Ga0070686_1002703052 295
48 3300005548 Ga0070665_100000014 Ga0070665_100000014361 295
49 3300005548 Ga0070665_100164206 Ga0070665_1001642062 295
50 3300005564 Ga0070664_100006889 Ga0070664_1000068892 295
51 3300005564 Ga0070664_100345430 Ga0070664_1003454302 295
52 3300005616 Ga0068852_100069555 Ga0068852_1000695554 295
53 3300005617 Ga0068859_100269463 Ga0068859_1002694632 295
54 3300005618 Ga0068864_100099104 Ga0068864_1000991041 295
55 3300005834 Ga0068851_10009475 Ga0068851_100094754 295
56 3300005842 Ga0068858_100048943 Ga0068858_1000489432 295
57 3300006237 Ga0097621_100025268 Ga0097621_1000252682 295
58 3300006358 Ga0068871_100573780 Ga0068871_1005737801 295
59 3300006931 Ga0097620_100269447 Ga0097620_1002694472 295
60 3300009545 Ga0105237_10001948 Ga0105237_1000194822 295
61 3300013102 Ga0157371_10065708 Ga0157371_100657082 295
62 3300013104 Ga0157370_10001014 Ga0157370_1000101432 295
63 3300013105 Ga0157369_10000952 Ga0157369_1000095236 295
64 3300013307 Ga0157372_10000077 Ga0157372_1000007720 295
65 3300013308 Ga0157375_10044269 Ga0157375_100442694 295
66 3300014325 Ga0163163_10249412 Ga0163163_102494122 295
67 3300014497 Ga0182008_10000058 Ga0182008_1000005870 295
68 3300015261 Ga0182006_1002797 Ga0182006_10027977 295
69 3300025250 Ga0209026_1000239 Ga0209026_100023921 295
70 3300025302 Ga0207426_1000681 Ga0207426_10006814 295
71 3300025303 Ga0209051_1012068 Ga0209051_10120683 295
72 3300025321 Ga0207656_10028953 Ga0207656_100289532 295
73 3300025903 Ga0207680_10066601 Ga0207680_100666012 295
74 3300025908 Ga0207643_10118054 Ga0207643_101180542 295
75 3300025912 Ga0207707_10200176 Ga0207707_102001762 295
76 3300025913 Ga0207695_10166215 Ga0207695_101662153 295
77 3300025914 Ga0207671_10002368 Ga0207671_100023684 295
78 3300025920 Ga0207649_10002116 Ga0207649_100021166 295
79 3300025925 Ga0207650_10004145 Ga0207650_100041459 295
80 3300025936 Ga0207670_10003877 Ga0207670_100038774 295
81 3300025945 Ga0207679_10000915 Ga0207679_100009157 295
82 3300025945 Ga0207679_10128109 Ga0207679_101281092 295
83 3300025945 Ga0207679_10494408 Ga0207679_104944081 295
84 3300025961 Ga0207712_10071008 Ga0207712_100710082 295
85 3300025961 Ga0207712_10309455 Ga0207712_103094552 295
86 3300026035 Ga0207703_10015384 Ga0207703_100153841 295
87 3300026035 Ga0207703_10282803 Ga0207703_102828032 295
88 3300026041 Ga0207639_10180301 Ga0207639_101803011 295
89 3300026041 Ga0207639_10196289 Ga0207639_101962892 295
90 3300026089 Ga0207648_10139222 Ga0207648_101392222 295
91 3300026095 Ga0207676_10007606 Ga0207676_100076067 295
92 3300026116 Ga0207674_10089144 Ga0207674_100891442 295
93 3300026142 Ga0207698_10233651 Ga0207698_102336512 295
94 3300028379 Ga0268266_10000068 Ga0268266_1000006874 295
95 3300028379 Ga0268266_10056092 Ga0268266_100560922 295
96 3300031616 Ga0307508_10000686 Ga0307508_1000068616 295
97 3300032004 Ga0307414_10171487 Ga0307414_101714872 295
98 3300037312 Ga0395899_0000257 Ga0395899_0000257_49345_50247 295
99 3300037471 Ga0395905_0012719 Ga0395905_0012719_5337_6236 295
100 3300038443 Ga0395901_0005836 Ga0395901_0005836_7819_8718 295
101 3300042876 Ga0451577_0318680 Ga0451577_0318680_34_948 295
102 3300046517 Ga0495630_0055754 Ga0495630_0055754_2029_2931 295
103 3300048904 Ga0496101_0241454 Ga0496101_0241454_362_1264 295
104 3300048925 Ga0496122_0000668 Ga0496122_0000668_42824_43711 295
105 3300048926 Ga0496123_0000728 Ga0496123_0000728_3436_4323 295
106 3300048928 Ga0496125_0101826 Ga0496125_0101826_22_909 295
107 3300048929 Ga0496126_0081511 Ga0496126_0081511_1756_2655 295
108 3300049571 Ga0501034_0056617 Ga0501034_0056617_580_1476 295
109 3300049579 Ga0501043_0256270 Ga0501043_0256270_421_1317 295
110 3300050496 nmdc:mga07m45_115720_c1 nmdc:mga07m45_115720_c1_26_925 295
111 3300053156 Ga0500622_0000371 Ga0500622_0000371_8132_9019 295
112 3300005563 Ga0068855_100425518 Ga0068855_1004255182 300
113 iso_pu_bacteria 2883068021 2883071364 303
114 3300005328 Ga0070676_10000001 Ga0070676_10000001420 304
115 3300005543 Ga0070672_100414180 Ga0070672_1004141801 304
116 3300013104 Ga0157370_10003406 Ga0157370_1000340610 304
117 3300013105 Ga0157369_10003837 Ga0157369_1000383710 304
118 3300013297 Ga0157378_10251138 Ga0157378_102511382 304
119 3300013306 Ga0163162_10098254 Ga0163162_100982544 304
120 3300013308 Ga0157375_10364637 Ga0157375_103646371 304
121 3300017792 Ga0163161_10108942 Ga0163161_101089422 304
122 3300025907 Ga0207645_10000001 Ga0207645_1000000184 304
123 3300045976 Ga0466967_0254367 Ga0466967_0254367_611_1546 304
124 iso_pu_bacteria 2513020052 2513233371 304
125 iso_pu_bacteria 2513237088 2513600905 304
126 iso_pu_bacteria 2519899754 2520879575 304
127 iso_pu_bacteria 2585427687 2586207192 304
128 iso_pu_bacteria 2721755487 2722725809 304
129 iso_pu_bacteria 2739367651 2739591391 304
130 iso_pu_bacteria 2739367857 2740002583 304
131 iso_pu_bacteria 2739367858 2740007399 304
132 iso_pu_bacteria 2818991437 2819549642 304
133 iso_pu_bacteria 2842722452 2842727385 304
134 iso_pu_bacteria 2849281842 2849285390 304
135 iso_pu_bacteria 2857618242 2857620485 304
136 iso_pu_bacteria 2896344016 2896344709 304
137 iso_pu_bacteria 2902048731 2902049514 304
138 iso_pu_bacteria 2919683626 2919686308 304
139 iso_pu_bacteria 2919692658 2919692754 304
140 iso_pu_bacteria 2929150217 2929154788 304
141 iso_pu_bacteria 2954016120 2954020759 304
142 iso_pu_bacteria 2958512119 2958514901 304
143 iso_pu_bacteria 2989349275 2989349951 304
144 iso_pu_bacteria 3003233435 3003237021 304
145 iso_pu_bacteria 8055588893 8055590090 304
146 iso_pu_bacteria 8056440228 8056440296 304
147 3300003320 rootH2_10036622 rootH2_1003662210 305
148 3300003323 rootH1_10004759 rootH1_1000475927 305
149 3300013102 Ga0157371_10013014 Ga0157371_100130142 305
150 3300014326 Ga0157380_10000019 Ga0157380_1000001952 305
151 3300037418 Ga0395900_0001869 Ga0395900_0001869_5238_6158 305
152 3300037466 Ga0395898_0022993 Ga0395898_0022993_3985_4905 305
153 3300053730 Ga0500645_005153 Ga0500645_005153_162_1097 305
154 iso_pu_bacteria 2522125168 2522552262 305
155 iso_pu_bacteria 2582581873 2585424243 305
156 iso_pu_bacteria 2643221725 2644683425 305
157 iso_pu_bacteria 2721755487 2722731012 305
158 iso_pu_bacteria 2738541283 2738755866 305
159 iso_pu_bacteria 2738543023 2739303016 305
160 iso_pu_bacteria 2775506987 2776615896 305
161 iso_pu_bacteria 2802428842 2802652693 305
162 iso_pu_bacteria 2818991442 2819574075 305
163 iso_pu_bacteria 2818991442 2819574641 305
164 iso_pu_bacteria 2818991444 2819586370 305
165 iso_pu_bacteria 2818991460 2819681557 305
166 iso_pu_bacteria 2821136567 2821137394 305
167 iso_pu_bacteria 2842903701 2842908628 305
168 iso_pu_bacteria 2852623160 2852625286 305
169 iso_pu_bacteria 2852627209 2852628099 305
170 iso_pu_bacteria 2857618242 2857619776 305
171 iso_pu_bacteria 2883068021 2883071597 305
172 iso_pu_bacteria 2884791551 2884792476 305
173 iso_pu_bacteria 2884933994 2884934299 305
174 iso_pu_bacteria 2896109856 2896110262 305
175 iso_pu_bacteria 2896109856 2896113477 305
176 iso_pu_bacteria 2904467357 2904467865 305
177 iso_pu_bacteria 2911138879 2911139278 305
178 iso_pu_bacteria 2919191525 2919194281 305
179 iso_pu_bacteria 2919692658 2919696821 305
180 iso_pu_bacteria 2929154850 2929155155 305
181 iso_pu_bacteria 2929177148 2929179119 305
182 iso_pu_bacteria 2929921140 2929923660 305
183 iso_pu_bacteria 2945977869 2945981519 305
184 iso_pu_bacteria 2946013367 2946019075 305
185 iso_pu_bacteria 2977243572 2977244997 305
186 iso_pu_bacteria 2977268062 2977271210 305
187 iso_pu_bacteria 2984572630 2984574901 305
188 iso_pu_bacteria 2984606641 2984608354 305
189 iso_pu_bacteria 8003151029 8003155202 305
190 iso_pu_bacteria 8003151029 8003155205 305
191 iso_pu_bacteria 8055419101 8055423520 305
192 iso_pu_bacteria 8055592153 8055595447 305
193 3300009553 Ga0105249_10001357 Ga0105249_1000135716 306
194 3300025960 Ga0207651_10255186 Ga0207651_102551862 306
195 3300025961 Ga0207712_10003067 Ga0207712_100030675 306
196 3300031595 Ga0265313_10009958 Ga0265313_100099583 306
197 3300042876 Ga0451577_0156648 Ga0451577_0156648_1099_2034 306
198 3300044673 Ga0453683_0000184 Ga0453683_0000184_64797_65735 306
199 3300044712 Ga0453684_0004363 Ga0453684_0004363_26098_27033 306
200 3300044712 Ga0453684_0096555 Ga0453684_0096555_1073_1993 306
201 3300045051 Ga0451576_0076983 Ga0451576_0076983_1387_2322 306
202 3300045051 Ga0451576_0287306 Ga0451576_0287306_231_1157 306
203 iso_pu_bacteria 2643221667 2644372797 306
204 iso_pu_bacteria 2839989709 2839991511 306
205 iso_pu_bacteria 2884634485 2884634839 306
206 iso_pu_bacteria 8055592153 8055593704 306
207 3300001904 JGI24736J21556_1000844 JGI24736J21556_10008442 307
208 3300001990 JGI24737J22298_10016126 JGI24737J22298_100161262 307
209 3300002067 JGI24735J21928_10043102 JGI24735J21928_100431022 307
210 3300003187 JGI25151J46595_10010532 JGI25151J46595_100105324 307
211 3300003322 rootL2_10022797 rootL2_100227972 307
212 3300003323 rootH1_10027324 rootH1_1002732430 307
213 3300005262 Ga0065165_1000814 Ga0065165_100081434 307
214 3300005289 Ga0065704_10112032 Ga0065704_101120322 307
215 3300005290 Ga0065712_10176867 Ga0065712_101768672 307
216 3300005327 Ga0070658_10011667 Ga0070658_100116674 307
217 3300005327 Ga0070658_10358558 Ga0070658_103585582 307
218 3300005354 Ga0070675_100555099 Ga0070675_1005550991 307
219 3300005366 Ga0070659_100005539 Ga0070659_1000055393 307
220 3300005471 Ga0070698_100002653 Ga0070698_1000026535 307
221 3300005518 Ga0070699_100221712 Ga0070699_1002217122 307
222 3300005563 Ga0068855_100042683 Ga0068855_1000426835 307
223 3300005577 Ga0068857_100028762 Ga0068857_1000287622 307
224 3300005616 Ga0068852_100212367 Ga0068852_1002123672 307
225 3300005844 Ga0068862_100187784 Ga0068862_1001877842 307
226 3300006175 Ga0070712_100022318 Ga0070712_1000223183 307
227 3300006195 Ga0075366_10043061 Ga0075366_100430612 307
228 3300006844 Ga0075428_100010603 Ga0075428_1000106038 307
229 3300006847 Ga0075431_100086675 Ga0075431_1000866753 307
230 3300009093 Ga0105240_10057327 Ga0105240_100573272 307
231 3300009147 Ga0114129_10031992 Ga0114129_100319923 307
232 3300009545 Ga0105237_10001142 Ga0105237_1000114233 307
233 3300010375 Ga0105239_10216683 Ga0105239_102166832 307
234 3300013100 Ga0157373_10000453 Ga0157373_1000045324 307
235 3300013100 Ga0157373_10138419 Ga0157373_101384192 307
236 3300013102 Ga0157371_10000069 Ga0157371_1000006915 307
237 3300013102 Ga0157371_10000713 Ga0157371_100007135 307
238 3300013104 Ga0157370_10019134 Ga0157370_100191342 307
239 3300013104 Ga0157370_10035236 Ga0157370_100352362 307
240 3300013104 Ga0157370_10086005 Ga0157370_100860053 307
241 3300013307 Ga0157372_10000254 Ga0157372_1000025426 307
242 3300013307 Ga0157372_10045539 Ga0157372_100455392 307
243 3300013307 Ga0157372_10155377 Ga0157372_101553772 307
244 3300014326 Ga0157380_10010574 Ga0157380_100105746 307
245 3300014326 Ga0157380_10104162 Ga0157380_101041621 307
246 3300014326 Ga0157380_10625877 Ga0157380_106258771 307
247 3300025261 Ga0209233_1001884 Ga0209233_10018842 307
248 3300025904 Ga0207647_10000299 Ga0207647_100002996 307
249 3300025909 Ga0207705_10158636 Ga0207705_101586362 307
250 3300025913 Ga0207695_10020573 Ga0207695_100205731 307
251 3300025914 Ga0207671_10004651 Ga0207671_100046513 307
252 3300025932 Ga0207690_10003716 Ga0207690_100037165 307
253 3300025949 Ga0207667_10045845 Ga0207667_100458455 307
254 3300026116 Ga0207674_10101451 Ga0207674_101014512 307
255 3300026142 Ga0207698_10008226 Ga0207698_100082265 307
256 3300028794 Ga0307515_10000012 Ga0307515_10000012423 307
257 3300028794 Ga0307515_10011199 Ga0307515_100111993 307
258 3300037312 Ga0395899_0065892 Ga0395899_0065892_804_1730 307
259 3300037466 Ga0395898_0165690 Ga0395898_0165690_1082_2005 307
260 3300042436 Ga0439435_0012248 Ga0439435_0012248_780_1706 307
261 3300042876 Ga0451577_0374137 Ga0451577_0374137_224_1150 307
262 3300044712 Ga0453684_0142598 Ga0453684_0142598_1325_2251 307
263 3300044712 Ga0453684_0495231 Ga0453684_0495231_95_1027 307
264 3300049663 Ga0501223_016576 Ga0501223_016576_313_1239 307
265 3300049669 Ga0501235_028148 Ga0501235_028148_73_999 307
266 3300049690 Ga0501261_010758 Ga0501261_010758_149_1075 307
267 3300050508 nmdc:mga09592_39180_c1 nmdc:mga09592_39180_c1_2126_3052 307
268 3300053080 Ga0500635_0000586 Ga0500635_0000586_944_1867 307
269 3300053108 Ga0500562_028356 Ga0500562_028356_355_1278 307
270 3300003316 rootH1_10033731 rootH1_100337315 308
271 3300003320 rootH2_10013030 rootH2_100130302 308
272 3300003320 rootH2_10160054 rootH2_101600542 308
273 3300003322 rootL2_10004925 rootL2_100049252 308
274 3300003323 rootH1_10010201 rootH1_100102014 308
275 3300003323 rootH1_10283993 rootH1_102839932 308
276 3300003781 Ga0055536_1000002 Ga0055536_1000002438 308
277 3300005288 Ga0065714_10009252 Ga0065714_100092522 308
278 3300005288 Ga0065714_10066377 Ga0065714_100663777 308
279 3300005289 Ga0065704_10085422 Ga0065704_100854222 308
280 3300005293 Ga0065715_10210627 Ga0065715_102106271 308
281 3300005293 Ga0065715_10249931 Ga0065715_102499311 308
282 3300005327 Ga0070658_10103291 Ga0070658_101032912 308
283 3300005329 Ga0070683_100138836 Ga0070683_1001388362 308
284 3300005535 Ga0070684_100118192 Ga0070684_1001181922 308
285 3300005563 Ga0068855_100163867 Ga0068855_1001638673 308
286 3300005616 Ga0068852_100216964 Ga0068852_1002169642 308
287 3300005616 Ga0068852_100235703 Ga0068852_1002357032 308
288 3300005843 Ga0068860_100006071 Ga0068860_10000607111 308
289 3300006844 Ga0075428_100119796 Ga0075428_1001197962 308
290 3300006846 Ga0075430_100016236 Ga0075430_1000162363 308
291 3300006880 Ga0075429_100105852 Ga0075429_1001058522 308
292 3300009036 Ga0105244_10047623 Ga0105244_100476232 308
293 3300009093 Ga0105240_10026991 Ga0105240_100269913 308
294 3300009093 Ga0105240_10034852 Ga0105240_100348525 308
295 3300009093 Ga0105240_10065857 Ga0105240_100658572 308
296 3300009093 Ga0105240_10091437 Ga0105240_100914374 308
297 3300009093 Ga0105240_10164711 Ga0105240_101647111 308
298 3300009147 Ga0114129_10091477 Ga0114129_100914773 308
299 3300009545 Ga0105237_10000409 Ga0105237_1000040933 308
300 3300009545 Ga0105237_10000577 Ga0105237_1000057713 308
301 3300009545 Ga0105237_10273360 Ga0105237_102733602 308
302 3300010375 Ga0105239_10000659 Ga0105239_1000065939 308
303 3300010375 Ga0105239_10014750 Ga0105239_1001475010 308
304 3300010375 Ga0105239_10042514 Ga0105239_100425142 308
305 3300013104 Ga0157370_10015818 Ga0157370_100158187 308
306 3300013105 Ga0157369_10000038 Ga0157369_1000003864 308
307 3300013296 Ga0157374_10000011 Ga0157374_10000011171 308
308 3300013307 Ga0157372_10048850 Ga0157372_100488503 308
309 3300014969 Ga0157376_10184522 Ga0157376_101845222 308
310 3300015261 Ga0182006_1000645 Ga0182006_100064516 308
311 3300015262 Ga0182007_10000024 Ga0182007_10000024104 308
312 3300017792 Ga0163161_10002479 Ga0163161_100024796 308
313 3300021384 Ga0213876_10003317 Ga0213876_100033171 308
314 3300025292 Ga0209676_1000022 Ga0209676_1000022100 308
315 3300025298 Ga0209050_1000020 Ga0209050_1000020440 308
316 3300025912 Ga0207707_10425829 Ga0207707_104258291 308
317 3300025913 Ga0207695_10000212 Ga0207695_1000021281 308
318 3300025913 Ga0207695_10000276 Ga0207695_10000276104 308
319 3300025913 Ga0207695_10000313 Ga0207695_10000313100 308
320 3300025913 Ga0207695_10019413 Ga0207695_100194136 308
321 3300025914 Ga0207671_10000402 Ga0207671_1000040223 308
322 3300025914 Ga0207671_10001317 Ga0207671_1000131725 308
323 3300025921 Ga0207652_10028756 Ga0207652_100287564 308
324 3300025942 Ga0207689_10016468 Ga0207689_100164686 308
325 3300025944 Ga0207661_10294898 Ga0207661_102948982 308
326 3300025949 Ga0207667_10000414 Ga0207667_100004148 308
327 3300025949 Ga0207667_10168412 Ga0207667_101684122 308
328 3300026078 Ga0207702_10170260 Ga0207702_101702601 308
329 3300026142 Ga0207698_10132762 Ga0207698_101327622 308
330 3300028381 Ga0268264_10004288 Ga0268264_100042882 308
331 3300028794 Ga0307515_10006021 Ga0307515_100060218 308
332 3300031730 Ga0307516_10022679 Ga0307516_100226792 308
333 3300031824 Ga0307413_10000942 Ga0307413_100009422 308
334 3300031903 Ga0307407_10000018 Ga0307407_1000001866 308
335 3300031995 Ga0307409_100023896 Ga0307409_1000238962 308
336 3300032002 Ga0307416_100001355 Ga0307416_1000013556 308
337 3300032004 Ga0307414_10000823 Ga0307414_100008238 308
338 3300032004 Ga0307414_10003291 Ga0307414_100032912 308
339 3300032004 Ga0307414_10007360 Ga0307414_100073606 308
340 3300032005 Ga0307411_10000014 Ga0307411_1000001451 308
341 3300033180 Ga0307510_10009375 Ga0307510_100093758 308
342 3300033180 Ga0307510_10185827 Ga0307510_101858272 308
343 3300041407 Ga0439447_001010 Ga0439447_001010_4542_5492 308
344 3300041509 Ga0451843_0512378 Ga0451843_0512378_390_1343 308
345 3300042005 Ga0439448_0029676 Ga0439448_0029676_561_1487 308
346 3300042876 Ga0451577_0123359 Ga0451577_0123359_583_1518 308
347 3300046507 Ga0495606_0070308 Ga0495606_0070308_914_1864 308
348 3300046519 Ga0495632_0061673 Ga0495632_0061673_840_1766 308
349 3300046558 Ga0495633_0014888 Ga0495633_0014888_3025_3951 308
350 3300046648 Ga0495611_0000435 Ga0495611_0000435_13732_14658 308
351 3300046660 Ga0495625_0010378 Ga0495625_0010378_3939_4889 308
352 3300046694 Ga0495649_0048434 Ga0495649_0048434_863_1789 308
353 3300047470 Ga0495681_0030281 Ga0495681_0030281_1481_2407 308
354 3300049579 Ga0501043_0020117 Ga0501043_0020117_1846_2775 308
355 3300049679 Ga0501249_000018 Ga0501249_000018_89174_90127 308
356 3300049679 Ga0501249_002229 Ga0501249_002229_1557_2507 308
357 3300049763 Ga0501266_000020 Ga0501266_000020_83221_84174 308
358 3300049823 Ga0501044_0126495 Ga0501044_0126495_1004_1933 308
359 3300050507 nmdc:mga05p37_160869_c1 nmdc:mga05p37_160869_c1_629_1558 308
360 3300050508 nmdc:mga09592_48509_c1 nmdc:mga09592_48509_c1_1088_2017 308
361 3300053090 Ga0500646_0007519 Ga0500646_0007519_634_1584 308
362 3300053096 Ga0500641_0000016 Ga0500641_0000016_84095_85045 308
363 3300053096 Ga0500641_0001850 Ga0500641_0001850_3154_4104 308
364 3300053134 Ga0500658_0000010 Ga0500658_0000010_83768_84718 308
365 3300001979 JGI24740J21852_10000688 JGI24740J21852_100006888 309
366 3300001979 JGI24740J21852_10002889 JGI24740J21852_100028896 309
367 3300001989 JGI24739J22299_10001392 JGI24739J22299_100013924 309
368 3300001989 JGI24739J22299_10053156 JGI24739J22299_100531562 309
369 3300002737 JGI25162J39368_1001124 JGI25162J39368_100112410 309
370 3300002738 JGI25154J39366_1000003 JGI25154J39366_1000003199 309
371 3300002738 JGI25154J39366_1000014 JGI25154J39366_1000014146 309
372 3300002741 JGI25157J39369_1002583 JGI25157J39369_10025834 309
373 3300002772 JGI25164J39214_1001008 JGI25164J39214_10010084 309
374 3300003214 JGI25165J46597_1000923 JGI25165J46597_100092321 309
375 3300003215 JGI25153J46596_10000539 JGI25153J46596_1000053918 309
376 3300003215 JGI25153J46596_10002851 JGI25153J46596_100028516 309
377 3300003215 JGI25153J46596_10037146 JGI25153J46596_100371462 309
378 3300003316 rootH1_10018273 rootH1_100182733 309
379 3300003316 rootH1_10101991 rootH1_101019913 309
380 3300003322 rootL2_10005069 rootL2_100050694 309
381 3300003322 rootL2_10043862 rootL2_100438622 309
382 3300003322 rootL2_10131047 rootL2_101310473 309
383 3300003322 rootL2_10163672 rootL2_101636723 309
384 3300003322 rootL2_10173005 rootL2_101730052 309
385 3300003322 rootL2_10366376 rootL2_103663762 309
386 3300003323 rootH1_10003366 rootH1_100033663 309
387 3300003323 rootH1_10010647 rootH1_100106472 309
388 3300003323 rootH1_10032632 rootH1_100326327 309
389 3300003323 rootH1_10072115 rootH1_100721153 309
390 3300003323 rootH1_10130033 rootH1_101300337 309
391 3300003323 rootH1_10131898 rootH1_101318984 309
392 3300003323 rootH1_10148682 rootH1_101486822 309
393 3300003323 rootH1_10190090 rootH1_101900904 309
394 3300003354 JGI25160J50197_1000175 JGI25160J50197_100017527 309
395 3300003354 JGI25160J50197_1002813 JGI25160J50197_10028138 309
396 3300003354 JGI25160J50197_1004550 JGI25160J50197_10045502 309
397 3300003354 JGI25160J50197_1008609 JGI25160J50197_10086094 309
398 3300003354 JGI25160J50197_1017025 JGI25160J50197_10170252 309
399 3300003354 JGI25160J50197_1032984 JGI25160J50197_10329841 309
400 3300003771 Ga0055526_1000270 Ga0055526_100027023 309
401 3300003790 Ga0055528_1000108 Ga0055528_100010826 309
402 3300003790 Ga0055528_1001425 Ga0055528_100142512 309
403 3300003791 Ga0055530_10000183 Ga0055530_1000018319 309
404 3300003791 Ga0055530_10000279 Ga0055530_1000027919 309
405 3300003794 Ga0055531_10000093 Ga0055531_1000009366 309
406 3300004625 Ga0055543_1011139 Ga0055543_10111391 309
407 3300005262 Ga0065165_1000036 Ga0065165_100003683 309
408 3300005262 Ga0065165_1000548 Ga0065165_100054851 309
409 3300005262 Ga0065165_1007727 Ga0065165_10077274 309
410 3300005288 Ga0065714_10014084 Ga0065714_100140845 309
411 3300005288 Ga0065714_10015372 Ga0065714_100153723 309
412 3300005288 Ga0065714_10073910 Ga0065714_100739103 309
413 3300005289 Ga0065704_10084803 Ga0065704_100848033 309
414 3300005289 Ga0065704_10087748 Ga0065704_100877483 309
415 3300005293 Ga0065715_10241072 Ga0065715_102410722 309
416 3300005328 Ga0070676_10016784 Ga0070676_100167844 309
417 3300005329 Ga0070683_100108393 Ga0070683_1001083932 309
418 3300005329 Ga0070683_100533197 Ga0070683_1005331971 309
419 3300005331 Ga0070670_100286533 Ga0070670_1002865331 309
420 3300005331 Ga0070670_100294650 Ga0070670_1002946502 309
421 3300005331 Ga0070670_100363226 Ga0070670_1003632261 309
422 3300005334 Ga0068869_100010053 Ga0068869_1000100534 309
423 3300005334 Ga0068869_100013167 Ga0068869_1000131672 309
424 3300005334 Ga0068869_100017619 Ga0068869_1000176194 309
425 3300005334 Ga0068869_100045584 Ga0068869_1000455844 309
426 3300005335 Ga0070666_10000197 Ga0070666_1000019728 309
427 3300005335 Ga0070666_10002958 Ga0070666_100029586 309
428 3300005335 Ga0070666_10037488 Ga0070666_100374883 309
429 3300005335 Ga0070666_10046753 Ga0070666_100467533 309
430 3300005338 Ga0068868_100000524 Ga0068868_10000052414 309
431 3300005338 Ga0068868_100001711 Ga0068868_10000171110 309
432 3300005338 Ga0068868_100115321 Ga0068868_1001153212 309
433 3300005339 Ga0070660_100184903 Ga0070660_1001849033 309
434 3300005343 Ga0070687_100249012 Ga0070687_1002490121 309
435 3300005347 Ga0070668_100112142 Ga0070668_1001121422 309
436 3300005347 Ga0070668_100210207 Ga0070668_1002102071 309
437 3300005353 Ga0070669_100022298 Ga0070669_1000222985 309
438 3300005353 Ga0070669_100036725 Ga0070669_1000367251 309
439 3300005354 Ga0070675_100363984 Ga0070675_1003639841 309
440 3300005355 Ga0070671_100011735 Ga0070671_1000117356 309
441 3300005355 Ga0070671_100141923 Ga0070671_1001419232 309
442 3300005355 Ga0070671_100159186 Ga0070671_1001591861 309
443 3300005355 Ga0070671_100219389 Ga0070671_1002193892 309
444 3300005356 Ga0070674_100006908 Ga0070674_1000069083 309
445 3300005356 Ga0070674_100057547 Ga0070674_1000575472 309
446 3300005356 Ga0070674_100092842 Ga0070674_1000928422 309
447 3300005364 Ga0070673_100030057 Ga0070673_1000300573 309
448 3300005364 Ga0070673_100030968 Ga0070673_1000309682 309
449 3300005366 Ga0070659_100000440 Ga0070659_10000044024 309
450 3300005367 Ga0070667_100039396 Ga0070667_1000393963 309
451 3300005367 Ga0070667_100101765 Ga0070667_1001017652 309
452 3300005367 Ga0070667_100145408 Ga0070667_1001454082 309
453 3300005367 Ga0070667_100286201 Ga0070667_1002862012 309
454 3300005456 Ga0070678_100013590 Ga0070678_1000135904 309
455 3300005456 Ga0070678_100064289 Ga0070678_1000642891 309
456 3300005457 Ga0070662_100002459 Ga0070662_1000024599 309
457 3300005457 Ga0070662_100003891 Ga0070662_1000038915 309
458 3300005457 Ga0070662_100377552 Ga0070662_1003775521 309
459 3300005459 Ga0068867_100007300 Ga0068867_1000073002 309
460 3300005459 Ga0068867_100011441 Ga0068867_1000114415 309
461 3300005459 Ga0068867_100094625 Ga0068867_1000946251 309
462 3300005459 Ga0068867_100098880 Ga0068867_1000988802 309
463 3300005468 Ga0070707_100051113 Ga0070707_1000511133 309
464 3300005471 Ga0070698_100005248 Ga0070698_10000524810 309
465 3300005518 Ga0070699_100015745 Ga0070699_1000157453 309
466 3300005530 Ga0070679_100193804 Ga0070679_1001938042 309
467 3300005539 Ga0068853_100043110 Ga0068853_1000431102 309
468 3300005539 Ga0068853_100094957 Ga0068853_1000949572 309
469 3300005539 Ga0068853_100166038 Ga0068853_1001660381 309
470 3300005543 Ga0070672_100008545 Ga0070672_1000085452 309
471 3300005543 Ga0070672_100041655 Ga0070672_1000416553 309
472 3300005543 Ga0070672_100193011 Ga0070672_1001930112 309
473 3300005548 Ga0070665_100010440 Ga0070665_1000104407 309
474 3300005563 Ga0068855_100000284 Ga0068855_10000028433 309
475 3300005563 Ga0068855_100030687 Ga0068855_1000306876 309
476 3300005564 Ga0070664_100045872 Ga0070664_1000458722 309
477 3300005564 Ga0070664_100117140 Ga0070664_1001171402 309
478 3300005577 Ga0068857_100172459 Ga0068857_1001724592 309
479 3300005577 Ga0068857_100621535 Ga0068857_1006215351 309
480 3300005578 Ga0068854_100044728 Ga0068854_1000447282 309
481 3300005578 Ga0068854_100060109 Ga0068854_1000601093 309
482 3300005578 Ga0068854_100080831 Ga0068854_1000808312 309
483 3300005578 Ga0068854_100086491 Ga0068854_1000864914 309
484 3300005578 Ga0068854_100098459 Ga0068854_1000984592 309
485 3300005614 Ga0068856_100000073 Ga0068856_10000007327 309
486 3300005614 Ga0068856_100127236 Ga0068856_1001272362 309
487 3300005616 Ga0068852_100019630 Ga0068852_1000196303 309
488 3300005616 Ga0068852_100103259 Ga0068852_1001032592 309
489 3300005616 Ga0068852_100247371 Ga0068852_1002473712 309
490 3300005617 Ga0068859_100000007 Ga0068859_100000007204 309
491 3300005617 Ga0068859_100015705 Ga0068859_1000157054 309
492 3300005617 Ga0068859_100409536 Ga0068859_1004095362 309
493 3300005618 Ga0068864_100009122 Ga0068864_1000091228 309
494 3300005618 Ga0068864_100164856 Ga0068864_1001648561 309
495 3300005718 Ga0068866_10006035 Ga0068866_100060353 309
496 3300005718 Ga0068866_10025612 Ga0068866_100256122 309
497 3300005719 Ga0068861_100131124 Ga0068861_1001311242 309
498 3300005834 Ga0068851_10015736 Ga0068851_100157362 309
499 3300005834 Ga0068851_10040661 Ga0068851_100406612 309
500 3300005841 Ga0068863_100000444 Ga0068863_10000044424 309
501 3300005841 Ga0068863_100000449 Ga0068863_10000044912 309
502 3300005841 Ga0068863_100673028 Ga0068863_1006730282 309
503 3300005841 Ga0068863_100702730 Ga0068863_1007027301 309
504 3300005842 Ga0068858_100002218 Ga0068858_10000221816 309
505 3300005842 Ga0068858_100301170 Ga0068858_1003011702 309
506 3300005843 Ga0068860_100000061 Ga0068860_100000061155 309
507 3300005843 Ga0068860_100000661 Ga0068860_10000066118 309
508 3300005843 Ga0068860_100031110 Ga0068860_1000311105 309
509 3300005843 Ga0068860_100032987 Ga0068860_1000329873 309
510 3300006195 Ga0075366_10000031 Ga0075366_1000003139 309
511 3300006195 Ga0075366_10163062 Ga0075366_101630621 309
512 3300006237 Ga0097621_100007495 Ga0097621_1000074952 309
513 3300006237 Ga0097621_100042264 Ga0097621_1000422643 309
514 3300006353 Ga0075370_10101921 Ga0075370_101019212 309
515 3300006358 Ga0068871_100004610 Ga0068871_10000461010 309
516 3300006358 Ga0068871_100004870 Ga0068871_1000048705 309
517 3300006844 Ga0075428_100062501 Ga0075428_1000625013 309
518 3300006844 Ga0075428_100227894 Ga0075428_1002278941 309
519 3300006881 Ga0068865_100004575 Ga0068865_1000045755 309
520 3300006881 Ga0068865_100053588 Ga0068865_1000535882 309
521 3300006931 Ga0097620_100000007 Ga0097620_100000007205 309
522 3300006931 Ga0097620_100015704 Ga0097620_1000157045 309
523 3300006931 Ga0097620_100409528 Ga0097620_1004095282 309
524 3300009093 Ga0105240_10000198 Ga0105240_1000019851 309
525 3300009093 Ga0105240_10048638 Ga0105240_100486383 309
526 3300009094 Ga0111539_10198008 Ga0111539_101980081 309
527 3300009098 Ga0105245_10174559 Ga0105245_101745592 309
528 3300009147 Ga0114129_10247912 Ga0114129_102479122 309
529 3300009174 Ga0105241_10000137 Ga0105241_1000013749 309
530 3300009174 Ga0105241_10000424 Ga0105241_1000042417 309
531 3300009174 Ga0105241_10005687 Ga0105241_100056873 309
532 3300009174 Ga0105241_10019080 Ga0105241_100190803 309
533 3300009174 Ga0105241_10038039 Ga0105241_100380391 309
534 3300009174 Ga0105241_10066029 Ga0105241_100660293 309
535 3300009176 Ga0105242_10023601 Ga0105242_100236012 309
536 3300009176 Ga0105242_10070686 Ga0105242_100706862 309
537 3300009176 Ga0105242_10088094 Ga0105242_100880942 309
538 3300009176 Ga0105242_10184388 Ga0105242_101843881 309
539 3300009545 Ga0105237_10001258 Ga0105237_1000125827 309
540 3300009545 Ga0105237_10001360 Ga0105237_1000136014 309
541 3300009545 Ga0105237_10005617 Ga0105237_1000561711 309
542 3300009545 Ga0105237_10392588 Ga0105237_103925882 309
543 3300009545 Ga0105237_10418610 Ga0105237_104186102 309
544 3300009551 Ga0105238_10007301 Ga0105238_100073016 309
545 3300009551 Ga0105238_10062384 Ga0105238_100623844 309
546 3300009553 Ga0105249_10030230 Ga0105249_100302303 309
547 3300009553 Ga0105249_10055907 Ga0105249_100559075 309
548 3300009553 Ga0105249_10176773 Ga0105249_101767732 309
549 3300009553 Ga0105249_10542628 Ga0105249_105426281 309
550 3300009553 Ga0105249_10593071 Ga0105249_105930711 309
551 3300009553 Ga0105249_10674694 Ga0105249_106746941 309
552 3300010375 Ga0105239_10005875 Ga0105239_100058758 309
553 3300010375 Ga0105239_10012560 Ga0105239_100125609 309
554 3300010375 Ga0105239_10070201 Ga0105239_100702014 309
555 3300010375 Ga0105239_10194055 Ga0105239_101940552 309
556 3300010375 Ga0105239_10600789 Ga0105239_106007892 309
557 3300010375 Ga0105239_10654484 Ga0105239_106544842 309
558 3300011119 Ga0105246_10001938 Ga0105246_1000193813 309
559 3300011119 Ga0105246_10067458 Ga0105246_100674581 309
560 3300013100 Ga0157373_10008808 Ga0157373_100088086 309
561 3300013100 Ga0157373_10010688 Ga0157373_100106887 309
562 3300013102 Ga0157371_10004170 Ga0157371_100041703 309
563 3300013102 Ga0157371_10048536 Ga0157371_100485363 309
564 3300013102 Ga0157371_10058305 Ga0157371_100583052 309
565 3300013102 Ga0157371_10093180 Ga0157371_100931802 309
566 3300013102 Ga0157371_10093567 Ga0157371_100935672 309
567 3300013104 Ga0157370_10001009 Ga0157370_100010099 309
568 3300013104 Ga0157370_10007076 Ga0157370_100070763 309
569 3300013104 Ga0157370_10010926 Ga0157370_100109264 309
570 3300013104 Ga0157370_10021662 Ga0157370_100216625 309
571 3300013104 Ga0157370_10047458 Ga0157370_100474584 309
572 3300013104 Ga0157370_10097750 Ga0157370_100977503 309
573 3300013105 Ga0157369_10229265 Ga0157369_102292652 309
574 3300013296 Ga0157374_10008935 Ga0157374_100089354 309
575 3300013296 Ga0157374_10010333 Ga0157374_100103333 309
576 3300013296 Ga0157374_10124929 Ga0157374_101249291 309
577 3300013296 Ga0157374_10306121 Ga0157374_103061212 309
578 3300013296 Ga0157374_10420939 Ga0157374_104209392 309
579 3300013297 Ga0157378_10014702 Ga0157378_100147023 309
580 3300013297 Ga0157378_10021840 Ga0157378_100218404 309
581 3300013297 Ga0157378_10131393 Ga0157378_101313932 309
582 3300013297 Ga0157378_10161016 Ga0157378_101610162 309
583 3300013297 Ga0157378_10251840 Ga0157378_102518401 309
584 3300013297 Ga0157378_10331291 Ga0157378_103312912 309
585 3300013297 Ga0157378_10454093 Ga0157378_104540932 309
586 3300013306 Ga0163162_10000151 Ga0163162_1000015151 309
587 3300013306 Ga0163162_10000406 Ga0163162_100004064 309
588 3300013306 Ga0163162_10000827 Ga0163162_100008279 309
589 3300013306 Ga0163162_10001117 Ga0163162_100011175 309
590 3300013306 Ga0163162_10037543 Ga0163162_100375433 309
591 3300013306 Ga0163162_10180651 Ga0163162_101806511 309
592 3300013307 Ga0157372_10020545 Ga0157372_100205456 309
593 3300013307 Ga0157372_10534867 Ga0157372_105348672 309
594 3300013307 Ga0157372_10697923 Ga0157372_106979231 309
595 3300013307 Ga0157372_10845670 Ga0157372_108456701 309
596 3300013308 Ga0157375_10034578 Ga0157375_100345784 309
597 3300013308 Ga0157375_10055835 Ga0157375_100558352 309
598 3300013308 Ga0157375_10088940 Ga0157375_100889403 309
599 3300013308 Ga0157375_10097917 Ga0157375_100979173 309
600 3300013308 Ga0157375_10134685 Ga0157375_101346852 309
601 3300013308 Ga0157375_10154784 Ga0157375_101547841 309
602 3300013308 Ga0157375_10170061 Ga0157375_101700612 309
603 3300014325 Ga0163163_10038961 Ga0163163_100389612 309
604 3300014325 Ga0163163_10085648 Ga0163163_100856482 309
605 3300014325 Ga0163163_10091197 Ga0163163_100911973 309
606 3300014325 Ga0163163_10147104 Ga0163163_101471042 309
607 3300014325 Ga0163163_10233997 Ga0163163_102339972 309
608 3300014326 Ga0157380_10208766 Ga0157380_102087662 309
609 3300014745 Ga0157377_10002753 Ga0157377_100027537 309
610 3300014745 Ga0157377_10002912 Ga0157377_100029127 309
611 3300014969 Ga0157376_10005885 Ga0157376_100058854 309
612 3300014969 Ga0157376_10015107 Ga0157376_100151076 309
613 3300015261 Ga0182006_1000357 Ga0182006_10003577 309
614 3300015261 Ga0182006_1000894 Ga0182006_100089416 309
615 3300015261 Ga0182006_1064751 Ga0182006_10647512 309
616 3300015265 Ga0182005_1000039 Ga0182005_1000039106 309
617 3300017792 Ga0163161_10000628 Ga0163161_1000062814 309
618 3300017792 Ga0163161_10051791 Ga0163161_100517914 309
619 3300017792 Ga0163161_10305670 Ga0163161_103056701 309
620 3300017792 Ga0163161_10314873 Ga0163161_103148732 309
621 3300025208 Ga0209436_100536 Ga0209436_1005363 309
622 3300025231 Ga0207427_100236 Ga0207427_10023623 309
623 3300025233 Ga0209437_100034 Ga0209437_10003421 309
624 3300025246 Ga0209646_1000002 Ga0209646_1000002979 309
625 3300025246 Ga0209646_1000004 Ga0209646_1000004140 309
626 3300025250 Ga0209026_1000132 Ga0209026_100013290 309
627 3300025250 Ga0209026_1000178 Ga0209026_100017864 309
628 3300025250 Ga0209026_1002731 Ga0209026_10027314 309
629 3300025261 Ga0209233_1000038 Ga0209233_100003821 309
630 3300025273 Ga0209673_1000183 Ga0209673_100018348 309
631 3300025273 Ga0209673_1000483 Ga0209673_100048356 309
632 3300025284 Ga0209130_1004353 Ga0209130_10043534 309
633 3300025292 Ga0209676_1002361 Ga0209676_10023616 309
634 3300025295 Ga0209564_1000561 Ga0209564_100056117 309
635 3300025297 Ga0209758_1000912 Ga0209758_10009126 309
636 3300025297 Ga0209758_1001298 Ga0209758_100129818 309
637 3300025297 Ga0209758_1001642 Ga0209758_100164219 309
638 3300025297 Ga0209758_1006687 Ga0209758_10066875 309
639 3300025298 Ga0209050_1000160 Ga0209050_100016074 309
640 3300025298 Ga0209050_1000305 Ga0209050_100030575 309
641 3300025298 Ga0209050_1024244 Ga0209050_10242442 309
642 3300025302 Ga0207426_1000051 Ga0207426_100005145 309
643 3300025302 Ga0207426_1000104 Ga0207426_1000104121 309
644 3300025302 Ga0207426_1000360 Ga0207426_100036048 309
645 3300025302 Ga0207426_1001364 Ga0207426_10013645 309
646 3300025302 Ga0207426_1001887 Ga0207426_10018876 309
647 3300025302 Ga0207426_1006794 Ga0207426_10067944 309
648 3300025303 Ga0209051_1045884 Ga0209051_10458842 309
649 3300025304 Ga0209257_1000001 Ga0209257_1000001894 309
650 3300025304 Ga0209257_1001540 Ga0209257_100154022 309
651 3300025304 Ga0209257_1004420 Ga0209257_10044202 309
652 3300025321 Ga0207656_10171817 Ga0207656_101718171 309
653 3300025901 Ga0207688_10029574 Ga0207688_100295742 309
654 3300025903 Ga0207680_10000177 Ga0207680_1000017716 309
655 3300025903 Ga0207680_10013867 Ga0207680_100138672 309
656 3300025903 Ga0207680_10308040 Ga0207680_103080401 309
657 3300025904 Ga0207647_10021677 Ga0207647_100216775 309
658 3300025907 Ga0207645_10000284 Ga0207645_100002842 309
659 3300025907 Ga0207645_10043803 Ga0207645_100438032 309
660 3300025911 Ga0207654_10005471 Ga0207654_100054713 309
661 3300025911 Ga0207654_10007056 Ga0207654_100070563 309
662 3300025911 Ga0207654_10275318 Ga0207654_102753182 309
663 3300025913 Ga0207695_10000346 Ga0207695_1000034649 309
664 3300025914 Ga0207671_10000987 Ga0207671_100009872 309
665 3300025914 Ga0207671_10001776 Ga0207671_1000177624 309
666 3300025914 Ga0207671_10002977 Ga0207671_100029778 309
667 3300025914 Ga0207671_10254657 Ga0207671_102546572 309
668 3300025918 Ga0207662_10030020 Ga0207662_100300204 309
669 3300025919 Ga0207657_10047967 Ga0207657_100479673 309
670 3300025921 Ga0207652_10181113 Ga0207652_101811133 309
671 3300025923 Ga0207681_10036284 Ga0207681_100362845 309
672 3300025923 Ga0207681_10054871 Ga0207681_100548712 309
673 3300025924 Ga0207694_10006626 Ga0207694_100066265 309
674 3300025924 Ga0207694_10070024 Ga0207694_100700243 309
675 3300025925 Ga0207650_10043496 Ga0207650_100434962 309
676 3300025925 Ga0207650_10117432 Ga0207650_101174322 309
677 3300025925 Ga0207650_10268998 Ga0207650_102689982 309
678 3300025926 Ga0207659_10037293 Ga0207659_100372932 309
679 3300025926 Ga0207659_10089587 Ga0207659_100895872 309
680 3300025926 Ga0207659_10460210 Ga0207659_104602101 309
681 3300025932 Ga0207690_10000235 Ga0207690_1000023538 309
682 3300025933 Ga0207706_10002489 Ga0207706_100024896 309
683 3300025933 Ga0207706_10007739 Ga0207706_100077397 309
684 3300025934 Ga0207686_10083451 Ga0207686_100834512 309
685 3300025934 Ga0207686_10153070 Ga0207686_101530702 309
686 3300025938 Ga0207704_10025050 Ga0207704_100250502 309
687 3300025938 Ga0207704_10157061 Ga0207704_101570612 309
688 3300025940 Ga0207691_10278685 Ga0207691_102786852 309
689 3300025942 Ga0207689_10003255 Ga0207689_1000325510 309
690 3300025942 Ga0207689_10004450 Ga0207689_100044504 309
691 3300025942 Ga0207689_10007607 Ga0207689_100076077 309
692 3300025942 Ga0207689_10025014 Ga0207689_100250146 309
693 3300025942 Ga0207689_10098104 Ga0207689_100981042 309
694 3300025945 Ga0207679_10060688 Ga0207679_100606882 309
695 3300025949 Ga0207667_10006159 Ga0207667_100061596 309
696 3300025949 Ga0207667_10036938 Ga0207667_100369384 309
697 3300025960 Ga0207651_10007927 Ga0207651_100079272 309
698 3300025960 Ga0207651_10053860 Ga0207651_100538603 309
699 3300025960 Ga0207651_10200619 Ga0207651_102006192 309
700 3300025961 Ga0207712_10064573 Ga0207712_100645732 309
701 3300025961 Ga0207712_10088045 Ga0207712_100880452 309
702 3300025972 Ga0207668_10238644 Ga0207668_102386441 309
703 3300025981 Ga0207640_10029277 Ga0207640_100292772 309
704 3300025981 Ga0207640_10066244 Ga0207640_100662442 309
705 3300025981 Ga0207640_10079304 Ga0207640_100793042 309
706 3300025986 Ga0207658_10041566 Ga0207658_100415662 309
707 3300025986 Ga0207658_10080217 Ga0207658_100802172 309
708 3300025986 Ga0207658_10251450 Ga0207658_102514502 309
709 3300026023 Ga0207677_10014564 Ga0207677_100145642 309
710 3300026023 Ga0207677_10042043 Ga0207677_100420434 309
711 3300026023 Ga0207677_10058309 Ga0207677_100583092 309
712 3300026023 Ga0207677_10152591 Ga0207677_101525912 309
713 3300026035 Ga0207703_10009385 Ga0207703_100093852 309
714 3300026041 Ga0207639_10135971 Ga0207639_101359713 309
715 3300026041 Ga0207639_10157414 Ga0207639_101574141 309
716 3300026075 Ga0207708_10072648 Ga0207708_100726482 309
717 3300026078 Ga0207702_10001281 Ga0207702_1000128119 309
718 3300026078 Ga0207702_10346179 Ga0207702_103461792 309
719 3300026088 Ga0207641_10000090 Ga0207641_1000009044 309
720 3300026088 Ga0207641_10000111 Ga0207641_1000011171 309
721 3300026088 Ga0207641_10002912 Ga0207641_100029128 309
722 3300026088 Ga0207641_10216546 Ga0207641_102165462 309
723 3300026089 Ga0207648_10000383 Ga0207648_1000038322 309
724 3300026089 Ga0207648_10022129 Ga0207648_100221297 309
725 3300026095 Ga0207676_10008833 Ga0207676_100088334 309
726 3300026116 Ga0207674_10004856 Ga0207674_100048563 309
727 3300026116 Ga0207674_10007260 Ga0207674_1000726010 309
728 3300026118 Ga0207675_100012579 Ga0207675_1000125797 309
729 3300026118 Ga0207675_100067386 Ga0207675_1000673864 309
730 3300026121 Ga0207683_10002635 Ga0207683_1000263514 309
731 3300026121 Ga0207683_10022617 Ga0207683_100226171 309
732 3300026121 Ga0207683_10023168 Ga0207683_100231683 309
733 3300026142 Ga0207698_10036136 Ga0207698_100361362 309
734 3300026142 Ga0207698_10119007 Ga0207698_101190072 309
735 3300026142 Ga0207698_10290671 Ga0207698_102906712 309
736 3300028379 Ga0268266_10073432 Ga0268266_100734322 309
737 3300028380 Ga0268265_10530521 Ga0268265_105305211 309
738 3300028381 Ga0268264_10000079 Ga0268264_1000007929 309
739 3300028381 Ga0268264_10023200 Ga0268264_100232004 309
740 3300028381 Ga0268264_10047692 Ga0268264_100476923 309
741 3300028381 Ga0268264_10170640 Ga0268264_101706402 309
742 3300028794 Ga0307515_10000078 Ga0307515_10000078154 309
743 3300028794 Ga0307515_10000290 Ga0307515_1000029080 309
744 3300030521 Ga0307511_10002426 Ga0307511_100024268 309
745 3300030731 Ga0316177_1183670 Ga0316177_11836701 309
746 3300030732 Ga0316176_1098279 Ga0316176_109827936 309
747 3300030742 Ga0316183_1030332 Ga0316183_10303324 309
748 3300030744 Ga0316181_1084052 Ga0316181_108405236 309
749 3300031251 Ga0265327_10036126 Ga0265327_100361262 309
750 3300031456 Ga0307513_10011825 Ga0307513_100118256 309
751 3300031456 Ga0307513_10063761 Ga0307513_100637613 309
752 3300031507 Ga0307509_10025814 Ga0307509_100258146 309
753 3300031507 Ga0307509_10262811 Ga0307509_102628112 309
754 3300031911 Ga0307412_10057868 Ga0307412_100578685 309
755 3300032004 Ga0307414_10000332 Ga0307414_1000033214 309
756 3300032004 Ga0307414_10006443 Ga0307414_100064433 309
757 3300032004 Ga0307414_10010074 Ga0307414_100100746 309
758 3300032004 Ga0307414_10029605 Ga0307414_100296052 309
759 3300032004 Ga0307414_10117073 Ga0307414_101170732 309
760 3300032004 Ga0307414_10354131 Ga0307414_103541311 309
761 3300032005 Ga0307411_10110350 Ga0307411_101103502 309
762 3300033179 Ga0307507_10000032 Ga0307507_1000003283 309
763 3300035172 Ga0373955_0018775 Ga0373955_0018775_2029_2973 309
764 3300035410 Ga0373924_0081276 Ga0373924_0081276_363_1307 309
765 3300036401 Ga0373937_0005416 Ga0373937_0005416_3338_4282 309
766 3300037312 Ga0395899_0000002 Ga0395899_0000002_51137_52081 309
767 3300037312 Ga0395899_0012334 Ga0395899_0012334_1229_2161 309
768 3300037418 Ga0395900_0000284 Ga0395900_0000284_61901_62830 309
769 3300037418 Ga0395900_0000701 Ga0395900_0000701_235_1167 309
770 3300037418 Ga0395900_0003637 Ga0395900_0003637_9967_10899 309
771 3300037418 Ga0395900_0079340 Ga0395900_0079340_1050_1982 309
772 3300037466 Ga0395898_0003757 Ga0395898_0003757_15688_16620 309
773 3300037466 Ga0395898_0004276 Ga0395898_0004276_3306_4238 309
774 3300037471 Ga0395905_0001420 Ga0395905_0001420_6340_7284 309
775 3300038443 Ga0395901_0084967 Ga0395901_0084967_2314_3246 309
776 3300038443 Ga0395901_0346086 Ga0395901_0346086_337_1269 309
777 3300038443 Ga0395901_0355930 Ga0395901_0355930_242_1174 309
778 3300041407 Ga0439447_000820 Ga0439447_000820_5229_6161 309
779 3300041997 Ga0439431_0009916 Ga0439431_0009916_406_1335 309
780 3300042876 Ga0451577_0215713 Ga0451577_0215713_331_1290 309
781 3300044658 Ga0466972_0000047 Ga0466972_0000047_73531_74469 309
782 3300044658 Ga0466972_0022806 Ga0466972_0022806_32_976 309
783 3300044673 Ga0453683_0006615 Ga0453683_0006615_6136_7095 309
784 3300044712 Ga0453684_0246880 Ga0453684_0246880_316_1275 309
785 3300044842 Ga0466957_0146978 Ga0466957_0146978_559_1500 309
786 3300045049 Ga0466959_0010259 Ga0466959_0010259_5038_5982 309
787 3300045051 Ga0451576_0036117 Ga0451576_0036117_245_1204 309
788 3300046453 Ga0495627_004361 Ga0495627_004361_1327_2268 309
789 3300046460 Ga0495638_0020710 Ga0495638_0020710_1032_1961 309
790 3300046471 Ga0495650_0000162 Ga0495650_0000162_33631_34566 309
791 3300046506 Ga0495583_0033179 Ga0495583_0033179_652_1587 309
792 3300046507 Ga0495606_0001495 Ga0495606_0001495_915_1850 309
793 3300046512 Ga0495610_0006790 Ga0495610_0006790_2113_3048 309
794 3300046514 Ga0495618_0062568 Ga0495618_0062568_609_1553 309
795 3300046516 Ga0495628_0042148 Ga0495628_0042148_2561_3505 309
796 3300046524 Ga0495648_0003925 Ga0495648_0003925_10506_11435 309
797 3300046524 Ga0495648_0035510 Ga0495648_0035510_387_1337 309
798 3300046536 Ga0495587_0022367 Ga0495587_0022367_513_1457 309
799 3300046538 Ga0495609_0026185 Ga0495609_0026185_620_1549 309
800 3300046538 Ga0495609_0026969 Ga0495609_0026969_1499_2449 309
801 3300046559 Ga0495667_0164769 Ga0495667_0164769_373_1317 309
802 3300046616 Ga0495668_0000009 Ga0495668_0000009_151334_152284 309
803 3300046616 Ga0495668_0002458 Ga0495668_0002458_11115_12053 309
804 3300046642 Ga0495634_0022653 Ga0495634_0022653_100_1044 309
805 3300046660 Ga0495625_0000515 Ga0495625_0000515_27962_28897 309
806 3300046660 Ga0495625_0000534 Ga0495625_0000534_29000_29950 309
807 3300046665 Ga0495661_0005923 Ga0495661_0005923_7372_8310 309
808 3300046665 Ga0495661_0019164 Ga0495661_0019164_3270_4205 309
809 3300046675 Ga0495657_0129231 Ga0495657_0129231_193_1137 309
810 3300046694 Ga0495649_0000009 Ga0495649_0000009_148510_149445 309
811 3300047320 Ga0495672_0011690 Ga0495672_0011690_1404_2333 309
812 3300047320 Ga0495672_0018509 Ga0495672_0018509_32_970 309
813 3300047471 Ga0495684_0104206 Ga0495684_0104206_756_1700 309
814 3300047472 Ga0495686_0000471 Ga0495686_0000471_58371_59309 309
815 3300047472 Ga0495686_0011123 Ga0495686_0011123_1186_2130 309
816 3300047472 Ga0495686_0051693 Ga0495686_0051693_600_1535 309
817 3300048914 Ga0496111_0046852 Ga0496111_0046852_20_964 309
818 3300048917 Ga0496114_0338270 Ga0496114_0338270_27_971 309
819 3300048924 Ga0496121_0007063 Ga0496121_0007063_2786_3721 309
820 3300048927 Ga0496124_0018530 Ga0496124_0018530_4630_5562 309
821 3300048927 Ga0496124_0037765 Ga0496124_0037765_1602_2555 309
822 3300048928 Ga0496125_0000018 Ga0496125_0000018_327822_328754 309
823 3300049571 Ga0501034_0016304 Ga0501034_0016304_5030_5968 309
824 3300049571 Ga0501034_0167941 Ga0501034_0167941_529_1476 309
825 3300049742 Ga0501080_0273511 Ga0501080_0273511_456_1415 309
826 3300049758 Ga0501241_000156 Ga0501241_000156_6431_7372 309
827 3300049822 Ga0501035_0138657 Ga0501035_0138657_62_1000 309
828 3300049823 Ga0501044_0497785 Ga0501044_0497785_144_1082 309
829 3300050493 nmdc:mga0k408_144193_c1 nmdc:mga0k408_144193_c1_43_972 309
830 3300050493 nmdc:mga0k408_85_c1 nmdc:mga0k408_85_c1_33297_34247 309
831 3300050496 nmdc:mga07m45_110018_c1 nmdc:mga07m45_110018_c1_453_1388 309
832 3300053085 Ga0495619_0061084 Ga0495619_0061084_485_1429 309
833 3300053086 Ga0500578_0000765 Ga0500578_0000765_16394_17332 309
834 3300053090 Ga0500646_0006420 Ga0500646_0006420_446_1384 309
835 3300053092 Ga0500583_0062394 Ga0500583_0062394_699_1628 309
836 3300053096 Ga0500641_0099399 Ga0500641_0099399_239_1183 309
837 3300053108 Ga0500562_000098 Ga0500562_000098_21260_22195 309
838 3300053118 Ga0500594_0018846 Ga0500594_0018846_280_1218 309
839 3300053125 Ga0500618_008553 Ga0500618_008553_340_1284 309
840 3300053130 Ga0500642_0033770 Ga0500642_0033770_611_1558 309
841 3300053139 Ga0500568_0020257 Ga0500568_0020257_240_1178 309
842 3300053139 Ga0500568_0024275 Ga0500568_0024275_589_1530 309
843 3300053139 Ga0500568_0060527 Ga0500568_0060527_176_1105 309
844 3300053156 Ga0500622_0002797 Ga0500622_0002797_11023_11952 309
845 3300053727 Ga0500611_000024 Ga0500611_000024_177_1127 309
846 iso_pu_bacteria 2929177148 2929178104 309
847 iso_pu_bacteria 2945977869 2945980466 309
848 iso_pu_bacteria 2946013367 2946013672 309
849 3300003323 rootH1_10330688 rootH1_103306882 310
850 3300005288 Ga0065714_10003215 Ga0065714_100032154 310
851 3300032004 Ga0307414_10000903 Ga0307414_100009037 310
852 3300046453 Ga0495627_037920 Ga0495627_037920_411_1367 310
853 3300049744 Ga0501083_0133403 Ga0501083_0133403_397_1335 310
854 3300053096 Ga0500641_0000007 Ga0500641_0000007_145149_146105 310
855 iso_pu_bacteria 2904445276 2904447319 310
856 3300002737 JGI25162J39368_1001640 JGI25162J39368_10016409 311
857 3300009093 Ga0105240_10074083 Ga0105240_100740833 311
858 3300010375 Ga0105239_10041485 Ga0105239_100414854 311
859 3300013105 Ga0157369_10044786 Ga0157369_100447864 311
860 3300013307 Ga0157372_10098575 Ga0157372_100985752 311
861 3300025226 Ga0209674_100329 Ga0209674_10032910 311
862 3300025233 Ga0209437_100719 Ga0209437_1007199 311
863 iso_pu_bacteria 2842909656 2842914909 311
864 3300025913 Ga0207695_10036487 Ga0207695_100364873 312
865 3300044673 Ga0453683_0059188 Ga0453683_0059188_376_1365 313
866 3300005563 Ga0068855_100158197 Ga0068855_1001581972 314
867 3300013104 Ga0157370_10059379 Ga0157370_100593793 314
868 3300013306 Ga0163162_10000123 Ga0163162_1000012324 314
869 3300013308 Ga0157375_10091846 Ga0157375_100918462 314
870 3300014497 Ga0182008_10000461 Ga0182008_1000046114 314
871 3300039437 Ga0436365_1399871 Ga0436365_1399871_10620_11570 314
872 3300044684 Ga0466966_0000047 Ga0466966_0000047_56005_57021 318
873 3300044765 Ga0466970_0094577 Ga0466970_0094577_247_1263 318
874 3300045049 Ga0466959_0000065 Ga0466959_0000065_47080_48096 318
875 3300017792 Ga0163161_10000979 Ga0163161_100009797 322
876 3300025914 Ga0207671_10004116 Ga0207671_1000411614 322
877 3300046558 Ga0495633_0000005 Ga0495633_0000005_156994_157977 323
878 3300053093 Ga0500651_0118206 Ga0500651_0118206_565_1548 323
879 2162886007 SwRhRL2b_contig_1524932 SwRhRL2b_0809.00006310 324
880 3300005288 Ga0065714_10004671 Ga0065714_100046717 324
881 3300005288 Ga0065714_10064770 Ga0065714_100647705 324
882 3300005289 Ga0065704_10070374 Ga0065704_1007037417 324
883 3300005367 Ga0070667_100003595 Ga0070667_10000359510 324
884 3300005617 Ga0068859_100007469 Ga0068859_1000074693 324
885 3300005843 Ga0068860_100005896 Ga0068860_1000058969 324
886 3300006931 Ga0097620_100007469 Ga0097620_1000074693 324
887 3300013100 Ga0157373_10000936 Ga0157373_1000093618 324
888 3300013102 Ga0157371_10003525 Ga0157371_100035255 324
889 3300013297 Ga0157378_10021640 Ga0157378_100216403 324
890 3300014497 Ga0182008_10000025 Ga0182008_10000025116 324
891 3300015261 Ga0182006_1001592 Ga0182006_10015925 324
892 3300025986 Ga0207658_10013982 Ga0207658_100139824 324
893 3300031911 Ga0307412_10000001 Ga0307412_10000001451 324
894 3300032004 Ga0307414_10000502 Ga0307414_1000050216 324
895 3300053093 Ga0500651_0000230 Ga0500651_0000230_3278_4252 324
896 iso_pu_bacteria 2738541284 2738761472 324

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01370

Epimerase

NAD dependent epimerase/dehydratase family

5

240

0.98

PF16363

GDP_Man_Dehyd

GDP-mannose 4,6 dehydratase

7

302

0.82

PF04321

RmlD_sub_bind

RmlD substrate binding domain

3

304

0.77

Structural Annotation

Top 5 Hits

ID Description Score Start End
1e7q-assembly1.cif.gz_A-2 gdp 4-keto-6-deoxy-d-mannose epimerase reductase s107a 0.9728 19 321
1e7r-assembly1.cif.gz_A-2 gdp 4-keto-6-deoxy-d-mannose epimerase reductase y136e 0.9727 19 321
1e7s-assembly1.cif.gz_A-2 gdp 4-keto-6-deoxy-d-mannose epimerase reductase k140r 0.9654 19 322
1e6u-assembly1.cif.gz_A-2 gdp 4-keto-6-deoxy-d-mannose epimerase reductase 0.9643 19 321
8ewu-assembly1.cif.gz_A x-ray structure of the gdp-6-deoxy-4-keto-d-lyxo-heptose-4-reductase from campylobacter jejuni hs:15 0.9622 17 320
ID Description Score Start End Superfamily
1e6uA02 Alpha Beta;Alpha-Beta Complex;UDP-galactose 4-epimerase; domain 1;UDP-galactose 4-epimerase, domain 1 0.9323 184 321 3.90.25.10
4bkpC01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9124 19 255 3.40.50.720
af_A0A0R0KMW5_231_418_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9122 152 324 3.40.50.720
1e6uA02 Alpha Beta;Alpha-Beta Complex;UDP-galactose 4-epimerase; domain 1;UDP-galactose 4-epimerase, domain 1 0.9037 184 321 3.90.25.10
6aqyC02 Alpha Beta;Alpha-Beta Complex;UDP-galactose 4-epimerase; domain 1;UDP-galactose 4-epimerase, domain 1 0.9019 184 321 3.90.25.10
ID Description Score Start End GO Terms
AF-A0A2A4Q680-F1-model_v4 GDP-fucose synthetase 1.002 16 154 GO:0050577
AF-A0A4Q3TSA3-F1-model_v4 deleted 1.001 16 176
AF-A0A2M7R8L0-F1-model_v4 GDP-fucose synthetase 1.001 16 171 GO:0050577
AF-A0A356R231-F1-model_v4 GDP-fucose synthetase 0.9994 16 162 GO:0050577
AF-A0A4Q3FS72-F1-model_v4 GDP-L-fucose synthase 0.9977 16 273 GO:0016853
GO:0050577

Feature Viewer

pLDDT pTM Quality
93.38 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map