F485035

General Info

Members Datasets Scaffolds Average Seq Length
897 326 1794 195

Family's Representative Sequence

Representative Sequence 3300003771|Ga0055526_1000107|Ga0055526_100010755
Length 222
Sequence MSAEPETPADHAPHARYQHPPGAPDGSIVLPLPPNVPRVKRSRLAQWTGRAILRLGGWRMVGQFPDIPRAVLIGIPHSSNWDGVWAFAAKAAMGLNVNIIAKESLFKVPVVGFMLRRFGVIPINRSAAHGVIDQAVAMMKGAEKLWLGIAPEGTRKRVEKWKAGFWKIAKNADVPVVLAYFHYPDKVIGIGPAFHLGDDMDADMRRIREYCRPFIGKNRGTV

Samples

Sample ID Description Type Environment
1 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
6 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
7 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
8 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
9 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
10 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
11 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
12 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
13 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
14 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
15 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
16 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
17 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
18 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
19 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
20 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
21 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
22 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
23 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
24 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
25 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
26 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
27 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
28 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
29 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
30 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
31 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
32 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
33 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
34 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
35 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
36 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
37 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
38 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
39 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
40 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
41 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
42 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
43 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
44 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
45 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
46 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
47 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
48 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
49 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
50 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
51 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
52 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
53 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
54 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
55 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
56 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
57 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
58 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
59 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
60 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
61 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
62 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
63 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
64 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
65 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
66 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
67 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
68 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
69 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
70 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
71 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
72 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
73 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
74 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
75 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
76 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
77 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
78 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
79 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
80 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
81 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
82 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
83 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
84 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
85 3300009982 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_189 metaG Metagenome Rhizosphere
86 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
87 3300012500 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 Metagenome Rhizosphere
88 3300012502 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 Metagenome Rhizosphere
89 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
90 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
91 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
92 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
93 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
94 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
95 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
96 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
97 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
98 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
99 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
100 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
101 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
102 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
103 3300015687 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 Metagenome Rhizosphere
104 3300015689 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A02 Metagenome Rhizosphere
105 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
106 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
107 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
108 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
109 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
110 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
111 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
112 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
113 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
114 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
115 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
116 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
117 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
118 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
119 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
120 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
121 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
122 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
123 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
124 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
125 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
126 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
127 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
128 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
129 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
130 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
131 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
132 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
133 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
174 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
175 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
176 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
177 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
178 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
179 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
180 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
181 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
182 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
183 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
184 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
185 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
186 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
187 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
188 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
189 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
190 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
191 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
192 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
193 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
194 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
195 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
196 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
197 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
198 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
199 3300044536 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA2E Metagenome Unclassified
200 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
201 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
202 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
203 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
204 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
205 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
206 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
207 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
208 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
209 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
210 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
211 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
212 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
213 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
214 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
215 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
216 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
217 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
218 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
219 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
220 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
221 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
222 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
223 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
224 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
225 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
226 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
227 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
228 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
229 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
230 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
231 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
232 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
233 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
234 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
235 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
236 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
237 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
238 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
239 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
240 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
241 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
242 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
243 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
244 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
245 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
246 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
247 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
248 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
249 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
250 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
251 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
252 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
253 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
254 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
255 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
256 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
257 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
258 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
259 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
260 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
261 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
262 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
263 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
264 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
265 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
266 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
267 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
268 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
269 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
270 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
271 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
272 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
273 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
274 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
275 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
276 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
277 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
278 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
279 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
280 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
281 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
282 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
283 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
284 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
285 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
286 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
287 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
288 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
289 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
290 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
291 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
292 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
293 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
294 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
295 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
296 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
297 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
298 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
299 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
300 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
301 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
302 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
303 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
304 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
305 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
306 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
307 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
308 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
309 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
310 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
311 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
312 2537561836 Rhodanobacter spathiphylli B39 Isolate Unclassified
313 2643221562 Rhodanobacter sp. Root561 Isolate Unclassified
314 2643221577 Rhodanobacter sp. Root627 Isolate Unclassified
315 2643221685 Rhodanobacter sp. Root480 Isolate Unclassified
316 2718218334 Luteibacter rhizovicinus LJ96 Isolate Rhizosphere
317 2734482264 Dyella sp. AD052 Isolate Unclassified
318 2739367700 Dyella sp. YR388 Isolate Unclassified
319 2842914999 Luteibacter sp. R-72151 Isolate Unclassified
320 2884338543 Luteibacter pinisoli MAH-14 Isolate Rhizosphere
321 2884411467 Dyella sp. AD56 Isolate Rhizosphere
322 2895395659 Rhodanobacter sp. T12-5 Isolate Unclassified
323 2928963466 Dyella japonica 1073 Isolate Unclassified
324 2939611941 Rhodanobacter soli 1757 Isolate Rhizosphere
325 2941489479 Lysobacter enzymogenes 2943 Isolate Rhizosphere
326 2995948881 Lysobacter enzymogenes B25 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 97.66
Metatranscriptomes 0.67
Isolates 1.67

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 13.15
Nodule 0
Rhizoplane 2.79
Rhizosphere 72.02
Stem 0
Stem Tuber 0
Unclassified 1

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0055526_1000107 3300003771 Bacteria 72819
2 JGI24740J21852_10017269 3300001979 Bacteria 2584
3 JGI24739J22299_10083624 3300001989 Bacteria 977
4 JGI24737J22298_10000503 3300001990 Bacteria 13631
5 JGI24737J22298_10109933 3300001990 Bacteria 816
6 JGI24735J21928_10023462 3300002067 Bacteria 1871
7 JGI24738J21930_10000020 3300002075 Bacteria 30020
8 JGI25156J39149_1000480 3300002705 Bacteria 24063
9 JGI25156J39149_1004347 3300002705 Bacteria 4346
10 JGI25156J39149_1006967 3300002705 Bacteria 3028
11 JGI25156J39149_1012327 3300002705 Bacteria 1886
12 JGI25162J39368_1000454 3300002737 Bacteria 32144
13 JGI25162J39368_1000657 3300002737 Bacteria 24439
14 JGI25162J39368_1000792 3300002737 Bacteria 21140
15 JGI25162J39368_1001661 3300002737 Bacteria 10994
16 JGI25162J39368_1002289 3300002737 Bacteria 7698
17 JGI25157J39369_1000300 3300002741 Bacteria 35735
18 JGI25157J39369_1000525 3300002741 Bacteria 23385
19 JGI25157J39369_1001263 3300002741 Bacteria 10336
20 JGI25157J39369_1003690 3300002741 Bacteria 3028
21 JGI25163J39215_1000882 3300002771 Bacteria 6984
22 JGI25164J39214_1000112 3300002772 Bacteria 78116
23 JGI25164J39214_1000295 3300002772 Bacteria 34610
24 JGI25164J39214_1000451 3300002772 Bacteria 21436
25 JGI25164J39214_1000454 3300002772 Bacteria 21300
26 JGI25164J39214_1008953 3300002772 Bacteria 991
27 JGI25165J46597_1000229 3300003214 Bacteria 78116
28 JGI25165J46597_1000527 3300003214 Bacteria 35739
29 JGI25165J46597_1000872 3300003214 Bacteria 21444
30 JGI25165J46597_1006555 3300003214 Bacteria 2053
31 rootH1_10006421 3300003316 Bacteria 3652
32 rootH1_10124382 3300003316 Bacteria 1390
33 rootH2_10047639 3300003320 Bacteria 15276
34 rootH2_10082323 3300003320 Bacteria 1260
35 rootL2_10011264 3300003322 Bacteria 2277
36 rootH1_10034785 3300003323 Bacteria 1263
37 rootH1_10183402 3300003323 Bacteria 1300
38 rootH1_10236681 3300003323 Bacteria 2848
39 Ga0006562J51391_1017349 3300003578 Bacteria 5332
40 Ga0006562J51391_1201163 3300003578 Bacteria 2364
41 Ga0006562J51391_1201164 3300003578 Bacteria 2270
42 Ga0055538_1001138 3300003751 Bacteria 5697
43 Ga0055539_1005663 3300003752 Bacteria 1616
44 Ga0055539_1019428 3300003752 Bacteria 814
45 Ga0055533_1000581 3300003756 Bacteria 12805
46 Ga0055533_1003055 3300003756 Bacteria 3543
47 Ga0055525_1000082 3300003759 Bacteria 159396
48 Ga0055527_1000072 3300003760 Bacteria 83753
49 Ga0055527_1000080 3300003760 Bacteria 78211
50 Ga0055527_1003188 3300003760 Bacteria 2510
51 Ga0055527_1011228 3300003760 Bacteria 1026
52 Ga0055535_1000162 3300003761 Bacteria 71868
53 Ga0055535_1000189 3300003761 Bacteria 65570
54 Ga0055535_1000491 3300003761 Bacteria 35499
55 Ga0055535_1000611 3300003761 Bacteria 29412
56 Ga0055535_1001129 3300003761 Bacteria 15988
57 Ga0055542_1000105 3300003762 Bacteria 113278
58 Ga0055542_1000163 3300003762 Bacteria 83753
59 Ga0055542_1000181 3300003762 Bacteria 78147
60 Ga0055542_1000188 3300003762 Bacteria 75366
61 Ga0055542_1000254 3300003762 Bacteria 60473
62 Ga0055542_1000573 3300003762 Bacteria 32144
63 Ga0055529_1000205 3300003763 Bacteria 78219
64 Ga0055529_1000209 3300003763 Bacteria 77662
65 Ga0055529_1000336 3300003763 Bacteria 52511
66 Ga0055529_1000496 3300003763 Bacteria 35739
67 Ga0055529_1023381 3300003763 Bacteria 765
68 Ga0055537_1000125 3300003773 Bacteria 58650
69 Ga0055524_1000176 3300003775 Bacteria 72819
70 Ga0055534_1000090 3300003784 Bacteria 71465
71 Ga0055528_1000088 3300003790 Bacteria 72819
72 Ga0070658_10005032 3300005327 Bacteria 10757
73 Ga0070658_10035840 3300005327 Bacteria 3997
74 Ga0070658_10873277 3300005327 Bacteria 782
75 Ga0070670_100132781 3300005331 Bacteria 2150
76 Ga0070670_100255716 3300005331 Bacteria 1526
77 Ga0068869_100244555 3300005334 Bacteria 1430
78 Ga0070666_10000020 3300005335 Bacteria 177564
79 Ga0070682_100006648 3300005337 Bacteria 6483
80 Ga0070682_100467750 3300005337 Bacteria 969
81 Ga0068868_100462320 3300005338 Bacteria 1105
82 Ga0070660_100011111 3300005339 Bacteria 6386
83 Ga0070660_100105322 3300005339 Bacteria 2238
84 Ga0070660_100120618 3300005339 Bacteria 2092
85 Ga0070660_100205709 3300005339 Bacteria 1597
86 Ga0070689_100004873 3300005340 Bacteria 9113
87 Ga0070691_10122135 3300005341 Bacteria 1312
88 Ga0070661_100004622 3300005344 Bacteria 9475
89 Ga0070661_100007423 3300005344 Bacteria 7557
90 Ga0070661_100028888 3300005344 Bacteria 4002
91 Ga0070661_100029522 3300005344 Bacteria 3958
92 Ga0070661_100055463 3300005344 Bacteria 2902
93 Ga0070661_100095087 3300005344 Unclassified 2210
94 Ga0070692_10023906 3300005345 Bacteria 2998
95 Ga0070692_10085847 3300005345 Bacteria 1703
96 Ga0070668_100001704 3300005347 Bacteria 15947
97 Ga0070668_100834439 3300005347 Bacteria 821
98 Ga0070669_100511960 3300005353 Bacteria 997
99 Ga0070671_100025842 3300005355 Bacteria 4821
100 Ga0070673_100220277 3300005364 Bacteria 1642
101 Ga0070659_100003695 3300005366 Bacteria 10914
102 Ga0070659_100043342 3300005366 Bacteria 3519
103 Ga0070659_100127110 3300005366 Bacteria 2069
104 Ga0070659_100519562 3300005366 Bacteria 1016
105 Ga0070667_100000040 3300005367 Bacteria 170222
106 Ga0070667_100010566 3300005367 Bacteria 7620
107 Ga0070667_100031091 3300005367 Bacteria 4451
108 Ga0070667_100062316 3300005367 Bacteria 3159
109 Ga0070667_100073758 3300005367 Bacteria 2910
110 Ga0070667_100309147 3300005367 Bacteria 1424
111 Ga0070667_100620417 3300005367 Bacteria 997
112 Ga0070714_100000207 3300005435 Bacteria 47558
113 Ga0070714_100001217 3300005435 Bacteria 18571
114 Ga0070711_100015114 3300005439 Bacteria 4880
115 Ga0070711_100536123 3300005439 Bacteria 969
116 Ga0070694_100076914 3300005444 Bacteria 2311
117 Ga0070663_100001131 3300005455 Bacteria 14691
118 Ga0070663_100012632 3300005455 Bacteria 5352
119 Ga0070663_100029842 3300005455 Bacteria 3731
120 Ga0070663_100039344 3300005455 Bacteria 3303
121 Ga0070663_100107997 3300005455 Bacteria 2087
122 Ga0070663_100197199 3300005455 Bacteria 1569
123 Ga0070663_100226213 3300005455 Bacteria 1471
124 Ga0070663_100299657 3300005455 Bacteria 1286
125 Ga0070663_100933358 3300005455 Bacteria 751
126 Ga0070662_100218434 3300005457 Bacteria 1520
127 Ga0070681_10013694 3300005458 Bacteria 8072
128 Ga0070681_10023056 3300005458 Bacteria 6259
129 Ga0068867_100219122 3300005459 Bacteria 1533
130 Ga0070685_10009321 3300005466 Bacteria 5067
131 Ga0070685_10010980 3300005466 Bacteria 4724
132 Ga0070679_100059614 3300005530 Bacteria 3804
133 Ga0070679_100090918 3300005530 Bacteria 3040
134 Ga0068853_100038222 3300005539 Bacteria 4087
135 Ga0068853_100041046 3300005539 Bacteria 3950
136 Ga0068853_100049856 3300005539 Bacteria 3599
137 Ga0068853_100181559 3300005539 Bacteria 1908
138 Ga0068853_100195727 3300005539 Bacteria 1838
139 Ga0068853_100276154 3300005539 Bacteria 1548
140 Ga0068853_100358905 3300005539 Bacteria 1357
141 Ga0070696_100004108 3300005546 Bacteria 9703
142 Ga0070696_100010225 3300005546 Bacteria 6280
143 Ga0070696_100124104 3300005546 Bacteria 1872
144 Ga0070693_100019491 3300005547 Bacteria 3557
145 Ga0070693_100046384 3300005547 Bacteria 2468
146 Ga0070665_100000097 3300005548 Bacteria 166302
147 Ga0070665_100001328 3300005548 Bacteria 29401
148 Ga0070665_100013315 3300005548 Bacteria 8280
149 Ga0070665_100020995 3300005548 Bacteria 6565
150 Ga0070665_100025880 3300005548 Bacteria 5907
151 Ga0070665_100033651 3300005548 Bacteria 5156
152 Ga0070665_100161102 3300005548 Bacteria 2246
153 Ga0070665_100349215 3300005548 Bacteria 1484
154 Ga0068855_100007368 3300005563 Bacteria 13321
155 Ga0068855_100041031 3300005563 Bacteria 5487
156 Ga0068855_100058503 3300005563 Bacteria 4513
157 Ga0068855_100141160 3300005563 Bacteria 2746
158 Ga0068855_100412537 3300005563 Bacteria 1478
159 Ga0068855_100501717 3300005563 Bacteria 1318
160 Ga0068855_100523970 3300005563 Bacteria 1285
161 Ga0068855_100732842 3300005563 Bacteria 1055
162 Ga0070664_100762991 3300005564 Bacteria 903
163 Ga0068857_100016650 3300005577 Bacteria 6440
164 Ga0068857_100032832 3300005577 Bacteria 4588
165 Ga0068857_100075732 3300005577 Bacteria 3000
166 Ga0068857_100086711 3300005577 Bacteria 2800
167 Ga0068857_100108570 3300005577 Bacteria 2493
168 Ga0068857_100141891 3300005577 Bacteria 2172
169 Ga0068857_100193289 3300005577 Bacteria 1854
170 Ga0068854_100001262 3300005578 Bacteria 15194
171 Ga0068854_100045364 3300005578 Bacteria 3125
172 Ga0068856_100000184 3300005614 Bacteria 65002
173 Ga0068856_100007251 3300005614 Bacteria 10814
174 Ga0068856_100028084 3300005614 Bacteria 5491
175 Ga0068856_100771812 3300005614 Bacteria 981
176 Ga0068852_100001204 3300005616 Bacteria 17171
177 Ga0068852_100014289 3300005616 Bacteria 6106
178 Ga0068852_100092432 3300005616 Bacteria 2709
179 Ga0068852_100221594 3300005616 Bacteria 1799
180 Ga0068852_101047322 3300005616 Bacteria 835
181 Ga0068859_100007515 3300005617 Bacteria 11061
182 Ga0068851_10023176 3300005834 Bacteria 3031
183 Ga0068863_100113735 3300005841 Bacteria 2578
184 Ga0068863_100685759 3300005841 Bacteria 1018
185 Ga0068858_100078324 3300005842 Bacteria 3072
186 Ga0068858_100120194 3300005842 Bacteria 2456
187 Ga0068860_100145004 3300005843 Bacteria 2284
188 Ga0068860_100162836 3300005843 Bacteria 2151
189 Ga0068860_100412916 3300005843 Bacteria 1337
190 Ga0068862_100000224 3300005844 Bacteria 62869
191 Ga0068862_100059714 3300005844 Bacteria 3275
192 Ga0068862_100104837 3300005844 Bacteria 2477
193 Ga0070712_100027163 3300006175 Bacteria 3820
194 Ga0097621_100017790 3300006237 Bacteria 5410
195 Ga0097621_100081890 3300006237 Bacteria 2687
196 Ga0068871_100069947 3300006358 Bacteria 2884
197 Ga0068871_100195291 3300006358 Bacteria 1745
198 Ga0068865_100199275 3300006881 Bacteria 1553
199 Ga0097620_100007515 3300006931 Bacteria 11061
200 Ga0105250_10095931 3300009092 Bacteria 1209
201 Ga0105240_10006212 3300009093 Bacteria 17569
202 Ga0105240_10006230 3300009093 Bacteria 17547
203 Ga0105240_10006360 3300009093 Bacteria 17388
204 Ga0105240_10007835 3300009093 Bacteria 15418
205 Ga0105240_10031364 3300009093 Bacteria 6894
206 Ga0105240_10055146 3300009093 Bacteria 4977
207 Ga0105240_10057256 3300009093 Bacteria 4871
208 Ga0105240_10084657 3300009093 Bacteria 3887
209 Ga0105240_10464558 3300009093 Bacteria 1413
210 Ga0105240_10975403 3300009093 Bacteria 908
211 Ga0105247_10002045 3300009101 Bacteria 13966
212 Ga0105247_10025236 3300009101 Bacteria 3586
213 Ga0105247_10630510 3300009101 Bacteria 798
214 Ga0105241_10017425 3300009174 Bacteria 5280
215 Ga0105241_10417655 3300009174 Bacteria 1180
216 Ga0105241_10473819 3300009174 Bacteria 1112
217 Ga0105248_10028291 3300009177 Bacteria 6244
218 Ga0105248_10346591 3300009177 Bacteria 1672
219 Ga0105237_10000022 3300009545 Bacteria 228427
220 Ga0105237_10000036 3300009545 Bacteria 191142
221 Ga0105237_10063098 3300009545 Bacteria 3703
222 Ga0105237_10093406 3300009545 Bacteria 2997
223 Ga0105237_10118792 3300009545 Bacteria 2638
224 Ga0105237_10137559 3300009545 Bacteria 2437
225 Ga0105237_11107800 3300009545 Bacteria 798
226 Ga0105238_10001023 3300009551 Bacteria 28434
227 Ga0105238_10015508 3300009551 Bacteria 7713
228 Ga0105238_10022715 3300009551 Bacteria 6393
229 Ga0105238_10051301 3300009551 Bacteria 4150
230 Ga0105238_10099966 3300009551 Bacteria 2884
231 Ga0105238_10162538 3300009551 Bacteria 2209
232 Ga0105238_10208703 3300009551 Bacteria 1929
233 Ga0105238_10326233 3300009551 Bacteria 1521
234 Ga0105238_10326569 3300009551 Bacteria 1520
235 Ga0105238_11203240 3300009551 Bacteria 782
236 Ga0105238_11240976 3300009551 Bacteria 770
237 Ga0105249_10000193 3300009553 Bacteria 69963
238 Ga0105147_100668 3300009982 Bacteria 2754
239 Ga0105239_10000192 3300010375 Bacteria 88793
240 Ga0105239_10004724 3300010375 Bacteria 16174
241 Ga0105239_10012311 3300010375 Bacteria 9527
242 Ga0105239_10025642 3300010375 Bacteria 6491
243 Ga0105239_10103323 3300010375 Bacteria 3154
244 Ga0105239_10119105 3300010375 Bacteria 2930
245 Ga0105239_10399618 3300010375 Bacteria 1555
246 Ga0105239_10421240 3300010375 Bacteria 1513
247 Ga0105239_10550070 3300010375 Bacteria 1314
248 Ga0157314_1000060 3300012500 Bacteria 11549
249 Ga0157347_1001512 3300012502 Bacteria 1837
250 Ga0157373_10012271 3300013100 Bacteria 6299
251 Ga0157373_10019943 3300013100 Bacteria 4878
252 Ga0157373_10299074 3300013100 Bacteria 1142
253 Ga0157373_10327469 3300013100 Bacteria 1090
254 Ga0157371_10004318 3300013102 Bacteria 12463
255 Ga0157371_10021258 3300013102 Bacteria 4766
256 Ga0157370_10001178 3300013104 Bacteria 32634
257 Ga0157370_10015371 3300013104 Bacteria 7780
258 Ga0157370_10021645 3300013104 Bacteria 6407
259 Ga0157370_10132571 3300013104 Bacteria 2324
260 Ga0157370_10145090 3300013104 Bacteria 2210
261 Ga0157370_10162156 3300013104 Bacteria 2080
262 Ga0157369_10008532 3300013105 Bacteria 11753
263 Ga0157369_10102041 3300013105 Bacteria 3057
264 Ga0157369_10132720 3300013105 Bacteria 2638
265 Ga0157369_10298142 3300013105 Bacteria 1677
266 Ga0163162_10083015 3300013306 Bacteria 3277
267 Ga0163162_11669365 3300013306 Unclassified 727
268 Ga0157372_10010508 3300013307 Bacteria 9854
269 Ga0157372_10092695 3300013307 Bacteria 3437
270 Ga0157372_10096496 3300013307 Bacteria 3369
271 Ga0157372_10104820 3300013307 Bacteria 3233
272 Ga0157372_10649018 3300013307 Bacteria 1229
273 Ga0157375_10205673 3300013308 Bacteria 2125
274 Ga0163163_10083520 3300014325 Bacteria 3199
275 Ga0182008_10014259 3300014497 Bacteria 4165
276 Ga0157379_10090031 3300014968 Bacteria 2753
277 Ga0157379_10275778 3300014968 Bacteria 1530
278 Ga0157376_10105080 3300014969 Bacteria 2476
279 Ga0157376_10963307 3300014969 Bacteria 874
280 Ga0182006_1000065 3300015261 Bacteria 152292
281 Ga0182006_1073793 3300015261 Bacteria 1259
282 Ga0182007_10005217 3300015262 Bacteria 5743
283 Ga0182007_10018151 3300015262 Bacteria 2555
284 Ga0182007_10043001 3300015262 Bacteria 1503
285 Ga0182007_10103943 3300015262 Bacteria 942
286 Ga0182005_1001497 3300015265 Bacteria 9321
287 Ga0182005_1008021 3300015265 Bacteria 3133
288 Ga0183368_1002 3300015687 Bacteria 1865598
289 Ga0183360_10004 3300015689 Bacteria 289992
290 Ga0163161_10002563 3300017792 Bacteria 12983
291 Ga0163161_10097349 3300017792 Bacteria 2186
292 Ga0206356_11612961 3300020070 Bacteria 2056
293 Ga0206354_10499166 3300020081 Bacteria 722
294 Ga0206353_11908525 3300020082 Bacteria 3476
295 Ga0209435_104672 3300025206 Bacteria 1543
296 Ga0209760_100417 3300025207 Bacteria 10203
297 Ga0209784_100053 3300025224 Bacteria 182075
298 Ga0209566_101751 3300025225 Bacteria 5170
299 Ga0209674_100014 3300025226 Bacteria 704989
300 Ga0209674_100234 3300025226 Bacteria 48788
301 Ga0209674_100413 3300025226 Bacteria 21057
302 Ga0209674_102618 3300025226 Bacteria 3745
303 Ga0209672_100004 3300025228 Bacteria 1467504
304 Ga0209672_100008 3300025228 Bacteria 946876
305 Ga0209672_100089 3300025228 Bacteria 120658
306 Ga0209672_101247 3300025228 Bacteria 10176
307 Ga0209672_101845 3300025228 Bacteria 6341
308 Ga0209672_103546 3300025228 Bacteria 3187
309 Ga0209147_108813 3300025229 Bacteria 1230
310 Ga0209563_100097 3300025230 Bacteria 159453
311 Ga0207427_100044 3300025231 Bacteria 242623
312 Ga0207427_100051 3300025231 Bacteria 218792
313 Ga0207427_100061 3300025231 Bacteria 182815
314 Ga0207427_100088 3300025231 Bacteria 137220
315 Ga0207427_103025 3300025231 Bacteria 3877
316 Ga0207427_112494 3300025231 Bacteria 848
317 Ga0209437_100005 3300025233 Bacteria 1071596
318 Ga0209437_100037 3300025233 Bacteria 459730
319 Ga0209437_100152 3300025233 Bacteria 154551
320 Ga0209437_100167 3300025233 Bacteria 144661
321 Ga0209437_100279 3300025233 Bacteria 75208
322 Ga0209437_102261 3300025233 Bacteria 3807
323 Ga0209258_100003 3300025242 Bacteria 1467504
324 Ga0209258_100004 3300025242 Bacteria 1376422
325 Ga0209258_100008 3300025242 Bacteria 1009355
326 Ga0209258_100090 3300025242 Bacteria 232619
327 Ga0209258_100173 3300025242 Bacteria 144525
328 Ga0209258_100541 3300025242 Bacteria 34852
329 Ga0209258_101149 3300025242 Bacteria 10836
330 Ga0209258_102841 3300025242 Bacteria 4132
331 Ga0209646_1000700 3300025246 Bacteria 12031
332 Ga0209646_1000900 3300025246 Bacteria 9648
333 Ga0209026_1000010 3300025250 Bacteria 511986
334 Ga0209026_1000064 3300025250 Bacteria 211303
335 Ga0209026_1000104 3300025250 Bacteria 152614
336 Ga0209026_1000407 3300025250 Bacteria 37955
337 Ga0209026_1000660 3300025250 Bacteria 21079
338 Ga0209026_1003591 3300025250 Bacteria 5002
339 Ga0209677_101838 3300025253 Bacteria 8651
340 Ga0209677_112023 3300025253 Bacteria 1309
341 Ga0209148_1000001 3300025254 Bacteria 2545271
342 Ga0209148_1000002 3300025254 Bacteria 2399500
343 Ga0209148_1000016 3300025254 Bacteria 804369
344 Ga0209148_1000065 3300025254 Bacteria 344489
345 Ga0209148_1000079 3300025254 Bacteria 288992
346 Ga0209148_1000279 3300025254 Bacteria 79426
347 Ga0209759_1000165 3300025256 Bacteria 113117
348 Ga0209759_1000544 3300025256 Bacteria 39139
349 Ga0209759_1000762 3300025256 Bacteria 27542
350 Ga0209759_1001342 3300025256 Bacteria 14350
351 Ga0209759_1002477 3300025256 Bacteria 8071
352 Ga0209759_1012013 3300025256 Bacteria 2423
353 Ga0209233_1000002 3300025261 Bacteria 2501366
354 Ga0209233_1000011 3300025261 Bacteria 1071611
355 Ga0209233_1000046 3300025261 Bacteria 470971
356 Ga0209233_1000099 3300025261 Bacteria 293995
357 Ga0209233_1000759 3300025261 Bacteria 14553
358 Ga0209233_1007681 3300025261 Bacteria 3397
359 Ga0209233_1027747 3300025261 Bacteria 1367
360 Ga0209565_1000002 3300025263 Bacteria 1423083
361 Ga0209455_1000004 3300025272 Bacteria 1467504
362 Ga0209455_1000007 3300025272 Bacteria 1157983
363 Ga0209455_1000016 3300025272 Bacteria 753097
364 Ga0209455_1000079 3300025272 Bacteria 268778
365 Ga0209455_1000295 3300025272 Bacteria 52412
366 Ga0209673_1000002 3300025273 Bacteria 1423083
367 Ga0209675_1000002 3300025291 Bacteria 1423083
368 Ga0209564_1000004 3300025295 Bacteria 1424639
369 Ga0209758_1000452 3300025297 Bacteria 68495
370 Ga0209256_1000004 3300025299 Bacteria 1424643
371 Ga0207656_10035314 3300025321 Bacteria 2092
372 Ga0207696_1149757 3300025711 Bacteria 623
373 Ga0207710_10042402 3300025900 Bacteria 2021
374 Ga0207680_10000001 3300025903 Bacteria 1091453
375 Ga0207647_10000014 3300025904 Bacteria 143525
376 Ga0207647_10001935 3300025904 Bacteria 15822
377 Ga0207647_10017313 3300025904 Bacteria 4899
378 Ga0207647_10054333 3300025904 Bacteria 2464
379 Ga0207647_10064530 3300025904 Bacteria 2225
380 Ga0207647_10296206 3300025904 Bacteria 922
381 Ga0207705_10003986 3300025909 Bacteria 11232
382 Ga0207705_10005837 3300025909 Bacteria 9167
383 Ga0207654_10341553 3300025911 Bacteria 1029
384 Ga0207707_10038371 3300025912 Bacteria 4185
385 Ga0207707_10047400 3300025912 Bacteria 3742
386 Ga0207707_10161188 3300025912 Bacteria 1961
387 Ga0207707_10535118 3300025912 Bacteria 997
388 Ga0207695_10000040 3300025913 Bacteria 452787
389 Ga0207695_10000291 3300025913 Bacteria 124555
390 Ga0207695_10000362 3300025913 Bacteria 104132
391 Ga0207695_10001147 3300025913 Bacteria 45960
392 Ga0207695_10002008 3300025913 Bacteria 31403
393 Ga0207695_10024317 3300025913 Bacteria 6819
394 Ga0207695_10042674 3300025913 Bacteria 4840
395 Ga0207695_10057571 3300025913 Bacteria 4037
396 Ga0207671_10000009 3300025914 Bacteria 724862
397 Ga0207671_10000135 3300025914 Bacteria 112401
398 Ga0207671_10004793 3300025914 Bacteria 12744
399 Ga0207671_10156614 3300025914 Bacteria 1762
400 Ga0207671_10210818 3300025914 Bacteria 1520
401 Ga0207657_10012203 3300025919 Bacteria 8490
402 Ga0207657_10106355 3300025919 Bacteria 2322
403 Ga0207657_10122356 3300025919 Bacteria 2140
404 Ga0207649_10003075 3300025920 Bacteria 9164
405 Ga0207649_10006684 3300025920 Bacteria 6268
406 Ga0207649_10021106 3300025920 Bacteria 3743
407 Ga0207649_10023263 3300025920 Bacteria 3586
408 Ga0207649_10126431 3300025920 Bacteria 1731
409 Ga0207652_10143154 3300025921 Bacteria 2138
410 Ga0207652_10220312 3300025921 Bacteria 1710
411 Ga0207694_10002190 3300025924 Bacteria 16057
412 Ga0207694_10005245 3300025924 Bacteria 9997
413 Ga0207694_10006615 3300025924 Bacteria 8812
414 Ga0207694_10023988 3300025924 Bacteria 4633
415 Ga0207694_10039266 3300025924 Bacteria 3642
416 Ga0207694_10050959 3300025924 Bacteria 3208
417 Ga0207694_10179994 3300025924 Bacteria 1714
418 Ga0207694_10434103 3300025924 Bacteria 1095
419 Ga0207694_10569775 3300025924 Bacteria 951
420 Ga0207650_10217151 3300025925 Bacteria 1538
421 Ga0207700_10023446 3300025928 Bacteria 4254
422 Ga0207700_10455654 3300025928 Bacteria 1128
423 Ga0207664_10000092 3300025929 Bacteria 83276
424 Ga0207664_10000929 3300025929 Bacteria 19672
425 Ga0207664_10039255 3300025929 Bacteria 3675
426 Ga0207690_10018537 3300025932 Bacteria 4269
427 Ga0207690_10018739 3300025932 Bacteria 4248
428 Ga0207690_10024493 3300025932 Bacteria 3780
429 Ga0207690_10031438 3300025932 Bacteria 3396
430 Ga0207706_10033243 3300025933 Bacteria 4591
431 Ga0207706_10076489 3300025933 Bacteria 2944
432 Ga0207706_10084528 3300025933 Bacteria 2790
433 Ga0207670_10008997 3300025936 Bacteria 5667
434 Ga0207691_10096278 3300025940 Bacteria 2646
435 Ga0207689_10047201 3300025942 Bacteria 3558
436 Ga0207679_10036264 3300025945 Bacteria 3496
437 Ga0207679_10227486 3300025945 Bacteria 1573
438 Ga0207679_10291168 3300025945 Bacteria 1404
439 Ga0207679_10725760 3300025945 Bacteria 903
440 Ga0207667_10000262 3300025949 Bacteria 73170
441 Ga0207667_10000329 3300025949 Bacteria 65667
442 Ga0207667_10002131 3300025949 Bacteria 24808
443 Ga0207667_10012894 3300025949 Bacteria 9603
444 Ga0207667_10027480 3300025949 Bacteria 6192
445 Ga0207667_10133995 3300025949 Bacteria 2551
446 Ga0207667_10229349 3300025949 Bacteria 1902
447 Ga0207651_10072042 3300025960 Bacteria 2452
448 Ga0207712_10000498 3300025961 Bacteria 32444
449 Ga0207668_10239745 3300025972 Bacteria 1466
450 Ga0207668_10497029 3300025972 Unclassified 1049
451 Ga0207640_10000116 3300025981 Bacteria 60174
452 Ga0207640_10003397 3300025981 Bacteria 8579
453 Ga0207640_10013585 3300025981 Bacteria 4672
454 Ga0207640_10543140 3300025981 Bacteria 975
455 Ga0207658_10000289 3300025986 Bacteria 52614
456 Ga0207658_10099716 3300025986 Bacteria 2272
457 Ga0207658_10112606 3300025986 Bacteria 2154
458 Ga0207658_10532337 3300025986 Bacteria 1050
459 Ga0207658_10614275 3300025986 Bacteria 977
460 Ga0207703_10088824 3300026035 Bacteria 2595
461 Ga0207703_10401961 3300026035 Bacteria 1271
462 Ga0207639_10009617 3300026041 Bacteria 6677
463 Ga0207639_10021122 3300026041 Bacteria 4671
464 Ga0207639_10026892 3300026041 Bacteria 4184
465 Ga0207639_10038222 3300026041 Bacteria 3569
466 Ga0207639_10225944 3300026041 Bacteria 1620
467 Ga0207639_10287545 3300026041 Bacteria 1448
468 Ga0207639_10499748 3300026041 Bacteria 1111
469 Ga0207678_10001533 3300026067 Bacteria 21214
470 Ga0207678_10006482 3300026067 Bacteria 10383
471 Ga0207678_10007650 3300026067 Bacteria 9542
472 Ga0207678_10026742 3300026067 Bacteria 5033
473 Ga0207678_10050032 3300026067 Bacteria 3611
474 Ga0207678_10053454 3300026067 Bacteria 3480
475 Ga0207678_10054822 3300026067 Bacteria 3434
476 Ga0207678_10082252 3300026067 Bacteria 2755
477 Ga0207678_10152847 3300026067 Bacteria 1971
478 Ga0207678_10185207 3300026067 Bacteria 1778
479 Ga0207678_10238262 3300026067 Bacteria 1558
480 Ga0207678_10468406 3300026067 Bacteria 1096
481 Ga0207702_10000037 3300026078 Bacteria 153366
482 Ga0207702_10000960 3300026078 Bacteria 29644
483 Ga0207702_10005837 3300026078 Bacteria 10705
484 Ga0207702_10741481 3300026078 Bacteria 969
485 Ga0207641_10940351 3300026088 Bacteria 859
486 Ga0207648_10186602 3300026089 Bacteria 1837
487 Ga0207674_10010758 3300026116 Bacteria 10324
488 Ga0207674_10032637 3300026116 Bacteria 5459
489 Ga0207674_10095686 3300026116 Bacteria 2955
490 Ga0207674_10100269 3300026116 Bacteria 2877
491 Ga0207674_10105110 3300026116 Bacteria 2802
492 Ga0207674_10137452 3300026116 Bacteria 2404
493 Ga0207674_10144148 3300026116 Bacteria 2341
494 Ga0207674_10188092 3300026116 Bacteria 2015
495 Ga0207698_10009393 3300026142 Bacteria 6235
496 Ga0207698_10145111 3300026142 Bacteria 2051
497 Ga0207698_10277718 3300026142 Bacteria 1548
498 Ga0207698_10552041 3300026142 Bacteria 1129
499 Ga0268266_10000067 3300028379 Bacteria 241577
500 Ga0268266_10000101 3300028379 Bacteria 180443
501 Ga0268266_10011365 3300028379 Bacteria 7742
502 Ga0268266_10023757 3300028379 Bacteria 5217
503 Ga0268266_10106346 3300028379 Bacteria 2480
504 Ga0268266_10121872 3300028379 Bacteria 2321
505 Ga0268266_10304927 3300028379 Bacteria 1487
506 Ga0268265_10000054 3300028380 Bacteria 165504
507 Ga0268265_10062614 3300028380 Bacteria 2859
508 Ga0268264_10333291 3300028381 Bacteria 1439
509 Ga0268264_10399613 3300028381 Bacteria 1320
510 Ga0268264_10767696 3300028381 Bacteria 961
511 Ga0307517_10102780 3300028786 Bacteria 2237
512 Ga0265338_10673318 3300028800 Bacteria 716
513 Ga0265332_10077822 3300031238 Bacteria 1408
514 Ga0307508_10449642 3300031616 Bacteria 881
515 Ga0316575_10051705 3300031665 Bacteria 1636
516 Ga0316575_10064821 3300031665 Bacteria 1463
517 Ga0307507_10176250 3300033179 Bacteria 1540
518 Ga0307510_10018630 3300033180 Bacteria 8164
519 Ga0307510_10040472 3300033180 Bacteria 5116
520 Ga0395899_0000189 3300037312 Bacteria 90438
521 Ga0395899_0001468 3300037312 Bacteria 20067
522 Ga0395899_0002467 3300037312 Bacteria 15012
523 Ga0395899_0010653 3300037312 Bacteria 7045
524 Ga0395899_0032747 3300037312 Bacteria 3906
525 Ga0395900_0000011 3300037418 Bacteria 421926
526 Ga0395900_0000733 3300037418 Bacteria 43644
527 Ga0395900_0002500 3300037418 Bacteria 20203
528 Ga0395900_0023472 3300037418 Bacteria 6312
529 Ga0395900_0112130 3300037418 Bacteria 2801
530 Ga0395900_0181739 3300037418 Bacteria 2137
531 Ga0395898_0000013 3300037466 Bacteria 458788
532 Ga0395898_0000058 3300037466 Bacteria 277701
533 Ga0395898_0019179 3300037466 Bacteria 6962
534 Ga0395898_0025108 3300037466 Bacteria 6008
535 Ga0395898_0031713 3300037466 Bacteria 5278
536 Ga0395898_0043523 3300037466 Bacteria 4424
537 Ga0395898_0122504 3300037466 Bacteria 2491
538 Ga0395898_0123055 3300037466 Bacteria 2486
539 Ga0395905_0257375 3300037471 Bacteria 1630
540 Ga0436364_1417079 3300037853 Bacteria 1546
541 Ga0395901_0000961 3300038443 Bacteria 31360
542 Ga0395901_0002045 3300038443 Bacteria 20694
543 Ga0395901_0018477 3300038443 Bacteria 7116
544 Ga0395901_0038039 3300038443 Bacteria 4977
545 Ga0395901_0134373 3300038443 Bacteria 2600
546 Ga0395901_0140291 3300038443 Bacteria 2540
547 Ga0395901_0142535 3300038443 Bacteria 2518
548 Ga0395901_0176825 3300038443 Bacteria 2238
549 Ga0395901_0311716 3300038443 Bacteria 1629
550 Ga0439466_0055399 3300041411 Bacteria 1289
551 Ga0451791_1402863 3300041451 Bacteria 1125
552 Ga0451793_1096456 3300041452 Bacteria 2302
553 Ga0451797_0845396 3300041453 Bacteria 1406
554 Ga0451800_0536604 3300041459 Bacteria 1206
555 Ga0451802_0271155 3300041460 Bacteria 1535
556 Ga0451807_1337181 3300041486 Bacteria 1222
557 Ga0451807_1964740 3300041486 Bacteria 1315
558 Ga0451833_1330051 3300041491 Bacteria 1166
559 Ga0451837_0571727 3300041494 Bacteria 4974
560 Ga0451837_1034586 3300041494 Bacteria 2204
561 Ga0451837_1245730 3300041494 Bacteria 898
562 Ga0451837_1427531 3300041494 Bacteria 2203
563 Ga0451843_0143886 3300041509 Bacteria 1032
564 Ga0451843_1235005 3300041509 Bacteria 1958
565 Ga0451853_1120445 3300041512 Bacteria 1637
566 Ga0451853_2151927 3300041512 Bacteria 934
567 Ga0439448_0012270 3300042005 Bacteria 2562
568 Ga0439448_0023023 3300042005 Bacteria 1940
569 Ga0439448_0182303 3300042005 Bacteria 734
570 Ga0439459_0003827 3300042438 Bacteria 2406
571 Ga0466988_0289744 3300044536 Bacteria 890
572 Ga0466969_0003545 3300044656 Bacteria 8300
573 Ga0466969_0028054 3300044656 Bacteria 2879
574 Ga0466969_0048569 3300044656 Bacteria 2097
575 Ga0466972_0005270 3300044658 Bacteria 6474
576 Ga0466972_0048682 3300044658 Bacteria 2047
577 Ga0466982_0000001 3300044672 Bacteria 514662
578 Ga0466965_0003322 3300044683 Bacteria 7038
579 Ga0466965_0039831 3300044683 Bacteria 2310
580 Ga0466966_0007089 3300044684 Bacteria 7429
581 Ga0466966_0012332 3300044684 Bacteria 5662
582 Ga0466966_0014647 3300044684 Bacteria 5190
583 Ga0466961_0000349 3300044693 Bacteria 30070
584 Ga0466961_0000378 3300044693 Bacteria 28652
585 Ga0466961_0000794 3300044693 Bacteria 19749
586 Ga0466961_0002114 3300044693 Bacteria 12365
587 Ga0466963_0092187 3300044694 Bacteria 2064
588 Ga0466963_0299782 3300044694 Bacteria 1130
589 Ga0466964_0055064 3300044706 Bacteria 1641
590 Ga0466964_0056523 3300044706 Bacteria 1622
591 Ga0466971_0007188 3300044719 Bacteria 4847
592 Ga0466971_0016413 3300044719 Bacteria 3268
593 Ga0466971_0045006 3300044719 Bacteria 1982
594 Ga0466971_0098167 3300044719 Bacteria 1345
595 Ga0466968_0000075 3300044735 Bacteria 29240
596 Ga0466970_0001508 3300044765 Bacteria 11209
597 Ga0466970_0001565 3300044765 Bacteria 11046
598 Ga0466970_0007450 3300044765 Bacteria 5485
599 Ga0466970_0013456 3300044765 Bacteria 4193
600 Ga0466970_0030479 3300044765 Bacteria 2844
601 Ga0466957_0001666 3300044842 Bacteria 11668
602 Ga0466957_0020866 3300044842 Bacteria 3854
603 Ga0466957_0076440 3300044842 Bacteria 2079
604 Ga0466957_0101706 3300044842 Bacteria 1812
605 Ga0466957_0462041 3300044842 Bacteria 876
606 Ga0466960_0007010 3300044901 Bacteria 4551
607 Ga0466959_0002024 3300045049 Bacteria 12808
608 Ga0466959_0019504 3300045049 Bacteria 4986
609 Ga0466959_0034927 3300045049 Bacteria 3718
610 Ga0466958_0009531 3300045836 Bacteria 5413
611 Ga0466958_0016435 3300045836 Bacteria 4261
612 Ga0466958_0067952 3300045836 Bacteria 2178
613 Ga0466967_0051040 3300045976 Bacteria 3623
614 Ga0466967_0255901 3300045976 Bacteria 1674
615 Ga0466967_0455997 3300045976 Bacteria 1250
616 Ga0495617_000091 3300046452 Bacteria 64325
617 Ga0495617_001450 3300046452 Bacteria 10407
618 Ga0495638_0000389 3300046460 Bacteria 54061
619 Ga0495638_0000511 3300046460 Bacteria 45545
620 Ga0495638_0000799 3300046460 Bacteria 33240
621 Ga0495641_0194264 3300046461 Bacteria 910
622 Ga0495650_0000210 3300046471 Bacteria 125249
623 Ga0495650_0000465 3300046471 Bacteria 62638
624 Ga0495584_0003983 3300046491 Bacteria 7967
625 Ga0495585_0000112 3300046492 Bacteria 87291
626 Ga0495585_0001222 3300046492 Bacteria 20809
627 Ga0495607_0000006 3300046501 Bacteria 281664
628 Ga0495583_0043307 3300046506 Bacteria 2096
629 Ga0495606_0000016 3300046507 Bacteria 284865
630 Ga0495606_0000248 3300046507 Bacteria 94934
631 Ga0495606_0000267 3300046507 Bacteria 92177
632 Ga0495606_0009735 3300046507 Bacteria 8086
633 Ga0495606_0026232 3300046507 Bacteria 4155
634 Ga0495606_0147989 3300046507 Bacteria 1380
635 Ga0495610_0068091 3300046512 Bacteria 1669
636 Ga0495616_0000074 3300046513 Bacteria 84866
637 Ga0495616_0056702 3300046513 Bacteria 1933
638 Ga0495620_0000066 3300046515 Bacteria 89405
639 Ga0495620_0002396 3300046515 Bacteria 10858
640 Ga0495631_0000997 3300046518 Bacteria 17566
641 Ga0495631_0044271 3300046518 Bacteria 1962
642 Ga0495632_0000279 3300046519 Bacteria 50089
643 Ga0495632_0018629 3300046519 Bacteria 3805
644 Ga0495643_0060116 3300046522 Bacteria 2018
645 Ga0495648_0000820 3300046524 Bacteria 32800
646 Ga0495609_0013453 3300046538 Bacteria 3862
647 Ga0495597_0181882 3300046542 Bacteria 849
648 Ga0495622_0008826 3300046557 Bacteria 4668
649 Ga0495668_0004126 3300046616 Bacteria 10514
650 Ga0495611_0000051 3300046648 Bacteria 83900
651 Ga0495625_0009320 3300046660 Bacteria 8226
652 Ga0495625_0027097 3300046660 Bacteria 4320
653 Ga0495625_0065402 3300046660 Bacteria 2563
654 Ga0495625_0584377 3300046660 Bacteria 672
655 Ga0495661_0001828 3300046665 Bacteria 17057
656 Ga0495661_0020848 3300046665 Bacteria 4273
657 Ga0495588_0094759 3300046674 Bacteria 1565
658 Ga0495670_0001121 3300046691 Bacteria 12980
659 Ga0495670_0003174 3300046691 Bacteria 8095
660 Ga0495671_0000220 3300046692 Bacteria 49354
661 Ga0495649_0006391 3300046694 Bacteria 7334
662 Ga0495589_0000067 3300046794 Bacteria 99395
663 Ga0495660_0000432 3300046810 Bacteria 35230
664 Ga0495660_0000808 3300046810 Bacteria 23439
665 Ga0495683_0001807 3300047323 Bacteria 13459
666 Ga0495673_0000004 3300047469 Bacteria 1354526
667 Ga0495673_0000062 3300047469 Bacteria 226461
668 Ga0495673_0001868 3300047469 Bacteria 15802
669 Ga0495673_0021570 3300047469 Bacteria 3177
670 Ga0495686_0000024 3300047472 Bacteria 400343
671 Ga0495686_0000287 3300047472 Bacteria 88733
672 Ga0495686_0007582 3300047472 Bacteria 8109
673 Ga0495686_0013559 3300047472 Bacteria 5651
674 Ga0495686_0047340 3300047472 Bacteria 2715
675 Ga0496100_0006210 3300048903 Bacteria 6498
676 Ga0496101_0018413 3300048904 Bacteria 4749
677 Ga0496101_0020683 3300048904 Bacteria 4512
678 Ga0496104_0052949 3300048907 Bacteria 3834
679 Ga0496105_0005605 3300048908 Bacteria 9547
680 Ga0496106_0000344 3300048909 Bacteria 32816
681 Ga0496106_0190925 3300048909 Bacteria 1628
682 Ga0496107_0341431 3300048910 Bacteria 1114
683 Ga0496107_0789362 3300048910 Unclassified 696
684 Ga0496112_0380324 3300048915 Bacteria 1353
685 Ga0496113_0195270 3300048916 Bacteria 1607
686 Ga0496113_0327063 3300048916 Bacteria 1229
687 Ga0496114_0164280 3300048917 Bacteria 1932
688 Ga0496114_0525977 3300048917 Bacteria 1046
689 Ga0496115_0000124 3300048918 Bacteria 70162
690 Ga0496115_0000466 3300048918 Bacteria 32209
691 Ga0496115_0018698 3300048918 Bacteria 5326
692 Ga0496115_0020772 3300048918 Bacteria 5066
693 Ga0496116_0027095 3300048919 Bacteria 4176
694 Ga0496117_0003423 3300048920 Bacteria 18456
695 Ga0496117_0014978 3300048920 Bacteria 6643
696 Ga0496117_0128885 3300048920 Bacteria 1537
697 Ga0496117_0337814 3300048920 Bacteria 783
698 Ga0496117_0426450 3300048920 Bacteria 662
699 Ga0496118_0000268 3300048921 Bacteria 91201
700 Ga0496118_0001052 3300048921 Bacteria 43071
701 Ga0496118_0001207 3300048921 Bacteria 39788
702 Ga0496118_0007168 3300048921 Bacteria 11924
703 Ga0496118_0022313 3300048921 Bacteria 5540
704 Ga0496118_0025910 3300048921 Bacteria 5013
705 Ga0496118_0322159 3300048921 Bacteria 838
706 Ga0496118_0329414 3300048921 Bacteria 824
707 Ga0496119_0001330 3300048922 Bacteria 30360
708 Ga0496119_0007350 3300048922 Bacteria 9956
709 Ga0496120_0000359 3300048923 Bacteria 74678
710 Ga0496120_0000539 3300048923 Bacteria 58074
711 Ga0496121_0000327 3300048924 Bacteria 99562
712 Ga0496121_0000450 3300048924 Bacteria 81062
713 Ga0496121_0001992 3300048924 Bacteria 32457
714 Ga0496121_0002452 3300048924 Bacteria 28356
715 Ga0496121_0026203 3300048924 Bacteria 5503
716 Ga0496121_0039112 3300048924 Bacteria 4187
717 Ga0496121_0045473 3300048924 Bacteria 3771
718 Ga0496121_0073796 3300048924 Bacteria 2732
719 Ga0496122_0008948 3300048925 Bacteria 10650
720 Ga0496122_0011189 3300048925 Bacteria 9131
721 Ga0496122_0018881 3300048925 Bacteria 6335
722 Ga0496122_0213971 3300048925 Bacteria 1113
723 Ga0496123_0000870 3300048926 Bacteria 48048
724 Ga0496123_0001731 3300048926 Bacteria 28930
725 Ga0496123_0128183 3300048926 Bacteria 1412
726 Ga0496123_0255814 3300048926 Bacteria 861
727 Ga0496124_0000550 3300048927 Bacteria 63401
728 Ga0496124_0277709 3300048927 Bacteria 1223
729 Ga0496125_0000088 3300048928 Bacteria 214942
730 Ga0496125_0104405 3300048928 Bacteria 2076
731 Ga0496125_0403797 3300048928 Bacteria 797
732 Ga0496126_0001255 3300048929 Bacteria 40994
733 Ga0496126_0043756 3300048929 Bacteria 4128
734 Ga0496126_0089276 3300048929 Bacteria 2713
735 Ga0496126_0099388 3300048929 Bacteria 2548
736 Ga0496126_0205539 3300048929 Bacteria 1660
737 Ga0496126_0274518 3300048929 Bacteria 1398
738 Ga0496126_0419888 3300048929 Bacteria 1081
739 Ga0496126_0595557 3300048929 Bacteria 871
740 Ga0495678_000717 3300049459 Bacteria 30162
741 Ga0495682_0002423 3300049460 Bacteria 8838
742 Ga0495682_0035371 3300049460 Bacteria 1840
743 Ga0501031_0017958 3300049568 Bacteria 4602
744 Ga0501031_0046308 3300049568 Bacteria 2836
745 Ga0501031_0082901 3300049568 Bacteria 2090
746 Ga0501031_0097531 3300049568 Bacteria 1918
747 Ga0501031_0246758 3300049568 Bacteria 1160
748 Ga0501032_0013508 3300049569 Bacteria 5806
749 Ga0501032_0015498 3300049569 Bacteria 5374
750 Ga0501032_0081607 3300049569 Bacteria 2151
751 Ga0501032_0155893 3300049569 Bacteria 1500
752 Ga0501032_0500882 3300049569 Bacteria 776
753 Ga0501033_0000821 3300049570 Bacteria 28339
754 Ga0501033_0020890 3300049570 Bacteria 4942
755 Ga0501033_0073695 3300049570 Bacteria 2507
756 Ga0501033_0204748 3300049570 Unclassified 1408
757 Ga0501033_0335896 3300049570 Bacteria 1060
758 Ga0501033_0341584 3300049570 Bacteria 1049
759 Ga0501033_0352101 3300049570 Bacteria 1031
760 Ga0501034_0000367 3300049571 Bacteria 76895
761 Ga0501034_0003776 3300049571 Bacteria 17093
762 Ga0501034_0006750 3300049571 Bacteria 12286
763 Ga0501034_0016243 3300049571 Bacteria 7639
764 Ga0501034_0026207 3300049571 Bacteria 5937
765 Ga0501034_0026424 3300049571 Bacteria 5911
766 Ga0501034_0099868 3300049571 Bacteria 2897
767 Ga0501036_0009039 3300049572 Bacteria 8192
768 Ga0501036_0018300 3300049572 Bacteria 5866
769 Ga0501036_0056006 3300049572 Bacteria 3340
770 Ga0501036_0304166 3300049572 Bacteria 1334
771 Ga0501037_0023840 3300049573 Bacteria 4525
772 Ga0501037_0040451 3300049573 Bacteria 3430
773 Ga0501037_0058913 3300049573 Bacteria 2802
774 Ga0501037_0090847 3300049573 Bacteria 2208
775 Ga0501037_0139593 3300049573 Bacteria 1735
776 Ga0501037_0162354 3300049573 Bacteria 1592
777 Ga0501037_0283099 3300049573 Bacteria 1155
778 Ga0501038_0001913 3300049574 Bacteria 19262
779 Ga0501038_0002023 3300049574 Bacteria 18731
780 Ga0501038_0011166 3300049574 Bacteria 8202
781 Ga0501038_0102047 3300049574 Bacteria 2388
782 Ga0501038_0125255 3300049574 Unclassified 2115
783 Ga0501038_0126984 3300049574 Bacteria 2098
784 Ga0501038_0316749 3300049574 Bacteria 1221
785 Ga0501038_0488022 3300049574 Bacteria 943
786 Ga0501039_0016405 3300049575 Bacteria 5673
787 Ga0501039_0049274 3300049575 Bacteria 3256
788 Ga0501042_0008733 3300049578 Bacteria 6721
789 Ga0501042_0172574 3300049578 Bacteria 1560
790 Ga0501042_0231764 3300049578 Bacteria 1332
791 Ga0501043_0002412 3300049579 Bacteria 15824
792 Ga0501043_0038855 3300049579 Bacteria 3742
793 Ga0501043_0081322 3300049579 Bacteria 2545
794 Ga0501043_0397587 3300049579 Bacteria 1041
795 Ga0501046_0005696 3300049580 Bacteria 11116
796 Ga0501046_0122223 3300049580 Bacteria 1980
797 Ga0501046_0144280 3300049580 Bacteria 1799
798 Ga0501047_0004935 3300049581 Bacteria 12527
799 Ga0501047_0019091 3300049581 Bacteria 6577
800 Ga0501047_0039526 3300049581 Bacteria 4562
801 Ga0501047_0040924 3300049581 Bacteria 4480
802 Ga0501047_0149576 3300049581 Bacteria 2211
803 Ga0501047_0245383 3300049581 Bacteria 1640
804 Ga0501047_0293539 3300049581 Bacteria 1469
805 Ga0501047_0635092 3300049581 Bacteria 888
806 Ga0501047_1030727 3300049581 Bacteria 636
807 Ga0501048_0064496 3300049582 Bacteria 2591
808 Ga0501048_0161859 3300049582 Bacteria 1584
809 Ga0501067_0011288 3300049583 Bacteria 4946
810 Ga0501067_0039847 3300049583 Bacteria 2609
811 Ga0501067_0091198 3300049583 Bacteria 1692
812 Ga0501067_0407467 3300049583 Unclassified 758
813 Ga0501068_0021725 3300049584 Bacteria 3750
814 Ga0501068_0041960 3300049584 Bacteria 2751
815 Ga0501069_0006690 3300049585 Bacteria 6035
816 Ga0501069_0055707 3300049585 Bacteria 2202
817 Ga0501069_0075989 3300049585 Bacteria 1888
818 Ga0501070_0007977 3300049586 Bacteria 8969
819 Ga0501070_0091418 3300049586 Bacteria 2518
820 Ga0501070_0103357 3300049586 Bacteria 2356
821 Ga0501070_0158682 3300049586 Bacteria 1865
822 Ga0501070_0178257 3300049586 Unclassified 1749
823 Ga0501070_0262264 3300049586 Bacteria 1412
824 Ga0501070_0376549 3300049586 Bacteria 1150
825 Ga0501071_0011086 3300049587 Bacteria 6058
826 Ga0501072_0121337 3300049588 Bacteria 2082
827 Ga0501073_0003257 3300049589 Bacteria 12187
828 Ga0501073_0007880 3300049589 Bacteria 7904
829 Ga0501073_0030626 3300049589 Bacteria 3841
830 Ga0501073_0039795 3300049589 Bacteria 3329
831 Ga0501073_0056974 3300049589 Bacteria 2732
832 Ga0501074_0006338 3300049590 Bacteria 8545
833 Ga0501074_0066000 3300049590 Bacteria 2603
834 Ga0501075_0625313 3300049591 Unclassified 821
835 Ga0501076_0131219 3300049592 Bacteria 2032
836 Ga0501077_0109670 3300049593 Bacteria 1749
837 Ga0501079_0032313 3300049741 Bacteria 4024
838 Ga0501080_0002305 3300049742 Bacteria 16635
839 Ga0501080_0036164 3300049742 Bacteria 4610
840 Ga0501080_0060497 3300049742 Bacteria 3526
841 Ga0501080_0250821 3300049742 Bacteria 1614
842 Ga0501080_0280718 3300049742 Bacteria 1514
843 Ga0501080_0486894 3300049742 Bacteria 1103
844 Ga0501080_0659825 3300049742 Bacteria 925
845 Ga0501083_0010536 3300049744 Bacteria 6506
846 Ga0501035_0005637 3300049822 Bacteria 11821
847 Ga0501035_0008113 3300049822 Bacteria 9785
848 Ga0501035_0009495 3300049822 Bacteria 9045
849 Ga0501035_0021755 3300049822 Bacteria 5895
850 Ga0501035_0063675 3300049822 Bacteria 3279
851 Ga0501035_0127152 3300049822 Bacteria 2224
852 Ga0501035_0315395 3300049822 Bacteria 1315
853 Ga0501035_0344346 3300049822 Bacteria 1248
854 Ga0501035_0406360 3300049822 Bacteria 1132
855 Ga0501044_0008272 3300049823 Bacteria 11407
856 Ga0501044_0017849 3300049823 Bacteria 7611
857 Ga0501044_0024496 3300049823 Bacteria 6404
858 Ga0501044_0030059 3300049823 Bacteria 5726
859 Ga0501044_0054290 3300049823 Bacteria 4119
860 Ga0501044_0069628 3300049823 Bacteria 3581
861 Ga0501044_0069885 3300049823 Bacteria 3574
862 Ga0501044_0075476 3300049823 Bacteria 3422
863 Ga0501044_0260274 3300049823 Bacteria 1673
864 Ga0501045_0061332 3300049824 Bacteria 2758
865 Ga0500643_000031 3300053087 Bacteria 204488
866 Ga0500643_019762 3300053087 Bacteria 2212
867 Ga0500646_0083100 3300053090 Bacteria 980
868 Ga0500651_0000144 3300053093 Bacteria 44879
869 Ga0500651_0013646 3300053093 Bacteria 4958
870 Ga0500651_0074083 3300053093 Bacteria 2116
871 Ga0500555_000249 3300053103 Bacteria 23702
872 Ga0500597_000253 3300053120 Bacteria 10919
873 Ga0500568_0000455 3300053139 Bacteria 30618
874 Ga0500633_0017865 3300053160 Bacteria 2090
875 Ga0500645_002319 3300053730 Bacteria 8588
876 Ga0501084_0011253 3300054114 Bacteria 7408
877 Ga0501084_0022192 3300054114 Bacteria 5297
878 Ga0501082_0011219 3300060353 Bacteria 7698
879 Ga0501082_0021595 3300060353 Bacteria 5550
880 Ga0501082_0078979 3300060353 Bacteria 2838
881 Ga0466962_0001040 3300061719 Bacteria 12727
882 Ga0466962_0008740 3300061719 Bacteria 4855
883 2538831992 2537561836 Bacteria 3910579
884 2643828880 2643221562 Bacteria 4048635
885 2643896583 2643221577 Bacteria 3710843
886 2644478664 2643221685 Bacteria 3673288
887 2721025542 2718218334 Bacteria 4765486
888 2735834488 2734482264 Unclassified 5014763
889 2739733187 2739367700 Bacteria 4747630
890 2842915674 2842914999 Bacteria 4419378
891 2884338883 2884338543 Bacteria 4610696
892 2884415724 2884411467 Bacteria 5246714
893 2895395923 2895395659 Bacteria 3983269
894 2928966899 2928963466 Bacteria 5165703
895 2939613344 2939611941 Bacteria 3892017
896 2941492705 2941489479 Bacteria 6313767
897 2995953853 2995948881 Bacteria 6358104
898 Ga0055526_1000107
899 JGI24740J21852_10017269
900 JGI24739J22299_10083624
901 JGI24737J22298_10000503
902 JGI24737J22298_10109933
903 JGI24735J21928_10023462
904 JGI24738J21930_10000020
905 JGI25156J39149_1000480
906 JGI25156J39149_1004347
907 JGI25156J39149_1006967
908 JGI25156J39149_1012327
909 JGI25162J39368_1000454
910 JGI25162J39368_1000657
911 JGI25162J39368_1000792
912 JGI25162J39368_1001661
913 JGI25162J39368_1002289
914 JGI25157J39369_1000300
915 JGI25157J39369_1000525
916 JGI25157J39369_1001263
917 JGI25157J39369_1003690
918 JGI25163J39215_1000882
919 JGI25164J39214_1000112
920 JGI25164J39214_1000295
921 JGI25164J39214_1000451
922 JGI25164J39214_1000454
923 JGI25164J39214_1008953
924 JGI25165J46597_1000229
925 JGI25165J46597_1000527
926 JGI25165J46597_1000872
927 JGI25165J46597_1006555
928 rootH1_10006421
929 rootH1_10124382
930 rootH2_10047639
931 rootH2_10082323
932 rootL2_10011264
933 rootH1_10034785
934 rootH1_10183402
935 rootH1_10236681
936 Ga0006562J51391_1017349
937 Ga0006562J51391_1201163
938 Ga0006562J51391_1201164
939 Ga0055538_1001138
940 Ga0055539_1005663
941 Ga0055539_1019428
942 Ga0055533_1000581
943 Ga0055533_1003055
944 Ga0055525_1000082
945 Ga0055527_1000072
946 Ga0055527_1000080
947 Ga0055527_1003188
948 Ga0055527_1011228
949 Ga0055535_1000162
950 Ga0055535_1000189
951 Ga0055535_1000491
952 Ga0055535_1000611
953 Ga0055535_1001129
954 Ga0055542_1000105
955 Ga0055542_1000163
956 Ga0055542_1000181
957 Ga0055542_1000188
958 Ga0055542_1000254
959 Ga0055542_1000573
960 Ga0055529_1000205
961 Ga0055529_1000209
962 Ga0055529_1000336
963 Ga0055529_1000496
964 Ga0055529_1023381
965 Ga0055537_1000125
966 Ga0055524_1000176
967 Ga0055534_1000090
968 Ga0055528_1000088
969 Ga0070658_10005032
970 Ga0070658_10035840
971 Ga0070658_10873277
972 Ga0070670_100132781
973 Ga0070670_100255716
974 Ga0068869_100244555
975 Ga0070666_10000020
976 Ga0070682_100006648
977 Ga0070682_100467750
978 Ga0068868_100462320
979 Ga0070660_100011111
980 Ga0070660_100105322
981 Ga0070660_100120618
982 Ga0070660_100205709
983 Ga0070689_100004873
984 Ga0070691_10122135
985 Ga0070661_100004622
986 Ga0070661_100007423
987 Ga0070661_100028888
988 Ga0070661_100029522
989 Ga0070661_100055463
990 Ga0070661_100095087
991 Ga0070692_10023906
992 Ga0070692_10085847
993 Ga0070668_100001704
994 Ga0070668_100834439
995 Ga0070669_100511960
996 Ga0070671_100025842
997 Ga0070673_100220277
998 Ga0070659_100003695
999 Ga0070659_100043342
1000 Ga0070659_100127110
1001 Ga0070659_100519562
1002 Ga0070667_100000040
1003 Ga0070667_100010566
1004 Ga0070667_100031091
1005 Ga0070667_100062316
1006 Ga0070667_100073758
1007 Ga0070667_100309147
1008 Ga0070667_100620417
1009 Ga0070714_100000207
1010 Ga0070714_100001217
1011 Ga0070711_100015114
1012 Ga0070711_100536123
1013 Ga0070694_100076914
1014 Ga0070663_100001131
1015 Ga0070663_100012632
1016 Ga0070663_100029842
1017 Ga0070663_100039344
1018 Ga0070663_100107997
1019 Ga0070663_100197199
1020 Ga0070663_100226213
1021 Ga0070663_100299657
1022 Ga0070663_100933358
1023 Ga0070662_100218434
1024 Ga0070681_10013694
1025 Ga0070681_10023056
1026 Ga0068867_100219122
1027 Ga0070685_10009321
1028 Ga0070685_10010980
1029 Ga0070679_100059614
1030 Ga0070679_100090918
1031 Ga0068853_100038222
1032 Ga0068853_100041046
1033 Ga0068853_100049856
1034 Ga0068853_100181559
1035 Ga0068853_100195727
1036 Ga0068853_100276154
1037 Ga0068853_100358905
1038 Ga0070696_100004108
1039 Ga0070696_100010225
1040 Ga0070696_100124104
1041 Ga0070693_100019491
1042 Ga0070693_100046384
1043 Ga0070665_100000097
1044 Ga0070665_100001328
1045 Ga0070665_100013315
1046 Ga0070665_100020995
1047 Ga0070665_100025880
1048 Ga0070665_100033651
1049 Ga0070665_100161102
1050 Ga0070665_100349215
1051 Ga0068855_100007368
1052 Ga0068855_100041031
1053 Ga0068855_100058503
1054 Ga0068855_100141160
1055 Ga0068855_100412537
1056 Ga0068855_100501717
1057 Ga0068855_100523970
1058 Ga0068855_100732842
1059 Ga0070664_100762991
1060 Ga0068857_100016650
1061 Ga0068857_100032832
1062 Ga0068857_100075732
1063 Ga0068857_100086711
1064 Ga0068857_100108570
1065 Ga0068857_100141891
1066 Ga0068857_100193289
1067 Ga0068854_100001262
1068 Ga0068854_100045364
1069 Ga0068856_100000184
1070 Ga0068856_100007251
1071 Ga0068856_100028084
1072 Ga0068856_100771812
1073 Ga0068852_100001204
1074 Ga0068852_100014289
1075 Ga0068852_100092432
1076 Ga0068852_100221594
1077 Ga0068852_101047322
1078 Ga0068859_100007515
1079 Ga0068851_10023176
1080 Ga0068863_100113735
1081 Ga0068863_100685759
1082 Ga0068858_100078324
1083 Ga0068858_100120194
1084 Ga0068860_100145004
1085 Ga0068860_100162836
1086 Ga0068860_100412916
1087 Ga0068862_100000224
1088 Ga0068862_100059714
1089 Ga0068862_100104837
1090 Ga0070712_100027163
1091 Ga0097621_100017790
1092 Ga0097621_100081890
1093 Ga0068871_100069947
1094 Ga0068871_100195291
1095 Ga0068865_100199275
1096 Ga0097620_100007515
1097 Ga0105250_10095931
1098 Ga0105240_10006212
1099 Ga0105240_10006230
1100 Ga0105240_10006360
1101 Ga0105240_10007835
1102 Ga0105240_10031364
1103 Ga0105240_10055146
1104 Ga0105240_10057256
1105 Ga0105240_10084657
1106 Ga0105240_10464558
1107 Ga0105240_10975403
1108 Ga0105247_10002045
1109 Ga0105247_10025236
1110 Ga0105247_10630510
1111 Ga0105241_10017425
1112 Ga0105241_10417655
1113 Ga0105241_10473819
1114 Ga0105248_10028291
1115 Ga0105248_10346591
1116 Ga0105237_10000022
1117 Ga0105237_10000036
1118 Ga0105237_10063098
1119 Ga0105237_10093406
1120 Ga0105237_10118792
1121 Ga0105237_10137559
1122 Ga0105237_11107800
1123 Ga0105238_10001023
1124 Ga0105238_10015508
1125 Ga0105238_10022715
1126 Ga0105238_10051301
1127 Ga0105238_10099966
1128 Ga0105238_10162538
1129 Ga0105238_10208703
1130 Ga0105238_10326233
1131 Ga0105238_10326569
1132 Ga0105238_11203240
1133 Ga0105238_11240976
1134 Ga0105249_10000193
1135 Ga0105147_100668
1136 Ga0105239_10000192
1137 Ga0105239_10004724
1138 Ga0105239_10012311
1139 Ga0105239_10025642
1140 Ga0105239_10103323
1141 Ga0105239_10119105
1142 Ga0105239_10399618
1143 Ga0105239_10421240
1144 Ga0105239_10550070
1145 Ga0157314_1000060
1146 Ga0157347_1001512
1147 Ga0157373_10012271
1148 Ga0157373_10019943
1149 Ga0157373_10299074
1150 Ga0157373_10327469
1151 Ga0157371_10004318
1152 Ga0157371_10021258
1153 Ga0157370_10001178
1154 Ga0157370_10015371
1155 Ga0157370_10021645
1156 Ga0157370_10132571
1157 Ga0157370_10145090
1158 Ga0157370_10162156
1159 Ga0157369_10008532
1160 Ga0157369_10102041
1161 Ga0157369_10132720
1162 Ga0157369_10298142
1163 Ga0163162_10083015
1164 Ga0163162_11669365
1165 Ga0157372_10010508
1166 Ga0157372_10092695
1167 Ga0157372_10096496
1168 Ga0157372_10104820
1169 Ga0157372_10649018
1170 Ga0157375_10205673
1171 Ga0163163_10083520
1172 Ga0182008_10014259
1173 Ga0157379_10090031
1174 Ga0157379_10275778
1175 Ga0157376_10105080
1176 Ga0157376_10963307
1177 Ga0182006_1000065
1178 Ga0182006_1073793
1179 Ga0182007_10005217
1180 Ga0182007_10018151
1181 Ga0182007_10043001
1182 Ga0182007_10103943
1183 Ga0182005_1001497
1184 Ga0182005_1008021
1185 Ga0183368_1002
1186 Ga0183360_10004
1187 Ga0163161_10002563
1188 Ga0163161_10097349
1189 Ga0206356_11612961
1190 Ga0206354_10499166
1191 Ga0206353_11908525
1192 Ga0209435_104672
1193 Ga0209760_100417
1194 Ga0209784_100053
1195 Ga0209566_101751
1196 Ga0209674_100014
1197 Ga0209674_100234
1198 Ga0209674_100413
1199 Ga0209674_102618
1200 Ga0209672_100004
1201 Ga0209672_100008
1202 Ga0209672_100089
1203 Ga0209672_101247
1204 Ga0209672_101845
1205 Ga0209672_103546
1206 Ga0209147_108813
1207 Ga0209563_100097
1208 Ga0207427_100044
1209 Ga0207427_100051
1210 Ga0207427_100061
1211 Ga0207427_100088
1212 Ga0207427_103025
1213 Ga0207427_112494
1214 Ga0209437_100005
1215 Ga0209437_100037
1216 Ga0209437_100152
1217 Ga0209437_100167
1218 Ga0209437_100279
1219 Ga0209437_102261
1220 Ga0209258_100003
1221 Ga0209258_100004
1222 Ga0209258_100008
1223 Ga0209258_100090
1224 Ga0209258_100173
1225 Ga0209258_100541
1226 Ga0209258_101149
1227 Ga0209258_102841
1228 Ga0209646_1000700
1229 Ga0209646_1000900
1230 Ga0209026_1000010
1231 Ga0209026_1000064
1232 Ga0209026_1000104
1233 Ga0209026_1000407
1234 Ga0209026_1000660
1235 Ga0209026_1003591
1236 Ga0209677_101838
1237 Ga0209677_112023
1238 Ga0209148_1000001
1239 Ga0209148_1000002
1240 Ga0209148_1000016
1241 Ga0209148_1000065
1242 Ga0209148_1000079
1243 Ga0209148_1000279
1244 Ga0209759_1000165
1245 Ga0209759_1000544
1246 Ga0209759_1000762
1247 Ga0209759_1001342
1248 Ga0209759_1002477
1249 Ga0209759_1012013
1250 Ga0209233_1000002
1251 Ga0209233_1000011
1252 Ga0209233_1000046
1253 Ga0209233_1000099
1254 Ga0209233_1000759
1255 Ga0209233_1007681
1256 Ga0209233_1027747
1257 Ga0209565_1000002
1258 Ga0209455_1000004
1259 Ga0209455_1000007
1260 Ga0209455_1000016
1261 Ga0209455_1000079
1262 Ga0209455_1000295
1263 Ga0209673_1000002
1264 Ga0209675_1000002
1265 Ga0209564_1000004
1266 Ga0209758_1000452
1267 Ga0209256_1000004
1268 Ga0207656_10035314
1269 Ga0207696_1149757
1270 Ga0207710_10042402
1271 Ga0207680_10000001
1272 Ga0207647_10000014
1273 Ga0207647_10001935
1274 Ga0207647_10017313
1275 Ga0207647_10054333
1276 Ga0207647_10064530
1277 Ga0207647_10296206
1278 Ga0207705_10003986
1279 Ga0207705_10005837
1280 Ga0207654_10341553
1281 Ga0207707_10038371
1282 Ga0207707_10047400
1283 Ga0207707_10161188
1284 Ga0207707_10535118
1285 Ga0207695_10000040
1286 Ga0207695_10000291
1287 Ga0207695_10000362
1288 Ga0207695_10001147
1289 Ga0207695_10002008
1290 Ga0207695_10024317
1291 Ga0207695_10042674
1292 Ga0207695_10057571
1293 Ga0207671_10000009
1294 Ga0207671_10000135
1295 Ga0207671_10004793
1296 Ga0207671_10156614
1297 Ga0207671_10210818
1298 Ga0207657_10012203
1299 Ga0207657_10106355
1300 Ga0207657_10122356
1301 Ga0207649_10003075
1302 Ga0207649_10006684
1303 Ga0207649_10021106
1304 Ga0207649_10023263
1305 Ga0207649_10126431
1306 Ga0207652_10143154
1307 Ga0207652_10220312
1308 Ga0207694_10002190
1309 Ga0207694_10005245
1310 Ga0207694_10006615
1311 Ga0207694_10023988
1312 Ga0207694_10039266
1313 Ga0207694_10050959
1314 Ga0207694_10179994
1315 Ga0207694_10434103
1316 Ga0207694_10569775
1317 Ga0207650_10217151
1318 Ga0207700_10023446
1319 Ga0207700_10455654
1320 Ga0207664_10000092
1321 Ga0207664_10000929
1322 Ga0207664_10039255
1323 Ga0207690_10018537
1324 Ga0207690_10018739
1325 Ga0207690_10024493
1326 Ga0207690_10031438
1327 Ga0207706_10033243
1328 Ga0207706_10076489
1329 Ga0207706_10084528
1330 Ga0207670_10008997
1331 Ga0207691_10096278
1332 Ga0207689_10047201
1333 Ga0207679_10036264
1334 Ga0207679_10227486
1335 Ga0207679_10291168
1336 Ga0207679_10725760
1337 Ga0207667_10000262
1338 Ga0207667_10000329
1339 Ga0207667_10002131
1340 Ga0207667_10012894
1341 Ga0207667_10027480
1342 Ga0207667_10133995
1343 Ga0207667_10229349
1344 Ga0207651_10072042
1345 Ga0207712_10000498
1346 Ga0207668_10239745
1347 Ga0207668_10497029
1348 Ga0207640_10000116
1349 Ga0207640_10003397
1350 Ga0207640_10013585
1351 Ga0207640_10543140
1352 Ga0207658_10000289
1353 Ga0207658_10099716
1354 Ga0207658_10112606
1355 Ga0207658_10532337
1356 Ga0207658_10614275
1357 Ga0207703_10088824
1358 Ga0207703_10401961
1359 Ga0207639_10009617
1360 Ga0207639_10021122
1361 Ga0207639_10026892
1362 Ga0207639_10038222
1363 Ga0207639_10225944
1364 Ga0207639_10287545
1365 Ga0207639_10499748
1366 Ga0207678_10001533
1367 Ga0207678_10006482
1368 Ga0207678_10007650
1369 Ga0207678_10026742
1370 Ga0207678_10050032
1371 Ga0207678_10053454
1372 Ga0207678_10054822
1373 Ga0207678_10082252
1374 Ga0207678_10152847
1375 Ga0207678_10185207
1376 Ga0207678_10238262
1377 Ga0207678_10468406
1378 Ga0207702_10000037
1379 Ga0207702_10000960
1380 Ga0207702_10005837
1381 Ga0207702_10741481
1382 Ga0207641_10940351
1383 Ga0207648_10186602
1384 Ga0207674_10010758
1385 Ga0207674_10032637
1386 Ga0207674_10095686
1387 Ga0207674_10100269
1388 Ga0207674_10105110
1389 Ga0207674_10137452
1390 Ga0207674_10144148
1391 Ga0207674_10188092
1392 Ga0207698_10009393
1393 Ga0207698_10145111
1394 Ga0207698_10277718
1395 Ga0207698_10552041
1396 Ga0268266_10000067
1397 Ga0268266_10000101
1398 Ga0268266_10011365
1399 Ga0268266_10023757
1400 Ga0268266_10106346
1401 Ga0268266_10121872
1402 Ga0268266_10304927
1403 Ga0268265_10000054
1404 Ga0268265_10062614
1405 Ga0268264_10333291
1406 Ga0268264_10399613
1407 Ga0268264_10767696
1408 Ga0307517_10102780
1409 Ga0265338_10673318
1410 Ga0265332_10077822
1411 Ga0307508_10449642
1412 Ga0316575_10051705
1413 Ga0316575_10064821
1414 Ga0307507_10176250
1415 Ga0307510_10018630
1416 Ga0307510_10040472
1417 Ga0395899_0000189
1418 Ga0395899_0001468
1419 Ga0395899_0002467
1420 Ga0395899_0010653
1421 Ga0395899_0032747
1422 Ga0395900_0000011
1423 Ga0395900_0000733
1424 Ga0395900_0002500
1425 Ga0395900_0023472
1426 Ga0395900_0112130
1427 Ga0395900_0181739
1428 Ga0395898_0000013
1429 Ga0395898_0000058
1430 Ga0395898_0019179
1431 Ga0395898_0025108
1432 Ga0395898_0031713
1433 Ga0395898_0043523
1434 Ga0395898_0122504
1435 Ga0395898_0123055
1436 Ga0395905_0257375
1437 Ga0436364_1417079
1438 Ga0395901_0000961
1439 Ga0395901_0002045
1440 Ga0395901_0018477
1441 Ga0395901_0038039
1442 Ga0395901_0134373
1443 Ga0395901_0140291
1444 Ga0395901_0142535
1445 Ga0395901_0176825
1446 Ga0395901_0311716
1447 Ga0439466_0055399
1448 Ga0451791_1402863
1449 Ga0451793_1096456
1450 Ga0451797_0845396
1451 Ga0451800_0536604
1452 Ga0451802_0271155
1453 Ga0451807_1337181
1454 Ga0451807_1964740
1455 Ga0451833_1330051
1456 Ga0451837_0571727
1457 Ga0451837_1034586
1458 Ga0451837_1245730
1459 Ga0451837_1427531
1460 Ga0451843_0143886
1461 Ga0451843_1235005
1462 Ga0451853_1120445
1463 Ga0451853_2151927
1464 Ga0439448_0012270
1465 Ga0439448_0023023
1466 Ga0439448_0182303
1467 Ga0439459_0003827
1468 Ga0466988_0289744
1469 Ga0466969_0003545
1470 Ga0466969_0028054
1471 Ga0466969_0048569
1472 Ga0466972_0005270
1473 Ga0466972_0048682
1474 Ga0466982_0000001
1475 Ga0466965_0003322
1476 Ga0466965_0039831
1477 Ga0466966_0007089
1478 Ga0466966_0012332
1479 Ga0466966_0014647
1480 Ga0466961_0000349
1481 Ga0466961_0000378
1482 Ga0466961_0000794
1483 Ga0466961_0002114
1484 Ga0466963_0092187
1485 Ga0466963_0299782
1486 Ga0466964_0055064
1487 Ga0466964_0056523
1488 Ga0466971_0007188
1489 Ga0466971_0016413
1490 Ga0466971_0045006
1491 Ga0466971_0098167
1492 Ga0466968_0000075
1493 Ga0466970_0001508
1494 Ga0466970_0001565
1495 Ga0466970_0007450
1496 Ga0466970_0013456
1497 Ga0466970_0030479
1498 Ga0466957_0001666
1499 Ga0466957_0020866
1500 Ga0466957_0076440
1501 Ga0466957_0101706
1502 Ga0466957_0462041
1503 Ga0466960_0007010
1504 Ga0466959_0002024
1505 Ga0466959_0019504
1506 Ga0466959_0034927
1507 Ga0466958_0009531
1508 Ga0466958_0016435
1509 Ga0466958_0067952
1510 Ga0466967_0051040
1511 Ga0466967_0255901
1512 Ga0466967_0455997
1513 Ga0495617_000091
1514 Ga0495617_001450
1515 Ga0495638_0000389
1516 Ga0495638_0000511
1517 Ga0495638_0000799
1518 Ga0495641_0194264
1519 Ga0495650_0000210
1520 Ga0495650_0000465
1521 Ga0495584_0003983
1522 Ga0495585_0000112
1523 Ga0495585_0001222
1524 Ga0495607_0000006
1525 Ga0495583_0043307
1526 Ga0495606_0000016
1527 Ga0495606_0000248
1528 Ga0495606_0000267
1529 Ga0495606_0009735
1530 Ga0495606_0026232
1531 Ga0495606_0147989
1532 Ga0495610_0068091
1533 Ga0495616_0000074
1534 Ga0495616_0056702
1535 Ga0495620_0000066
1536 Ga0495620_0002396
1537 Ga0495631_0000997
1538 Ga0495631_0044271
1539 Ga0495632_0000279
1540 Ga0495632_0018629
1541 Ga0495643_0060116
1542 Ga0495648_0000820
1543 Ga0495609_0013453
1544 Ga0495597_0181882
1545 Ga0495622_0008826
1546 Ga0495668_0004126
1547 Ga0495611_0000051
1548 Ga0495625_0009320
1549 Ga0495625_0027097
1550 Ga0495625_0065402
1551 Ga0495625_0584377
1552 Ga0495661_0001828
1553 Ga0495661_0020848
1554 Ga0495588_0094759
1555 Ga0495670_0001121
1556 Ga0495670_0003174
1557 Ga0495671_0000220
1558 Ga0495649_0006391
1559 Ga0495589_0000067
1560 Ga0495660_0000432
1561 Ga0495660_0000808
1562 Ga0495683_0001807
1563 Ga0495673_0000004
1564 Ga0495673_0000062
1565 Ga0495673_0001868
1566 Ga0495673_0021570
1567 Ga0495686_0000024
1568 Ga0495686_0000287
1569 Ga0495686_0007582
1570 Ga0495686_0013559
1571 Ga0495686_0047340
1572 Ga0496100_0006210
1573 Ga0496101_0018413
1574 Ga0496101_0020683
1575 Ga0496104_0052949
1576 Ga0496105_0005605
1577 Ga0496106_0000344
1578 Ga0496106_0190925
1579 Ga0496107_0341431
1580 Ga0496107_0789362
1581 Ga0496112_0380324
1582 Ga0496113_0195270
1583 Ga0496113_0327063
1584 Ga0496114_0164280
1585 Ga0496114_0525977
1586 Ga0496115_0000124
1587 Ga0496115_0000466
1588 Ga0496115_0018698
1589 Ga0496115_0020772
1590 Ga0496116_0027095
1591 Ga0496117_0003423
1592 Ga0496117_0014978
1593 Ga0496117_0128885
1594 Ga0496117_0337814
1595 Ga0496117_0426450
1596 Ga0496118_0000268
1597 Ga0496118_0001052
1598 Ga0496118_0001207
1599 Ga0496118_0007168
1600 Ga0496118_0022313
1601 Ga0496118_0025910
1602 Ga0496118_0322159
1603 Ga0496118_0329414
1604 Ga0496119_0001330
1605 Ga0496119_0007350
1606 Ga0496120_0000359
1607 Ga0496120_0000539
1608 Ga0496121_0000327
1609 Ga0496121_0000450
1610 Ga0496121_0001992
1611 Ga0496121_0002452
1612 Ga0496121_0026203
1613 Ga0496121_0039112
1614 Ga0496121_0045473
1615 Ga0496121_0073796
1616 Ga0496122_0008948
1617 Ga0496122_0011189
1618 Ga0496122_0018881
1619 Ga0496122_0213971
1620 Ga0496123_0000870
1621 Ga0496123_0001731
1622 Ga0496123_0128183
1623 Ga0496123_0255814
1624 Ga0496124_0000550
1625 Ga0496124_0277709
1626 Ga0496125_0000088
1627 Ga0496125_0104405
1628 Ga0496125_0403797
1629 Ga0496126_0001255
1630 Ga0496126_0043756
1631 Ga0496126_0089276
1632 Ga0496126_0099388
1633 Ga0496126_0205539
1634 Ga0496126_0274518
1635 Ga0496126_0419888
1636 Ga0496126_0595557
1637 Ga0495678_000717
1638 Ga0495682_0002423
1639 Ga0495682_0035371
1640 Ga0501031_0017958
1641 Ga0501031_0046308
1642 Ga0501031_0082901
1643 Ga0501031_0097531
1644 Ga0501031_0246758
1645 Ga0501032_0013508
1646 Ga0501032_0015498
1647 Ga0501032_0081607
1648 Ga0501032_0155893
1649 Ga0501032_0500882
1650 Ga0501033_0000821
1651 Ga0501033_0020890
1652 Ga0501033_0073695
1653 Ga0501033_0204748
1654 Ga0501033_0335896
1655 Ga0501033_0341584
1656 Ga0501033_0352101
1657 Ga0501034_0000367
1658 Ga0501034_0003776
1659 Ga0501034_0006750
1660 Ga0501034_0016243
1661 Ga0501034_0026207
1662 Ga0501034_0026424
1663 Ga0501034_0099868
1664 Ga0501036_0009039
1665 Ga0501036_0018300
1666 Ga0501036_0056006
1667 Ga0501036_0304166
1668 Ga0501037_0023840
1669 Ga0501037_0040451
1670 Ga0501037_0058913
1671 Ga0501037_0090847
1672 Ga0501037_0139593
1673 Ga0501037_0162354
1674 Ga0501037_0283099
1675 Ga0501038_0001913
1676 Ga0501038_0002023
1677 Ga0501038_0011166
1678 Ga0501038_0102047
1679 Ga0501038_0125255
1680 Ga0501038_0126984
1681 Ga0501038_0316749
1682 Ga0501038_0488022
1683 Ga0501039_0016405
1684 Ga0501039_0049274
1685 Ga0501042_0008733
1686 Ga0501042_0172574
1687 Ga0501042_0231764
1688 Ga0501043_0002412
1689 Ga0501043_0038855
1690 Ga0501043_0081322
1691 Ga0501043_0397587
1692 Ga0501046_0005696
1693 Ga0501046_0122223
1694 Ga0501046_0144280
1695 Ga0501047_0004935
1696 Ga0501047_0019091
1697 Ga0501047_0039526
1698 Ga0501047_0040924
1699 Ga0501047_0149576
1700 Ga0501047_0245383
1701 Ga0501047_0293539
1702 Ga0501047_0635092
1703 Ga0501047_1030727
1704 Ga0501048_0064496
1705 Ga0501048_0161859
1706 Ga0501067_0011288
1707 Ga0501067_0039847
1708 Ga0501067_0091198
1709 Ga0501067_0407467
1710 Ga0501068_0021725
1711 Ga0501068_0041960
1712 Ga0501069_0006690
1713 Ga0501069_0055707
1714 Ga0501069_0075989
1715 Ga0501070_0007977
1716 Ga0501070_0091418
1717 Ga0501070_0103357
1718 Ga0501070_0158682
1719 Ga0501070_0178257
1720 Ga0501070_0262264
1721 Ga0501070_0376549
1722 Ga0501071_0011086
1723 Ga0501072_0121337
1724 Ga0501073_0003257
1725 Ga0501073_0007880
1726 Ga0501073_0030626
1727 Ga0501073_0039795
1728 Ga0501073_0056974
1729 Ga0501074_0006338
1730 Ga0501074_0066000
1731 Ga0501075_0625313
1732 Ga0501076_0131219
1733 Ga0501077_0109670
1734 Ga0501079_0032313
1735 Ga0501080_0002305
1736 Ga0501080_0036164
1737 Ga0501080_0060497
1738 Ga0501080_0250821
1739 Ga0501080_0280718
1740 Ga0501080_0486894
1741 Ga0501080_0659825
1742 Ga0501083_0010536
1743 Ga0501035_0005637
1744 Ga0501035_0008113
1745 Ga0501035_0009495
1746 Ga0501035_0021755
1747 Ga0501035_0063675
1748 Ga0501035_0127152
1749 Ga0501035_0315395
1750 Ga0501035_0344346
1751 Ga0501035_0406360
1752 Ga0501044_0008272
1753 Ga0501044_0017849
1754 Ga0501044_0024496
1755 Ga0501044_0030059
1756 Ga0501044_0054290
1757 Ga0501044_0069628
1758 Ga0501044_0069885
1759 Ga0501044_0075476
1760 Ga0501044_0260274
1761 Ga0501045_0061332
1762 Ga0500643_000031
1763 Ga0500643_019762
1764 Ga0500646_0083100
1765 Ga0500651_0000144
1766 Ga0500651_0013646
1767 Ga0500651_0074083
1768 Ga0500555_000249
1769 Ga0500597_000253
1770 Ga0500568_0000455
1771 Ga0500633_0017865
1772 Ga0500645_002319
1773 Ga0501084_0011253
1774 Ga0501084_0022192
1775 Ga0501082_0011219
1776 Ga0501082_0021595
1777 Ga0501082_0078979
1778 Ga0466962_0001040
1779 Ga0466962_0008740
1780 2538831992
1781 2643828880
1782 2643896583
1783 2644478664
1784 2721025542
1785 2735834488
1786 2739733187
1787 2842915674
1788 2884338883
1789 2884415724
1790 2895395923
1791 2928966899
1792 2939613344
1793 2941492705
1794 2995953853

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01553

Acyltransferase

Acyltransferase

61

181

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
8e50-assembly1.cif.gz_A cryo-em structure of human glycerol-3-phosphate acyltransferase 1 (gpat1) in complex with coa and palmitoyl-lpa 0.6336 13 150
6zvj-assembly1.cif.gz_1 structure of a human abce1-bound 43s pre-initiation complex - state ii 0.5376 94 178
5f34-assembly1.cif.gz_A crystal structure of membrane associated pata from mycobacterium smegmatis in complex with s-hexadecyl coenzyme a - p21 space group 0.5325 12 184
3kwp-assembly1.cif.gz_A-2 crystal structure of putative methyltransferase from lactobacillus brevis 0.5269 41 150
3hh1-assembly2.cif.gz_C the structure of a tetrapyrrole methylase family protein domain from chlorobium tepidum tls 0.5253 38 149
ID Description Score Start End Superfamily
af_P26647_52_180_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.7378 31 149 3.40.50.620
af_Q2FXJ7_19_144_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.7339 36 149 3.40.50.2000
af_Q8IL28_86_216_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.7305 33 149 3.40.50.620
af_Q8GXU8_180_307_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.7285 36 149 3.40.50.2000
af_D4AC45_64_192_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.7279 34 149 3.40.50.620
ID Description Score Start End GO Terms
AF-A0A1B8PVB4-F1-model_v4 Glycerol acyltransferase 0.9491 11 189 GO:0003841
GO:0006654
AF-A0A091BH66-F1-model_v4 Phospholipid/glycerol acyltransferase domain-containing protein 0.947 4 191 GO:0003841
GO:0006654
AF-A0A7Y0LF21-F1-model_v4 Acyltransferase 0.9457 10 189 GO:0003841
GO:0006654
AF-A0A143HR79-F1-model_v4 Acyltransferase 0.9428 11 189 GO:0003841
GO:0006654
AF-A0A160N2L2-F1-model_v4 1-acylglycerol-3-phosphate O-acyltransferase (EC 2.3.1.51) 0.942 26 191 GO:0003841
GO:0006654

Map