F485034
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 896 | 375 | 824 | 311 |
Family's Representative Sequence
| Representative Sequence | iso_pu_bacteria|2884634485|2884634839 |
| Length | 319 |
| Sequence | RNTRIYIAGHRGMVGSAIWRKLEAEGYTNLIGKTSAELDLRNQAAVQDFFKAEKPELVIDAAARVGGILANNTYPYQFLMENLQIQNNLIDTAFHSGVEKFIFLGSSCIYPKLAPQPLKEEYLLTAPLEPTNEWYAIAKIAGVKACEAIRKQYGKDYISLMPTNLYGPHDNFDLKTSHVLPSMIRKFHEAKQYAVGSKQSTVTLWGSGTPMREFLYVEDLAEAVVFAMENKFSDNLYNVGTGEDLTIKDLALLIQKIVGHTGEIIWDSTKPDGTPRKLMDVSKMEKAGWKAKTSLEDGIRKTYEWFLENQDSVKQVKMG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 2 | 2513020052 | Flavobacterium sp. CF136 | Isolate | Rhizosphere |
| 3 | 2513237088 | Rhizobium mesoamericanum STM6155 | Isolate | Nodule |
| 4 | 2519899754 | Flavobacterium sp. F52 | Isolate | Rhizosphere |
| 5 | 2522125168 | Dyadobacter beijingensis DSM 21582 | Isolate | Rhizosphere |
| 6 | 2582581873 | Chryseobacterium sp. OV259 | Isolate | Rhizosphere |
| 7 | 2585427687 | Pedobacter borealis DSM 19626 | Isolate | Rhizosphere |
| 8 | 2643221667 | Flavobacterium sp. Root420 | Isolate | Unclassified |
| 9 | 2643221725 | Flavobacterium sp. Root935 | Isolate | Unclassified |
| 10 | 2721755487 | Sphingobacterium sp. B29 | Isolate | Rhizosphere |
| 11 | 2738541283 | Pedobacter sp. OK701 | Isolate | Unclassified |
| 12 | 2738541284 | Pedobacter sp. YR016 | Isolate | Unclassified |
| 13 | 2738543023 | Pedobacter sp. OK628 | Isolate | Unclassified |
| 14 | 2739367651 | Pedobacter sp. OK291 | Isolate | Unclassified |
| 15 | 2739367857 | Flavobacterium sp. GV029 | Isolate | Unclassified |
| 16 | 2739367858 | Flavobacterium sp. GV028 | Isolate | Unclassified |
| 17 | 2775506987 | Pedobacter ginsengisoli T01R-27 | Isolate | Unclassified |
| 18 | 2802428842 | Flavobacterium sp. S87F.05.LMB.W.Kidney.N | Isolate | Unclassified |
| 19 | 2818991437 | Pedobacter terrae 518 | Isolate | Unclassified |
| 20 | 2818991442 | Chitinophaga pinensis 1204 | Isolate | Unclassified |
| 21 | 2818991444 | Filimonas endophytica 3197 | Isolate | Unclassified |
| 22 | 2818991460 | Chitinophaga polysaccharea 1209 | Isolate | Unclassified |
| 23 | 2821136567 | Chitinophaga sancti 1232 | Isolate | Unclassified |
| 24 | 2839989709 | Pontibacter arcticus 2b14 | Isolate | Unclassified |
| 25 | 2842722452 | Pedobacter sp. R-72249 | Isolate | Unclassified |
| 26 | 2842903701 | Olivibacter sp. R-72191 | Isolate | Unclassified |
| 27 | 2842909656 | Pedobacter sp. R-72393 | Isolate | Unclassified |
| 28 | 2849281842 | Pedobacter sp. AK013 | Isolate | Rhizosphere |
| 29 | 2852623160 | Mucilaginibacter sp. AK015 | Isolate | Rhizosphere |
| 30 | 2852627209 | Pedobacter sp. AK017 | Isolate | Rhizosphere |
| 31 | 2857618242 | Flavobacterium sp. R-74482 | Isolate | Unclassified |
| 32 | 2883068021 | Chitinophaga rhizosphaerae T16R-86 | Isolate | Rhizosphere |
| 33 | 2884634485 | Algoriphagus kandeliae XY-J91 | Isolate | Unclassified |
| 34 | 2884791551 | Chitinophaga oryzae 1310 | Isolate | Unclassified |
| 35 | 2884933994 | Mucilaginibacter sp. 14171R-50 | Isolate | Rhizosphere |
| 36 | 2896109856 | Chitinophaga sp. SYP-B3965 | Isolate | Rhizosphere |
| 37 | 2896344016 | Sphingobacterium sp. SGL-16 | Isolate | Rhizosphere |
| 38 | 2902048731 | Pedobacter ureilyticus THG-T11 | Isolate | Rhizosphere |
| 39 | 2904445276 | Pedobacter terrae 1734 | Isolate | Rhizosphere |
| 40 | 2904467357 | Chitinophaga sancti 3198 | Isolate | Unclassified |
| 41 | 2911138879 | Spirosoma sp. KUDC1026 | Isolate | Rhizosphere |
| 42 | 2919191525 | Flavobacterium sp. 2755 | Isolate | Rhizosphere |
| 43 | 2919683626 | Flavobacterium piscis 4129 | Isolate | Unclassified |
| 44 | 2919692658 | Algoriphagus sp. 4150 | Isolate | Rhizosphere |
| 45 | 2929150217 | Flavobacterium sp. R-74510 Hybrid assembly | Isolate | Unclassified |
| 46 | 2929154850 | Filimonas sp. R-72421 Hybrid assembly | Isolate | Unclassified |
| 47 | 2929177148 | Chitinophaga sp. R-72269 Hybrid assembly | Isolate | Unclassified |
| 48 | 2929921140 | Chitinophaga sp. R-72609 Hybrid assembly | Isolate | Unclassified |
| 49 | 2945977869 | Chitinophaga sp. W2I13 | Isolate | Rhizosphere |
| 50 | 2946013367 | Chitinophaga sp. W3I9 | Isolate | Rhizosphere |
| 51 | 2954016120 | Flavobacterium sp. W4I14 | Isolate | Rhizosphere |
| 52 | 2958512119 | Flavobacterium sp. Sd200 | Isolate | Rhizosphere |
| 53 | 2977243572 | Chryseobacterium sp. SORGH_AS 447 | Isolate | Unclassified |
| 54 | 2977268062 | Flavobacterium sp. SORGH_AS 622 | Isolate | Unclassified |
| 55 | 2984572630 | Chryseobacterium sp. SORGH_AS909 | Isolate | Aerial Root |
| 56 | 2984606641 | Chryseobacterium sp. SORGH_AS1175 | Isolate | Aerial Root |
| 57 | 2989349275 | Shinella kummerowiae CCBAU 25048 | Isolate | Unclassified |
| 58 | 3003233435 | Sphingobacterium shayense CrR18 | Isolate | Unclassified |
| 59 | 3300001904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 | Metagenome | Rhizosphere |
| 60 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 61 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 62 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 63 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 64 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 65 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 66 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 67 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 68 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 69 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 70 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 71 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 72 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 73 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 74 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 75 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 76 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 77 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 78 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 79 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 80 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 81 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 82 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 83 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 84 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 85 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 86 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 87 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 88 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 89 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 90 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 91 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 92 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 93 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 94 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 95 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 96 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 97 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 98 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 99 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 100 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 101 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 102 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 103 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 104 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 105 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 106 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 107 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 108 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 109 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 110 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 111 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 112 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 113 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 114 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 115 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 116 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 117 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 118 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 119 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 120 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 121 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 122 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 123 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 124 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 125 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 126 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 127 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 128 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 129 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 130 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 131 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 132 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 133 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 134 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 135 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 136 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 137 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 138 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 140 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 141 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 142 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 143 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 144 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 145 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 146 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 148 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 149 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 151 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 153 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 154 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 155 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 156 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 157 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 158 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 159 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 160 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 161 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 162 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 163 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 164 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 165 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 166 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 167 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 168 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 169 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 170 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 171 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 172 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 173 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 174 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 175 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 176 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 177 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 178 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 179 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 180 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 181 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 182 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 183 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 184 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 185 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 186 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 187 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 188 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 189 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 190 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 191 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 192 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 193 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 194 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 234 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 235 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 236 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 237 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 238 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 239 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 240 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 241 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 242 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 243 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 244 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 245 | 3300030731 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 | Metagenome | Rhizosphere |
| 246 | 3300030732 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 | Metagenome | Rhizosphere |
| 247 | 3300030742 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 | Metagenome | Rhizosphere |
| 248 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 249 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 250 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 251 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 252 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 253 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 254 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 255 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 256 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 257 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 258 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 259 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 260 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 261 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 262 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 263 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 264 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 265 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 266 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 267 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 268 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 269 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 270 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 271 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 272 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 273 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 274 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 275 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 276 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 277 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 278 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 279 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 280 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 281 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 282 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 283 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 284 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 285 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 286 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 287 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 288 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 325 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 326 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 327 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 328 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 329 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 330 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 331 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 332 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 333 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 334 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 335 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 336 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 337 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 338 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 339 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 340 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 341 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 342 | 3300049690 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought | Metagenome | Rhizosphere |
| 343 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 344 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 345 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 346 | 3300049763 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control | Metagenome | Rhizosphere |
| 347 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 348 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 349 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 350 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 351 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 352 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 353 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 354 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 356 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 357 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 358 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 359 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 360 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 361 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 362 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 363 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 364 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 365 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 366 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 367 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 368 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 369 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 370 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 371 | 8003151029 | Chitinophaga sp. GbtcB8 | Isolate | Unclassified |
| 372 | 8055419101 | Flavobacterium tyrosinilyticum KCTC 42726 | Isolate | Rhizosphere |
| 373 | 8055588893 | Parapedobacter lycopersici KACC 18788 | Isolate | Rhizosphere |
| 374 | 8055592153 | Flavobacterium panacis DCY106 | Isolate | Rhizosphere |
| 375 | 8056440228 | Flavobacterium hibisci THG-HG1.4 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 91.85 |
| Metatranscriptomes | 0 |
| Isolates | 8.15 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.22 |
| Bulb | 0 |
| Endosphere | 10.38 |
| Nodule | 0.11 |
| Rhizoplane | 0.33 |
| Rhizosphere | 77.79 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 11.16 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL2b_contig_1524932 | 2162886007 | Bacteria | 15202 |
| 2 | JGI24736J21556_1000844 | 3300001904 | Bacteria | 5654 |
| 3 | JGI24740J21852_10000688 | 3300001979 | Bacteria | 14666 |
| 4 | JGI24740J21852_10002889 | 3300001979 | Bacteria | 7682 |
| 5 | JGI24740J21852_10006644 | 3300001979 | Bacteria | 4767 |
| 6 | JGI24739J22299_10001392 | 3300001989 | Bacteria | 9093 |
| 7 | JGI24739J22299_10053156 | 3300001989 | Bacteria | 1301 |
| 8 | JGI24737J22298_10016126 | 3300001990 | Bacteria | 2413 |
| 9 | JGI24735J21928_10043102 | 3300002067 | Bacteria | 1313 |
| 10 | JGI25162J39368_1001124 | 3300002737 | Bacteria | 16113 |
| 11 | JGI25162J39368_1001640 | 3300002737 | Bacteria | 11150 |
| 12 | JGI25154J39366_1000003 | 3300002738 | Bacteria | 397627 |
| 13 | JGI25154J39366_1000014 | 3300002738 | Bacteria | 265287 |
| 14 | JGI25157J39369_1002583 | 3300002741 | Bacteria | 4322 |
| 15 | JGI25164J39214_1001008 | 3300002772 | Bacteria | 8770 |
| 16 | JGI25151J46595_10010532 | 3300003187 | Bacteria | 4289 |
| 17 | JGI25165J46597_1000923 | 3300003214 | Bacteria | 20349 |
| 18 | JGI25153J46596_10000539 | 3300003215 | Bacteria | 23685 |
| 19 | JGI25153J46596_10002851 | 3300003215 | Bacteria | 9818 |
| 20 | JGI25153J46596_10037146 | 3300003215 | Bacteria | 1552 |
| 21 | rootH1_10018273 | 3300003316 | Bacteria | 26474 |
| 22 | rootH1_10033731 | 3300003316 | Bacteria | 6741 |
| 23 | rootH1_10101991 | 3300003316 | Bacteria | 3825 |
| 24 | rootH2_10013030 | 3300003320 | Bacteria | 7264 |
| 25 | rootH2_10036622 | 3300003320 | Bacteria | 17189 |
| 26 | rootH2_10160054 | 3300003320 | Bacteria | 1458 |
| 27 | rootL2_10004925 | 3300003322 | Bacteria | 14721 |
| 28 | rootL2_10005069 | 3300003322 | Bacteria | 20828 |
| 29 | rootL2_10022797 | 3300003322 | Bacteria | 7476 |
| 30 | rootL2_10043862 | 3300003322 | Bacteria | 1900 |
| 31 | rootL2_10131047 | 3300003322 | Bacteria | 4144 |
| 32 | rootL2_10163672 | 3300003322 | Bacteria | 2548 |
| 33 | rootL2_10173005 | 3300003322 | Bacteria | 3386 |
| 34 | rootL2_10366376 | 3300003322 | Bacteria | 1400 |
| 35 | rootH1_10003366 | 3300003316 | Bacteria | 5707 |
| 36 | rootH1_10003366 | 3300003323 | Bacteria | 132108 |
| 37 | rootH1_10004759 | 3300003323 | Bacteria | 40082 |
| 38 | rootH1_10010201 | 3300003323 | Bacteria | 42291 |
| 39 | rootH1_10010647 | 3300003323 | Bacteria | 12387 |
| 40 | rootH1_10026775 | 3300003323 | Bacteria | 37408 |
| 41 | rootH1_10027324 | 3300003323 | Bacteria | 28607 |
| 42 | rootH1_10032632 | 3300003323 | Bacteria | 15899 |
| 43 | rootH1_10072115 | 3300003323 | Bacteria | 3183 |
| 44 | rootH1_10130033 | 3300003323 | Bacteria | 6041 |
| 45 | rootH1_10131898 | 3300003323 | Bacteria | 4675 |
| 46 | rootH1_10148682 | 3300003323 | Bacteria | 2949 |
| 47 | rootH1_10190090 | 3300003323 | Bacteria | 2644 |
| 48 | rootH1_10283993 | 3300003323 | Bacteria | 2232 |
| 49 | rootH1_10330688 | 3300003323 | Bacteria | 4384 |
| 50 | JGI25160J50197_1000175 | 3300003354 | Bacteria | 54393 |
| 51 | JGI25160J50197_1002813 | 3300003354 | Bacteria | 7967 |
| 52 | JGI25160J50197_1004550 | 3300003354 | Bacteria | 5976 |
| 53 | JGI25160J50197_1008609 | 3300003354 | Bacteria | 3875 |
| 54 | JGI25160J50197_1017025 | 3300003354 | Bacteria | 2319 |
| 55 | JGI25160J50197_1032984 | 3300003354 | Bacteria | 1308 |
| 56 | Ga0055526_1000270 | 3300003771 | Bacteria | 43854 |
| 57 | Ga0055536_1000002 | 3300003781 | Bacteria | 605605 |
| 58 | Ga0055528_1000108 | 3300003790 | Bacteria | 66828 |
| 59 | Ga0055528_1001425 | 3300003790 | Bacteria | 14634 |
| 60 | Ga0055530_10000183 | 3300003791 | Bacteria | 56206 |
| 61 | Ga0055530_10000279 | 3300003791 | Bacteria | 46371 |
| 62 | Ga0055531_10000093 | 3300003794 | Bacteria | 97901 |
| 63 | Ga0055543_1011139 | 3300004625 | Bacteria | 1855 |
| 64 | Ga0065165_1000036 | 3300005262 | Bacteria | 212900 |
| 65 | Ga0065165_1000548 | 3300005262 | Bacteria | 56570 |
| 66 | Ga0065165_1000814 | 3300005262 | Bacteria | 41379 |
| 67 | Ga0065165_1007727 | 3300005262 | Bacteria | 5205 |
| 68 | Ga0065714_10003215 | 3300005288 | Bacteria | 9296 |
| 69 | Ga0065714_10004671 | 3300005288 | Bacteria | 7854 |
| 70 | Ga0065714_10009252 | 3300005288 | Bacteria | 2961 |
| 71 | Ga0065714_10014084 | 3300005288 | Bacteria | 3638 |
| 72 | Ga0065714_10015372 | 3300005288 | Bacteria | 2871 |
| 73 | Ga0065714_10064770 | 3300005288 | Bacteria | 19370 |
| 74 | Ga0065714_10066377 | 3300005288 | Bacteria | 6973 |
| 75 | Ga0065714_10073910 | 3300005288 | Bacteria | 3114 |
| 76 | Ga0065704_10070374 | 3300005289 | Bacteria | 28734 |
| 77 | Ga0065704_10084803 | 3300005289 | Bacteria | 3294 |
| 78 | Ga0065704_10085422 | 3300005289 | Bacteria | 3224 |
| 79 | Ga0065704_10087748 | 3300005289 | Bacteria | 2987 |
| 80 | Ga0065704_10112032 | 3300005289 | Unclassified | 1943 |
| 81 | Ga0065712_10176867 | 3300005290 | Bacteria | 1213 |
| 82 | Ga0065715_10210627 | 3300005293 | Unclassified | 1316 |
| 83 | Ga0065715_10241072 | 3300005293 | Bacteria | 1190 |
| 84 | Ga0065715_10249931 | 3300005293 | Bacteria | 1170 |
| 85 | Ga0070658_10011667 | 3300005327 | Bacteria | 7047 |
| 86 | Ga0070658_10103291 | 3300005327 | Bacteria | 2357 |
| 87 | Ga0070658_10358558 | 3300005327 | Bacteria | 1248 |
| 88 | Ga0070676_10000001 | 3300005328 | Bacteria | 443830 |
| 89 | Ga0070676_10016784 | 3300005328 | Bacteria | 4047 |
| 90 | Ga0070683_100108393 | 3300005329 | Bacteria | 2619 |
| 91 | Ga0070683_100138836 | 3300005329 | Bacteria | 2302 |
| 92 | Ga0070683_100533197 | 3300005329 | Bacteria | 1122 |
| 93 | Ga0070690_100062732 | 3300005330 | Unclassified | 2397 |
| 94 | Ga0070670_100141298 | 3300005331 | Bacteria | 2082 |
| 95 | Ga0070670_100286533 | 3300005331 | Bacteria | 1439 |
| 96 | Ga0070670_100294650 | 3300005331 | Bacteria | 1418 |
| 97 | Ga0070670_100363226 | 3300005331 | Bacteria | 1273 |
| 98 | Ga0068869_100010053 | 3300005334 | Bacteria | 6154 |
| 99 | Ga0068869_100013167 | 3300005334 | Bacteria | 5493 |
| 100 | Ga0068869_100017619 | 3300005334 | Bacteria | 4846 |
| 101 | Ga0068869_100045584 | 3300005334 | Bacteria | 3158 |
| 102 | Ga0070666_10000197 | 3300005335 | Bacteria | 41178 |
| 103 | Ga0070666_10002958 | 3300005335 | Bacteria | 10296 |
| 104 | Ga0070666_10037488 | 3300005335 | Bacteria | 3223 |
| 105 | Ga0070666_10046753 | 3300005335 | Bacteria | 2904 |
| 106 | Ga0070666_10124625 | 3300005335 | Unclassified | 1788 |
| 107 | Ga0068868_100000524 | 3300005338 | Bacteria | 25677 |
| 108 | Ga0068868_100001711 | 3300005338 | Bacteria | 15014 |
| 109 | Ga0068868_100115321 | 3300005338 | Bacteria | 2187 |
| 110 | Ga0070660_100184903 | 3300005339 | Bacteria | 1687 |
| 111 | Ga0070689_100004044 | 3300005340 | Bacteria | 9868 |
| 112 | Ga0070687_100249012 | 3300005343 | Bacteria | 1103 |
| 113 | Ga0070661_100013628 | 3300005344 | Bacteria | 5709 |
| 114 | Ga0070661_100014545 | 3300005344 | Bacteria | 5545 |
| 115 | Ga0070668_100112142 | 3300005347 | Bacteria | 2171 |
| 116 | Ga0070668_100210207 | 3300005347 | Unclassified | 1600 |
| 117 | Ga0070669_100022298 | 3300005353 | Bacteria | 4529 |
| 118 | Ga0070669_100036725 | 3300005353 | Bacteria | 3552 |
| 119 | Ga0070675_100052282 | 3300005354 | Unclassified | 3359 |
| 120 | Ga0070675_100363984 | 3300005354 | Bacteria | 1285 |
| 121 | Ga0070675_100555099 | 3300005354 | Bacteria | 1039 |
| 122 | Ga0070671_100011735 | 3300005355 | Bacteria | 7047 |
| 123 | Ga0070671_100141923 | 3300005355 | Bacteria | 2027 |
| 124 | Ga0070671_100159186 | 3300005355 | Bacteria | 1909 |
| 125 | Ga0070671_100219389 | 3300005355 | Bacteria | 1613 |
| 126 | Ga0070674_100006908 | 3300005356 | Bacteria | 6653 |
| 127 | Ga0070674_100057547 | 3300005356 | Bacteria | 2699 |
| 128 | Ga0070674_100092842 | 3300005356 | Bacteria | 2183 |
| 129 | Ga0070673_100030057 | 3300005364 | Bacteria | 4060 |
| 130 | Ga0070673_100030968 | 3300005364 | Bacteria | 4010 |
| 131 | Ga0070659_100000440 | 3300005366 | Bacteria | 31084 |
| 132 | Ga0070659_100005539 | 3300005366 | Bacteria | 9073 |
| 133 | Ga0070667_100003595 | 3300005367 | Bacteria | 13187 |
| 134 | Ga0070667_100039396 | 3300005367 | Bacteria | 3961 |
| 135 | Ga0070667_100101765 | 3300005367 | Bacteria | 2482 |
| 136 | Ga0070667_100145408 | 3300005367 | Bacteria | 2079 |
| 137 | Ga0070667_100196622 | 3300005367 | Unclassified | 1788 |
| 138 | Ga0070667_100286201 | 3300005367 | Bacteria | 1481 |
| 139 | Ga0070678_100013590 | 3300005456 | Bacteria | 5112 |
| 140 | Ga0070678_100064289 | 3300005456 | Bacteria | 2719 |
| 141 | Ga0070662_100002459 | 3300005457 | Bacteria | 11410 |
| 142 | Ga0070662_100003891 | 3300005457 | Bacteria | 9359 |
| 143 | Ga0070662_100377552 | 3300005457 | Bacteria | 1166 |
| 144 | Ga0070681_10040017 | 3300005458 | Bacteria | 4700 |
| 145 | Ga0068867_100007300 | 3300005459 | Bacteria | 7821 |
| 146 | Ga0068867_100011441 | 3300005459 | Bacteria | 6260 |
| 147 | Ga0068867_100094625 | 3300005459 | Bacteria | 2272 |
| 148 | Ga0068867_100098880 | 3300005459 | Bacteria | 2225 |
| 149 | Ga0070685_10018108 | 3300005466 | Bacteria | 3784 |
| 150 | Ga0070685_10149589 | 3300005466 | Bacteria | 1478 |
| 151 | Ga0070707_100051113 | 3300005468 | Bacteria | 3962 |
| 152 | Ga0070698_100002653 | 3300005471 | Bacteria | 19726 |
| 153 | Ga0070698_100005248 | 3300005471 | Bacteria | 14175 |
| 154 | Ga0070699_100015745 | 3300005518 | Bacteria | 6492 |
| 155 | Ga0070699_100221712 | 3300005518 | Bacteria | 1685 |
| 156 | Ga0070679_100193804 | 3300005530 | Bacteria | 2000 |
| 157 | Ga0070684_100000251 | 3300005535 | Bacteria | 37139 |
| 158 | Ga0070684_100118192 | 3300005535 | Bacteria | 2382 |
| 159 | Ga0068853_100001703 | 3300005539 | Bacteria | 16107 |
| 160 | Ga0068853_100043110 | 3300005539 | Bacteria | 3861 |
| 161 | Ga0068853_100094957 | 3300005539 | Bacteria | 2628 |
| 162 | Ga0068853_100095956 | 3300005539 | Unclassified | 2616 |
| 163 | Ga0068853_100166038 | 3300005539 | Bacteria | 1995 |
| 164 | Ga0068853_100181628 | 3300005539 | Bacteria | 1908 |
| 165 | Ga0070672_100008545 | 3300005543 | Bacteria | 7013 |
| 166 | Ga0070672_100041655 | 3300005543 | Bacteria | 3532 |
| 167 | Ga0070672_100193011 | 3300005543 | Bacteria | 1701 |
| 168 | Ga0070672_100414180 | 3300005543 | Bacteria | 1157 |
| 169 | Ga0070686_100270305 | 3300005544 | Unclassified | 1249 |
| 170 | Ga0070665_100000014 | 3300005548 | Bacteria | 484881 |
| 171 | Ga0070665_100010440 | 3300005548 | Bacteria | 9397 |
| 172 | Ga0070665_100164206 | 3300005548 | Bacteria | 2223 |
| 173 | Ga0068855_100000284 | 3300005563 | Bacteria | 62592 |
| 174 | Ga0068855_100030687 | 3300005563 | Bacteria | 6426 |
| 175 | Ga0068855_100042683 | 3300005563 | Bacteria | 5373 |
| 176 | Ga0068855_100158197 | 3300005563 | Bacteria | 2573 |
| 177 | Ga0068855_100163867 | 3300005563 | Bacteria | 2521 |
| 178 | Ga0068855_100425518 | 3300005563 | Bacteria | 1452 |
| 179 | Ga0070664_100006889 | 3300005564 | Bacteria | 9161 |
| 180 | Ga0070664_100045872 | 3300005564 | Bacteria | 3691 |
| 181 | Ga0070664_100117140 | 3300005564 | Bacteria | 2330 |
| 182 | Ga0070664_100345430 | 3300005564 | Unclassified | 1352 |
| 183 | Ga0068857_100028762 | 3300005577 | Bacteria | 4904 |
| 184 | Ga0068857_100172459 | 3300005577 | Bacteria | 1966 |
| 185 | Ga0068857_100621535 | 3300005577 | Bacteria | 1022 |
| 186 | Ga0068854_100044728 | 3300005578 | Bacteria | 3145 |
| 187 | Ga0068854_100060109 | 3300005578 | Bacteria | 2748 |
| 188 | Ga0068854_100080831 | 3300005578 | Bacteria | 2399 |
| 189 | Ga0068854_100086491 | 3300005578 | Bacteria | 2324 |
| 190 | Ga0068854_100098459 | 3300005578 | Bacteria | 2188 |
| 191 | Ga0068856_100000073 | 3300005614 | Bacteria | 95021 |
| 192 | Ga0068856_100127236 | 3300005614 | Bacteria | 2551 |
| 193 | Ga0068852_100019630 | 3300005616 | Bacteria | 5355 |
| 194 | Ga0068852_100069555 | 3300005616 | Bacteria | 3086 |
| 195 | Ga0068852_100103259 | 3300005616 | Bacteria | 2578 |
| 196 | Ga0068852_100212367 | 3300005616 | Bacteria | 1836 |
| 197 | Ga0068852_100216964 | 3300005616 | Bacteria | 1818 |
| 198 | Ga0068852_100235703 | 3300005616 | Bacteria | 1747 |
| 199 | Ga0068852_100247371 | 3300005616 | Bacteria | 1707 |
| 200 | Ga0068859_100000007 | 3300005617 | Bacteria | 390070 |
| 201 | Ga0068859_100007469 | 3300005617 | Bacteria | 11096 |
| 202 | Ga0068859_100015705 | 3300005617 | Bacteria | 7609 |
| 203 | Ga0068859_100269463 | 3300005617 | Unclassified | 1795 |
| 204 | Ga0068859_100409536 | 3300005617 | Bacteria | 1452 |
| 205 | Ga0068864_100009122 | 3300005618 | Bacteria | 8177 |
| 206 | Ga0068864_100099104 | 3300005618 | Bacteria | 2581 |
| 207 | Ga0068864_100164856 | 3300005618 | Bacteria | 2017 |
| 208 | Ga0068866_10006035 | 3300005718 | Bacteria | 5041 |
| 209 | Ga0068866_10025612 | 3300005718 | Bacteria | 2775 |
| 210 | Ga0068861_100131124 | 3300005719 | Unclassified | 2035 |
| 211 | Ga0068851_10009475 | 3300005834 | Bacteria | 4530 |
| 212 | Ga0068851_10015736 | 3300005834 | Bacteria | 3609 |
| 213 | Ga0068851_10040661 | 3300005834 | Bacteria | 2337 |
| 214 | Ga0068863_100000444 | 3300005841 | Bacteria | 41977 |
| 215 | Ga0068863_100000449 | 3300005841 | Bacteria | 41845 |
| 216 | Ga0068863_100673028 | 3300005841 | Unclassified | 1027 |
| 217 | Ga0068863_100702730 | 3300005841 | Bacteria | 1005 |
| 218 | Ga0068858_100002218 | 3300005842 | Bacteria | 19660 |
| 219 | Ga0068858_100048943 | 3300005842 | Bacteria | 3915 |
| 220 | Ga0068858_100301170 | 3300005842 | Bacteria | 1530 |
| 221 | Ga0068860_100000061 | 3300005843 | Bacteria | 192548 |
| 222 | Ga0068860_100000661 | 3300005843 | Bacteria | 40073 |
| 223 | Ga0068860_100005896 | 3300005843 | Bacteria | 12335 |
| 224 | Ga0068860_100006071 | 3300005843 | Bacteria | 12160 |
| 225 | Ga0068860_100031110 | 3300005843 | Bacteria | 5132 |
| 226 | Ga0068860_100032987 | 3300005843 | Bacteria | 4972 |
| 227 | Ga0068862_100187784 | 3300005844 | Bacteria | 1858 |
| 228 | Ga0070712_100022318 | 3300006175 | Bacteria | 4169 |
| 229 | Ga0075366_10000031 | 3300006195 | Bacteria | 49332 |
| 230 | Ga0075366_10043061 | 3300006195 | Bacteria | 2674 |
| 231 | Ga0075366_10163062 | 3300006195 | Bacteria | 1351 |
| 232 | Ga0097621_100007495 | 3300006237 | Bacteria | 7812 |
| 233 | Ga0097621_100025268 | 3300006237 | Bacteria | 4645 |
| 234 | Ga0097621_100042264 | 3300006237 | Bacteria | 3671 |
| 235 | Ga0075370_10101921 | 3300006353 | Bacteria | 1662 |
| 236 | Ga0068871_100004610 | 3300006358 | Bacteria | 9622 |
| 237 | Ga0068871_100004870 | 3300006358 | Bacteria | 9380 |
| 238 | Ga0068871_100573780 | 3300006358 | Bacteria | 1024 |
| 239 | Ga0075428_100010603 | 3300006844 | Bacteria | 10243 |
| 240 | Ga0075428_100062501 | 3300006844 | Bacteria | 4076 |
| 241 | Ga0075428_100119796 | 3300006844 | Bacteria | 2865 |
| 242 | Ga0075428_100227894 | 3300006844 | Bacteria | 2011 |
| 243 | Ga0075430_100016236 | 3300006846 | Bacteria | 6341 |
| 244 | Ga0075431_100086675 | 3300006847 | Bacteria | 3231 |
| 245 | Ga0075429_100105852 | 3300006880 | Bacteria | 2457 |
| 246 | Ga0068865_100004575 | 3300006881 | Bacteria | 8348 |
| 247 | Ga0068865_100053588 | 3300006881 | Bacteria | 2799 |
| 248 | Ga0097620_100000007 | 3300006931 | Bacteria | 390070 |
| 249 | Ga0097620_100007469 | 3300006931 | Bacteria | 11096 |
| 250 | Ga0097620_100015704 | 3300006931 | Bacteria | 7609 |
| 251 | Ga0097620_100269447 | 3300006931 | Unclassified | 1795 |
| 252 | Ga0097620_100409528 | 3300006931 | Bacteria | 1452 |
| 253 | Ga0105244_10047623 | 3300009036 | Bacteria | 2198 |
| 254 | Ga0105240_10000198 | 3300009093 | Bacteria | 122388 |
| 255 | Ga0105240_10026991 | 3300009093 | Bacteria | 7527 |
| 256 | Ga0105240_10034852 | 3300009093 | Bacteria | 6489 |
| 257 | Ga0105240_10048638 | 3300009093 | Bacteria | 5358 |
| 258 | Ga0105240_10057327 | 3300009093 | Bacteria | 4867 |
| 259 | Ga0105240_10065857 | 3300009093 | Bacteria | 4497 |
| 260 | Ga0105240_10074083 | 3300009093 | Bacteria | 4203 |
| 261 | Ga0105240_10091437 | 3300009093 | Bacteria | 3718 |
| 262 | Ga0105240_10164711 | 3300009093 | Bacteria | 2630 |
| 263 | Ga0111539_10198008 | 3300009094 | Bacteria | 2343 |
| 264 | Ga0105245_10174559 | 3300009098 | Bacteria | 2049 |
| 265 | Ga0114129_10031992 | 3300009147 | Bacteria | 7436 |
| 266 | Ga0114129_10091477 | 3300009147 | Bacteria | 4215 |
| 267 | Ga0114129_10247912 | 3300009147 | Bacteria | 2392 |
| 268 | Ga0105241_10000137 | 3300009174 | Bacteria | 52153 |
| 269 | Ga0105241_10000424 | 3300009174 | Bacteria | 31880 |
| 270 | Ga0105241_10005687 | 3300009174 | Bacteria | 9202 |
| 271 | Ga0105241_10019080 | 3300009174 | Bacteria | 5057 |
| 272 | Ga0105241_10038039 | 3300009174 | Bacteria | 3628 |
| 273 | Ga0105241_10066029 | 3300009174 | Bacteria | 2797 |
| 274 | Ga0105242_10023601 | 3300009176 | Bacteria | 4848 |
| 275 | Ga0105242_10070686 | 3300009176 | Bacteria | 2894 |
| 276 | Ga0105242_10088094 | 3300009176 | Bacteria | 2607 |
| 277 | Ga0105242_10184388 | 3300009176 | Bacteria | 1843 |
| 278 | Ga0105237_10000409 | 3300009545 | Bacteria | 61096 |
| 279 | Ga0105237_10000577 | 3300009545 | Bacteria | 51264 |
| 280 | Ga0105237_10001142 | 3300009545 | Bacteria | 35679 |
| 281 | Ga0105237_10001258 | 3300009545 | Bacteria | 33852 |
| 282 | Ga0105237_10001360 | 3300009545 | Bacteria | 32389 |
| 283 | Ga0105237_10001948 | 3300009545 | Bacteria | 26296 |
| 284 | Ga0105237_10005617 | 3300009545 | Bacteria | 14137 |
| 285 | Ga0105237_10273360 | 3300009545 | Bacteria | 1692 |
| 286 | Ga0105237_10392588 | 3300009545 | Bacteria | 1392 |
| 287 | Ga0105237_10418610 | 3300009545 | Bacteria | 1345 |
| 288 | Ga0105238_10007301 | 3300009551 | Bacteria | 11064 |
| 289 | Ga0105238_10062384 | 3300009551 | Bacteria | 3728 |
| 290 | Ga0105249_10001357 | 3300009553 | Bacteria | 21397 |
| 291 | Ga0105249_10030230 | 3300009553 | Bacteria | 4896 |
| 292 | Ga0105249_10055907 | 3300009553 | Bacteria | 3613 |
| 293 | Ga0105249_10176773 | 3300009553 | Bacteria | 2074 |
| 294 | Ga0105249_10542628 | 3300009553 | Bacteria | 1213 |
| 295 | Ga0105249_10593071 | 3300009553 | Bacteria | 1162 |
| 296 | Ga0105249_10674694 | 3300009553 | Bacteria | 1092 |
| 297 | Ga0105239_10000659 | 3300010375 | Bacteria | 49123 |
| 298 | Ga0105239_10005875 | 3300010375 | Bacteria | 14303 |
| 299 | Ga0105239_10012560 | 3300010375 | Bacteria | 9428 |
| 300 | Ga0105239_10014750 | 3300010375 | Bacteria | 8665 |
| 301 | Ga0105239_10041485 | 3300010375 | Bacteria | 5043 |
| 302 | Ga0105239_10042514 | 3300010375 | Bacteria | 4980 |
| 303 | Ga0105239_10070201 | 3300010375 | Bacteria | 3848 |
| 304 | Ga0105239_10194055 | 3300010375 | Bacteria | 2274 |
| 305 | Ga0105239_10216683 | 3300010375 | Bacteria | 2146 |
| 306 | Ga0105239_10600789 | 3300010375 | Bacteria | 1255 |
| 307 | Ga0105239_10654484 | 3300010375 | Bacteria | 1200 |
| 308 | Ga0105246_10001938 | 3300011119 | Bacteria | 12496 |
| 309 | Ga0105246_10067458 | 3300011119 | Bacteria | 2507 |
| 310 | Ga0157373_10000453 | 3300013100 | Bacteria | 32441 |
| 311 | Ga0157373_10000936 | 3300013100 | Bacteria | 22553 |
| 312 | Ga0157373_10008808 | 3300013100 | Bacteria | 7476 |
| 313 | Ga0157373_10010688 | 3300013100 | Bacteria | 6751 |
| 314 | Ga0157373_10138419 | 3300013100 | Bacteria | 1712 |
| 315 | Ga0157371_10000069 | 3300013102 | Bacteria | 165391 |
| 316 | Ga0157371_10000713 | 3300013102 | Bacteria | 38893 |
| 317 | Ga0157371_10003525 | 3300013102 | Bacteria | 14120 |
| 318 | Ga0157371_10004170 | 3300013102 | Bacteria | 12736 |
| 319 | Ga0157371_10013014 | 3300013102 | Bacteria | 6334 |
| 320 | Ga0157371_10048536 | 3300013102 | Bacteria | 3017 |
| 321 | Ga0157371_10058305 | 3300013102 | Bacteria | 2739 |
| 322 | Ga0157371_10065708 | 3300013102 | Bacteria | 2569 |
| 323 | Ga0157371_10093180 | 3300013102 | Bacteria | 2134 |
| 324 | Ga0157371_10093567 | 3300013102 | Bacteria | 2130 |
| 325 | Ga0157370_10001009 | 3300013104 | Bacteria | 35544 |
| 326 | Ga0157370_10001014 | 3300013104 | Bacteria | 35409 |
| 327 | Ga0157370_10003406 | 3300013104 | Bacteria | 18685 |
| 328 | Ga0157370_10007076 | 3300013104 | Bacteria | 12255 |
| 329 | Ga0157370_10010926 | 3300013104 | Bacteria | 9533 |
| 330 | Ga0157370_10015818 | 3300013104 | Bacteria | 7656 |
| 331 | Ga0157370_10019134 | 3300013104 | Bacteria | 6884 |
| 332 | Ga0157370_10021662 | 3300013104 | Bacteria | 6403 |
| 333 | Ga0157370_10035236 | 3300013104 | Bacteria | 4867 |
| 334 | Ga0157370_10047458 | 3300013104 | Bacteria | 4117 |
| 335 | Ga0157370_10059379 | 3300013104 | Unclassified | 3634 |
| 336 | Ga0157370_10086005 | 3300013104 | Bacteria | 2954 |
| 337 | Ga0157370_10097750 | 3300013104 | Bacteria | 2754 |
| 338 | Ga0157370_10512195 | 3300013104 | Bacteria | 1102 |
| 339 | Ga0157369_10000038 | 3300013105 | Bacteria | 189078 |
| 340 | Ga0157369_10000952 | 3300013105 | Bacteria | 36747 |
| 341 | Ga0157369_10003837 | 3300013105 | Bacteria | 17855 |
| 342 | Ga0157369_10044786 | 3300013105 | Bacteria | 4815 |
| 343 | Ga0157369_10229265 | 3300013105 | Bacteria | 1942 |
| 344 | Ga0157374_10000011 | 3300013296 | Bacteria | 466749 |
| 345 | Ga0157374_10008935 | 3300013296 | Bacteria | 8585 |
| 346 | Ga0157374_10010333 | 3300013296 | Bacteria | 8028 |
| 347 | Ga0157374_10124929 | 3300013296 | Bacteria | 2486 |
| 348 | Ga0157374_10306121 | 3300013296 | Bacteria | 1573 |
| 349 | Ga0157374_10420939 | 3300013296 | Bacteria | 1334 |
| 350 | Ga0157378_10014702 | 3300013297 | Bacteria | 6856 |
| 351 | Ga0157378_10021640 | 3300013297 | Bacteria | 5655 |
| 352 | Ga0157378_10021840 | 3300013297 | Bacteria | 5627 |
| 353 | Ga0157378_10131393 | 3300013297 | Bacteria | 2318 |
| 354 | Ga0157378_10161016 | 3300013297 | Bacteria | 2099 |
| 355 | Ga0157378_10251138 | 3300013297 | Unclassified | 1693 |
| 356 | Ga0157378_10251840 | 3300013297 | Bacteria | 1691 |
| 357 | Ga0157378_10331291 | 3300013297 | Bacteria | 1482 |
| 358 | Ga0157378_10454093 | 3300013297 | Bacteria | 1272 |
| 359 | Ga0163162_10000123 | 3300013306 | Bacteria | 68905 |
| 360 | Ga0163162_10000151 | 3300013306 | Bacteria | 64454 |
| 361 | Ga0163162_10000406 | 3300013306 | Bacteria | 39456 |
| 362 | Ga0163162_10000827 | 3300013306 | Bacteria | 28791 |
| 363 | Ga0163162_10001117 | 3300013306 | Bacteria | 24935 |
| 364 | Ga0163162_10037543 | 3300013306 | Bacteria | 4834 |
| 365 | Ga0163162_10098254 | 3300013306 | Bacteria | 3017 |
| 366 | Ga0163162_10180651 | 3300013306 | Bacteria | 2236 |
| 367 | Ga0157372_10000077 | 3300013307 | Bacteria | 102192 |
| 368 | Ga0157372_10000254 | 3300013307 | Bacteria | 59194 |
| 369 | Ga0157372_10020545 | 3300013307 | Bacteria | 7125 |
| 370 | Ga0157372_10045539 | 3300013307 | Bacteria | 4867 |
| 371 | Ga0157372_10048850 | 3300013307 | Bacteria | 4703 |
| 372 | Ga0157372_10098575 | 3300013307 | Bacteria | 3334 |
| 373 | Ga0157372_10155377 | 3300013307 | Bacteria | 2642 |
| 374 | Ga0157372_10534867 | 3300013307 | Bacteria | 1366 |
| 375 | Ga0157372_10697923 | 3300013307 | Bacteria | 1181 |
| 376 | Ga0157372_10845670 | 3300013307 | Bacteria | 1062 |
| 377 | Ga0157375_10034578 | 3300013308 | Bacteria | 4816 |
| 378 | Ga0157375_10044269 | 3300013308 | Bacteria | 4323 |
| 379 | Ga0157375_10055835 | 3300013308 | Bacteria | 3896 |
| 380 | Ga0157375_10088940 | 3300013308 | Bacteria | 3144 |
| 381 | Ga0157375_10091846 | 3300013308 | Bacteria | 3098 |
| 382 | Ga0157375_10097917 | 3300013308 | Bacteria | 3009 |
| 383 | Ga0157375_10134685 | 3300013308 | Bacteria | 2593 |
| 384 | Ga0157375_10154784 | 3300013308 | Bacteria | 2431 |
| 385 | Ga0157375_10170061 | 3300013308 | Bacteria | 2326 |
| 386 | Ga0157375_10364637 | 3300013308 | Bacteria | 1611 |
| 387 | Ga0163163_10038961 | 3300014325 | Bacteria | 4636 |
| 388 | Ga0163163_10085648 | 3300014325 | Bacteria | 3159 |
| 389 | Ga0163163_10091197 | 3300014325 | Bacteria | 3061 |
| 390 | Ga0163163_10147104 | 3300014325 | Bacteria | 2400 |
| 391 | Ga0163163_10233997 | 3300014325 | Bacteria | 1887 |
| 392 | Ga0163163_10249412 | 3300014325 | Bacteria | 1826 |
| 393 | Ga0157380_10000019 | 3300014326 | Bacteria | 116129 |
| 394 | Ga0157380_10010574 | 3300014326 | Bacteria | 6637 |
| 395 | Ga0157380_10104162 | 3300014326 | Bacteria | 2369 |
| 396 | Ga0157380_10208766 | 3300014326 | Bacteria | 1739 |
| 397 | Ga0157380_10625877 | 3300014326 | Bacteria | 1069 |
| 398 | Ga0182008_10000025 | 3300014497 | Bacteria | 191222 |
| 399 | Ga0182008_10000058 | 3300014497 | Bacteria | 100175 |
| 400 | Ga0182008_10000461 | 3300014497 | Bacteria | 31061 |
| 401 | Ga0182008_10063153 | 3300014497 | Bacteria | 1824 |
| 402 | Ga0157377_10002753 | 3300014745 | Bacteria | 7827 |
| 403 | Ga0157377_10002912 | 3300014745 | Bacteria | 7652 |
| 404 | Ga0157376_10005885 | 3300014969 | Bacteria | 8605 |
| 405 | Ga0157376_10015107 | 3300014969 | Bacteria | 5820 |
| 406 | Ga0157376_10184522 | 3300014969 | Bacteria | 1909 |
| 407 | Ga0182006_1000357 | 3300015261 | Bacteria | 38142 |
| 408 | Ga0182006_1000645 | 3300015261 | Bacteria | 24732 |
| 409 | Ga0182006_1000894 | 3300015261 | Bacteria | 19999 |
| 410 | Ga0182006_1001592 | 3300015261 | Bacteria | 13422 |
| 411 | Ga0182006_1002797 | 3300015261 | Bacteria | 9312 |
| 412 | Ga0182006_1064751 | 3300015261 | Bacteria | 1370 |
| 413 | Ga0182007_10000024 | 3300015262 | Bacteria | 181761 |
| 414 | Ga0182005_1000039 | 3300015265 | Bacteria | 155210 |
| 415 | Ga0163161_10000628 | 3300017792 | Bacteria | 28142 |
| 416 | Ga0163161_10000979 | 3300017792 | Bacteria | 21853 |
| 417 | Ga0163161_10002479 | 3300017792 | Bacteria | 13157 |
| 418 | Ga0163161_10051791 | 3300017792 | Bacteria | 2975 |
| 419 | Ga0163161_10108942 | 3300017792 | Bacteria | 2068 |
| 420 | Ga0163161_10305670 | 3300017792 | Bacteria | 1254 |
| 421 | Ga0163161_10314873 | 3300017792 | Bacteria | 1236 |
| 422 | Ga0213876_10003317 | 3300021384 | Bacteria | 9232 |
| 423 | Ga0209436_100536 | 3300025208 | Bacteria | 16457 |
| 424 | Ga0209674_100329 | 3300025226 | Bacteria | 29551 |
| 425 | Ga0207427_100236 | 3300025231 | Bacteria | 45297 |
| 426 | Ga0209437_100034 | 3300025233 | Bacteria | 494007 |
| 427 | Ga0209437_100719 | 3300025233 | Bacteria | 16878 |
| 428 | Ga0209646_1000002 | 3300025246 | Bacteria | 1425781 |
| 429 | Ga0209646_1000004 | 3300025246 | Bacteria | 786587 |
| 430 | Ga0209026_1000132 | 3300025250 | Bacteria | 119048 |
| 431 | Ga0209026_1000178 | 3300025250 | Bacteria | 96368 |
| 432 | Ga0209026_1000239 | 3300025250 | Bacteria | 71740 |
| 433 | Ga0209026_1002731 | 3300025250 | Bacteria | 6332 |
| 434 | Ga0209233_1000038 | 3300025261 | Bacteria | 548972 |
| 435 | Ga0209233_1001884 | 3300025261 | Bacteria | 8048 |
| 436 | Ga0209673_1000183 | 3300025273 | Bacteria | 126175 |
| 437 | Ga0209673_1000483 | 3300025273 | Bacteria | 66457 |
| 438 | Ga0209130_1004353 | 3300025284 | Bacteria | 5425 |
| 439 | Ga0209676_1000022 | 3300025292 | Bacteria | 605659 |
| 440 | Ga0209676_1002361 | 3300025292 | Bacteria | 13605 |
| 441 | Ga0209564_1000561 | 3300025295 | Bacteria | 59357 |
| 442 | Ga0209758_1000912 | 3300025297 | Bacteria | 40017 |
| 443 | Ga0209758_1001298 | 3300025297 | Bacteria | 30631 |
| 444 | Ga0209758_1001642 | 3300025297 | Bacteria | 25398 |
| 445 | Ga0209758_1006687 | 3300025297 | Bacteria | 8139 |
| 446 | Ga0209050_1000020 | 3300025298 | Bacteria | 605671 |
| 447 | Ga0209050_1000160 | 3300025298 | Bacteria | 157000 |
| 448 | Ga0209050_1000305 | 3300025298 | Bacteria | 100790 |
| 449 | Ga0209050_1024244 | 3300025298 | Bacteria | 2106 |
| 450 | Ga0207426_1000051 | 3300025302 | Bacteria | 391700 |
| 451 | Ga0207426_1000104 | 3300025302 | Bacteria | 249464 |
| 452 | Ga0207426_1000360 | 3300025302 | Bacteria | 82007 |
| 453 | Ga0207426_1000681 | 3300025302 | Bacteria | 41125 |
| 454 | Ga0207426_1001364 | 3300025302 | Bacteria | 20704 |
| 455 | Ga0207426_1001887 | 3300025302 | Bacteria | 15299 |
| 456 | Ga0207426_1006794 | 3300025302 | Bacteria | 4896 |
| 457 | Ga0209051_1012068 | 3300025303 | Bacteria | 4207 |
| 458 | Ga0209051_1045884 | 3300025303 | Bacteria | 1508 |
| 459 | Ga0209257_1000001 | 3300025304 | Bacteria | 2274655 |
| 460 | Ga0209257_1001540 | 3300025304 | Bacteria | 26823 |
| 461 | Ga0209257_1004420 | 3300025304 | Bacteria | 10909 |
| 462 | Ga0207656_10028953 | 3300025321 | Bacteria | 2278 |
| 463 | Ga0207656_10171817 | 3300025321 | Bacteria | 1036 |
| 464 | Ga0207688_10029574 | 3300025901 | Bacteria | 3017 |
| 465 | Ga0207680_10000177 | 3300025903 | Bacteria | 30942 |
| 466 | Ga0207680_10013867 | 3300025903 | Bacteria | 4152 |
| 467 | Ga0207680_10066601 | 3300025903 | Unclassified | 2216 |
| 468 | Ga0207680_10308040 | 3300025903 | Bacteria | 1105 |
| 469 | Ga0207647_10000299 | 3300025904 | Bacteria | 40747 |
| 470 | Ga0207647_10021677 | 3300025904 | Bacteria | 4284 |
| 471 | Ga0207645_10000001 | 3300025907 | Bacteria | 442754 |
| 472 | Ga0207645_10000284 | 3300025907 | Bacteria | 42247 |
| 473 | Ga0207645_10021073 | 3300025907 | Bacteria | 4255 |
| 474 | Ga0207645_10043803 | 3300025907 | Bacteria | 2864 |
| 475 | Ga0207643_10118054 | 3300025908 | Bacteria | 1569 |
| 476 | Ga0207705_10158636 | 3300025909 | Bacteria | 1698 |
| 477 | Ga0207654_10005471 | 3300025911 | Bacteria | 6422 |
| 478 | Ga0207654_10007056 | 3300025911 | Bacteria | 5659 |
| 479 | Ga0207654_10275318 | 3300025911 | Bacteria | 1137 |
| 480 | Ga0207707_10200176 | 3300025912 | Bacteria | 1741 |
| 481 | Ga0207707_10425829 | 3300025912 | Bacteria | 1137 |
| 482 | Ga0207695_10000212 | 3300025913 | Bacteria | 156450 |
| 483 | Ga0207695_10000276 | 3300025913 | Bacteria | 128924 |
| 484 | Ga0207695_10000313 | 3300025913 | Bacteria | 117072 |
| 485 | Ga0207695_10000346 | 3300025913 | Bacteria | 107028 |
| 486 | Ga0207695_10019413 | 3300025913 | Bacteria | 7830 |
| 487 | Ga0207695_10020573 | 3300025913 | Bacteria | 7554 |
| 488 | Ga0207695_10036487 | 3300025913 | Bacteria | 5314 |
| 489 | Ga0207695_10166215 | 3300025913 | Bacteria | 2134 |
| 490 | Ga0207671_10000402 | 3300025914 | Bacteria | 60371 |
| 491 | Ga0207671_10000987 | 3300025914 | Bacteria | 35078 |
| 492 | Ga0207671_10001317 | 3300025914 | Bacteria | 29052 |
| 493 | Ga0207671_10001776 | 3300025914 | Bacteria | 24234 |
| 494 | Ga0207671_10002368 | 3300025914 | Bacteria | 20262 |
| 495 | Ga0207671_10002977 | 3300025914 | Bacteria | 17383 |
| 496 | Ga0207671_10004116 | 3300025914 | Bacteria | 14061 |
| 497 | Ga0207671_10004651 | 3300025914 | Bacteria | 12997 |
| 498 | Ga0207671_10254657 | 3300025914 | Bacteria | 1380 |
| 499 | Ga0207662_10030020 | 3300025918 | Bacteria | 3152 |
| 500 | Ga0207657_10047967 | 3300025919 | Bacteria | 3730 |
| 501 | Ga0207649_10002116 | 3300025920 | Bacteria | 11250 |
| 502 | Ga0207652_10028756 | 3300025921 | Bacteria | 4640 |
| 503 | Ga0207652_10181113 | 3300025921 | Bacteria | 1894 |
| 504 | Ga0207681_10036284 | 3300025923 | Unclassified | 3252 |
| 505 | Ga0207681_10054871 | 3300025923 | Bacteria | 2711 |
| 506 | Ga0207694_10006626 | 3300025924 | Bacteria | 8801 |
| 507 | Ga0207694_10070024 | 3300025924 | Bacteria | 2740 |
| 508 | Ga0207650_10004145 | 3300025925 | Bacteria | 9909 |
| 509 | Ga0207650_10043496 | 3300025925 | Bacteria | 3297 |
| 510 | Ga0207650_10117432 | 3300025925 | Bacteria | 2067 |
| 511 | Ga0207650_10268998 | 3300025925 | Bacteria | 1385 |
| 512 | Ga0207659_10037293 | 3300025926 | Bacteria | 3374 |
| 513 | Ga0207659_10089587 | 3300025926 | Bacteria | 2294 |
| 514 | Ga0207659_10460210 | 3300025926 | Unclassified | 1072 |
| 515 | Ga0207690_10000235 | 3300025932 | Bacteria | 40691 |
| 516 | Ga0207690_10003716 | 3300025932 | Bacteria | 9073 |
| 517 | Ga0207706_10002489 | 3300025933 | Bacteria | 17951 |
| 518 | Ga0207706_10007739 | 3300025933 | Bacteria | 9918 |
| 519 | Ga0207686_10083451 | 3300025934 | Bacteria | 2091 |
| 520 | Ga0207686_10153070 | 3300025934 | Unclassified | 1608 |
| 521 | Ga0207670_10003877 | 3300025936 | Bacteria | 7974 |
| 522 | Ga0207704_10025050 | 3300025938 | Bacteria | 3249 |
| 523 | Ga0207704_10157061 | 3300025938 | Bacteria | 1613 |
| 524 | Ga0207691_10278685 | 3300025940 | Bacteria | 1439 |
| 525 | Ga0207689_10003255 | 3300025942 | Bacteria | 14889 |
| 526 | Ga0207689_10004450 | 3300025942 | Bacteria | 12706 |
| 527 | Ga0207689_10007607 | 3300025942 | Bacteria | 9491 |
| 528 | Ga0207689_10016468 | 3300025942 | Bacteria | 6257 |
| 529 | Ga0207689_10025014 | 3300025942 | Bacteria | 5005 |
| 530 | Ga0207689_10098104 | 3300025942 | Unclassified | 2407 |
| 531 | Ga0207661_10294898 | 3300025944 | Bacteria | 1452 |
| 532 | Ga0207679_10000915 | 3300025945 | Bacteria | 18846 |
| 533 | Ga0207679_10060688 | 3300025945 | Bacteria | 2811 |
| 534 | Ga0207679_10128109 | 3300025945 | Bacteria | 2032 |
| 535 | Ga0207679_10494408 | 3300025945 | Unclassified | 1091 |
| 536 | Ga0207667_10000414 | 3300025949 | Bacteria | 57815 |
| 537 | Ga0207667_10006159 | 3300025949 | Bacteria | 14576 |
| 538 | Ga0207667_10036938 | 3300025949 | Bacteria | 5229 |
| 539 | Ga0207667_10045845 | 3300025949 | Bacteria | 4629 |
| 540 | Ga0207667_10168412 | 3300025949 | Bacteria | 2252 |
| 541 | Ga0207667_10184386 | 3300025949 | Bacteria | 2143 |
| 542 | Ga0207651_10007927 | 3300025960 | Bacteria | 5692 |
| 543 | Ga0207651_10053860 | 3300025960 | Bacteria | 2753 |
| 544 | Ga0207651_10200619 | 3300025960 | Bacteria | 1598 |
| 545 | Ga0207651_10255186 | 3300025960 | Bacteria | 1437 |
| 546 | Ga0207712_10003067 | 3300025961 | Bacteria | 10662 |
| 547 | Ga0207712_10064573 | 3300025961 | Bacteria | 2610 |
| 548 | Ga0207712_10071008 | 3300025961 | Bacteria | 2503 |
| 549 | Ga0207712_10088045 | 3300025961 | Bacteria | 2279 |
| 550 | Ga0207712_10309455 | 3300025961 | Bacteria | 1299 |
| 551 | Ga0207668_10238644 | 3300025972 | Bacteria | 1469 |
| 552 | Ga0207640_10029277 | 3300025981 | Bacteria | 3379 |
| 553 | Ga0207640_10066244 | 3300025981 | Bacteria | 2413 |
| 554 | Ga0207640_10079304 | 3300025981 | Bacteria | 2238 |
| 555 | Ga0207658_10013982 | 3300025986 | Bacteria | 5494 |
| 556 | Ga0207658_10041566 | 3300025986 | Bacteria | 3330 |
| 557 | Ga0207658_10080217 | 3300025986 | Bacteria | 2499 |
| 558 | Ga0207658_10251450 | 3300025986 | Bacteria | 1502 |
| 559 | Ga0207677_10014564 | 3300026023 | Bacteria | 4598 |
| 560 | Ga0207677_10042043 | 3300026023 | Unclassified | 3027 |
| 561 | Ga0207677_10058309 | 3300026023 | Bacteria | 2657 |
| 562 | Ga0207677_10152591 | 3300026023 | Bacteria | 1784 |
| 563 | Ga0207703_10009385 | 3300026035 | Bacteria | 7690 |
| 564 | Ga0207703_10015384 | 3300026035 | Bacteria | 5968 |
| 565 | Ga0207703_10282803 | 3300026035 | Bacteria | 1507 |
| 566 | Ga0207639_10021989 | 3300026041 | Bacteria | 4588 |
| 567 | Ga0207639_10135971 | 3300026041 | Bacteria | 2041 |
| 568 | Ga0207639_10157414 | 3300026041 | Bacteria | 1910 |
| 569 | Ga0207639_10180301 | 3300026041 | Bacteria | 1796 |
| 570 | Ga0207639_10196289 | 3300026041 | Unclassified | 1728 |
| 571 | Ga0207708_10072648 | 3300026075 | Bacteria | 2636 |
| 572 | Ga0207702_10001281 | 3300026078 | Bacteria | 25238 |
| 573 | Ga0207702_10170260 | 3300026078 | Bacteria | 1996 |
| 574 | Ga0207702_10346179 | 3300026078 | Bacteria | 1421 |
| 575 | Ga0207641_10000090 | 3300026088 | Bacteria | 127735 |
| 576 | Ga0207641_10000111 | 3300026088 | Bacteria | 120527 |
| 577 | Ga0207641_10002912 | 3300026088 | Bacteria | 15494 |
| 578 | Ga0207641_10216546 | 3300026088 | Bacteria | 1774 |
| 579 | Ga0207648_10000383 | 3300026089 | Bacteria | 48959 |
| 580 | Ga0207648_10022129 | 3300026089 | Bacteria | 5710 |
| 581 | Ga0207648_10139222 | 3300026089 | Bacteria | 2139 |
| 582 | Ga0207676_10007606 | 3300026095 | Bacteria | 7693 |
| 583 | Ga0207676_10008833 | 3300026095 | Bacteria | 7171 |
| 584 | Ga0207674_10004856 | 3300026116 | Bacteria | 16098 |
| 585 | Ga0207674_10007260 | 3300026116 | Bacteria | 12917 |
| 586 | Ga0207674_10089144 | 3300026116 | Bacteria | 3077 |
| 587 | Ga0207674_10101451 | 3300026116 | Bacteria | 2858 |
| 588 | Ga0207675_100012579 | 3300026118 | Bacteria | 7905 |
| 589 | Ga0207675_100067386 | 3300026118 | Bacteria | 3346 |
| 590 | Ga0207683_10002635 | 3300026121 | Bacteria | 15683 |
| 591 | Ga0207683_10022617 | 3300026121 | Bacteria | 5399 |
| 592 | Ga0207683_10023168 | 3300026121 | Bacteria | 5336 |
| 593 | Ga0207698_10008226 | 3300026142 | Bacteria | 6581 |
| 594 | Ga0207698_10036136 | 3300026142 | Bacteria | 3623 |
| 595 | Ga0207698_10119007 | 3300026142 | Bacteria | 2231 |
| 596 | Ga0207698_10132762 | 3300026142 | Bacteria | 2131 |
| 597 | Ga0207698_10233651 | 3300026142 | Unclassified | 1671 |
| 598 | Ga0207698_10290671 | 3300026142 | Bacteria | 1516 |
| 599 | Ga0268266_10000068 | 3300028379 | Bacteria | 241100 |
| 600 | Ga0268266_10056092 | 3300028379 | Bacteria | 3389 |
| 601 | Ga0268266_10073432 | 3300028379 | Bacteria | 2968 |
| 602 | Ga0268265_10530521 | 3300028380 | Bacteria | 1114 |
| 603 | Ga0268264_10000079 | 3300028381 | Bacteria | 249516 |
| 604 | Ga0268264_10004288 | 3300028381 | Bacteria | 12173 |
| 605 | Ga0268264_10023200 | 3300028381 | Bacteria | 5063 |
| 606 | Ga0268264_10047692 | 3300028381 | Bacteria | 3561 |
| 607 | Ga0268264_10170640 | 3300028381 | Bacteria | 1967 |
| 608 | Ga0307515_10000012 | 3300028794 | Bacteria | 582232 |
| 609 | Ga0307515_10000078 | 3300028794 | Bacteria | 227988 |
| 610 | Ga0307515_10000290 | 3300028794 | Bacteria | 123604 |
| 611 | Ga0307515_10006021 | 3300028794 | Bacteria | 24408 |
| 612 | Ga0307515_10011199 | 3300028794 | Bacteria | 17050 |
| 613 | Ga0307511_10002426 | 3300030521 | Bacteria | 19480 |
| 614 | Ga0316177_1183670 | 3300030731 | Bacteria | 2227 |
| 615 | Ga0316176_1098279 | 3300030732 | Bacteria | 44333 |
| 616 | Ga0316183_1030332 | 3300030742 | Bacteria | 25507 |
| 617 | Ga0316181_1084052 | 3300030744 | Bacteria | 48491 |
| 618 | Ga0265327_10036126 | 3300031251 | Bacteria | 2720 |
| 619 | Ga0307513_10011825 | 3300031456 | Bacteria | 10818 |
| 620 | Ga0307513_10063761 | 3300031456 | Bacteria | 3888 |
| 621 | Ga0307509_10025814 | 3300031507 | Bacteria | 6561 |
| 622 | Ga0307509_10262811 | 3300031507 | Bacteria | 1499 |
| 623 | Ga0265313_10009958 | 3300031595 | Bacteria | 6099 |
| 624 | Ga0307508_10000686 | 3300031616 | Bacteria | 40604 |
| 625 | Ga0307516_10022679 | 3300031730 | Bacteria | 6444 |
| 626 | Ga0307413_10000942 | 3300031824 | Bacteria | 10397 |
| 627 | Ga0307407_10000018 | 3300031903 | Bacteria | 135979 |
| 628 | Ga0307412_10000001 | 3300031911 | Bacteria | 822691 |
| 629 | Ga0307412_10057868 | 3300031911 | Bacteria | 2590 |
| 630 | Ga0307409_100023896 | 3300031995 | Bacteria | 4247 |
| 631 | Ga0307416_100001355 | 3300032002 | Bacteria | 13215 |
| 632 | Ga0307414_10000332 | 3300032004 | Bacteria | 26901 |
| 633 | Ga0307414_10000502 | 3300032004 | Bacteria | 20406 |
| 634 | Ga0307414_10000823 | 3300032004 | Bacteria | 15850 |
| 635 | Ga0307414_10000903 | 3300032004 | Bacteria | 15224 |
| 636 | Ga0307414_10003291 | 3300032004 | Bacteria | 8613 |
| 637 | Ga0307414_10006443 | 3300032004 | Bacteria | 6547 |
| 638 | Ga0307414_10007360 | 3300032004 | Bacteria | 6186 |
| 639 | Ga0307414_10010074 | 3300032004 | Bacteria | 5463 |
| 640 | Ga0307414_10029605 | 3300032004 | Bacteria | 3565 |
| 641 | Ga0307414_10117073 | 3300032004 | Bacteria | 2041 |
| 642 | Ga0307414_10171487 | 3300032004 | Bacteria | 1735 |
| 643 | Ga0307414_10354131 | 3300032004 | Bacteria | 1261 |
| 644 | Ga0307411_10000014 | 3300032005 | Bacteria | 134682 |
| 645 | Ga0307411_10110350 | 3300032005 | Bacteria | 1967 |
| 646 | Ga0307507_10000032 | 3300033179 | Bacteria | 194155 |
| 647 | Ga0307510_10009375 | 3300033180 | Bacteria | 11661 |
| 648 | Ga0307510_10185827 | 3300033180 | Bacteria | 1633 |
| 649 | Ga0373955_0018775 | 3300035172 | Bacteria | 3446 |
| 650 | Ga0373924_0081276 | 3300035410 | Bacteria | 1378 |
| 651 | Ga0373937_0005416 | 3300036401 | Bacteria | 10921 |
| 652 | Ga0395899_0000002 | 3300037312 | Bacteria | 1324310 |
| 653 | Ga0395899_0000257 | 3300037312 | Bacteria | 69779 |
| 654 | Ga0395899_0012334 | 3300037312 | Bacteria | 6546 |
| 655 | Ga0395899_0065892 | 3300037312 | Bacteria | 2661 |
| 656 | Ga0395900_0000284 | 3300037418 | Bacteria | 75852 |
| 657 | Ga0395900_0000701 | 3300037418 | Bacteria | 44627 |
| 658 | Ga0395900_0001869 | 3300037418 | Bacteria | 23970 |
| 659 | Ga0395900_0003637 | 3300037418 | Bacteria | 16572 |
| 660 | Ga0395900_0079340 | 3300037418 | Bacteria | 3373 |
| 661 | Ga0395898_0003757 | 3300037466 | Bacteria | 16815 |
| 662 | Ga0395898_0004276 | 3300037466 | Bacteria | 15662 |
| 663 | Ga0395898_0022993 | 3300037466 | Bacteria | 6303 |
| 664 | Ga0395898_0165690 | 3300037466 | Bacteria | 2114 |
| 665 | Ga0395905_0001420 | 3300037471 | Bacteria | 28906 |
| 666 | Ga0395905_0012719 | 3300037471 | Bacteria | 8094 |
| 667 | Ga0395901_0005836 | 3300038443 | Bacteria | 12464 |
| 668 | Ga0395901_0084967 | 3300038443 | Bacteria | 3308 |
| 669 | Ga0395901_0346086 | 3300038443 | Bacteria | 1535 |
| 670 | Ga0395901_0355930 | 3300038443 | Bacteria | 1510 |
| 671 | Ga0436365_1399871 | 3300039437 | Bacteria | 18429 |
| 672 | Ga0439447_000820 | 3300041407 | Bacteria | 11391 |
| 673 | Ga0439447_001010 | 3300041407 | Bacteria | 10250 |
| 674 | Ga0451843_0512378 | 3300041509 | Bacteria | 1528 |
| 675 | Ga0439431_0009916 | 3300041997 | Bacteria | 2156 |
| 676 | Ga0439448_0029676 | 3300042005 | Bacteria | 1732 |
| 677 | Ga0439435_0012248 | 3300042436 | Bacteria | 2074 |
| 678 | Ga0451577_0123359 | 3300042876 | Bacteria | 2321 |
| 679 | Ga0451577_0156648 | 3300042876 | Bacteria | 2050 |
| 680 | Ga0451577_0215713 | 3300042876 | Bacteria | 1734 |
| 681 | Ga0451577_0318680 | 3300042876 | Bacteria | 1410 |
| 682 | Ga0451577_0374137 | 3300042876 | Bacteria | 1292 |
| 683 | Ga0466972_0000047 | 3300044658 | Bacteria | 122901 |
| 684 | Ga0466972_0022806 | 3300044658 | Bacteria | 3115 |
| 685 | Ga0453683_0000184 | 3300044673 | Bacteria | 86818 |
| 686 | Ga0453683_0006615 | 3300044673 | Bacteria | 7939 |
| 687 | Ga0453683_0059188 | 3300044673 | Bacteria | 2395 |
| 688 | Ga0466966_0000047 | 3300044684 | Bacteria | 91962 |
| 689 | Ga0453684_0004363 | 3300044712 | Bacteria | 30009 |
| 690 | Ga0453684_0096555 | 3300044712 | Bacteria | 3630 |
| 691 | Ga0453684_0142598 | 3300044712 | Bacteria | 2858 |
| 692 | Ga0453684_0246880 | 3300044712 | Bacteria | 2052 |
| 693 | Ga0453684_0495231 | 3300044712 | Bacteria | 1354 |
| 694 | Ga0466970_0094577 | 3300044765 | Bacteria | 1624 |
| 695 | Ga0466957_0146978 | 3300044842 | Bacteria | 1522 |
| 696 | Ga0466959_0000065 | 3300045049 | Bacteria | 73931 |
| 697 | Ga0466959_0010259 | 3300045049 | Bacteria | 6688 |
| 698 | Ga0451576_0036117 | 3300045051 | Bacteria | 5241 |
| 699 | Ga0451576_0076983 | 3300045051 | Bacteria | 3472 |
| 700 | Ga0451576_0287306 | 3300045051 | Bacteria | 1719 |
| 701 | Ga0466967_0254367 | 3300045976 | Bacteria | 1679 |
| 702 | Ga0495627_004361 | 3300046453 | Bacteria | 5938 |
| 703 | Ga0495627_037920 | 3300046453 | Bacteria | 1493 |
| 704 | Ga0495638_0020710 | 3300046460 | Bacteria | 4342 |
| 705 | Ga0495653_0077421 | 3300046463 | Bacteria | 2469 |
| 706 | Ga0495650_0000162 | 3300046471 | Bacteria | 148927 |
| 707 | Ga0495583_0033179 | 3300046506 | Bacteria | 2484 |
| 708 | Ga0495606_0001495 | 3300046507 | Bacteria | 31082 |
| 709 | Ga0495606_0070308 | 3300046507 | Bacteria | 2208 |
| 710 | Ga0495608_0002063 | 3300046511 | Bacteria | 14459 |
| 711 | Ga0495610_0006790 | 3300046512 | Bacteria | 7764 |
| 712 | Ga0495618_0022330 | 3300046514 | Bacteria | 3908 |
| 713 | Ga0495618_0062568 | 3300046514 | Bacteria | 2362 |
| 714 | Ga0495628_0003469 | 3300046516 | Bacteria | 14104 |
| 715 | Ga0495628_0042148 | 3300046516 | Bacteria | 3642 |
| 716 | Ga0495630_0055754 | 3300046517 | Bacteria | 2961 |
| 717 | Ga0495632_0061673 | 3300046519 | Bacteria | 1820 |
| 718 | Ga0495648_0003925 | 3300046524 | Bacteria | 12873 |
| 719 | Ga0495648_0035510 | 3300046524 | Bacteria | 3231 |
| 720 | Ga0495652_0001518 | 3300046529 | Bacteria | 25469 |
| 721 | Ga0495640_0037202 | 3300046533 | Bacteria | 3435 |
| 722 | Ga0495587_0022367 | 3300046536 | Bacteria | 3893 |
| 723 | Ga0495609_0026185 | 3300046538 | Bacteria | 2671 |
| 724 | Ga0495609_0026969 | 3300046538 | Bacteria | 2627 |
| 725 | Ga0495645_0059390 | 3300046543 | Bacteria | 2773 |
| 726 | Ga0495633_0000005 | 3300046558 | Bacteria | 357644 |
| 727 | Ga0495633_0014888 | 3300046558 | Bacteria | 4046 |
| 728 | Ga0495667_0003320 | 3300046559 | Bacteria | 10772 |
| 729 | Ga0495667_0164769 | 3300046559 | Bacteria | 1425 |
| 730 | Ga0495668_0000009 | 3300046616 | Bacteria | 492623 |
| 731 | Ga0495668_0002458 | 3300046616 | Bacteria | 15240 |
| 732 | Ga0495634_0022653 | 3300046642 | Bacteria | 4425 |
| 733 | Ga0495611_0000435 | 3300046648 | Bacteria | 25748 |
| 734 | Ga0495625_0000515 | 3300046660 | Bacteria | 56971 |
| 735 | Ga0495625_0000534 | 3300046660 | Bacteria | 55918 |
| 736 | Ga0495625_0010378 | 3300046660 | Bacteria | 7713 |
| 737 | Ga0495661_0005923 | 3300046665 | Bacteria | 8638 |
| 738 | Ga0495661_0019164 | 3300046665 | Bacteria | 4489 |
| 739 | Ga0495657_0002782 | 3300046675 | Bacteria | 14544 |
| 740 | Ga0495657_0129231 | 3300046675 | Bacteria | 1584 |
| 741 | Ga0495649_0000009 | 3300046694 | Bacteria | 451725 |
| 742 | Ga0495649_0048434 | 3300046694 | Bacteria | 2309 |
| 743 | Ga0495600_0001165 | 3300046809 | Bacteria | 14341 |
| 744 | Ga0495604_0016121 | 3300047317 | Bacteria | 5970 |
| 745 | Ga0495674_0005045 | 3300047319 | Bacteria | 12700 |
| 746 | Ga0495672_0011690 | 3300047320 | Bacteria | 6177 |
| 747 | Ga0495672_0018509 | 3300047320 | Bacteria | 4620 |
| 748 | Ga0495680_0022796 | 3300047322 | Bacteria | 5214 |
| 749 | Ga0495675_0000072 | 3300047444 | Bacteria | 70487 |
| 750 | Ga0495681_0030281 | 3300047470 | Bacteria | 2758 |
| 751 | Ga0495684_0000740 | 3300047471 | Bacteria | 26347 |
| 752 | Ga0495684_0104206 | 3300047471 | Bacteria | 2144 |
| 753 | Ga0495686_0000471 | 3300047472 | Bacteria | 60050 |
| 754 | Ga0495686_0011123 | 3300047472 | Bacteria | 6357 |
| 755 | Ga0495686_0051693 | 3300047472 | Bacteria | 2578 |
| 756 | Ga0496101_0241454 | 3300048904 | Bacteria | 1406 |
| 757 | Ga0496111_0046852 | 3300048914 | Bacteria | 3114 |
| 758 | Ga0496114_0338270 | 3300048917 | Bacteria | 1331 |
| 759 | Ga0496121_0007063 | 3300048924 | Bacteria | 13635 |
| 760 | Ga0496122_0000668 | 3300048925 | Bacteria | 69054 |
| 761 | Ga0496123_0000728 | 3300048926 | Bacteria | 53516 |
| 762 | Ga0496124_0018530 | 3300048927 | Bacteria | 6516 |
| 763 | Ga0496124_0037765 | 3300048927 | Bacteria | 4198 |
| 764 | Ga0496125_0000018 | 3300048928 | Bacteria | 482390 |
| 765 | Ga0496125_0101826 | 3300048928 | Bacteria | 2112 |
| 766 | Ga0496126_0081511 | 3300048929 | Bacteria | 2860 |
| 767 | Ga0501033_0011190 | 3300049570 | Bacteria | 6873 |
| 768 | Ga0501034_0002811 | 3300049571 | Bacteria | 20358 |
| 769 | Ga0501034_0016304 | 3300049571 | Bacteria | 7628 |
| 770 | Ga0501034_0056617 | 3300049571 | Bacteria | 3944 |
| 771 | Ga0501034_0167941 | 3300049571 | Bacteria | 2162 |
| 772 | Ga0501037_0118881 | 3300049573 | Bacteria | 1901 |
| 773 | Ga0501039_0460031 | 3300049575 | Bacteria | 999 |
| 774 | Ga0501040_0119888 | 3300049576 | Bacteria | 1845 |
| 775 | Ga0501043_0020117 | 3300049579 | Bacteria | 5238 |
| 776 | Ga0501043_0256270 | 3300049579 | Bacteria | 1347 |
| 777 | Ga0501223_016576 | 3300049663 | Bacteria | 1456 |
| 778 | Ga0501235_028148 | 3300049669 | Bacteria | 1262 |
| 779 | Ga0501249_000018 | 3300049679 | Bacteria | 113532 |
| 780 | Ga0501249_002229 | 3300049679 | Bacteria | 3937 |
| 781 | Ga0501261_010758 | 3300049690 | Bacteria | 1210 |
| 782 | Ga0501080_0273511 | 3300049742 | Bacteria | 1537 |
| 783 | Ga0501083_0133403 | 3300049744 | Bacteria | 1628 |
| 784 | Ga0501241_000156 | 3300049758 | Bacteria | 15206 |
| 785 | Ga0501266_000020 | 3300049763 | Bacteria | 101935 |
| 786 | Ga0501035_0126679 | 3300049822 | Bacteria | 2229 |
| 787 | Ga0501035_0138657 | 3300049822 | Bacteria | 2116 |
| 788 | Ga0501044_0033875 | 3300049823 | Bacteria | 5363 |
| 789 | Ga0501044_0126495 | 3300049823 | Bacteria | 2553 |
| 790 | Ga0501044_0497785 | 3300049823 | Bacteria | 1120 |
| 791 | nmdc:mga0k408_144193_c1 | 3300050493 | Bacteria | 1417 |
| 792 | nmdc:mga0k408_85_c1 | 3300050493 | Bacteria | 43890 |
| 793 | nmdc:mga07m45_110018_c1 | 3300050496 | Bacteria | 1586 |
| 794 | nmdc:mga07m45_115720_c1 | 3300050496 | Bacteria | 1546 |
| 795 | nmdc:mga05p37_160869_c1 | 3300050507 | Bacteria | 2742 |
| 796 | nmdc:mga09592_39180_c1 | 3300050508 | Bacteria | 3980 |
| 797 | nmdc:mga09592_48509_c1 | 3300050508 | Bacteria | 3580 |
| 798 | Ga0500635_0000586 | 3300053080 | Bacteria | 9656 |
| 799 | Ga0495619_0061084 | 3300053085 | Bacteria | 2507 |
| 800 | Ga0500578_0000765 | 3300053086 | Bacteria | 37890 |
| 801 | Ga0500646_0006420 | 3300053090 | Bacteria | 2990 |
| 802 | Ga0500646_0007519 | 3300053090 | Bacteria | 2786 |
| 803 | Ga0500583_0062394 | 3300053092 | Bacteria | 1762 |
| 804 | Ga0500651_0000230 | 3300053093 | Bacteria | 34750 |
| 805 | Ga0500651_0118206 | 3300053093 | Bacteria | 1612 |
| 806 | Ga0500641_0000007 | 3300053096 | Bacteria | 206510 |
| 807 | Ga0500641_0000016 | 3300053096 | Bacteria | 134532 |
| 808 | Ga0500641_0001850 | 3300053096 | Bacteria | 7507 |
| 809 | Ga0500641_0099399 | 3300053096 | Bacteria | 1247 |
| 810 | Ga0500562_000098 | 3300053108 | Bacteria | 33851 |
| 811 | Ga0500562_028356 | 3300053108 | Bacteria | 1471 |
| 812 | Ga0500594_0018846 | 3300053118 | Bacteria | 1705 |
| 813 | Ga0500618_008553 | 3300053125 | Bacteria | 2849 |
| 814 | Ga0500642_0033770 | 3300053130 | Bacteria | 2158 |
| 815 | Ga0500658_0000010 | 3300053134 | Bacteria | 248149 |
| 816 | Ga0500568_0020257 | 3300053139 | Bacteria | 2880 |
| 817 | Ga0500568_0024275 | 3300053139 | Bacteria | 2569 |
| 818 | Ga0500568_0060527 | 3300053139 | Bacteria | 1466 |
| 819 | Ga0500616_0040112 | 3300053153 | Bacteria | 2520 |
| 820 | Ga0500622_0000371 | 3300053156 | Bacteria | 43288 |
| 821 | Ga0500622_0002797 | 3300053156 | Bacteria | 12259 |
| 822 | Ga0500627_0093212 | 3300053158 | Bacteria | 1349 |
| 823 | Ga0500611_000024 | 3300053727 | Bacteria | 101593 |
| 824 | Ga0500645_005153 | 3300053730 | Bacteria | 4872 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300053158 | Ga0500627_0093212 | Ga0500627_0093212_508_1305 | 257 |
| 2 | 3300025907 | Ga0207645_10021073 | Ga0207645_100210735 | 278 |
| 3 | 3300049575 | Ga0501039_0460031 | Ga0501039_0460031_130_981 | 282 |
| 4 | 3300013104 | Ga0157370_10512195 | Ga0157370_105121952 | 285 |
| 5 | 3300046463 | Ga0495653_0077421 | Ga0495653_0077421_976_1872 | 288 |
| 6 | 3300046511 | Ga0495608_0002063 | Ga0495608_0002063_5002_5898 | 288 |
| 7 | 3300046514 | Ga0495618_0022330 | Ga0495618_0022330_983_1879 | 288 |
| 8 | 3300046516 | Ga0495628_0003469 | Ga0495628_0003469_1558_2454 | 288 |
| 9 | 3300046529 | Ga0495652_0001518 | Ga0495652_0001518_6505_7401 | 288 |
| 10 | 3300046533 | Ga0495640_0037202 | Ga0495640_0037202_1079_1975 | 288 |
| 11 | 3300046543 | Ga0495645_0059390 | Ga0495645_0059390_1541_2437 | 288 |
| 12 | 3300046559 | Ga0495667_0003320 | Ga0495667_0003320_8899_9795 | 288 |
| 13 | 3300046675 | Ga0495657_0002782 | Ga0495657_0002782_12415_13311 | 288 |
| 14 | 3300046809 | Ga0495600_0001165 | Ga0495600_0001165_25_921 | 288 |
| 15 | 3300047317 | Ga0495604_0016121 | Ga0495604_0016121_4285_5181 | 288 |
| 16 | 3300047319 | Ga0495674_0005045 | Ga0495674_0005045_7473_8369 | 288 |
| 17 | 3300047322 | Ga0495680_0022796 | Ga0495680_0022796_942_1838 | 288 |
| 18 | 3300047444 | Ga0495675_0000072 | Ga0495675_0000072_24835_25731 | 288 |
| 19 | 3300047471 | Ga0495684_0000740 | Ga0495684_0000740_269_1165 | 288 |
| 20 | 3300049570 | Ga0501033_0011190 | Ga0501033_0011190_181_1065 | 293 |
| 21 | 3300049571 | Ga0501034_0002811 | Ga0501034_0002811_12501_13385 | 293 |
| 22 | 3300049573 | Ga0501037_0118881 | Ga0501037_0118881_806_1690 | 293 |
| 23 | 3300049822 | Ga0501035_0126679 | Ga0501035_0126679_816_1700 | 293 |
| 24 | 3300049823 | Ga0501044_0033875 | Ga0501044_0033875_4185_5069 | 293 |
| 25 | 3300003323 | rootH1_10026775 | rootH1_1002677533 | 294 |
| 26 | 3300014497 | Ga0182008_10063153 | Ga0182008_100631532 | 294 |
| 27 | 3300025949 | Ga0207667_10184386 | Ga0207667_101843863 | 294 |
| 28 | 3300026041 | Ga0207639_10021989 | Ga0207639_100219894 | 294 |
| 29 | 3300049576 | Ga0501040_0119888 | Ga0501040_0119888_906_1823 | 294 |
| 30 | 3300053153 | Ga0500616_0040112 | Ga0500616_0040112_483_1382 | 294 |
| 31 | 3300001979 | JGI24740J21852_10006644 | JGI24740J21852_100066443 | 295 |
| 32 | 3300005330 | Ga0070690_100062732 | Ga0070690_1000627324 | 295 |
| 33 | 3300005331 | Ga0070670_100141298 | Ga0070670_1001412982 | 295 |
| 34 | 3300005335 | Ga0070666_10124625 | Ga0070666_101246251 | 295 |
| 35 | 3300005340 | Ga0070689_100004044 | Ga0070689_1000040444 | 295 |
| 36 | 3300005344 | Ga0070661_100013628 | Ga0070661_1000136287 | 295 |
| 37 | 3300005344 | Ga0070661_100014545 | Ga0070661_1000145453 | 295 |
| 38 | 3300005354 | Ga0070675_100052282 | Ga0070675_1000522824 | 295 |
| 39 | 3300005367 | Ga0070667_100196622 | Ga0070667_1001966222 | 295 |
| 40 | 3300005458 | Ga0070681_10040017 | Ga0070681_100400172 | 295 |
| 41 | 3300005466 | Ga0070685_10018108 | Ga0070685_100181083 | 295 |
| 42 | 3300005466 | Ga0070685_10149589 | Ga0070685_101495891 | 295 |
| 43 | 3300005535 | Ga0070684_100000251 | Ga0070684_1000002511 | 295 |
| 44 | 3300005539 | Ga0068853_100001703 | Ga0068853_10000170310 | 295 |
| 45 | 3300005539 | Ga0068853_100095956 | Ga0068853_1000959561 | 295 |
| 46 | 3300005539 | Ga0068853_100181628 | Ga0068853_1001816283 | 295 |
| 47 | 3300005544 | Ga0070686_100270305 | Ga0070686_1002703052 | 295 |
| 48 | 3300005548 | Ga0070665_100000014 | Ga0070665_100000014361 | 295 |
| 49 | 3300005548 | Ga0070665_100164206 | Ga0070665_1001642062 | 295 |
| 50 | 3300005564 | Ga0070664_100006889 | Ga0070664_1000068892 | 295 |
| 51 | 3300005564 | Ga0070664_100345430 | Ga0070664_1003454302 | 295 |
| 52 | 3300005616 | Ga0068852_100069555 | Ga0068852_1000695554 | 295 |
| 53 | 3300005617 | Ga0068859_100269463 | Ga0068859_1002694632 | 295 |
| 54 | 3300005618 | Ga0068864_100099104 | Ga0068864_1000991041 | 295 |
| 55 | 3300005834 | Ga0068851_10009475 | Ga0068851_100094754 | 295 |
| 56 | 3300005842 | Ga0068858_100048943 | Ga0068858_1000489432 | 295 |
| 57 | 3300006237 | Ga0097621_100025268 | Ga0097621_1000252682 | 295 |
| 58 | 3300006358 | Ga0068871_100573780 | Ga0068871_1005737801 | 295 |
| 59 | 3300006931 | Ga0097620_100269447 | Ga0097620_1002694472 | 295 |
| 60 | 3300009545 | Ga0105237_10001948 | Ga0105237_1000194822 | 295 |
| 61 | 3300013102 | Ga0157371_10065708 | Ga0157371_100657082 | 295 |
| 62 | 3300013104 | Ga0157370_10001014 | Ga0157370_1000101432 | 295 |
| 63 | 3300013105 | Ga0157369_10000952 | Ga0157369_1000095236 | 295 |
| 64 | 3300013307 | Ga0157372_10000077 | Ga0157372_1000007720 | 295 |
| 65 | 3300013308 | Ga0157375_10044269 | Ga0157375_100442694 | 295 |
| 66 | 3300014325 | Ga0163163_10249412 | Ga0163163_102494122 | 295 |
| 67 | 3300014497 | Ga0182008_10000058 | Ga0182008_1000005870 | 295 |
| 68 | 3300015261 | Ga0182006_1002797 | Ga0182006_10027977 | 295 |
| 69 | 3300025250 | Ga0209026_1000239 | Ga0209026_100023921 | 295 |
| 70 | 3300025302 | Ga0207426_1000681 | Ga0207426_10006814 | 295 |
| 71 | 3300025303 | Ga0209051_1012068 | Ga0209051_10120683 | 295 |
| 72 | 3300025321 | Ga0207656_10028953 | Ga0207656_100289532 | 295 |
| 73 | 3300025903 | Ga0207680_10066601 | Ga0207680_100666012 | 295 |
| 74 | 3300025908 | Ga0207643_10118054 | Ga0207643_101180542 | 295 |
| 75 | 3300025912 | Ga0207707_10200176 | Ga0207707_102001762 | 295 |
| 76 | 3300025913 | Ga0207695_10166215 | Ga0207695_101662153 | 295 |
| 77 | 3300025914 | Ga0207671_10002368 | Ga0207671_100023684 | 295 |
| 78 | 3300025920 | Ga0207649_10002116 | Ga0207649_100021166 | 295 |
| 79 | 3300025925 | Ga0207650_10004145 | Ga0207650_100041459 | 295 |
| 80 | 3300025936 | Ga0207670_10003877 | Ga0207670_100038774 | 295 |
| 81 | 3300025945 | Ga0207679_10000915 | Ga0207679_100009157 | 295 |
| 82 | 3300025945 | Ga0207679_10128109 | Ga0207679_101281092 | 295 |
| 83 | 3300025945 | Ga0207679_10494408 | Ga0207679_104944081 | 295 |
| 84 | 3300025961 | Ga0207712_10071008 | Ga0207712_100710082 | 295 |
| 85 | 3300025961 | Ga0207712_10309455 | Ga0207712_103094552 | 295 |
| 86 | 3300026035 | Ga0207703_10015384 | Ga0207703_100153841 | 295 |
| 87 | 3300026035 | Ga0207703_10282803 | Ga0207703_102828032 | 295 |
| 88 | 3300026041 | Ga0207639_10180301 | Ga0207639_101803011 | 295 |
| 89 | 3300026041 | Ga0207639_10196289 | Ga0207639_101962892 | 295 |
| 90 | 3300026089 | Ga0207648_10139222 | Ga0207648_101392222 | 295 |
| 91 | 3300026095 | Ga0207676_10007606 | Ga0207676_100076067 | 295 |
| 92 | 3300026116 | Ga0207674_10089144 | Ga0207674_100891442 | 295 |
| 93 | 3300026142 | Ga0207698_10233651 | Ga0207698_102336512 | 295 |
| 94 | 3300028379 | Ga0268266_10000068 | Ga0268266_1000006874 | 295 |
| 95 | 3300028379 | Ga0268266_10056092 | Ga0268266_100560922 | 295 |
| 96 | 3300031616 | Ga0307508_10000686 | Ga0307508_1000068616 | 295 |
| 97 | 3300032004 | Ga0307414_10171487 | Ga0307414_101714872 | 295 |
| 98 | 3300037312 | Ga0395899_0000257 | Ga0395899_0000257_49345_50247 | 295 |
| 99 | 3300037471 | Ga0395905_0012719 | Ga0395905_0012719_5337_6236 | 295 |
| 100 | 3300038443 | Ga0395901_0005836 | Ga0395901_0005836_7819_8718 | 295 |
| 101 | 3300042876 | Ga0451577_0318680 | Ga0451577_0318680_34_948 | 295 |
| 102 | 3300046517 | Ga0495630_0055754 | Ga0495630_0055754_2029_2931 | 295 |
| 103 | 3300048904 | Ga0496101_0241454 | Ga0496101_0241454_362_1264 | 295 |
| 104 | 3300048925 | Ga0496122_0000668 | Ga0496122_0000668_42824_43711 | 295 |
| 105 | 3300048926 | Ga0496123_0000728 | Ga0496123_0000728_3436_4323 | 295 |
| 106 | 3300048928 | Ga0496125_0101826 | Ga0496125_0101826_22_909 | 295 |
| 107 | 3300048929 | Ga0496126_0081511 | Ga0496126_0081511_1756_2655 | 295 |
| 108 | 3300049571 | Ga0501034_0056617 | Ga0501034_0056617_580_1476 | 295 |
| 109 | 3300049579 | Ga0501043_0256270 | Ga0501043_0256270_421_1317 | 295 |
| 110 | 3300050496 | nmdc:mga07m45_115720_c1 | nmdc:mga07m45_115720_c1_26_925 | 295 |
| 111 | 3300053156 | Ga0500622_0000371 | Ga0500622_0000371_8132_9019 | 295 |
| 112 | 3300005563 | Ga0068855_100425518 | Ga0068855_1004255182 | 300 |
| 113 | iso_pu_bacteria | 2883068021 | 2883071364 | 303 |
| 114 | 3300005328 | Ga0070676_10000001 | Ga0070676_10000001420 | 304 |
| 115 | 3300005543 | Ga0070672_100414180 | Ga0070672_1004141801 | 304 |
| 116 | 3300013104 | Ga0157370_10003406 | Ga0157370_1000340610 | 304 |
| 117 | 3300013105 | Ga0157369_10003837 | Ga0157369_1000383710 | 304 |
| 118 | 3300013297 | Ga0157378_10251138 | Ga0157378_102511382 | 304 |
| 119 | 3300013306 | Ga0163162_10098254 | Ga0163162_100982544 | 304 |
| 120 | 3300013308 | Ga0157375_10364637 | Ga0157375_103646371 | 304 |
| 121 | 3300017792 | Ga0163161_10108942 | Ga0163161_101089422 | 304 |
| 122 | 3300025907 | Ga0207645_10000001 | Ga0207645_1000000184 | 304 |
| 123 | 3300045976 | Ga0466967_0254367 | Ga0466967_0254367_611_1546 | 304 |
| 124 | iso_pu_bacteria | 2513020052 | 2513233371 | 304 |
| 125 | iso_pu_bacteria | 2513237088 | 2513600905 | 304 |
| 126 | iso_pu_bacteria | 2519899754 | 2520879575 | 304 |
| 127 | iso_pu_bacteria | 2585427687 | 2586207192 | 304 |
| 128 | iso_pu_bacteria | 2721755487 | 2722725809 | 304 |
| 129 | iso_pu_bacteria | 2739367651 | 2739591391 | 304 |
| 130 | iso_pu_bacteria | 2739367857 | 2740002583 | 304 |
| 131 | iso_pu_bacteria | 2739367858 | 2740007399 | 304 |
| 132 | iso_pu_bacteria | 2818991437 | 2819549642 | 304 |
| 133 | iso_pu_bacteria | 2842722452 | 2842727385 | 304 |
| 134 | iso_pu_bacteria | 2849281842 | 2849285390 | 304 |
| 135 | iso_pu_bacteria | 2857618242 | 2857620485 | 304 |
| 136 | iso_pu_bacteria | 2896344016 | 2896344709 | 304 |
| 137 | iso_pu_bacteria | 2902048731 | 2902049514 | 304 |
| 138 | iso_pu_bacteria | 2919683626 | 2919686308 | 304 |
| 139 | iso_pu_bacteria | 2919692658 | 2919692754 | 304 |
| 140 | iso_pu_bacteria | 2929150217 | 2929154788 | 304 |
| 141 | iso_pu_bacteria | 2954016120 | 2954020759 | 304 |
| 142 | iso_pu_bacteria | 2958512119 | 2958514901 | 304 |
| 143 | iso_pu_bacteria | 2989349275 | 2989349951 | 304 |
| 144 | iso_pu_bacteria | 3003233435 | 3003237021 | 304 |
| 145 | iso_pu_bacteria | 8055588893 | 8055590090 | 304 |
| 146 | iso_pu_bacteria | 8056440228 | 8056440296 | 304 |
| 147 | 3300003320 | rootH2_10036622 | rootH2_1003662210 | 305 |
| 148 | 3300003323 | rootH1_10004759 | rootH1_1000475927 | 305 |
| 149 | 3300013102 | Ga0157371_10013014 | Ga0157371_100130142 | 305 |
| 150 | 3300014326 | Ga0157380_10000019 | Ga0157380_1000001952 | 305 |
| 151 | 3300037418 | Ga0395900_0001869 | Ga0395900_0001869_5238_6158 | 305 |
| 152 | 3300037466 | Ga0395898_0022993 | Ga0395898_0022993_3985_4905 | 305 |
| 153 | 3300053730 | Ga0500645_005153 | Ga0500645_005153_162_1097 | 305 |
| 154 | iso_pu_bacteria | 2522125168 | 2522552262 | 305 |
| 155 | iso_pu_bacteria | 2582581873 | 2585424243 | 305 |
| 156 | iso_pu_bacteria | 2643221725 | 2644683425 | 305 |
| 157 | iso_pu_bacteria | 2721755487 | 2722731012 | 305 |
| 158 | iso_pu_bacteria | 2738541283 | 2738755866 | 305 |
| 159 | iso_pu_bacteria | 2738543023 | 2739303016 | 305 |
| 160 | iso_pu_bacteria | 2775506987 | 2776615896 | 305 |
| 161 | iso_pu_bacteria | 2802428842 | 2802652693 | 305 |
| 162 | iso_pu_bacteria | 2818991442 | 2819574075 | 305 |
| 163 | iso_pu_bacteria | 2818991442 | 2819574641 | 305 |
| 164 | iso_pu_bacteria | 2818991444 | 2819586370 | 305 |
| 165 | iso_pu_bacteria | 2818991460 | 2819681557 | 305 |
| 166 | iso_pu_bacteria | 2821136567 | 2821137394 | 305 |
| 167 | iso_pu_bacteria | 2842903701 | 2842908628 | 305 |
| 168 | iso_pu_bacteria | 2852623160 | 2852625286 | 305 |
| 169 | iso_pu_bacteria | 2852627209 | 2852628099 | 305 |
| 170 | iso_pu_bacteria | 2857618242 | 2857619776 | 305 |
| 171 | iso_pu_bacteria | 2883068021 | 2883071597 | 305 |
| 172 | iso_pu_bacteria | 2884791551 | 2884792476 | 305 |
| 173 | iso_pu_bacteria | 2884933994 | 2884934299 | 305 |
| 174 | iso_pu_bacteria | 2896109856 | 2896110262 | 305 |
| 175 | iso_pu_bacteria | 2896109856 | 2896113477 | 305 |
| 176 | iso_pu_bacteria | 2904467357 | 2904467865 | 305 |
| 177 | iso_pu_bacteria | 2911138879 | 2911139278 | 305 |
| 178 | iso_pu_bacteria | 2919191525 | 2919194281 | 305 |
| 179 | iso_pu_bacteria | 2919692658 | 2919696821 | 305 |
| 180 | iso_pu_bacteria | 2929154850 | 2929155155 | 305 |
| 181 | iso_pu_bacteria | 2929177148 | 2929179119 | 305 |
| 182 | iso_pu_bacteria | 2929921140 | 2929923660 | 305 |
| 183 | iso_pu_bacteria | 2945977869 | 2945981519 | 305 |
| 184 | iso_pu_bacteria | 2946013367 | 2946019075 | 305 |
| 185 | iso_pu_bacteria | 2977243572 | 2977244997 | 305 |
| 186 | iso_pu_bacteria | 2977268062 | 2977271210 | 305 |
| 187 | iso_pu_bacteria | 2984572630 | 2984574901 | 305 |
| 188 | iso_pu_bacteria | 2984606641 | 2984608354 | 305 |
| 189 | iso_pu_bacteria | 8003151029 | 8003155202 | 305 |
| 190 | iso_pu_bacteria | 8003151029 | 8003155205 | 305 |
| 191 | iso_pu_bacteria | 8055419101 | 8055423520 | 305 |
| 192 | iso_pu_bacteria | 8055592153 | 8055595447 | 305 |
| 193 | 3300009553 | Ga0105249_10001357 | Ga0105249_1000135716 | 306 |
| 194 | 3300025960 | Ga0207651_10255186 | Ga0207651_102551862 | 306 |
| 195 | 3300025961 | Ga0207712_10003067 | Ga0207712_100030675 | 306 |
| 196 | 3300031595 | Ga0265313_10009958 | Ga0265313_100099583 | 306 |
| 197 | 3300042876 | Ga0451577_0156648 | Ga0451577_0156648_1099_2034 | 306 |
| 198 | 3300044673 | Ga0453683_0000184 | Ga0453683_0000184_64797_65735 | 306 |
| 199 | 3300044712 | Ga0453684_0004363 | Ga0453684_0004363_26098_27033 | 306 |
| 200 | 3300044712 | Ga0453684_0096555 | Ga0453684_0096555_1073_1993 | 306 |
| 201 | 3300045051 | Ga0451576_0076983 | Ga0451576_0076983_1387_2322 | 306 |
| 202 | 3300045051 | Ga0451576_0287306 | Ga0451576_0287306_231_1157 | 306 |
| 203 | iso_pu_bacteria | 2643221667 | 2644372797 | 306 |
| 204 | iso_pu_bacteria | 2839989709 | 2839991511 | 306 |
| 205 | iso_pu_bacteria | 2884634485 | 2884634839 | 306 |
| 206 | iso_pu_bacteria | 8055592153 | 8055593704 | 306 |
| 207 | 3300001904 | JGI24736J21556_1000844 | JGI24736J21556_10008442 | 307 |
| 208 | 3300001990 | JGI24737J22298_10016126 | JGI24737J22298_100161262 | 307 |
| 209 | 3300002067 | JGI24735J21928_10043102 | JGI24735J21928_100431022 | 307 |
| 210 | 3300003187 | JGI25151J46595_10010532 | JGI25151J46595_100105324 | 307 |
| 211 | 3300003322 | rootL2_10022797 | rootL2_100227972 | 307 |
| 212 | 3300003323 | rootH1_10027324 | rootH1_1002732430 | 307 |
| 213 | 3300005262 | Ga0065165_1000814 | Ga0065165_100081434 | 307 |
| 214 | 3300005289 | Ga0065704_10112032 | Ga0065704_101120322 | 307 |
| 215 | 3300005290 | Ga0065712_10176867 | Ga0065712_101768672 | 307 |
| 216 | 3300005327 | Ga0070658_10011667 | Ga0070658_100116674 | 307 |
| 217 | 3300005327 | Ga0070658_10358558 | Ga0070658_103585582 | 307 |
| 218 | 3300005354 | Ga0070675_100555099 | Ga0070675_1005550991 | 307 |
| 219 | 3300005366 | Ga0070659_100005539 | Ga0070659_1000055393 | 307 |
| 220 | 3300005471 | Ga0070698_100002653 | Ga0070698_1000026535 | 307 |
| 221 | 3300005518 | Ga0070699_100221712 | Ga0070699_1002217122 | 307 |
| 222 | 3300005563 | Ga0068855_100042683 | Ga0068855_1000426835 | 307 |
| 223 | 3300005577 | Ga0068857_100028762 | Ga0068857_1000287622 | 307 |
| 224 | 3300005616 | Ga0068852_100212367 | Ga0068852_1002123672 | 307 |
| 225 | 3300005844 | Ga0068862_100187784 | Ga0068862_1001877842 | 307 |
| 226 | 3300006175 | Ga0070712_100022318 | Ga0070712_1000223183 | 307 |
| 227 | 3300006195 | Ga0075366_10043061 | Ga0075366_100430612 | 307 |
| 228 | 3300006844 | Ga0075428_100010603 | Ga0075428_1000106038 | 307 |
| 229 | 3300006847 | Ga0075431_100086675 | Ga0075431_1000866753 | 307 |
| 230 | 3300009093 | Ga0105240_10057327 | Ga0105240_100573272 | 307 |
| 231 | 3300009147 | Ga0114129_10031992 | Ga0114129_100319923 | 307 |
| 232 | 3300009545 | Ga0105237_10001142 | Ga0105237_1000114233 | 307 |
| 233 | 3300010375 | Ga0105239_10216683 | Ga0105239_102166832 | 307 |
| 234 | 3300013100 | Ga0157373_10000453 | Ga0157373_1000045324 | 307 |
| 235 | 3300013100 | Ga0157373_10138419 | Ga0157373_101384192 | 307 |
| 236 | 3300013102 | Ga0157371_10000069 | Ga0157371_1000006915 | 307 |
| 237 | 3300013102 | Ga0157371_10000713 | Ga0157371_100007135 | 307 |
| 238 | 3300013104 | Ga0157370_10019134 | Ga0157370_100191342 | 307 |
| 239 | 3300013104 | Ga0157370_10035236 | Ga0157370_100352362 | 307 |
| 240 | 3300013104 | Ga0157370_10086005 | Ga0157370_100860053 | 307 |
| 241 | 3300013307 | Ga0157372_10000254 | Ga0157372_1000025426 | 307 |
| 242 | 3300013307 | Ga0157372_10045539 | Ga0157372_100455392 | 307 |
| 243 | 3300013307 | Ga0157372_10155377 | Ga0157372_101553772 | 307 |
| 244 | 3300014326 | Ga0157380_10010574 | Ga0157380_100105746 | 307 |
| 245 | 3300014326 | Ga0157380_10104162 | Ga0157380_101041621 | 307 |
| 246 | 3300014326 | Ga0157380_10625877 | Ga0157380_106258771 | 307 |
| 247 | 3300025261 | Ga0209233_1001884 | Ga0209233_10018842 | 307 |
| 248 | 3300025904 | Ga0207647_10000299 | Ga0207647_100002996 | 307 |
| 249 | 3300025909 | Ga0207705_10158636 | Ga0207705_101586362 | 307 |
| 250 | 3300025913 | Ga0207695_10020573 | Ga0207695_100205731 | 307 |
| 251 | 3300025914 | Ga0207671_10004651 | Ga0207671_100046513 | 307 |
| 252 | 3300025932 | Ga0207690_10003716 | Ga0207690_100037165 | 307 |
| 253 | 3300025949 | Ga0207667_10045845 | Ga0207667_100458455 | 307 |
| 254 | 3300026116 | Ga0207674_10101451 | Ga0207674_101014512 | 307 |
| 255 | 3300026142 | Ga0207698_10008226 | Ga0207698_100082265 | 307 |
| 256 | 3300028794 | Ga0307515_10000012 | Ga0307515_10000012423 | 307 |
| 257 | 3300028794 | Ga0307515_10011199 | Ga0307515_100111993 | 307 |
| 258 | 3300037312 | Ga0395899_0065892 | Ga0395899_0065892_804_1730 | 307 |
| 259 | 3300037466 | Ga0395898_0165690 | Ga0395898_0165690_1082_2005 | 307 |
| 260 | 3300042436 | Ga0439435_0012248 | Ga0439435_0012248_780_1706 | 307 |
| 261 | 3300042876 | Ga0451577_0374137 | Ga0451577_0374137_224_1150 | 307 |
| 262 | 3300044712 | Ga0453684_0142598 | Ga0453684_0142598_1325_2251 | 307 |
| 263 | 3300044712 | Ga0453684_0495231 | Ga0453684_0495231_95_1027 | 307 |
| 264 | 3300049663 | Ga0501223_016576 | Ga0501223_016576_313_1239 | 307 |
| 265 | 3300049669 | Ga0501235_028148 | Ga0501235_028148_73_999 | 307 |
| 266 | 3300049690 | Ga0501261_010758 | Ga0501261_010758_149_1075 | 307 |
| 267 | 3300050508 | nmdc:mga09592_39180_c1 | nmdc:mga09592_39180_c1_2126_3052 | 307 |
| 268 | 3300053080 | Ga0500635_0000586 | Ga0500635_0000586_944_1867 | 307 |
| 269 | 3300053108 | Ga0500562_028356 | Ga0500562_028356_355_1278 | 307 |
| 270 | 3300003316 | rootH1_10033731 | rootH1_100337315 | 308 |
| 271 | 3300003320 | rootH2_10013030 | rootH2_100130302 | 308 |
| 272 | 3300003320 | rootH2_10160054 | rootH2_101600542 | 308 |
| 273 | 3300003322 | rootL2_10004925 | rootL2_100049252 | 308 |
| 274 | 3300003323 | rootH1_10010201 | rootH1_100102014 | 308 |
| 275 | 3300003323 | rootH1_10283993 | rootH1_102839932 | 308 |
| 276 | 3300003781 | Ga0055536_1000002 | Ga0055536_1000002438 | 308 |
| 277 | 3300005288 | Ga0065714_10009252 | Ga0065714_100092522 | 308 |
| 278 | 3300005288 | Ga0065714_10066377 | Ga0065714_100663777 | 308 |
| 279 | 3300005289 | Ga0065704_10085422 | Ga0065704_100854222 | 308 |
| 280 | 3300005293 | Ga0065715_10210627 | Ga0065715_102106271 | 308 |
| 281 | 3300005293 | Ga0065715_10249931 | Ga0065715_102499311 | 308 |
| 282 | 3300005327 | Ga0070658_10103291 | Ga0070658_101032912 | 308 |
| 283 | 3300005329 | Ga0070683_100138836 | Ga0070683_1001388362 | 308 |
| 284 | 3300005535 | Ga0070684_100118192 | Ga0070684_1001181922 | 308 |
| 285 | 3300005563 | Ga0068855_100163867 | Ga0068855_1001638673 | 308 |
| 286 | 3300005616 | Ga0068852_100216964 | Ga0068852_1002169642 | 308 |
| 287 | 3300005616 | Ga0068852_100235703 | Ga0068852_1002357032 | 308 |
| 288 | 3300005843 | Ga0068860_100006071 | Ga0068860_10000607111 | 308 |
| 289 | 3300006844 | Ga0075428_100119796 | Ga0075428_1001197962 | 308 |
| 290 | 3300006846 | Ga0075430_100016236 | Ga0075430_1000162363 | 308 |
| 291 | 3300006880 | Ga0075429_100105852 | Ga0075429_1001058522 | 308 |
| 292 | 3300009036 | Ga0105244_10047623 | Ga0105244_100476232 | 308 |
| 293 | 3300009093 | Ga0105240_10026991 | Ga0105240_100269913 | 308 |
| 294 | 3300009093 | Ga0105240_10034852 | Ga0105240_100348525 | 308 |
| 295 | 3300009093 | Ga0105240_10065857 | Ga0105240_100658572 | 308 |
| 296 | 3300009093 | Ga0105240_10091437 | Ga0105240_100914374 | 308 |
| 297 | 3300009093 | Ga0105240_10164711 | Ga0105240_101647111 | 308 |
| 298 | 3300009147 | Ga0114129_10091477 | Ga0114129_100914773 | 308 |
| 299 | 3300009545 | Ga0105237_10000409 | Ga0105237_1000040933 | 308 |
| 300 | 3300009545 | Ga0105237_10000577 | Ga0105237_1000057713 | 308 |
| 301 | 3300009545 | Ga0105237_10273360 | Ga0105237_102733602 | 308 |
| 302 | 3300010375 | Ga0105239_10000659 | Ga0105239_1000065939 | 308 |
| 303 | 3300010375 | Ga0105239_10014750 | Ga0105239_1001475010 | 308 |
| 304 | 3300010375 | Ga0105239_10042514 | Ga0105239_100425142 | 308 |
| 305 | 3300013104 | Ga0157370_10015818 | Ga0157370_100158187 | 308 |
| 306 | 3300013105 | Ga0157369_10000038 | Ga0157369_1000003864 | 308 |
| 307 | 3300013296 | Ga0157374_10000011 | Ga0157374_10000011171 | 308 |
| 308 | 3300013307 | Ga0157372_10048850 | Ga0157372_100488503 | 308 |
| 309 | 3300014969 | Ga0157376_10184522 | Ga0157376_101845222 | 308 |
| 310 | 3300015261 | Ga0182006_1000645 | Ga0182006_100064516 | 308 |
| 311 | 3300015262 | Ga0182007_10000024 | Ga0182007_10000024104 | 308 |
| 312 | 3300017792 | Ga0163161_10002479 | Ga0163161_100024796 | 308 |
| 313 | 3300021384 | Ga0213876_10003317 | Ga0213876_100033171 | 308 |
| 314 | 3300025292 | Ga0209676_1000022 | Ga0209676_1000022100 | 308 |
| 315 | 3300025298 | Ga0209050_1000020 | Ga0209050_1000020440 | 308 |
| 316 | 3300025912 | Ga0207707_10425829 | Ga0207707_104258291 | 308 |
| 317 | 3300025913 | Ga0207695_10000212 | Ga0207695_1000021281 | 308 |
| 318 | 3300025913 | Ga0207695_10000276 | Ga0207695_10000276104 | 308 |
| 319 | 3300025913 | Ga0207695_10000313 | Ga0207695_10000313100 | 308 |
| 320 | 3300025913 | Ga0207695_10019413 | Ga0207695_100194136 | 308 |
| 321 | 3300025914 | Ga0207671_10000402 | Ga0207671_1000040223 | 308 |
| 322 | 3300025914 | Ga0207671_10001317 | Ga0207671_1000131725 | 308 |
| 323 | 3300025921 | Ga0207652_10028756 | Ga0207652_100287564 | 308 |
| 324 | 3300025942 | Ga0207689_10016468 | Ga0207689_100164686 | 308 |
| 325 | 3300025944 | Ga0207661_10294898 | Ga0207661_102948982 | 308 |
| 326 | 3300025949 | Ga0207667_10000414 | Ga0207667_100004148 | 308 |
| 327 | 3300025949 | Ga0207667_10168412 | Ga0207667_101684122 | 308 |
| 328 | 3300026078 | Ga0207702_10170260 | Ga0207702_101702601 | 308 |
| 329 | 3300026142 | Ga0207698_10132762 | Ga0207698_101327622 | 308 |
| 330 | 3300028381 | Ga0268264_10004288 | Ga0268264_100042882 | 308 |
| 331 | 3300028794 | Ga0307515_10006021 | Ga0307515_100060218 | 308 |
| 332 | 3300031730 | Ga0307516_10022679 | Ga0307516_100226792 | 308 |
| 333 | 3300031824 | Ga0307413_10000942 | Ga0307413_100009422 | 308 |
| 334 | 3300031903 | Ga0307407_10000018 | Ga0307407_1000001866 | 308 |
| 335 | 3300031995 | Ga0307409_100023896 | Ga0307409_1000238962 | 308 |
| 336 | 3300032002 | Ga0307416_100001355 | Ga0307416_1000013556 | 308 |
| 337 | 3300032004 | Ga0307414_10000823 | Ga0307414_100008238 | 308 |
| 338 | 3300032004 | Ga0307414_10003291 | Ga0307414_100032912 | 308 |
| 339 | 3300032004 | Ga0307414_10007360 | Ga0307414_100073606 | 308 |
| 340 | 3300032005 | Ga0307411_10000014 | Ga0307411_1000001451 | 308 |
| 341 | 3300033180 | Ga0307510_10009375 | Ga0307510_100093758 | 308 |
| 342 | 3300033180 | Ga0307510_10185827 | Ga0307510_101858272 | 308 |
| 343 | 3300041407 | Ga0439447_001010 | Ga0439447_001010_4542_5492 | 308 |
| 344 | 3300041509 | Ga0451843_0512378 | Ga0451843_0512378_390_1343 | 308 |
| 345 | 3300042005 | Ga0439448_0029676 | Ga0439448_0029676_561_1487 | 308 |
| 346 | 3300042876 | Ga0451577_0123359 | Ga0451577_0123359_583_1518 | 308 |
| 347 | 3300046507 | Ga0495606_0070308 | Ga0495606_0070308_914_1864 | 308 |
| 348 | 3300046519 | Ga0495632_0061673 | Ga0495632_0061673_840_1766 | 308 |
| 349 | 3300046558 | Ga0495633_0014888 | Ga0495633_0014888_3025_3951 | 308 |
| 350 | 3300046648 | Ga0495611_0000435 | Ga0495611_0000435_13732_14658 | 308 |
| 351 | 3300046660 | Ga0495625_0010378 | Ga0495625_0010378_3939_4889 | 308 |
| 352 | 3300046694 | Ga0495649_0048434 | Ga0495649_0048434_863_1789 | 308 |
| 353 | 3300047470 | Ga0495681_0030281 | Ga0495681_0030281_1481_2407 | 308 |
| 354 | 3300049579 | Ga0501043_0020117 | Ga0501043_0020117_1846_2775 | 308 |
| 355 | 3300049679 | Ga0501249_000018 | Ga0501249_000018_89174_90127 | 308 |
| 356 | 3300049679 | Ga0501249_002229 | Ga0501249_002229_1557_2507 | 308 |
| 357 | 3300049763 | Ga0501266_000020 | Ga0501266_000020_83221_84174 | 308 |
| 358 | 3300049823 | Ga0501044_0126495 | Ga0501044_0126495_1004_1933 | 308 |
| 359 | 3300050507 | nmdc:mga05p37_160869_c1 | nmdc:mga05p37_160869_c1_629_1558 | 308 |
| 360 | 3300050508 | nmdc:mga09592_48509_c1 | nmdc:mga09592_48509_c1_1088_2017 | 308 |
| 361 | 3300053090 | Ga0500646_0007519 | Ga0500646_0007519_634_1584 | 308 |
| 362 | 3300053096 | Ga0500641_0000016 | Ga0500641_0000016_84095_85045 | 308 |
| 363 | 3300053096 | Ga0500641_0001850 | Ga0500641_0001850_3154_4104 | 308 |
| 364 | 3300053134 | Ga0500658_0000010 | Ga0500658_0000010_83768_84718 | 308 |
| 365 | 3300001979 | JGI24740J21852_10000688 | JGI24740J21852_100006888 | 309 |
| 366 | 3300001979 | JGI24740J21852_10002889 | JGI24740J21852_100028896 | 309 |
| 367 | 3300001989 | JGI24739J22299_10001392 | JGI24739J22299_100013924 | 309 |
| 368 | 3300001989 | JGI24739J22299_10053156 | JGI24739J22299_100531562 | 309 |
| 369 | 3300002737 | JGI25162J39368_1001124 | JGI25162J39368_100112410 | 309 |
| 370 | 3300002738 | JGI25154J39366_1000003 | JGI25154J39366_1000003199 | 309 |
| 371 | 3300002738 | JGI25154J39366_1000014 | JGI25154J39366_1000014146 | 309 |
| 372 | 3300002741 | JGI25157J39369_1002583 | JGI25157J39369_10025834 | 309 |
| 373 | 3300002772 | JGI25164J39214_1001008 | JGI25164J39214_10010084 | 309 |
| 374 | 3300003214 | JGI25165J46597_1000923 | JGI25165J46597_100092321 | 309 |
| 375 | 3300003215 | JGI25153J46596_10000539 | JGI25153J46596_1000053918 | 309 |
| 376 | 3300003215 | JGI25153J46596_10002851 | JGI25153J46596_100028516 | 309 |
| 377 | 3300003215 | JGI25153J46596_10037146 | JGI25153J46596_100371462 | 309 |
| 378 | 3300003316 | rootH1_10018273 | rootH1_100182733 | 309 |
| 379 | 3300003316 | rootH1_10101991 | rootH1_101019913 | 309 |
| 380 | 3300003322 | rootL2_10005069 | rootL2_100050694 | 309 |
| 381 | 3300003322 | rootL2_10043862 | rootL2_100438622 | 309 |
| 382 | 3300003322 | rootL2_10131047 | rootL2_101310473 | 309 |
| 383 | 3300003322 | rootL2_10163672 | rootL2_101636723 | 309 |
| 384 | 3300003322 | rootL2_10173005 | rootL2_101730052 | 309 |
| 385 | 3300003322 | rootL2_10366376 | rootL2_103663762 | 309 |
| 386 | 3300003323 | rootH1_10003366 | rootH1_100033663 | 309 |
| 387 | 3300003323 | rootH1_10010647 | rootH1_100106472 | 309 |
| 388 | 3300003323 | rootH1_10032632 | rootH1_100326327 | 309 |
| 389 | 3300003323 | rootH1_10072115 | rootH1_100721153 | 309 |
| 390 | 3300003323 | rootH1_10130033 | rootH1_101300337 | 309 |
| 391 | 3300003323 | rootH1_10131898 | rootH1_101318984 | 309 |
| 392 | 3300003323 | rootH1_10148682 | rootH1_101486822 | 309 |
| 393 | 3300003323 | rootH1_10190090 | rootH1_101900904 | 309 |
| 394 | 3300003354 | JGI25160J50197_1000175 | JGI25160J50197_100017527 | 309 |
| 395 | 3300003354 | JGI25160J50197_1002813 | JGI25160J50197_10028138 | 309 |
| 396 | 3300003354 | JGI25160J50197_1004550 | JGI25160J50197_10045502 | 309 |
| 397 | 3300003354 | JGI25160J50197_1008609 | JGI25160J50197_10086094 | 309 |
| 398 | 3300003354 | JGI25160J50197_1017025 | JGI25160J50197_10170252 | 309 |
| 399 | 3300003354 | JGI25160J50197_1032984 | JGI25160J50197_10329841 | 309 |
| 400 | 3300003771 | Ga0055526_1000270 | Ga0055526_100027023 | 309 |
| 401 | 3300003790 | Ga0055528_1000108 | Ga0055528_100010826 | 309 |
| 402 | 3300003790 | Ga0055528_1001425 | Ga0055528_100142512 | 309 |
| 403 | 3300003791 | Ga0055530_10000183 | Ga0055530_1000018319 | 309 |
| 404 | 3300003791 | Ga0055530_10000279 | Ga0055530_1000027919 | 309 |
| 405 | 3300003794 | Ga0055531_10000093 | Ga0055531_1000009366 | 309 |
| 406 | 3300004625 | Ga0055543_1011139 | Ga0055543_10111391 | 309 |
| 407 | 3300005262 | Ga0065165_1000036 | Ga0065165_100003683 | 309 |
| 408 | 3300005262 | Ga0065165_1000548 | Ga0065165_100054851 | 309 |
| 409 | 3300005262 | Ga0065165_1007727 | Ga0065165_10077274 | 309 |
| 410 | 3300005288 | Ga0065714_10014084 | Ga0065714_100140845 | 309 |
| 411 | 3300005288 | Ga0065714_10015372 | Ga0065714_100153723 | 309 |
| 412 | 3300005288 | Ga0065714_10073910 | Ga0065714_100739103 | 309 |
| 413 | 3300005289 | Ga0065704_10084803 | Ga0065704_100848033 | 309 |
| 414 | 3300005289 | Ga0065704_10087748 | Ga0065704_100877483 | 309 |
| 415 | 3300005293 | Ga0065715_10241072 | Ga0065715_102410722 | 309 |
| 416 | 3300005328 | Ga0070676_10016784 | Ga0070676_100167844 | 309 |
| 417 | 3300005329 | Ga0070683_100108393 | Ga0070683_1001083932 | 309 |
| 418 | 3300005329 | Ga0070683_100533197 | Ga0070683_1005331971 | 309 |
| 419 | 3300005331 | Ga0070670_100286533 | Ga0070670_1002865331 | 309 |
| 420 | 3300005331 | Ga0070670_100294650 | Ga0070670_1002946502 | 309 |
| 421 | 3300005331 | Ga0070670_100363226 | Ga0070670_1003632261 | 309 |
| 422 | 3300005334 | Ga0068869_100010053 | Ga0068869_1000100534 | 309 |
| 423 | 3300005334 | Ga0068869_100013167 | Ga0068869_1000131672 | 309 |
| 424 | 3300005334 | Ga0068869_100017619 | Ga0068869_1000176194 | 309 |
| 425 | 3300005334 | Ga0068869_100045584 | Ga0068869_1000455844 | 309 |
| 426 | 3300005335 | Ga0070666_10000197 | Ga0070666_1000019728 | 309 |
| 427 | 3300005335 | Ga0070666_10002958 | Ga0070666_100029586 | 309 |
| 428 | 3300005335 | Ga0070666_10037488 | Ga0070666_100374883 | 309 |
| 429 | 3300005335 | Ga0070666_10046753 | Ga0070666_100467533 | 309 |
| 430 | 3300005338 | Ga0068868_100000524 | Ga0068868_10000052414 | 309 |
| 431 | 3300005338 | Ga0068868_100001711 | Ga0068868_10000171110 | 309 |
| 432 | 3300005338 | Ga0068868_100115321 | Ga0068868_1001153212 | 309 |
| 433 | 3300005339 | Ga0070660_100184903 | Ga0070660_1001849033 | 309 |
| 434 | 3300005343 | Ga0070687_100249012 | Ga0070687_1002490121 | 309 |
| 435 | 3300005347 | Ga0070668_100112142 | Ga0070668_1001121422 | 309 |
| 436 | 3300005347 | Ga0070668_100210207 | Ga0070668_1002102071 | 309 |
| 437 | 3300005353 | Ga0070669_100022298 | Ga0070669_1000222985 | 309 |
| 438 | 3300005353 | Ga0070669_100036725 | Ga0070669_1000367251 | 309 |
| 439 | 3300005354 | Ga0070675_100363984 | Ga0070675_1003639841 | 309 |
| 440 | 3300005355 | Ga0070671_100011735 | Ga0070671_1000117356 | 309 |
| 441 | 3300005355 | Ga0070671_100141923 | Ga0070671_1001419232 | 309 |
| 442 | 3300005355 | Ga0070671_100159186 | Ga0070671_1001591861 | 309 |
| 443 | 3300005355 | Ga0070671_100219389 | Ga0070671_1002193892 | 309 |
| 444 | 3300005356 | Ga0070674_100006908 | Ga0070674_1000069083 | 309 |
| 445 | 3300005356 | Ga0070674_100057547 | Ga0070674_1000575472 | 309 |
| 446 | 3300005356 | Ga0070674_100092842 | Ga0070674_1000928422 | 309 |
| 447 | 3300005364 | Ga0070673_100030057 | Ga0070673_1000300573 | 309 |
| 448 | 3300005364 | Ga0070673_100030968 | Ga0070673_1000309682 | 309 |
| 449 | 3300005366 | Ga0070659_100000440 | Ga0070659_10000044024 | 309 |
| 450 | 3300005367 | Ga0070667_100039396 | Ga0070667_1000393963 | 309 |
| 451 | 3300005367 | Ga0070667_100101765 | Ga0070667_1001017652 | 309 |
| 452 | 3300005367 | Ga0070667_100145408 | Ga0070667_1001454082 | 309 |
| 453 | 3300005367 | Ga0070667_100286201 | Ga0070667_1002862012 | 309 |
| 454 | 3300005456 | Ga0070678_100013590 | Ga0070678_1000135904 | 309 |
| 455 | 3300005456 | Ga0070678_100064289 | Ga0070678_1000642891 | 309 |
| 456 | 3300005457 | Ga0070662_100002459 | Ga0070662_1000024599 | 309 |
| 457 | 3300005457 | Ga0070662_100003891 | Ga0070662_1000038915 | 309 |
| 458 | 3300005457 | Ga0070662_100377552 | Ga0070662_1003775521 | 309 |
| 459 | 3300005459 | Ga0068867_100007300 | Ga0068867_1000073002 | 309 |
| 460 | 3300005459 | Ga0068867_100011441 | Ga0068867_1000114415 | 309 |
| 461 | 3300005459 | Ga0068867_100094625 | Ga0068867_1000946251 | 309 |
| 462 | 3300005459 | Ga0068867_100098880 | Ga0068867_1000988802 | 309 |
| 463 | 3300005468 | Ga0070707_100051113 | Ga0070707_1000511133 | 309 |
| 464 | 3300005471 | Ga0070698_100005248 | Ga0070698_10000524810 | 309 |
| 465 | 3300005518 | Ga0070699_100015745 | Ga0070699_1000157453 | 309 |
| 466 | 3300005530 | Ga0070679_100193804 | Ga0070679_1001938042 | 309 |
| 467 | 3300005539 | Ga0068853_100043110 | Ga0068853_1000431102 | 309 |
| 468 | 3300005539 | Ga0068853_100094957 | Ga0068853_1000949572 | 309 |
| 469 | 3300005539 | Ga0068853_100166038 | Ga0068853_1001660381 | 309 |
| 470 | 3300005543 | Ga0070672_100008545 | Ga0070672_1000085452 | 309 |
| 471 | 3300005543 | Ga0070672_100041655 | Ga0070672_1000416553 | 309 |
| 472 | 3300005543 | Ga0070672_100193011 | Ga0070672_1001930112 | 309 |
| 473 | 3300005548 | Ga0070665_100010440 | Ga0070665_1000104407 | 309 |
| 474 | 3300005563 | Ga0068855_100000284 | Ga0068855_10000028433 | 309 |
| 475 | 3300005563 | Ga0068855_100030687 | Ga0068855_1000306876 | 309 |
| 476 | 3300005564 | Ga0070664_100045872 | Ga0070664_1000458722 | 309 |
| 477 | 3300005564 | Ga0070664_100117140 | Ga0070664_1001171402 | 309 |
| 478 | 3300005577 | Ga0068857_100172459 | Ga0068857_1001724592 | 309 |
| 479 | 3300005577 | Ga0068857_100621535 | Ga0068857_1006215351 | 309 |
| 480 | 3300005578 | Ga0068854_100044728 | Ga0068854_1000447282 | 309 |
| 481 | 3300005578 | Ga0068854_100060109 | Ga0068854_1000601093 | 309 |
| 482 | 3300005578 | Ga0068854_100080831 | Ga0068854_1000808312 | 309 |
| 483 | 3300005578 | Ga0068854_100086491 | Ga0068854_1000864914 | 309 |
| 484 | 3300005578 | Ga0068854_100098459 | Ga0068854_1000984592 | 309 |
| 485 | 3300005614 | Ga0068856_100000073 | Ga0068856_10000007327 | 309 |
| 486 | 3300005614 | Ga0068856_100127236 | Ga0068856_1001272362 | 309 |
| 487 | 3300005616 | Ga0068852_100019630 | Ga0068852_1000196303 | 309 |
| 488 | 3300005616 | Ga0068852_100103259 | Ga0068852_1001032592 | 309 |
| 489 | 3300005616 | Ga0068852_100247371 | Ga0068852_1002473712 | 309 |
| 490 | 3300005617 | Ga0068859_100000007 | Ga0068859_100000007204 | 309 |
| 491 | 3300005617 | Ga0068859_100015705 | Ga0068859_1000157054 | 309 |
| 492 | 3300005617 | Ga0068859_100409536 | Ga0068859_1004095362 | 309 |
| 493 | 3300005618 | Ga0068864_100009122 | Ga0068864_1000091228 | 309 |
| 494 | 3300005618 | Ga0068864_100164856 | Ga0068864_1001648561 | 309 |
| 495 | 3300005718 | Ga0068866_10006035 | Ga0068866_100060353 | 309 |
| 496 | 3300005718 | Ga0068866_10025612 | Ga0068866_100256122 | 309 |
| 497 | 3300005719 | Ga0068861_100131124 | Ga0068861_1001311242 | 309 |
| 498 | 3300005834 | Ga0068851_10015736 | Ga0068851_100157362 | 309 |
| 499 | 3300005834 | Ga0068851_10040661 | Ga0068851_100406612 | 309 |
| 500 | 3300005841 | Ga0068863_100000444 | Ga0068863_10000044424 | 309 |
| 501 | 3300005841 | Ga0068863_100000449 | Ga0068863_10000044912 | 309 |
| 502 | 3300005841 | Ga0068863_100673028 | Ga0068863_1006730282 | 309 |
| 503 | 3300005841 | Ga0068863_100702730 | Ga0068863_1007027301 | 309 |
| 504 | 3300005842 | Ga0068858_100002218 | Ga0068858_10000221816 | 309 |
| 505 | 3300005842 | Ga0068858_100301170 | Ga0068858_1003011702 | 309 |
| 506 | 3300005843 | Ga0068860_100000061 | Ga0068860_100000061155 | 309 |
| 507 | 3300005843 | Ga0068860_100000661 | Ga0068860_10000066118 | 309 |
| 508 | 3300005843 | Ga0068860_100031110 | Ga0068860_1000311105 | 309 |
| 509 | 3300005843 | Ga0068860_100032987 | Ga0068860_1000329873 | 309 |
| 510 | 3300006195 | Ga0075366_10000031 | Ga0075366_1000003139 | 309 |
| 511 | 3300006195 | Ga0075366_10163062 | Ga0075366_101630621 | 309 |
| 512 | 3300006237 | Ga0097621_100007495 | Ga0097621_1000074952 | 309 |
| 513 | 3300006237 | Ga0097621_100042264 | Ga0097621_1000422643 | 309 |
| 514 | 3300006353 | Ga0075370_10101921 | Ga0075370_101019212 | 309 |
| 515 | 3300006358 | Ga0068871_100004610 | Ga0068871_10000461010 | 309 |
| 516 | 3300006358 | Ga0068871_100004870 | Ga0068871_1000048705 | 309 |
| 517 | 3300006844 | Ga0075428_100062501 | Ga0075428_1000625013 | 309 |
| 518 | 3300006844 | Ga0075428_100227894 | Ga0075428_1002278941 | 309 |
| 519 | 3300006881 | Ga0068865_100004575 | Ga0068865_1000045755 | 309 |
| 520 | 3300006881 | Ga0068865_100053588 | Ga0068865_1000535882 | 309 |
| 521 | 3300006931 | Ga0097620_100000007 | Ga0097620_100000007205 | 309 |
| 522 | 3300006931 | Ga0097620_100015704 | Ga0097620_1000157045 | 309 |
| 523 | 3300006931 | Ga0097620_100409528 | Ga0097620_1004095282 | 309 |
| 524 | 3300009093 | Ga0105240_10000198 | Ga0105240_1000019851 | 309 |
| 525 | 3300009093 | Ga0105240_10048638 | Ga0105240_100486383 | 309 |
| 526 | 3300009094 | Ga0111539_10198008 | Ga0111539_101980081 | 309 |
| 527 | 3300009098 | Ga0105245_10174559 | Ga0105245_101745592 | 309 |
| 528 | 3300009147 | Ga0114129_10247912 | Ga0114129_102479122 | 309 |
| 529 | 3300009174 | Ga0105241_10000137 | Ga0105241_1000013749 | 309 |
| 530 | 3300009174 | Ga0105241_10000424 | Ga0105241_1000042417 | 309 |
| 531 | 3300009174 | Ga0105241_10005687 | Ga0105241_100056873 | 309 |
| 532 | 3300009174 | Ga0105241_10019080 | Ga0105241_100190803 | 309 |
| 533 | 3300009174 | Ga0105241_10038039 | Ga0105241_100380391 | 309 |
| 534 | 3300009174 | Ga0105241_10066029 | Ga0105241_100660293 | 309 |
| 535 | 3300009176 | Ga0105242_10023601 | Ga0105242_100236012 | 309 |
| 536 | 3300009176 | Ga0105242_10070686 | Ga0105242_100706862 | 309 |
| 537 | 3300009176 | Ga0105242_10088094 | Ga0105242_100880942 | 309 |
| 538 | 3300009176 | Ga0105242_10184388 | Ga0105242_101843881 | 309 |
| 539 | 3300009545 | Ga0105237_10001258 | Ga0105237_1000125827 | 309 |
| 540 | 3300009545 | Ga0105237_10001360 | Ga0105237_1000136014 | 309 |
| 541 | 3300009545 | Ga0105237_10005617 | Ga0105237_1000561711 | 309 |
| 542 | 3300009545 | Ga0105237_10392588 | Ga0105237_103925882 | 309 |
| 543 | 3300009545 | Ga0105237_10418610 | Ga0105237_104186102 | 309 |
| 544 | 3300009551 | Ga0105238_10007301 | Ga0105238_100073016 | 309 |
| 545 | 3300009551 | Ga0105238_10062384 | Ga0105238_100623844 | 309 |
| 546 | 3300009553 | Ga0105249_10030230 | Ga0105249_100302303 | 309 |
| 547 | 3300009553 | Ga0105249_10055907 | Ga0105249_100559075 | 309 |
| 548 | 3300009553 | Ga0105249_10176773 | Ga0105249_101767732 | 309 |
| 549 | 3300009553 | Ga0105249_10542628 | Ga0105249_105426281 | 309 |
| 550 | 3300009553 | Ga0105249_10593071 | Ga0105249_105930711 | 309 |
| 551 | 3300009553 | Ga0105249_10674694 | Ga0105249_106746941 | 309 |
| 552 | 3300010375 | Ga0105239_10005875 | Ga0105239_100058758 | 309 |
| 553 | 3300010375 | Ga0105239_10012560 | Ga0105239_100125609 | 309 |
| 554 | 3300010375 | Ga0105239_10070201 | Ga0105239_100702014 | 309 |
| 555 | 3300010375 | Ga0105239_10194055 | Ga0105239_101940552 | 309 |
| 556 | 3300010375 | Ga0105239_10600789 | Ga0105239_106007892 | 309 |
| 557 | 3300010375 | Ga0105239_10654484 | Ga0105239_106544842 | 309 |
| 558 | 3300011119 | Ga0105246_10001938 | Ga0105246_1000193813 | 309 |
| 559 | 3300011119 | Ga0105246_10067458 | Ga0105246_100674581 | 309 |
| 560 | 3300013100 | Ga0157373_10008808 | Ga0157373_100088086 | 309 |
| 561 | 3300013100 | Ga0157373_10010688 | Ga0157373_100106887 | 309 |
| 562 | 3300013102 | Ga0157371_10004170 | Ga0157371_100041703 | 309 |
| 563 | 3300013102 | Ga0157371_10048536 | Ga0157371_100485363 | 309 |
| 564 | 3300013102 | Ga0157371_10058305 | Ga0157371_100583052 | 309 |
| 565 | 3300013102 | Ga0157371_10093180 | Ga0157371_100931802 | 309 |
| 566 | 3300013102 | Ga0157371_10093567 | Ga0157371_100935672 | 309 |
| 567 | 3300013104 | Ga0157370_10001009 | Ga0157370_100010099 | 309 |
| 568 | 3300013104 | Ga0157370_10007076 | Ga0157370_100070763 | 309 |
| 569 | 3300013104 | Ga0157370_10010926 | Ga0157370_100109264 | 309 |
| 570 | 3300013104 | Ga0157370_10021662 | Ga0157370_100216625 | 309 |
| 571 | 3300013104 | Ga0157370_10047458 | Ga0157370_100474584 | 309 |
| 572 | 3300013104 | Ga0157370_10097750 | Ga0157370_100977503 | 309 |
| 573 | 3300013105 | Ga0157369_10229265 | Ga0157369_102292652 | 309 |
| 574 | 3300013296 | Ga0157374_10008935 | Ga0157374_100089354 | 309 |
| 575 | 3300013296 | Ga0157374_10010333 | Ga0157374_100103333 | 309 |
| 576 | 3300013296 | Ga0157374_10124929 | Ga0157374_101249291 | 309 |
| 577 | 3300013296 | Ga0157374_10306121 | Ga0157374_103061212 | 309 |
| 578 | 3300013296 | Ga0157374_10420939 | Ga0157374_104209392 | 309 |
| 579 | 3300013297 | Ga0157378_10014702 | Ga0157378_100147023 | 309 |
| 580 | 3300013297 | Ga0157378_10021840 | Ga0157378_100218404 | 309 |
| 581 | 3300013297 | Ga0157378_10131393 | Ga0157378_101313932 | 309 |
| 582 | 3300013297 | Ga0157378_10161016 | Ga0157378_101610162 | 309 |
| 583 | 3300013297 | Ga0157378_10251840 | Ga0157378_102518401 | 309 |
| 584 | 3300013297 | Ga0157378_10331291 | Ga0157378_103312912 | 309 |
| 585 | 3300013297 | Ga0157378_10454093 | Ga0157378_104540932 | 309 |
| 586 | 3300013306 | Ga0163162_10000151 | Ga0163162_1000015151 | 309 |
| 587 | 3300013306 | Ga0163162_10000406 | Ga0163162_100004064 | 309 |
| 588 | 3300013306 | Ga0163162_10000827 | Ga0163162_100008279 | 309 |
| 589 | 3300013306 | Ga0163162_10001117 | Ga0163162_100011175 | 309 |
| 590 | 3300013306 | Ga0163162_10037543 | Ga0163162_100375433 | 309 |
| 591 | 3300013306 | Ga0163162_10180651 | Ga0163162_101806511 | 309 |
| 592 | 3300013307 | Ga0157372_10020545 | Ga0157372_100205456 | 309 |
| 593 | 3300013307 | Ga0157372_10534867 | Ga0157372_105348672 | 309 |
| 594 | 3300013307 | Ga0157372_10697923 | Ga0157372_106979231 | 309 |
| 595 | 3300013307 | Ga0157372_10845670 | Ga0157372_108456701 | 309 |
| 596 | 3300013308 | Ga0157375_10034578 | Ga0157375_100345784 | 309 |
| 597 | 3300013308 | Ga0157375_10055835 | Ga0157375_100558352 | 309 |
| 598 | 3300013308 | Ga0157375_10088940 | Ga0157375_100889403 | 309 |
| 599 | 3300013308 | Ga0157375_10097917 | Ga0157375_100979173 | 309 |
| 600 | 3300013308 | Ga0157375_10134685 | Ga0157375_101346852 | 309 |
| 601 | 3300013308 | Ga0157375_10154784 | Ga0157375_101547841 | 309 |
| 602 | 3300013308 | Ga0157375_10170061 | Ga0157375_101700612 | 309 |
| 603 | 3300014325 | Ga0163163_10038961 | Ga0163163_100389612 | 309 |
| 604 | 3300014325 | Ga0163163_10085648 | Ga0163163_100856482 | 309 |
| 605 | 3300014325 | Ga0163163_10091197 | Ga0163163_100911973 | 309 |
| 606 | 3300014325 | Ga0163163_10147104 | Ga0163163_101471042 | 309 |
| 607 | 3300014325 | Ga0163163_10233997 | Ga0163163_102339972 | 309 |
| 608 | 3300014326 | Ga0157380_10208766 | Ga0157380_102087662 | 309 |
| 609 | 3300014745 | Ga0157377_10002753 | Ga0157377_100027537 | 309 |
| 610 | 3300014745 | Ga0157377_10002912 | Ga0157377_100029127 | 309 |
| 611 | 3300014969 | Ga0157376_10005885 | Ga0157376_100058854 | 309 |
| 612 | 3300014969 | Ga0157376_10015107 | Ga0157376_100151076 | 309 |
| 613 | 3300015261 | Ga0182006_1000357 | Ga0182006_10003577 | 309 |
| 614 | 3300015261 | Ga0182006_1000894 | Ga0182006_100089416 | 309 |
| 615 | 3300015261 | Ga0182006_1064751 | Ga0182006_10647512 | 309 |
| 616 | 3300015265 | Ga0182005_1000039 | Ga0182005_1000039106 | 309 |
| 617 | 3300017792 | Ga0163161_10000628 | Ga0163161_1000062814 | 309 |
| 618 | 3300017792 | Ga0163161_10051791 | Ga0163161_100517914 | 309 |
| 619 | 3300017792 | Ga0163161_10305670 | Ga0163161_103056701 | 309 |
| 620 | 3300017792 | Ga0163161_10314873 | Ga0163161_103148732 | 309 |
| 621 | 3300025208 | Ga0209436_100536 | Ga0209436_1005363 | 309 |
| 622 | 3300025231 | Ga0207427_100236 | Ga0207427_10023623 | 309 |
| 623 | 3300025233 | Ga0209437_100034 | Ga0209437_10003421 | 309 |
| 624 | 3300025246 | Ga0209646_1000002 | Ga0209646_1000002979 | 309 |
| 625 | 3300025246 | Ga0209646_1000004 | Ga0209646_1000004140 | 309 |
| 626 | 3300025250 | Ga0209026_1000132 | Ga0209026_100013290 | 309 |
| 627 | 3300025250 | Ga0209026_1000178 | Ga0209026_100017864 | 309 |
| 628 | 3300025250 | Ga0209026_1002731 | Ga0209026_10027314 | 309 |
| 629 | 3300025261 | Ga0209233_1000038 | Ga0209233_100003821 | 309 |
| 630 | 3300025273 | Ga0209673_1000183 | Ga0209673_100018348 | 309 |
| 631 | 3300025273 | Ga0209673_1000483 | Ga0209673_100048356 | 309 |
| 632 | 3300025284 | Ga0209130_1004353 | Ga0209130_10043534 | 309 |
| 633 | 3300025292 | Ga0209676_1002361 | Ga0209676_10023616 | 309 |
| 634 | 3300025295 | Ga0209564_1000561 | Ga0209564_100056117 | 309 |
| 635 | 3300025297 | Ga0209758_1000912 | Ga0209758_10009126 | 309 |
| 636 | 3300025297 | Ga0209758_1001298 | Ga0209758_100129818 | 309 |
| 637 | 3300025297 | Ga0209758_1001642 | Ga0209758_100164219 | 309 |
| 638 | 3300025297 | Ga0209758_1006687 | Ga0209758_10066875 | 309 |
| 639 | 3300025298 | Ga0209050_1000160 | Ga0209050_100016074 | 309 |
| 640 | 3300025298 | Ga0209050_1000305 | Ga0209050_100030575 | 309 |
| 641 | 3300025298 | Ga0209050_1024244 | Ga0209050_10242442 | 309 |
| 642 | 3300025302 | Ga0207426_1000051 | Ga0207426_100005145 | 309 |
| 643 | 3300025302 | Ga0207426_1000104 | Ga0207426_1000104121 | 309 |
| 644 | 3300025302 | Ga0207426_1000360 | Ga0207426_100036048 | 309 |
| 645 | 3300025302 | Ga0207426_1001364 | Ga0207426_10013645 | 309 |
| 646 | 3300025302 | Ga0207426_1001887 | Ga0207426_10018876 | 309 |
| 647 | 3300025302 | Ga0207426_1006794 | Ga0207426_10067944 | 309 |
| 648 | 3300025303 | Ga0209051_1045884 | Ga0209051_10458842 | 309 |
| 649 | 3300025304 | Ga0209257_1000001 | Ga0209257_1000001894 | 309 |
| 650 | 3300025304 | Ga0209257_1001540 | Ga0209257_100154022 | 309 |
| 651 | 3300025304 | Ga0209257_1004420 | Ga0209257_10044202 | 309 |
| 652 | 3300025321 | Ga0207656_10171817 | Ga0207656_101718171 | 309 |
| 653 | 3300025901 | Ga0207688_10029574 | Ga0207688_100295742 | 309 |
| 654 | 3300025903 | Ga0207680_10000177 | Ga0207680_1000017716 | 309 |
| 655 | 3300025903 | Ga0207680_10013867 | Ga0207680_100138672 | 309 |
| 656 | 3300025903 | Ga0207680_10308040 | Ga0207680_103080401 | 309 |
| 657 | 3300025904 | Ga0207647_10021677 | Ga0207647_100216775 | 309 |
| 658 | 3300025907 | Ga0207645_10000284 | Ga0207645_100002842 | 309 |
| 659 | 3300025907 | Ga0207645_10043803 | Ga0207645_100438032 | 309 |
| 660 | 3300025911 | Ga0207654_10005471 | Ga0207654_100054713 | 309 |
| 661 | 3300025911 | Ga0207654_10007056 | Ga0207654_100070563 | 309 |
| 662 | 3300025911 | Ga0207654_10275318 | Ga0207654_102753182 | 309 |
| 663 | 3300025913 | Ga0207695_10000346 | Ga0207695_1000034649 | 309 |
| 664 | 3300025914 | Ga0207671_10000987 | Ga0207671_100009872 | 309 |
| 665 | 3300025914 | Ga0207671_10001776 | Ga0207671_1000177624 | 309 |
| 666 | 3300025914 | Ga0207671_10002977 | Ga0207671_100029778 | 309 |
| 667 | 3300025914 | Ga0207671_10254657 | Ga0207671_102546572 | 309 |
| 668 | 3300025918 | Ga0207662_10030020 | Ga0207662_100300204 | 309 |
| 669 | 3300025919 | Ga0207657_10047967 | Ga0207657_100479673 | 309 |
| 670 | 3300025921 | Ga0207652_10181113 | Ga0207652_101811133 | 309 |
| 671 | 3300025923 | Ga0207681_10036284 | Ga0207681_100362845 | 309 |
| 672 | 3300025923 | Ga0207681_10054871 | Ga0207681_100548712 | 309 |
| 673 | 3300025924 | Ga0207694_10006626 | Ga0207694_100066265 | 309 |
| 674 | 3300025924 | Ga0207694_10070024 | Ga0207694_100700243 | 309 |
| 675 | 3300025925 | Ga0207650_10043496 | Ga0207650_100434962 | 309 |
| 676 | 3300025925 | Ga0207650_10117432 | Ga0207650_101174322 | 309 |
| 677 | 3300025925 | Ga0207650_10268998 | Ga0207650_102689982 | 309 |
| 678 | 3300025926 | Ga0207659_10037293 | Ga0207659_100372932 | 309 |
| 679 | 3300025926 | Ga0207659_10089587 | Ga0207659_100895872 | 309 |
| 680 | 3300025926 | Ga0207659_10460210 | Ga0207659_104602101 | 309 |
| 681 | 3300025932 | Ga0207690_10000235 | Ga0207690_1000023538 | 309 |
| 682 | 3300025933 | Ga0207706_10002489 | Ga0207706_100024896 | 309 |
| 683 | 3300025933 | Ga0207706_10007739 | Ga0207706_100077397 | 309 |
| 684 | 3300025934 | Ga0207686_10083451 | Ga0207686_100834512 | 309 |
| 685 | 3300025934 | Ga0207686_10153070 | Ga0207686_101530702 | 309 |
| 686 | 3300025938 | Ga0207704_10025050 | Ga0207704_100250502 | 309 |
| 687 | 3300025938 | Ga0207704_10157061 | Ga0207704_101570612 | 309 |
| 688 | 3300025940 | Ga0207691_10278685 | Ga0207691_102786852 | 309 |
| 689 | 3300025942 | Ga0207689_10003255 | Ga0207689_1000325510 | 309 |
| 690 | 3300025942 | Ga0207689_10004450 | Ga0207689_100044504 | 309 |
| 691 | 3300025942 | Ga0207689_10007607 | Ga0207689_100076077 | 309 |
| 692 | 3300025942 | Ga0207689_10025014 | Ga0207689_100250146 | 309 |
| 693 | 3300025942 | Ga0207689_10098104 | Ga0207689_100981042 | 309 |
| 694 | 3300025945 | Ga0207679_10060688 | Ga0207679_100606882 | 309 |
| 695 | 3300025949 | Ga0207667_10006159 | Ga0207667_100061596 | 309 |
| 696 | 3300025949 | Ga0207667_10036938 | Ga0207667_100369384 | 309 |
| 697 | 3300025960 | Ga0207651_10007927 | Ga0207651_100079272 | 309 |
| 698 | 3300025960 | Ga0207651_10053860 | Ga0207651_100538603 | 309 |
| 699 | 3300025960 | Ga0207651_10200619 | Ga0207651_102006192 | 309 |
| 700 | 3300025961 | Ga0207712_10064573 | Ga0207712_100645732 | 309 |
| 701 | 3300025961 | Ga0207712_10088045 | Ga0207712_100880452 | 309 |
| 702 | 3300025972 | Ga0207668_10238644 | Ga0207668_102386441 | 309 |
| 703 | 3300025981 | Ga0207640_10029277 | Ga0207640_100292772 | 309 |
| 704 | 3300025981 | Ga0207640_10066244 | Ga0207640_100662442 | 309 |
| 705 | 3300025981 | Ga0207640_10079304 | Ga0207640_100793042 | 309 |
| 706 | 3300025986 | Ga0207658_10041566 | Ga0207658_100415662 | 309 |
| 707 | 3300025986 | Ga0207658_10080217 | Ga0207658_100802172 | 309 |
| 708 | 3300025986 | Ga0207658_10251450 | Ga0207658_102514502 | 309 |
| 709 | 3300026023 | Ga0207677_10014564 | Ga0207677_100145642 | 309 |
| 710 | 3300026023 | Ga0207677_10042043 | Ga0207677_100420434 | 309 |
| 711 | 3300026023 | Ga0207677_10058309 | Ga0207677_100583092 | 309 |
| 712 | 3300026023 | Ga0207677_10152591 | Ga0207677_101525912 | 309 |
| 713 | 3300026035 | Ga0207703_10009385 | Ga0207703_100093852 | 309 |
| 714 | 3300026041 | Ga0207639_10135971 | Ga0207639_101359713 | 309 |
| 715 | 3300026041 | Ga0207639_10157414 | Ga0207639_101574141 | 309 |
| 716 | 3300026075 | Ga0207708_10072648 | Ga0207708_100726482 | 309 |
| 717 | 3300026078 | Ga0207702_10001281 | Ga0207702_1000128119 | 309 |
| 718 | 3300026078 | Ga0207702_10346179 | Ga0207702_103461792 | 309 |
| 719 | 3300026088 | Ga0207641_10000090 | Ga0207641_1000009044 | 309 |
| 720 | 3300026088 | Ga0207641_10000111 | Ga0207641_1000011171 | 309 |
| 721 | 3300026088 | Ga0207641_10002912 | Ga0207641_100029128 | 309 |
| 722 | 3300026088 | Ga0207641_10216546 | Ga0207641_102165462 | 309 |
| 723 | 3300026089 | Ga0207648_10000383 | Ga0207648_1000038322 | 309 |
| 724 | 3300026089 | Ga0207648_10022129 | Ga0207648_100221297 | 309 |
| 725 | 3300026095 | Ga0207676_10008833 | Ga0207676_100088334 | 309 |
| 726 | 3300026116 | Ga0207674_10004856 | Ga0207674_100048563 | 309 |
| 727 | 3300026116 | Ga0207674_10007260 | Ga0207674_1000726010 | 309 |
| 728 | 3300026118 | Ga0207675_100012579 | Ga0207675_1000125797 | 309 |
| 729 | 3300026118 | Ga0207675_100067386 | Ga0207675_1000673864 | 309 |
| 730 | 3300026121 | Ga0207683_10002635 | Ga0207683_1000263514 | 309 |
| 731 | 3300026121 | Ga0207683_10022617 | Ga0207683_100226171 | 309 |
| 732 | 3300026121 | Ga0207683_10023168 | Ga0207683_100231683 | 309 |
| 733 | 3300026142 | Ga0207698_10036136 | Ga0207698_100361362 | 309 |
| 734 | 3300026142 | Ga0207698_10119007 | Ga0207698_101190072 | 309 |
| 735 | 3300026142 | Ga0207698_10290671 | Ga0207698_102906712 | 309 |
| 736 | 3300028379 | Ga0268266_10073432 | Ga0268266_100734322 | 309 |
| 737 | 3300028380 | Ga0268265_10530521 | Ga0268265_105305211 | 309 |
| 738 | 3300028381 | Ga0268264_10000079 | Ga0268264_1000007929 | 309 |
| 739 | 3300028381 | Ga0268264_10023200 | Ga0268264_100232004 | 309 |
| 740 | 3300028381 | Ga0268264_10047692 | Ga0268264_100476923 | 309 |
| 741 | 3300028381 | Ga0268264_10170640 | Ga0268264_101706402 | 309 |
| 742 | 3300028794 | Ga0307515_10000078 | Ga0307515_10000078154 | 309 |
| 743 | 3300028794 | Ga0307515_10000290 | Ga0307515_1000029080 | 309 |
| 744 | 3300030521 | Ga0307511_10002426 | Ga0307511_100024268 | 309 |
| 745 | 3300030731 | Ga0316177_1183670 | Ga0316177_11836701 | 309 |
| 746 | 3300030732 | Ga0316176_1098279 | Ga0316176_109827936 | 309 |
| 747 | 3300030742 | Ga0316183_1030332 | Ga0316183_10303324 | 309 |
| 748 | 3300030744 | Ga0316181_1084052 | Ga0316181_108405236 | 309 |
| 749 | 3300031251 | Ga0265327_10036126 | Ga0265327_100361262 | 309 |
| 750 | 3300031456 | Ga0307513_10011825 | Ga0307513_100118256 | 309 |
| 751 | 3300031456 | Ga0307513_10063761 | Ga0307513_100637613 | 309 |
| 752 | 3300031507 | Ga0307509_10025814 | Ga0307509_100258146 | 309 |
| 753 | 3300031507 | Ga0307509_10262811 | Ga0307509_102628112 | 309 |
| 754 | 3300031911 | Ga0307412_10057868 | Ga0307412_100578685 | 309 |
| 755 | 3300032004 | Ga0307414_10000332 | Ga0307414_1000033214 | 309 |
| 756 | 3300032004 | Ga0307414_10006443 | Ga0307414_100064433 | 309 |
| 757 | 3300032004 | Ga0307414_10010074 | Ga0307414_100100746 | 309 |
| 758 | 3300032004 | Ga0307414_10029605 | Ga0307414_100296052 | 309 |
| 759 | 3300032004 | Ga0307414_10117073 | Ga0307414_101170732 | 309 |
| 760 | 3300032004 | Ga0307414_10354131 | Ga0307414_103541311 | 309 |
| 761 | 3300032005 | Ga0307411_10110350 | Ga0307411_101103502 | 309 |
| 762 | 3300033179 | Ga0307507_10000032 | Ga0307507_1000003283 | 309 |
| 763 | 3300035172 | Ga0373955_0018775 | Ga0373955_0018775_2029_2973 | 309 |
| 764 | 3300035410 | Ga0373924_0081276 | Ga0373924_0081276_363_1307 | 309 |
| 765 | 3300036401 | Ga0373937_0005416 | Ga0373937_0005416_3338_4282 | 309 |
| 766 | 3300037312 | Ga0395899_0000002 | Ga0395899_0000002_51137_52081 | 309 |
| 767 | 3300037312 | Ga0395899_0012334 | Ga0395899_0012334_1229_2161 | 309 |
| 768 | 3300037418 | Ga0395900_0000284 | Ga0395900_0000284_61901_62830 | 309 |
| 769 | 3300037418 | Ga0395900_0000701 | Ga0395900_0000701_235_1167 | 309 |
| 770 | 3300037418 | Ga0395900_0003637 | Ga0395900_0003637_9967_10899 | 309 |
| 771 | 3300037418 | Ga0395900_0079340 | Ga0395900_0079340_1050_1982 | 309 |
| 772 | 3300037466 | Ga0395898_0003757 | Ga0395898_0003757_15688_16620 | 309 |
| 773 | 3300037466 | Ga0395898_0004276 | Ga0395898_0004276_3306_4238 | 309 |
| 774 | 3300037471 | Ga0395905_0001420 | Ga0395905_0001420_6340_7284 | 309 |
| 775 | 3300038443 | Ga0395901_0084967 | Ga0395901_0084967_2314_3246 | 309 |
| 776 | 3300038443 | Ga0395901_0346086 | Ga0395901_0346086_337_1269 | 309 |
| 777 | 3300038443 | Ga0395901_0355930 | Ga0395901_0355930_242_1174 | 309 |
| 778 | 3300041407 | Ga0439447_000820 | Ga0439447_000820_5229_6161 | 309 |
| 779 | 3300041997 | Ga0439431_0009916 | Ga0439431_0009916_406_1335 | 309 |
| 780 | 3300042876 | Ga0451577_0215713 | Ga0451577_0215713_331_1290 | 309 |
| 781 | 3300044658 | Ga0466972_0000047 | Ga0466972_0000047_73531_74469 | 309 |
| 782 | 3300044658 | Ga0466972_0022806 | Ga0466972_0022806_32_976 | 309 |
| 783 | 3300044673 | Ga0453683_0006615 | Ga0453683_0006615_6136_7095 | 309 |
| 784 | 3300044712 | Ga0453684_0246880 | Ga0453684_0246880_316_1275 | 309 |
| 785 | 3300044842 | Ga0466957_0146978 | Ga0466957_0146978_559_1500 | 309 |
| 786 | 3300045049 | Ga0466959_0010259 | Ga0466959_0010259_5038_5982 | 309 |
| 787 | 3300045051 | Ga0451576_0036117 | Ga0451576_0036117_245_1204 | 309 |
| 788 | 3300046453 | Ga0495627_004361 | Ga0495627_004361_1327_2268 | 309 |
| 789 | 3300046460 | Ga0495638_0020710 | Ga0495638_0020710_1032_1961 | 309 |
| 790 | 3300046471 | Ga0495650_0000162 | Ga0495650_0000162_33631_34566 | 309 |
| 791 | 3300046506 | Ga0495583_0033179 | Ga0495583_0033179_652_1587 | 309 |
| 792 | 3300046507 | Ga0495606_0001495 | Ga0495606_0001495_915_1850 | 309 |
| 793 | 3300046512 | Ga0495610_0006790 | Ga0495610_0006790_2113_3048 | 309 |
| 794 | 3300046514 | Ga0495618_0062568 | Ga0495618_0062568_609_1553 | 309 |
| 795 | 3300046516 | Ga0495628_0042148 | Ga0495628_0042148_2561_3505 | 309 |
| 796 | 3300046524 | Ga0495648_0003925 | Ga0495648_0003925_10506_11435 | 309 |
| 797 | 3300046524 | Ga0495648_0035510 | Ga0495648_0035510_387_1337 | 309 |
| 798 | 3300046536 | Ga0495587_0022367 | Ga0495587_0022367_513_1457 | 309 |
| 799 | 3300046538 | Ga0495609_0026185 | Ga0495609_0026185_620_1549 | 309 |
| 800 | 3300046538 | Ga0495609_0026969 | Ga0495609_0026969_1499_2449 | 309 |
| 801 | 3300046559 | Ga0495667_0164769 | Ga0495667_0164769_373_1317 | 309 |
| 802 | 3300046616 | Ga0495668_0000009 | Ga0495668_0000009_151334_152284 | 309 |
| 803 | 3300046616 | Ga0495668_0002458 | Ga0495668_0002458_11115_12053 | 309 |
| 804 | 3300046642 | Ga0495634_0022653 | Ga0495634_0022653_100_1044 | 309 |
| 805 | 3300046660 | Ga0495625_0000515 | Ga0495625_0000515_27962_28897 | 309 |
| 806 | 3300046660 | Ga0495625_0000534 | Ga0495625_0000534_29000_29950 | 309 |
| 807 | 3300046665 | Ga0495661_0005923 | Ga0495661_0005923_7372_8310 | 309 |
| 808 | 3300046665 | Ga0495661_0019164 | Ga0495661_0019164_3270_4205 | 309 |
| 809 | 3300046675 | Ga0495657_0129231 | Ga0495657_0129231_193_1137 | 309 |
| 810 | 3300046694 | Ga0495649_0000009 | Ga0495649_0000009_148510_149445 | 309 |
| 811 | 3300047320 | Ga0495672_0011690 | Ga0495672_0011690_1404_2333 | 309 |
| 812 | 3300047320 | Ga0495672_0018509 | Ga0495672_0018509_32_970 | 309 |
| 813 | 3300047471 | Ga0495684_0104206 | Ga0495684_0104206_756_1700 | 309 |
| 814 | 3300047472 | Ga0495686_0000471 | Ga0495686_0000471_58371_59309 | 309 |
| 815 | 3300047472 | Ga0495686_0011123 | Ga0495686_0011123_1186_2130 | 309 |
| 816 | 3300047472 | Ga0495686_0051693 | Ga0495686_0051693_600_1535 | 309 |
| 817 | 3300048914 | Ga0496111_0046852 | Ga0496111_0046852_20_964 | 309 |
| 818 | 3300048917 | Ga0496114_0338270 | Ga0496114_0338270_27_971 | 309 |
| 819 | 3300048924 | Ga0496121_0007063 | Ga0496121_0007063_2786_3721 | 309 |
| 820 | 3300048927 | Ga0496124_0018530 | Ga0496124_0018530_4630_5562 | 309 |
| 821 | 3300048927 | Ga0496124_0037765 | Ga0496124_0037765_1602_2555 | 309 |
| 822 | 3300048928 | Ga0496125_0000018 | Ga0496125_0000018_327822_328754 | 309 |
| 823 | 3300049571 | Ga0501034_0016304 | Ga0501034_0016304_5030_5968 | 309 |
| 824 | 3300049571 | Ga0501034_0167941 | Ga0501034_0167941_529_1476 | 309 |
| 825 | 3300049742 | Ga0501080_0273511 | Ga0501080_0273511_456_1415 | 309 |
| 826 | 3300049758 | Ga0501241_000156 | Ga0501241_000156_6431_7372 | 309 |
| 827 | 3300049822 | Ga0501035_0138657 | Ga0501035_0138657_62_1000 | 309 |
| 828 | 3300049823 | Ga0501044_0497785 | Ga0501044_0497785_144_1082 | 309 |
| 829 | 3300050493 | nmdc:mga0k408_144193_c1 | nmdc:mga0k408_144193_c1_43_972 | 309 |
| 830 | 3300050493 | nmdc:mga0k408_85_c1 | nmdc:mga0k408_85_c1_33297_34247 | 309 |
| 831 | 3300050496 | nmdc:mga07m45_110018_c1 | nmdc:mga07m45_110018_c1_453_1388 | 309 |
| 832 | 3300053085 | Ga0495619_0061084 | Ga0495619_0061084_485_1429 | 309 |
| 833 | 3300053086 | Ga0500578_0000765 | Ga0500578_0000765_16394_17332 | 309 |
| 834 | 3300053090 | Ga0500646_0006420 | Ga0500646_0006420_446_1384 | 309 |
| 835 | 3300053092 | Ga0500583_0062394 | Ga0500583_0062394_699_1628 | 309 |
| 836 | 3300053096 | Ga0500641_0099399 | Ga0500641_0099399_239_1183 | 309 |
| 837 | 3300053108 | Ga0500562_000098 | Ga0500562_000098_21260_22195 | 309 |
| 838 | 3300053118 | Ga0500594_0018846 | Ga0500594_0018846_280_1218 | 309 |
| 839 | 3300053125 | Ga0500618_008553 | Ga0500618_008553_340_1284 | 309 |
| 840 | 3300053130 | Ga0500642_0033770 | Ga0500642_0033770_611_1558 | 309 |
| 841 | 3300053139 | Ga0500568_0020257 | Ga0500568_0020257_240_1178 | 309 |
| 842 | 3300053139 | Ga0500568_0024275 | Ga0500568_0024275_589_1530 | 309 |
| 843 | 3300053139 | Ga0500568_0060527 | Ga0500568_0060527_176_1105 | 309 |
| 844 | 3300053156 | Ga0500622_0002797 | Ga0500622_0002797_11023_11952 | 309 |
| 845 | 3300053727 | Ga0500611_000024 | Ga0500611_000024_177_1127 | 309 |
| 846 | iso_pu_bacteria | 2929177148 | 2929178104 | 309 |
| 847 | iso_pu_bacteria | 2945977869 | 2945980466 | 309 |
| 848 | iso_pu_bacteria | 2946013367 | 2946013672 | 309 |
| 849 | 3300003323 | rootH1_10330688 | rootH1_103306882 | 310 |
| 850 | 3300005288 | Ga0065714_10003215 | Ga0065714_100032154 | 310 |
| 851 | 3300032004 | Ga0307414_10000903 | Ga0307414_100009037 | 310 |
| 852 | 3300046453 | Ga0495627_037920 | Ga0495627_037920_411_1367 | 310 |
| 853 | 3300049744 | Ga0501083_0133403 | Ga0501083_0133403_397_1335 | 310 |
| 854 | 3300053096 | Ga0500641_0000007 | Ga0500641_0000007_145149_146105 | 310 |
| 855 | iso_pu_bacteria | 2904445276 | 2904447319 | 310 |
| 856 | 3300002737 | JGI25162J39368_1001640 | JGI25162J39368_10016409 | 311 |
| 857 | 3300009093 | Ga0105240_10074083 | Ga0105240_100740833 | 311 |
| 858 | 3300010375 | Ga0105239_10041485 | Ga0105239_100414854 | 311 |
| 859 | 3300013105 | Ga0157369_10044786 | Ga0157369_100447864 | 311 |
| 860 | 3300013307 | Ga0157372_10098575 | Ga0157372_100985752 | 311 |
| 861 | 3300025226 | Ga0209674_100329 | Ga0209674_10032910 | 311 |
| 862 | 3300025233 | Ga0209437_100719 | Ga0209437_1007199 | 311 |
| 863 | iso_pu_bacteria | 2842909656 | 2842914909 | 311 |
| 864 | 3300025913 | Ga0207695_10036487 | Ga0207695_100364873 | 312 |
| 865 | 3300044673 | Ga0453683_0059188 | Ga0453683_0059188_376_1365 | 313 |
| 866 | 3300005563 | Ga0068855_100158197 | Ga0068855_1001581972 | 314 |
| 867 | 3300013104 | Ga0157370_10059379 | Ga0157370_100593793 | 314 |
| 868 | 3300013306 | Ga0163162_10000123 | Ga0163162_1000012324 | 314 |
| 869 | 3300013308 | Ga0157375_10091846 | Ga0157375_100918462 | 314 |
| 870 | 3300014497 | Ga0182008_10000461 | Ga0182008_1000046114 | 314 |
| 871 | 3300039437 | Ga0436365_1399871 | Ga0436365_1399871_10620_11570 | 314 |
| 872 | 3300044684 | Ga0466966_0000047 | Ga0466966_0000047_56005_57021 | 318 |
| 873 | 3300044765 | Ga0466970_0094577 | Ga0466970_0094577_247_1263 | 318 |
| 874 | 3300045049 | Ga0466959_0000065 | Ga0466959_0000065_47080_48096 | 318 |
| 875 | 3300017792 | Ga0163161_10000979 | Ga0163161_100009797 | 322 |
| 876 | 3300025914 | Ga0207671_10004116 | Ga0207671_1000411614 | 322 |
| 877 | 3300046558 | Ga0495633_0000005 | Ga0495633_0000005_156994_157977 | 323 |
| 878 | 3300053093 | Ga0500651_0118206 | Ga0500651_0118206_565_1548 | 323 |
| 879 | 2162886007 | SwRhRL2b_contig_1524932 | SwRhRL2b_0809.00006310 | 324 |
| 880 | 3300005288 | Ga0065714_10004671 | Ga0065714_100046717 | 324 |
| 881 | 3300005288 | Ga0065714_10064770 | Ga0065714_100647705 | 324 |
| 882 | 3300005289 | Ga0065704_10070374 | Ga0065704_1007037417 | 324 |
| 883 | 3300005367 | Ga0070667_100003595 | Ga0070667_10000359510 | 324 |
| 884 | 3300005617 | Ga0068859_100007469 | Ga0068859_1000074693 | 324 |
| 885 | 3300005843 | Ga0068860_100005896 | Ga0068860_1000058969 | 324 |
| 886 | 3300006931 | Ga0097620_100007469 | Ga0097620_1000074693 | 324 |
| 887 | 3300013100 | Ga0157373_10000936 | Ga0157373_1000093618 | 324 |
| 888 | 3300013102 | Ga0157371_10003525 | Ga0157371_100035255 | 324 |
| 889 | 3300013297 | Ga0157378_10021640 | Ga0157378_100216403 | 324 |
| 890 | 3300014497 | Ga0182008_10000025 | Ga0182008_10000025116 | 324 |
| 891 | 3300015261 | Ga0182006_1001592 | Ga0182006_10015925 | 324 |
| 892 | 3300025986 | Ga0207658_10013982 | Ga0207658_100139824 | 324 |
| 893 | 3300031911 | Ga0307412_10000001 | Ga0307412_10000001451 | 324 |
| 894 | 3300032004 | Ga0307414_10000502 | Ga0307414_1000050216 | 324 |
| 895 | 3300053093 | Ga0500651_0000230 | Ga0500651_0000230_3278_4252 | 324 |
| 896 | iso_pu_bacteria | 2738541284 | 2738761472 | 324 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1e7q-assembly1.cif.gz_A-2 | gdp 4-keto-6-deoxy-d-mannose epimerase reductase s107a | 0.9728 | 19 | 321 |
| 1e7r-assembly1.cif.gz_A-2 | gdp 4-keto-6-deoxy-d-mannose epimerase reductase y136e | 0.9727 | 19 | 321 |
| 1e7s-assembly1.cif.gz_A-2 | gdp 4-keto-6-deoxy-d-mannose epimerase reductase k140r | 0.9654 | 19 | 322 |
| 1e6u-assembly1.cif.gz_A-2 | gdp 4-keto-6-deoxy-d-mannose epimerase reductase | 0.9643 | 19 | 321 |
| 8ewu-assembly1.cif.gz_A | x-ray structure of the gdp-6-deoxy-4-keto-d-lyxo-heptose-4-reductase from campylobacter jejuni hs:15 | 0.9622 | 17 | 320 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1e6uA02 | Alpha Beta;Alpha-Beta Complex;UDP-galactose 4-epimerase; domain 1;UDP-galactose 4-epimerase, domain 1 | 0.9323 | 184 | 321 | 3.90.25.10 |
| 4bkpC01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9124 | 19 | 255 | 3.40.50.720 |
| af_A0A0R0KMW5_231_418_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9122 | 152 | 324 | 3.40.50.720 |
| 1e6uA02 | Alpha Beta;Alpha-Beta Complex;UDP-galactose 4-epimerase; domain 1;UDP-galactose 4-epimerase, domain 1 | 0.9037 | 184 | 321 | 3.90.25.10 |
| 6aqyC02 | Alpha Beta;Alpha-Beta Complex;UDP-galactose 4-epimerase; domain 1;UDP-galactose 4-epimerase, domain 1 | 0.9019 | 184 | 321 | 3.90.25.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2A4Q680-F1-model_v4 | GDP-fucose synthetase | 1.002 | 16 | 154 |
GO:0050577
|
| AF-A0A4Q3TSA3-F1-model_v4 | deleted | 1.001 | 16 | 176 |
|
| AF-A0A2M7R8L0-F1-model_v4 | GDP-fucose synthetase | 1.001 | 16 | 171 |
GO:0050577
|
| AF-A0A356R231-F1-model_v4 | GDP-fucose synthetase | 0.9994 | 16 | 162 |
GO:0050577
|
| AF-A0A4Q3FS72-F1-model_v4 | GDP-L-fucose synthase | 0.9977 | 16 | 273 |
GO:0016853
GO:0050577 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar