F485041

General Info

Members Datasets Scaffolds Average Seq Length
897 328 1794 212

Family's Representative Sequence

Representative Sequence 3300006871|Ga0075434_100153127|Ga0075434_1001531273
Length 233
Sequence VVAAAATAAVRVTSTKQPMAAEHTLYCFAQSGNAYKAALMLAVTGSSWAPRFVDYFGGETRTPEYRVINVMGEVPVLEHEGRRLTQSGVILDYLAEKTGQFGPANGEERRDILRWLFFDNHKLTSYTATYRFMRTFVSAPNPAVMEEFRKRAETAWRVLDAHLDGRRSVVGERLTIADLSLVGYLFFDDEIGVDWNDYPHLRDWLARIRALPGWAHPYDLMPGHPLPAKDAAK

Samples

Sample ID Description Type Environment
1 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
2 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
3 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
4 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
5 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
6 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
7 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
8 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
9 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
10 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
11 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
12 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
13 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
14 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
15 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
16 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
17 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
18 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
19 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
20 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
21 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
22 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
23 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
24 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
25 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
26 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
27 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
28 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
29 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
30 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
31 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
32 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
33 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
34 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
35 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
36 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
37 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
38 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
39 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
40 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
41 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
42 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
43 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
44 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
45 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
46 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
47 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
48 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
49 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
50 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
51 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
52 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
53 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
54 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
55 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
56 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
57 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
58 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
59 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
60 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
61 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
62 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
63 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
64 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
65 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
66 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
67 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
68 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
69 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
70 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
71 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
72 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
73 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
74 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
75 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
76 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
77 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
78 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
79 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
80 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
81 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
82 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
83 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
84 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
85 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
86 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
87 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
88 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
89 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
90 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
91 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
92 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
93 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
94 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
95 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
96 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
97 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
98 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
99 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
100 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
101 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
102 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
103 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
104 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
105 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
106 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
107 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
108 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
109 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
110 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
111 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
112 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
113 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
114 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
115 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
116 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
117 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
118 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
119 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
120 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
121 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
122 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
123 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
124 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
125 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
126 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
127 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
128 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
193 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
194 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
195 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
196 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
200 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
201 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
202 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
203 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
204 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
205 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
206 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
207 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
208 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
209 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
210 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
211 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
212 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
213 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
214 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
215 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
216 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
217 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
218 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
219 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
220 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
221 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
222 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
223 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
224 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
225 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
226 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
227 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
228 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
229 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
230 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
231 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
232 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
233 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
234 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
235 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
236 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
237 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
238 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
239 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
240 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
241 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
242 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
243 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
244 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
245 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
246 3300042117 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0415F_E14_082316_1937 Metagenome Rhizosphere
247 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
248 3300042129 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 Metagenome Rhizosphere
249 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
250 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
251 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
252 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
253 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
254 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
255 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
256 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
257 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
258 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
259 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
260 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
261 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
262 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
263 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
264 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
265 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
266 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
267 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
268 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
269 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
270 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
271 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
272 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
273 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
274 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
275 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
276 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
277 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
278 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
279 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
280 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
281 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
282 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
283 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
284 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
285 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
286 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
287 3300049520 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought Metagenome Rhizosphere
288 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
289 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
290 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
291 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
292 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
293 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
294 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
295 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
296 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
297 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
298 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
299 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
300 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
301 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
302 3300049684 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_B_3_control Metagenome Rhizosphere
303 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
304 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
305 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
306 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
307 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
308 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
309 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
310 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
311 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
312 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
313 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
314 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
315 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
316 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
317 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
318 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
319 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
320 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
321 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
322 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
323 2511231024 Pseudomonas sp. GM84 Isolate Nodule
324 2643221544 Pelomonas sp. Root1444 Isolate Unclassified
325 2765235841 Pseudomonas putida AA7 Isolate Unclassified
326 3000017691 Rhodobacteraceae bacterium GH2-2 Isolate Rhizosphere
327 8054929484 Pseudomonas vlassakiae RW4S1 Isolate Rhizosphere
328 8056137416 Pseudomonas fakonensis COW40 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.22
Metatranscriptomes 0.11
Isolates 0.67

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1
Nodule 0.11
Rhizoplane 5.02
Rhizosphere 92.64
Stem 0
Stem Tuber 0
Unclassified 4.12

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075434_100153127 3300006871 Bacteria 2326
2 JGI24743J22301_10012326 3300001991 Bacteria 1554
3 JGI24749J21850_1023695 3300002076 Bacteria 872
4 JGI24034J26672_10048157 3300002239 Bacteria 728
5 JGI24742J22300_10057369 3300002244 Bacteria 712
6 rootH1_10003216 3300003316 Bacteria 15917
7 rootL2_10002048 3300003322 Bacteria 12254
8 Ga0065712_10006136 3300005290 Bacteria 3721
9 Ga0065715_10139235 3300005293 Unclassified 1879
10 Ga0065715_10446243 3300005293 Bacteria 809
11 Ga0070658_10019632 3300005327 Bacteria 5411
12 Ga0070658_10218595 3300005327 Bacteria 1611
13 Ga0070658_10410322 3300005327 Bacteria 1164
14 Ga0070676_10000712 3300005328 Bacteria 16253
15 Ga0070676_10010963 3300005328 Bacteria 4924
16 Ga0070676_10082019 3300005328 Bacteria 1958
17 Ga0070676_10398702 3300005328 Bacteria 957
18 Ga0070683_100010112 3300005329 Bacteria 8094
19 Ga0070683_100285637 3300005329 Bacteria 1570
20 Ga0070683_100375282 3300005329 Unclassified 1355
21 Ga0070690_100001392 3300005330 Bacteria 12605
22 Ga0070690_100003483 3300005330 Bacteria 8610
23 Ga0070690_100018815 3300005330 Bacteria 4180
24 Ga0070690_100145969 3300005330 Bacteria 1610
25 Ga0070690_100448582 3300005330 Bacteria 956
26 Ga0070670_100028486 3300005331 Bacteria 4807
27 Ga0070670_100046953 3300005331 Bacteria 3715
28 Ga0070670_100059340 3300005331 Bacteria 3284
29 Ga0070670_100103130 3300005331 Bacteria 2457
30 Ga0070670_100151800 3300005331 Bacteria 2005
31 Ga0070670_100205984 3300005331 Bacteria 1710
32 Ga0070670_100269697 3300005331 Bacteria 1485
33 Ga0070677_10030637 3300005333 Bacteria 2049
34 Ga0068869_100000631 3300005334 Bacteria 19900
35 Ga0068869_100001258 3300005334 Bacteria 14962
36 Ga0068869_100008561 3300005334 Bacteria 6604
37 Ga0068869_100210289 3300005334 Bacteria 1537
38 Ga0068869_100274296 3300005334 Bacteria 1354
39 Ga0070666_10001286 3300005335 Bacteria 15184
40 Ga0070666_10013719 3300005335 Bacteria 5144
41 Ga0070680_100599651 3300005336 Unclassified 945
42 Ga0070682_100015068 3300005337 Bacteria 4476
43 Ga0070682_100405908 3300005337 Unclassified 1032
44 Ga0070682_100461479 3300005337 Bacteria 975
45 Ga0068868_100001544 3300005338 Bacteria 15719
46 Ga0068868_100002946 3300005338 Bacteria 11816
47 Ga0068868_100281599 3300005338 Bacteria 1407
48 Ga0068868_100479627 3300005338 Bacteria 1086
49 Ga0070660_100003674 3300005339 Bacteria 10596
50 Ga0070660_100027048 3300005339 Bacteria 4278
51 Ga0070660_100040566 3300005339 Bacteria 3543
52 Ga0070689_100000781 3300005340 Bacteria 19535
53 Ga0070689_100003108 3300005340 Bacteria 10962
54 Ga0070689_100005522 3300005340 Bacteria 8646
55 Ga0070689_100042402 3300005340 Bacteria 3494
56 Ga0070689_100081017 3300005340 Bacteria 2548
57 Ga0070691_10035517 3300005341 Bacteria 2347
58 Ga0070687_100009949 3300005343 Bacteria 4091
59 Ga0070687_100028147 3300005343 Bacteria 2723
60 Ga0070687_100265424 3300005343 Bacteria 1073
61 Ga0070661_100009592 3300005344 Bacteria 6705
62 Ga0070661_100032273 3300005344 Bacteria 3790
63 Ga0070661_100047425 3300005344 Bacteria 3144
64 Ga0070661_100068496 3300005344 Bacteria 2608
65 Ga0070661_100119601 3300005344 Bacteria 1972
66 Ga0070661_100184529 3300005344 Bacteria 1589
67 Ga0070661_100210364 3300005344 Bacteria 1489
68 Ga0070661_100676822 3300005344 Bacteria 839
69 Ga0070692_10010969 3300005345 Bacteria 4147
70 Ga0070692_10077601 3300005345 Bacteria 1782
71 Ga0070668_100001957 3300005347 Bacteria 15024
72 Ga0070668_100005291 3300005347 Bacteria 9575
73 Ga0070668_100065413 3300005347 Bacteria 2820
74 Ga0070668_100130810 3300005347 Bacteria 2014
75 Ga0070668_100427380 3300005347 Unclassified 1135
76 Ga0070669_100001265 3300005353 Bacteria 18326
77 Ga0070669_100078882 3300005353 Bacteria 2448
78 Ga0070669_100082815 3300005353 Bacteria 2392
79 Ga0070675_100018807 3300005354 Bacteria 5499
80 Ga0070675_100133188 3300005354 Bacteria 2120
81 Ga0070675_100182643 3300005354 Bacteria 1814
82 Ga0070675_100242682 3300005354 Bacteria 1574
83 Ga0070675_100510249 3300005354 Unclassified 1084
84 Ga0070675_100524603 3300005354 Bacteria 1069
85 Ga0070671_100012552 3300005355 Bacteria 6822
86 Ga0070671_100018529 3300005355 Bacteria 5655
87 Ga0070671_100023505 3300005355 Bacteria 5045
88 Ga0070671_100122018 3300005355 Bacteria 2193
89 Ga0070671_100126289 3300005355 Bacteria 2153
90 Ga0070671_100355246 3300005355 Bacteria 1251
91 Ga0070674_100071357 3300005356 Bacteria 2456
92 Ga0070674_100197260 3300005356 Bacteria 1552
93 Ga0070674_100229909 3300005356 Bacteria 1447
94 Ga0070674_100341933 3300005356 Bacteria 1206
95 Ga0070673_100012387 3300005364 Bacteria 5853
96 Ga0070673_100956517 3300005364 Unclassified 796
97 Ga0070688_100018907 3300005365 Bacteria 3984
98 Ga0070688_100049737 3300005365 Bacteria 2609
99 Ga0070688_100287089 3300005365 Bacteria 1184
100 Ga0070688_100808024 3300005365 Unclassified 734
101 Ga0070659_100000738 3300005366 Bacteria 23779
102 Ga0070659_100001702 3300005366 Bacteria 15803
103 Ga0070659_100068711 3300005366 Bacteria 2811
104 Ga0070659_100124765 3300005366 Bacteria 2089
105 Ga0070659_100498199 3300005366 Bacteria 1038
106 Ga0070659_100803268 3300005366 Unclassified 818
107 Ga0070667_100000537 3300005367 Bacteria 37823
108 Ga0070667_100001294 3300005367 Bacteria 22631
109 Ga0070667_100006565 3300005367 Bacteria 9669
110 Ga0070667_100188580 3300005367 Bacteria 1826
111 Ga0070709_10001554 3300005434 Bacteria 12384
112 Ga0070709_10023418 3300005434 Bacteria 3626
113 Ga0070709_10126273 3300005434 Bacteria 1741
114 Ga0070709_10727809 3300005434 Bacteria 774
115 Ga0070714_100011182 3300005435 Bacteria 7116
116 Ga0070714_100241805 3300005435 Bacteria 1666
117 Ga0070714_100571301 3300005435 Bacteria 1084
118 Ga0070713_100000093 3300005436 Bacteria 57164
119 Ga0070713_100022947 3300005436 Bacteria 4831
120 Ga0070713_100073880 3300005436 Bacteria 2887
121 Ga0070710_10002620 3300005437 Bacteria 8549
122 Ga0070710_10033776 3300005437 Bacteria 2780
123 Ga0070710_10164745 3300005437 Bacteria 1377
124 Ga0070701_10000512 3300005438 Bacteria 13327
125 Ga0070701_10004791 3300005438 Bacteria 5530
126 Ga0070701_10170488 3300005438 Bacteria 1267
127 Ga0070701_10269498 3300005438 Bacteria 1035
128 Ga0070711_100015980 3300005439 Bacteria 4758
129 Ga0070711_100043941 3300005439 Bacteria 3030
130 Ga0070705_100050350 3300005440 Unclassified 2423
131 Ga0070700_100000680 3300005441 Bacteria 16817
132 Ga0070700_100002925 3300005441 Bacteria 8758
133 Ga0070700_100061027 3300005441 Bacteria 2378
134 Ga0070700_100077251 3300005441 Bacteria 2140
135 Ga0070694_100060463 3300005444 Bacteria 2584
136 Ga0070694_100279301 3300005444 Bacteria 1273
137 Ga0070708_100000235 3300005445 Bacteria 41417
138 Ga0070708_100132795 3300005445 Bacteria 2305
139 Ga0070708_100234089 3300005445 Bacteria 1724
140 Ga0070663_100006029 3300005455 Bacteria 7256
141 Ga0070663_100007958 3300005455 Bacteria 6495
142 Ga0070663_100026121 3300005455 Bacteria 3951
143 Ga0070663_100089174 3300005455 Bacteria 2282
144 Ga0070663_100214383 3300005455 Bacteria 1509
145 Ga0070678_100000115 3300005456 Bacteria 31495
146 Ga0070678_100011176 3300005456 Bacteria 5528
147 Ga0070678_100205014 3300005456 Bacteria 1630
148 Ga0070678_100376935 3300005456 Bacteria 1226
149 Ga0070678_100424961 3300005456 Bacteria 1159
150 Ga0070662_100001899 3300005457 Bacteria 12825
151 Ga0070662_100075514 3300005457 Bacteria 2496
152 Ga0070662_100109767 3300005457 Bacteria 2100
153 Ga0070662_100398670 3300005457 Bacteria 1135
154 Ga0070662_100488439 3300005457 Bacteria 1026
155 Ga0070681_10159048 3300005458 Bacteria 2183
156 Ga0068867_100002089 3300005459 Bacteria 14000
157 Ga0068867_100002384 3300005459 Bacteria 13215
158 Ga0068867_100011849 3300005459 Bacteria 6159
159 Ga0068867_100017076 3300005459 Bacteria 5156
160 Ga0068867_100352997 3300005459 Bacteria 1228
161 Ga0068867_100423508 3300005459 Bacteria 1128
162 Ga0070685_10000280 3300005466 Bacteria 32659
163 Ga0070685_10004000 3300005466 Bacteria 7446
164 Ga0070706_100003250 3300005467 Bacteria 16066
165 Ga0070698_100038927 3300005471 Bacteria 4898
166 Ga0070698_100457357 3300005471 Bacteria 1212
167 Ga0070699_100021973 3300005518 Bacteria 5497
168 Ga0070679_100319854 3300005530 Bacteria 1501
169 Ga0070684_100127045 3300005535 Bacteria 2297
170 Ga0070684_101079181 3300005535 Unclassified 754
171 Ga0068853_100004240 3300005539 Bacteria 11071
172 Ga0068853_100024944 3300005539 Bacteria 5017
173 Ga0068853_100100019 3300005539 Bacteria 2562
174 Ga0068853_100172200 3300005539 Bacteria 1959
175 Ga0068853_100216891 3300005539 Bacteria 1746
176 Ga0068853_100305750 3300005539 Bacteria 1471
177 Ga0068853_100810180 3300005539 Bacteria 897
178 Ga0070672_100000912 3300005543 Bacteria 17711
179 Ga0070672_100025764 3300005543 Bacteria 4368
180 Ga0070672_100031779 3300005543 Bacteria 3977
181 Ga0070672_100150637 3300005543 Bacteria 1924
182 Ga0070686_100000973 3300005544 Bacteria 16512
183 Ga0070686_100052252 3300005544 Unclassified 2605
184 Ga0070686_100059674 3300005544 Bacteria 2458
185 Ga0070686_100207589 3300005544 Bacteria 1408
186 Ga0070695_100393133 3300005545 Bacteria 1049
187 Ga0070696_100014415 3300005546 Bacteria 5301
188 Ga0070696_100023215 3300005546 Bacteria 4215
189 Ga0070696_100192159 3300005546 Bacteria 1520
190 Ga0070693_100204317 3300005547 Bacteria 1285
191 Ga0070665_100010968 3300005548 Bacteria 9164
192 Ga0070665_100022112 3300005548 Bacteria 6397
193 Ga0070665_100258975 3300005548 Bacteria 1741
194 Ga0070665_100276442 3300005548 Unclassified 1681
195 Ga0070704_100013168 3300005549 Bacteria 5125
196 Ga0070704_100110206 3300005549 Bacteria 2093
197 Ga0070704_100176187 3300005549 Bacteria 1706
198 Ga0070704_100605632 3300005549 Bacteria 963
199 Ga0068855_100001097 3300005563 Bacteria 33624
200 Ga0068855_100023399 3300005563 Bacteria 7399
201 Ga0068855_100440046 3300005563 Bacteria 1424
202 Ga0070664_100003001 3300005564 Bacteria 13649
203 Ga0070664_100010765 3300005564 Bacteria 7416
204 Ga0070664_100028505 3300005564 Bacteria 4645
205 Ga0070664_100062529 3300005564 Bacteria 3174
206 Ga0070664_100151426 3300005564 Bacteria 2048
207 Ga0068857_100001800 3300005577 Bacteria 17243
208 Ga0068857_100121668 3300005577 Bacteria 2350
209 Ga0068857_100385254 3300005577 Bacteria 1302
210 Ga0068854_100023280 3300005578 Bacteria 4229
211 Ga0068854_100049838 3300005578 Bacteria 2994
212 Ga0068854_100587588 3300005578 Bacteria 949
213 Ga0068856_100003602 3300005614 Bacteria 15590
214 Ga0068856_100004835 3300005614 Bacteria 13357
215 Ga0068856_100035198 3300005614 Bacteria 4906
216 Ga0068856_100066958 3300005614 Bacteria 3549
217 Ga0068856_100139215 3300005614 Bacteria 2434
218 Ga0070702_100001461 3300005615 Bacteria 9684
219 Ga0070702_100002888 3300005615 Bacteria 7553
220 Ga0070702_100067716 3300005615 Bacteria 2099
221 Ga0070702_100068538 3300005615 Bacteria 2088
222 Ga0070702_100094931 3300005615 Bacteria 1817
223 Ga0070702_100231428 3300005615 Bacteria 1242
224 Ga0070702_100673200 3300005615 Unclassified 785
225 Ga0068852_100023710 3300005616 Bacteria 4945
226 Ga0068852_100125206 3300005616 Bacteria 2359
227 Ga0068852_100135834 3300005616 Bacteria 2270
228 Ga0068852_100322172 3300005616 Bacteria 1501
229 Ga0068859_100000548 3300005617 Bacteria 37251
230 Ga0068859_100003142 3300005617 Bacteria 16795
231 Ga0068859_100007100 3300005617 Bacteria 11368
232 Ga0068859_100024433 3300005617 Bacteria 6062
233 Ga0068859_100050112 3300005617 Bacteria 4194
234 Ga0068859_100217700 3300005617 Bacteria 1997
235 Ga0068859_101148230 3300005617 Bacteria 855
236 Ga0068864_100000759 3300005618 Bacteria 27157
237 Ga0068864_100004336 3300005618 Bacteria 11650
238 Ga0068864_100006912 3300005618 Bacteria 9305
239 Ga0068864_100013541 3300005618 Bacteria 6762
240 Ga0068864_100086324 3300005618 Bacteria 2760
241 Ga0068864_100125126 3300005618 Bacteria 2303
242 Ga0068864_100517332 3300005618 Bacteria 1150
243 Ga0068866_10000632 3300005718 Bacteria 15998
244 Ga0068866_10003761 3300005718 Bacteria 6218
245 Ga0068866_10032069 3300005718 Bacteria 2537
246 Ga0068866_10295129 3300005718 Bacteria 1010
247 Ga0068861_100001692 3300005719 Bacteria 14152
248 Ga0068861_100004985 3300005719 Bacteria 8946
249 Ga0068861_100005833 3300005719 Bacteria 8361
250 Ga0068861_100074737 3300005719 Unclassified 2636
251 Ga0068861_100077602 3300005719 Bacteria 2591
252 Ga0068861_100497862 3300005719 Bacteria 1101
253 Ga0068861_100581050 3300005719 Bacteria 1025
254 Ga0068851_10001169 3300005834 Bacteria 11384
255 Ga0068851_10004676 3300005834 Bacteria 6186
256 Ga0068851_10037191 3300005834 Bacteria 2440
257 Ga0068851_10055432 3300005834 Bacteria 2019
258 Ga0068851_10123578 3300005834 Bacteria 1393
259 Ga0068870_10010668 3300005840 Bacteria 4228
260 Ga0068870_10022434 3300005840 Bacteria 3102
261 Ga0068870_10089571 3300005840 Bacteria 1717
262 Ga0068870_10157105 3300005840 Bacteria 1345
263 Ga0068863_100001304 3300005841 Bacteria 24887
264 Ga0068863_100002477 3300005841 Bacteria 18351
265 Ga0068863_100003845 3300005841 Bacteria 14849
266 Ga0068863_100031144 3300005841 Bacteria 5093
267 Ga0068863_100069978 3300005841 Bacteria 3318
268 Ga0068863_100234342 3300005841 Bacteria 1771
269 Ga0068863_100472998 3300005841 Bacteria 1232
270 Ga0068858_100000652 3300005842 Bacteria 36211
271 Ga0068858_100006770 3300005842 Bacteria 11150
272 Ga0068858_100030416 3300005842 Bacteria 5013
273 Ga0068858_100038945 3300005842 Bacteria 4409
274 Ga0068858_100133876 3300005842 Bacteria 2325
275 Ga0068860_100004322 3300005843 Bacteria 14523
276 Ga0068860_100020811 3300005843 Bacteria 6356
277 Ga0068860_100040991 3300005843 Bacteria 4424
278 Ga0068860_100239423 3300005843 Bacteria 1765
279 Ga0068860_100358405 3300005843 Bacteria 1436
280 Ga0068860_100428198 3300005843 Bacteria 1313
281 Ga0068862_100002384 3300005844 Bacteria 16717
282 Ga0068862_100003241 3300005844 Bacteria 14082
283 Ga0068862_100042079 3300005844 Bacteria 3890
284 Ga0068862_100076173 3300005844 Unclassified 2903
285 Ga0068862_100271715 3300005844 Bacteria 1550
286 Ga0068862_100308854 3300005844 Bacteria 1457
287 Ga0068862_100618267 3300005844 Bacteria 1042
288 Ga0068862_100978901 3300005844 Unclassified 835
289 Ga0081540_1013533 3300005983 Bacteria 5298
290 Ga0081539_10027713 3300005985 Bacteria 3581
291 Ga0075363_100443198 3300006048 Bacteria 766
292 Ga0070715_10000885 3300006163 Bacteria 8298
293 Ga0070712_100005914 3300006175 Bacteria 7569
294 Ga0070712_100038639 3300006175 Bacteria 3263
295 Ga0075366_10029069 3300006195 Bacteria 3246
296 Ga0075366_10088002 3300006195 Bacteria 1860
297 Ga0097621_100002419 3300006237 Bacteria 12782
298 Ga0097621_100002825 3300006237 Bacteria 11902
299 Ga0097621_100020672 3300006237 Bacteria 5076
300 Ga0097621_100265158 3300006237 Bacteria 1508
301 Ga0075370_10173486 3300006353 Bacteria 1268
302 Ga0068871_100001447 3300006358 Bacteria 15879
303 Ga0068871_100005154 3300006358 Bacteria 9137
304 Ga0068871_100108277 3300006358 Bacteria 2335
305 Ga0068871_100183402 3300006358 Bacteria 1800
306 Ga0068871_100441896 3300006358 Bacteria 1164
307 Ga0075428_100002872 3300006844 Bacteria 18789
308 Ga0075428_100063847 3300006844 Bacteria 4032
309 Ga0075431_100001468 3300006847 Bacteria 21760
310 Ga0075434_100056642 3300006871 Bacteria 3896
311 Ga0075434_100159143 3300006871 Unclassified 2278
312 Ga0075434_100360468 3300006871 Bacteria 1475
313 Ga0075434_100578741 3300006871 Bacteria 1142
314 Ga0075429_100030854 3300006880 Bacteria 4658
315 Ga0075429_100093494 3300006880 Bacteria 2622
316 Ga0068865_100000305 3300006881 Bacteria 27101
317 Ga0068865_100006566 3300006881 Bacteria 7110
318 Ga0068865_100053296 3300006881 Bacteria 2806
319 Ga0068865_100085032 3300006881 Bacteria 2281
320 Ga0068865_100096792 3300006881 Bacteria 2153
321 Ga0097620_100000548 3300006931 Bacteria 37251
322 Ga0097620_100003142 3300006931 Bacteria 16795
323 Ga0097620_100007100 3300006931 Bacteria 11368
324 Ga0097620_100024433 3300006931 Bacteria 6062
325 Ga0097620_100050112 3300006931 Bacteria 4194
326 Ga0097620_100217712 3300006931 Bacteria 1997
327 Ga0097620_101148334 3300006931 Bacteria 855
328 Ga0105251_10008897 3300009011 Bacteria 6010
329 Ga0105240_10014974 3300009093 Bacteria 10566
330 Ga0105240_10108406 3300009093 Bacteria 3365
331 Ga0105240_10174218 3300009093 Bacteria 2545
332 Ga0111539_10003134 3300009094 Bacteria 21872
333 Ga0111539_10028863 3300009094 Bacteria 6766
334 Ga0111539_10166724 3300009094 Bacteria 2575
335 Ga0111539_10192785 3300009094 Bacteria 2377
336 Ga0111539_11200814 3300009094 Bacteria 881
337 Ga0105245_10008300 3300009098 Bacteria 9072
338 Ga0105245_10950510 3300009098 Bacteria 902
339 Ga0105247_10010870 3300009101 Bacteria 5499
340 Ga0105247_10042203 3300009101 Bacteria 2793
341 Ga0114129_10001566 3300009147 Bacteria 31036
342 Ga0114129_10103578 3300009147 Bacteria 3935
343 Ga0114129_10988474 3300009147 Bacteria 1060
344 Ga0114129_11331391 3300009147 Bacteria 889
345 Ga0105243_10004538 3300009148 Bacteria 10971
346 Ga0105241_10006534 3300009174 Bacteria 8593
347 Ga0105241_10371043 3300009174 Bacteria 1248
348 Ga0105242_10029601 3300009176 Bacteria 4368
349 Ga0105242_10079223 3300009176 Bacteria 2744
350 Ga0105242_10148426 3300009176 Bacteria 2042
351 Ga0105242_10688935 3300009176 Bacteria 998
352 Ga0105248_10009060 3300009177 Bacteria 10946
353 Ga0105248_10030473 3300009177 Bacteria 6023
354 Ga0105248_10034915 3300009177 Bacteria 5627
355 Ga0105248_10130909 3300009177 Bacteria 2830
356 Ga0105248_10131205 3300009177 Bacteria 2827
357 Ga0105248_10315236 3300009177 Bacteria 1762
358 Ga0105237_10204634 3300009545 Bacteria 1974
359 Ga0105237_10251426 3300009545 Bacteria 1770
360 Ga0105237_10512691 3300009545 Bacteria 1206
361 Ga0105237_11121596 3300009545 Bacteria 793
362 Ga0105238_10007180 3300009551 Bacteria 11142
363 Ga0105238_10071679 3300009551 Bacteria 3462
364 Ga0105249_10009105 3300009553 Bacteria 8683
365 Ga0105249_10092530 3300009553 Unclassified 2831
366 Ga0105249_10232227 3300009553 Bacteria 1820
367 Ga0105249_10300942 3300009553 Bacteria 1609
368 Ga0105249_11021939 3300009553 Unclassified 896
369 Ga0105239_10021898 3300010375 Bacteria 7046
370 Ga0105239_10058956 3300010375 Bacteria 4214
371 Ga0105239_10119122 3300010375 Bacteria 2930
372 Ga0105239_10535735 3300010375 Bacteria 1333
373 Ga0105246_10065155 3300011119 Bacteria 2547
374 Ga0105246_10752466 3300011119 Bacteria 860
375 Ga0157373_10005110 3300013100 Bacteria 9862
376 Ga0157373_10064475 3300013100 Bacteria 2593
377 Ga0157373_10269897 3300013100 Bacteria 1204
378 Ga0157371_10000330 3300013102 Bacteria 61144
379 Ga0157371_10132508 3300013102 Unclassified 1774
380 Ga0157371_10634718 3300013102 Bacteria 796
381 Ga0157370_10027517 3300013104 Bacteria 5606
382 Ga0157370_10063967 3300013104 Bacteria 3483
383 Ga0157369_10017713 3300013105 Bacteria 8000
384 Ga0157369_10161662 3300013105 Bacteria 2364
385 Ga0157369_10232934 3300013105 Bacteria 1925
386 Ga0157369_10366923 3300013105 Bacteria 1495
387 Ga0157369_10496390 3300013105 Bacteria 1263
388 Ga0157374_10000286 3300013296 Bacteria 46853
389 Ga0157374_10002810 3300013296 Bacteria 14607
390 Ga0157374_10040877 3300013296 Bacteria 4271
391 Ga0157374_10158128 3300013296 Bacteria 2206
392 Ga0157374_10236500 3300013296 Bacteria 1795
393 Ga0157374_11005309 3300013296 Bacteria 853
394 Ga0157378_10001140 3300013297 Bacteria 24155
395 Ga0157378_10056612 3300013297 Bacteria 3494
396 Ga0157378_10076042 3300013297 Bacteria 3024
397 Ga0157378_10079153 3300013297 Bacteria 2967
398 Ga0157378_10119157 3300013297 Bacteria 2431
399 Ga0157378_10123996 3300013297 Bacteria 2385
400 Ga0157378_10143688 3300013297 Bacteria 2218
401 Ga0163162_10003799 3300013306 Bacteria 14485
402 Ga0163162_10158951 3300013306 Bacteria 2381
403 Ga0163162_10161614 3300013306 Bacteria 2362
404 Ga0163162_10295960 3300013306 Bacteria 1750
405 Ga0163162_11007096 3300013306 Bacteria 942
406 Ga0163162_11186080 3300013306 Bacteria 866
407 Ga0163162_12018871 3300013306 Bacteria 661
408 Ga0157372_10018145 3300013307 Bacteria 7565
409 Ga0157372_10203107 3300013307 Bacteria 2296
410 Ga0157372_10247440 3300013307 Bacteria 2069
411 Ga0157372_10476525 3300013307 Bacteria 1455
412 Ga0157375_10029021 3300013308 Bacteria 5196
413 Ga0157375_10038446 3300013308 Bacteria 4595
414 Ga0157375_10061001 3300013308 Bacteria 3742
415 Ga0157375_10419192 3300013308 Bacteria 1505
416 Ga0157375_10872079 3300013308 Bacteria 1045
417 Ga0163163_10022213 3300014325 Bacteria 6003
418 Ga0163163_10035753 3300014325 Bacteria 4821
419 Ga0163163_10128168 3300014325 Bacteria 2576
420 Ga0163163_10357665 3300014325 Bacteria 1516
421 Ga0157380_10000449 3300014326 Bacteria 25167
422 Ga0157380_10040064 3300014326 Bacteria 3646
423 Ga0157380_10066986 3300014326 Bacteria 2890
424 Ga0157380_10231317 3300014326 Bacteria 1660
425 Ga0182008_10267819 3300014497 Bacteria 885
426 Ga0157377_10214265 3300014745 Bacteria 1230
427 Ga0157379_10020080 3300014968 Bacteria 5905
428 Ga0157379_10034811 3300014968 Bacteria 4491
429 Ga0157379_10373771 3300014968 Bacteria 1307
430 Ga0157379_11163853 3300014968 Unclassified 741
431 Ga0157376_10008963 3300014969 Bacteria 7245
432 Ga0157376_10136242 3300014969 Bacteria 2197
433 Ga0157376_11057459 3300014969 Bacteria 836
434 Ga0163161_10021490 3300017792 Bacteria 4534
435 Ga0163161_10067580 3300017792 Bacteria 2610
436 Ga0163161_10214259 3300017792 Unclassified 1489
437 Ga0206354_11167538 3300020081 Bacteria 1647
438 Ga0207697_10018755 3300025315 Bacteria 2835
439 Ga0207656_10004890 3300025321 Bacteria 4702
440 Ga0207656_10018064 3300025321 Bacteria 2770
441 Ga0207656_10173677 3300025321 Bacteria 1031
442 Ga0207656_10256049 3300025321 Bacteria 858
443 Ga0207656_10264257 3300025321 Bacteria 846
444 Ga0207713_1024027 3300025735 Bacteria 2851
445 Ga0207682_10001309 3300025893 Bacteria 11440
446 Ga0207692_10119800 3300025898 Bacteria 1472
447 Ga0207692_10148269 3300025898 Bacteria 1341
448 Ga0207642_10000855 3300025899 Bacteria 9475
449 Ga0207642_10149201 3300025899 Bacteria 1242
450 Ga0207710_10019811 3300025900 Bacteria 2872
451 Ga0207710_10261838 3300025900 Bacteria 867
452 Ga0207688_10000064 3300025901 Bacteria 38683
453 Ga0207680_10002662 3300025903 Bacteria 8352
454 Ga0207680_10008244 3300025903 Bacteria 5108
455 Ga0207680_10144850 3300025903 Bacteria 1578
456 Ga0207699_10022518 3300025906 Bacteria 3415
457 Ga0207699_10082855 3300025906 Bacteria 1993
458 Ga0207699_10106843 3300025906 Bacteria 1787
459 Ga0207699_10511103 3300025906 Bacteria 868
460 Ga0207645_10000517 3300025907 Bacteria 32075
461 Ga0207645_10004266 3300025907 Bacteria 10610
462 Ga0207645_10014722 3300025907 Bacteria 5222
463 Ga0207645_10270136 3300025907 Bacteria 1127
464 Ga0207645_10370344 3300025907 Bacteria 960
465 Ga0207643_10000593 3300025908 Bacteria 22972
466 Ga0207643_10034526 3300025908 Bacteria 2834
467 Ga0207643_10037936 3300025908 Bacteria 2705
468 Ga0207643_10061840 3300025908 Bacteria 2139
469 Ga0207643_10079348 3300025908 Bacteria 1900
470 Ga0207705_10065087 3300025909 Bacteria 2635
471 Ga0207705_10290055 3300025909 Bacteria 1254
472 Ga0207684_10020548 3300025910 Bacteria 5642
473 Ga0207654_10012461 3300025911 Bacteria 4357
474 Ga0207707_10001948 3300025912 Bacteria 18787
475 Ga0207707_10177929 3300025912 Bacteria 1858
476 Ga0207695_10006723 3300025913 Bacteria 14842
477 Ga0207695_10191046 3300025913 Bacteria 1965
478 Ga0207671_10139784 3300025914 Bacteria 1865
479 Ga0207671_10330991 3300025914 Bacteria 1206
480 Ga0207693_10003485 3300025915 Bacteria 13422
481 Ga0207693_10043597 3300025915 Bacteria 3528
482 Ga0207663_10013001 3300025916 Bacteria 4514
483 Ga0207660_10007884 3300025917 Bacteria 6892
484 Ga0207662_10004084 3300025918 Bacteria 7627
485 Ga0207662_10022451 3300025918 Bacteria 3619
486 Ga0207662_10046069 3300025918 Bacteria 2579
487 Ga0207657_10000745 3300025919 Bacteria 34547
488 Ga0207657_10000927 3300025919 Bacteria 31004
489 Ga0207657_10033548 3300025919 Bacteria 4626
490 Ga0207657_10061986 3300025919 Bacteria 3203
491 Ga0207649_10046725 3300025920 Bacteria 2661
492 Ga0207649_10063546 3300025920 Bacteria 2331
493 Ga0207649_10131544 3300025920 Bacteria 1700
494 Ga0207649_10235537 3300025920 Bacteria 1311
495 Ga0207652_10013940 3300025921 Bacteria 6508
496 Ga0207652_10169230 3300025921 Bacteria 1960
497 Ga0207652_10178783 3300025921 Bacteria 1906
498 Ga0207652_10218140 3300025921 Bacteria 1719
499 Ga0207681_10007743 3300025923 Bacteria 6580
500 Ga0207681_10083857 3300025923 Bacteria 2257
501 Ga0207681_10155468 3300025923 Bacteria 1718
502 Ga0207681_10725148 3300025923 Bacteria 827
503 Ga0207694_10016717 3300025924 Bacteria 5546
504 Ga0207650_10005701 3300025925 Bacteria 8500
505 Ga0207650_10012515 3300025925 Bacteria 5856
506 Ga0207650_10012972 3300025925 Bacteria 5761
507 Ga0207650_10038721 3300025925 Bacteria 3483
508 Ga0207650_10062656 3300025925 Bacteria 2779
509 Ga0207650_10204871 3300025925 Bacteria 1582
510 Ga0207650_10276376 3300025925 Bacteria 1366
511 Ga0207659_10008481 3300025926 Bacteria 6383
512 Ga0207659_10039126 3300025926 Bacteria 3304
513 Ga0207659_10039639 3300025926 Bacteria 3287
514 Ga0207659_10180953 3300025926 Bacteria 1670
515 Ga0207659_10304532 3300025926 Bacteria 1310
516 Ga0207659_10415873 3300025926 Bacteria 1127
517 Ga0207687_10000800 3300025927 Bacteria 21246
518 Ga0207687_10478042 3300025927 Bacteria 1037
519 Ga0207700_10000073 3300025928 Bacteria 61784
520 Ga0207700_10444260 3300025928 Bacteria 1142
521 Ga0207664_10015163 3300025929 Bacteria 5585
522 Ga0207644_10002067 3300025931 Bacteria 12998
523 Ga0207644_10014673 3300025931 Bacteria 5249
524 Ga0207644_10040602 3300025931 Bacteria 3289
525 Ga0207644_10048940 3300025931 Bacteria 3025
526 Ga0207644_10054154 3300025931 Bacteria 2888
527 Ga0207644_10195795 3300025931 Bacteria 1591
528 Ga0207644_10228680 3300025931 Bacteria 1477
529 Ga0207644_10771129 3300025931 Bacteria 804
530 Ga0207690_10001061 3300025932 Bacteria 17606
531 Ga0207690_10008488 3300025932 Bacteria 6095
532 Ga0207690_10128236 3300025932 Bacteria 1853
533 Ga0207690_10456793 3300025932 Unclassified 1027
534 Ga0207690_10469206 3300025932 Bacteria 1014
535 Ga0207690_10485170 3300025932 Bacteria 998
536 Ga0207706_10000023 3300025933 Bacteria 153979
537 Ga0207706_10000585 3300025933 Bacteria 38812
538 Ga0207706_10223969 3300025933 Bacteria 1646
539 Ga0207706_10239475 3300025933 Bacteria 1586
540 Ga0207706_10267134 3300025933 Bacteria 1493
541 Ga0207706_10962515 3300025933 Bacteria 719
542 Ga0207686_10002242 3300025934 Bacteria 10617
543 Ga0207686_10434218 3300025934 Bacteria 1007
544 Ga0207686_10623116 3300025934 Bacteria 851
545 Ga0207709_10005847 3300025935 Bacteria 6953
546 Ga0207670_10015865 3300025936 Bacteria 4511
547 Ga0207670_10021052 3300025936 Bacteria 4017
548 Ga0207670_10063507 3300025936 Bacteria 2527
549 Ga0207670_10081540 3300025936 Bacteria 2264
550 Ga0207669_10034323 3300025937 Bacteria 2873
551 Ga0207669_10722320 3300025937 Bacteria 820
552 Ga0207704_10001417 3300025938 Bacteria 10719
553 Ga0207704_10026988 3300025938 Bacteria 3159
554 Ga0207704_10050304 3300025938 Bacteria 2513
555 Ga0207704_10067624 3300025938 Bacteria 2249
556 Ga0207691_10000688 3300025940 Bacteria 33404
557 Ga0207691_10013470 3300025940 Bacteria 7824
558 Ga0207691_10014621 3300025940 Bacteria 7482
559 Ga0207691_10040386 3300025940 Bacteria 4311
560 Ga0207691_10043574 3300025940 Bacteria 4135
561 Ga0207691_10173810 3300025940 Bacteria 1885
562 Ga0207711_10000087 3300025941 Bacteria 98302
563 Ga0207711_10007347 3300025941 Bacteria 9222
564 Ga0207711_10022461 3300025941 Bacteria 5275
565 Ga0207711_10081565 3300025941 Bacteria 2827
566 Ga0207711_10233237 3300025941 Bacteria 1686
567 Ga0207689_10000069 3300025942 Bacteria 83053
568 Ga0207689_10000642 3300025942 Bacteria 33355
569 Ga0207689_10003820 3300025942 Bacteria 13729
570 Ga0207689_10027555 3300025942 Bacteria 4754
571 Ga0207661_10010000 3300025944 Bacteria 6816
572 Ga0207679_10013781 3300025945 Bacteria 5302
573 Ga0207679_10051343 3300025945 Bacteria 3018
574 Ga0207679_10067061 3300025945 Bacteria 2691
575 Ga0207679_10105109 3300025945 Bacteria 2217
576 Ga0207679_10151238 3300025945 Bacteria 1889
577 Ga0207679_10174401 3300025945 Bacteria 1773
578 Ga0207679_10485927 3300025945 Bacteria 1100
579 Ga0207679_10653644 3300025945 Bacteria 951
580 Ga0207667_10001383 3300025949 Bacteria 30431
581 Ga0207667_10008157 3300025949 Bacteria 12470
582 Ga0207667_10026225 3300025949 Bacteria 6369
583 Ga0207667_10299919 3300025949 Unclassified 1642
584 Ga0207667_10356438 3300025949 Bacteria 1492
585 Ga0207651_10007432 3300025960 Bacteria 5838
586 Ga0207651_10076905 3300025960 Bacteria 2387
587 Ga0207651_10080674 3300025960 Bacteria 2342
588 Ga0207712_10021014 3300025961 Bacteria 4280
589 Ga0207712_10208263 3300025961 Bacteria 1555
590 Ga0207668_10004330 3300025972 Bacteria 8333
591 Ga0207668_10013121 3300025972 Bacteria 5092
592 Ga0207668_10121321 3300025972 Bacteria 1980
593 Ga0207640_10093279 3300025981 Bacteria 2091
594 Ga0207640_10285338 3300025981 Bacteria 1299
595 Ga0207658_10025203 3300025986 Bacteria 4163
596 Ga0207658_10152481 3300025986 Bacteria 1884
597 Ga0207658_10247727 3300025986 Bacteria 1512
598 Ga0207677_10000700 3300026023 Bacteria 19901
599 Ga0207677_10007124 3300026023 Bacteria 6157
600 Ga0207677_10286087 3300026023 Bacteria 1355
601 Ga0207677_10360332 3300026023 Bacteria 1221
602 Ga0207677_10557167 3300026023 Bacteria 1000
603 Ga0207703_10000994 3300026035 Bacteria 27268
604 Ga0207703_10004909 3300026035 Bacteria 10868
605 Ga0207703_10005565 3300026035 Bacteria 10111
606 Ga0207703_10013743 3300026035 Bacteria 6311
607 Ga0207703_10018715 3300026035 Bacteria 5410
608 Ga0207639_10010939 3300026041 Bacteria 6292
609 Ga0207639_10014491 3300026041 Bacteria 5547
610 Ga0207639_10144669 3300026041 Bacteria 1985
611 Ga0207639_10210511 3300026041 Bacteria 1673
612 Ga0207639_10397560 3300026041 Bacteria 1241
613 Ga0207639_10514032 3300026041 Bacteria 1096
614 Ga0207678_10001787 3300026067 Bacteria 19688
615 Ga0207678_10012488 3300026067 Bacteria 7458
616 Ga0207678_10058005 3300026067 Bacteria 3332
617 Ga0207678_10132633 3300026067 Bacteria 2126
618 Ga0207678_10296284 3300026067 Bacteria 1390
619 Ga0207708_10000102 3300026075 Bacteria 64743
620 Ga0207708_10002194 3300026075 Bacteria 14414
621 Ga0207708_10014181 3300026075 Bacteria 5959
622 Ga0207708_10280486 3300026075 Unclassified 1350
623 Ga0207702_10004398 3300026078 Bacteria 12551
624 Ga0207702_10020136 3300026078 Bacteria 5527
625 Ga0207702_10085787 3300026078 Bacteria 2744
626 Ga0207641_10683779 3300026088 Bacteria 1009
627 Ga0207648_10000048 3300026089 Bacteria 109946
628 Ga0207648_10005941 3300026089 Bacteria 12211
629 Ga0207648_10006115 3300026089 Bacteria 12004
630 Ga0207648_10006307 3300026089 Bacteria 11795
631 Ga0207648_10040528 3300026089 Bacteria 4092
632 Ga0207676_10000140 3300026095 Bacteria 62993
633 Ga0207676_10014793 3300026095 Bacteria 5620
634 Ga0207676_10027398 3300026095 Bacteria 4244
635 Ga0207676_10119335 3300026095 Bacteria 2221
636 Ga0207676_10244230 3300026095 Bacteria 1612
637 Ga0207676_10603737 3300026095 Bacteria 1054
638 Ga0207674_10000429 3300026116 Bacteria 54858
639 Ga0207674_10002511 3300026116 Bacteria 23131
640 Ga0207674_10004730 3300026116 Bacteria 16322
641 Ga0207674_10115494 3300026116 Bacteria 2656
642 Ga0207674_10530958 3300026116 Bacteria 1137
643 Ga0207675_100000527 3300026118 Bacteria 37150
644 Ga0207675_100001991 3300026118 Bacteria 20375
645 Ga0207675_100005190 3300026118 Bacteria 12538
646 Ga0207675_100006094 3300026118 Bacteria 11473
647 Ga0207675_100006419 3300026118 Bacteria 11136
648 Ga0207675_100096997 3300026118 Bacteria 2776
649 Ga0207675_100127263 3300026118 Bacteria 2414
650 Ga0207675_100180959 3300026118 Bacteria 2018
651 Ga0207675_100333972 3300026118 Bacteria 1482
652 Ga0207683_10000258 3300026121 Bacteria 47224
653 Ga0207683_10007413 3300026121 Bacteria 9407
654 Ga0207683_10019835 3300026121 Bacteria 5743
655 Ga0207683_10048403 3300026121 Bacteria 3723
656 Ga0207683_10124070 3300026121 Bacteria 2320
657 Ga0207683_10585378 3300026121 Bacteria 1032
658 Ga0207683_10696537 3300026121 Bacteria 942
659 Ga0207698_10025921 3300026142 Bacteria 4140
660 Ga0207698_10027312 3300026142 Bacteria 4050
661 Ga0207698_10083504 3300026142 Bacteria 2585
662 Ga0207698_10176926 3300026142 Bacteria 1885
663 Ga0207698_10371191 3300026142 Bacteria 1358
664 Ga0207698_10474750 3300026142 Bacteria 1212
665 Ga0207698_10484567 3300026142 Bacteria 1200
666 Ga0207698_10972935 3300026142 Bacteria 858
667 Ga0210000_1007201 3300027462 Bacteria 1626
668 Ga0209971_1006278 3300027682 Bacteria 2813
669 Ga0209974_10026864 3300027876 Bacteria 1904
670 Ga0207428_10012525 3300027907 Bacteria 7446
671 Ga0207428_10013315 3300027907 Bacteria 7191
672 Ga0268266_10025724 3300028379 Bacteria 5008
673 Ga0268266_10106968 3300028379 Bacteria 2473
674 Ga0268266_10286865 3300028379 Bacteria 1532
675 Ga0268265_10015056 3300028380 Bacteria 5282
676 Ga0268265_10038563 3300028380 Bacteria 3515
677 Ga0268265_10106839 3300028380 Unclassified 2274
678 Ga0268265_10184640 3300028380 Bacteria 1795
679 Ga0268265_10453058 3300028380 Bacteria 1199
680 Ga0268265_10499085 3300028380 Bacteria 1146
681 Ga0268264_10000523 3300028381 Bacteria 48670
682 Ga0268264_10008062 3300028381 Bacteria 8760
683 Ga0268264_10017643 3300028381 Bacteria 5844
684 Ga0268264_10092267 3300028381 Bacteria 2613
685 Ga0268264_10113457 3300028381 Bacteria 2378
686 Ga0268264_10332787 3300028381 Bacteria 1440
687 Ga0268264_10843934 3300028381 Bacteria 917
688 Ga0307515_10026788 3300028794 Bacteria 9896
689 Ga0265329_10025516 3300031242 Bacteria 1955
690 Ga0307408_100000006 3300031548 Bacteria 472824
691 Ga0307408_100040552 3300031548 Bacteria 3297
692 Ga0307408_100195641 3300031548 Bacteria 1632
693 Ga0307408_100200318 3300031548 Bacteria 1615
694 Ga0265314_10060431 3300031711 Bacteria 2586
695 Ga0307405_10098914 3300031731 Unclassified 1951
696 Ga0307413_10000525 3300031824 Bacteria 12688
697 Ga0307413_10065374 3300031824 Bacteria 2264
698 Ga0307410_10013194 3300031852 Bacteria 4810
699 Ga0307406_10014179 3300031901 Bacteria 4581
700 Ga0307406_10094907 3300031901 Unclassified 2017
701 Ga0307407_10003999 3300031903 Bacteria 6168
702 Ga0307407_10006770 3300031903 Bacteria 5131
703 Ga0307407_10227855 3300031903 Bacteria 1264
704 Ga0307412_10047662 3300031911 Bacteria 2815
705 Ga0307409_100010145 3300031995 Bacteria 5836
706 Ga0307409_100016686 3300031995 Bacteria 4868
707 Ga0307409_100163097 3300031995 Bacteria 1952
708 Ga0307409_100324843 3300031995 Unclassified 1442
709 Ga0307416_100004232 3300032002 Bacteria 8616
710 Ga0307416_100014686 3300032002 Bacteria 5380
711 Ga0307416_100087493 3300032002 Bacteria 2660
712 Ga0307414_10012002 3300032004 Bacteria 5107
713 Ga0307414_10120681 3300032004 Bacteria 2015
714 Ga0307411_10002182 3300032005 Bacteria 8502
715 Ga0307411_10006514 3300032005 Bacteria 5850
716 Ga0307411_10016744 3300032005 Bacteria 4156
717 Ga0373934_0148616 3300035086 Unclassified 959
718 Ga0373940_0009372 3300035088 Bacteria 2275
719 Ga0373923_0077260 3300035111 Bacteria 1439
720 Ga0373936_0017734 3300035113 Bacteria 2743
721 Ga0373936_0108957 3300035113 Bacteria 1175
722 Ga0373939_0000089 3300035114 Bacteria 29155
723 Ga0373953_0016078 3300035117 Bacteria 2725
724 Ga0373954_0000495 3300035118 Bacteria 14814
725 Ga0373954_0046201 3300035118 Bacteria 2035
726 Ga0373956_0017278 3300035119 Bacteria 3039
727 Ga0373957_0010986 3300035120 Bacteria 3009
728 Ga0373960_0000853 3300035121 Bacteria 6448
729 Ga0373960_0077176 3300035121 Bacteria 1042
730 Ga0373943_0212706 3300035170 Bacteria 1074
731 Ga0373955_0002775 3300035172 Bacteria 7684
732 Ga0373955_0013970 3300035172 Bacteria 3898
733 Ga0373955_0030278 3300035172 Bacteria 2824
734 Ga0373955_0146636 3300035172 Bacteria 1387
735 Ga0373955_0219442 3300035172 Unclassified 1135
736 Ga0373924_0009262 3300035410 Bacteria 3606
737 Ga0373931_0001113 3300035691 Bacteria 11411
738 Ga0373931_0048919 3300035691 Bacteria 2243
739 Ga0373931_0068163 3300035691 Bacteria 1936
740 Ga0373935_0387188 3300035692 Bacteria 1002
741 Ga0373935_0414952 3300035692 Bacteria 968
742 Ga0373927_0323704 3300035695 Bacteria 1015
743 Ga0373933_0007482 3300035724 Bacteria 5963
744 Ga0373933_0177656 3300035724 Bacteria 1357
745 Ga0373933_0325194 3300035724 Bacteria 997
746 Ga0373947_0172210 3300035725 Bacteria 1405
747 Ga0373947_0176670 3300035725 Bacteria 1388
748 Ga0373937_0003673 3300036401 Bacteria 12956
749 Ga0373937_0059200 3300036401 Bacteria 3520
750 Ga0373937_0197746 3300036401 Bacteria 1889
751 Ga0373937_0209720 3300036401 Bacteria 1833
752 Ga0373937_0245343 3300036401 Bacteria 1688
753 Ga0373937_0282294 3300036401 Bacteria 1568
754 Ga0373937_0404930 3300036401 Bacteria 1294
755 Ga0373925_0032323 3300037068 Bacteria 3852
756 Ga0373925_0060497 3300037068 Bacteria 2844
757 Ga0373925_0557647 3300037068 Bacteria 942
758 Ga0395899_0094005 3300037312 Bacteria 2170
759 Ga0395900_0279153 3300037418 Bacteria 1663
760 Ga0395898_0128534 3300037466 Bacteria 2427
761 Ga0395898_0245420 3300037466 Bacteria 1708
762 Ga0395905_0101849 3300037471 Bacteria 2696
763 Ga0395905_0163713 3300037471 Bacteria 2090
764 Ga0395901_0215998 3300038443 Bacteria 2006
765 Ga0451797_0459451 3300041453 Bacteria 2691
766 Ga0451798_1011580 3300041458 Bacteria 1337
767 Ga0451802_1947593 3300041460 Bacteria 4569
768 Ga0451807_0129515 3300041486 Bacteria 6177
769 Ga0451807_1798842 3300041486 Bacteria 1381
770 Ga0451837_0939764 3300041494 Unclassified 2091
771 Ga0451855_1464634 3300041511 Bacteria 896
772 Ga0451853_0624379 3300041512 Bacteria 1125
773 Ga0439445_0017454 3300042004 Bacteria 1774
774 Ga0450913_006632 3300042117 Bacteria 854
775 Ga0450888_000605 3300042126 Bacteria 3392
776 Ga0450891_000309 3300042129 Bacteria 4999
777 Ga0450902_017625 3300042137 Bacteria 1168
778 Ga0450916_008109 3300042530 Bacteria 1273
779 Ga0450918_000034 3300042531 Bacteria 28207
780 Ga0451577_0099787 3300042876 Bacteria 2594
781 Ga0453684_0148943 3300044712 Bacteria 2784
782 Ga0453684_1057083 3300044712 Bacteria 860
783 Ga0451576_0021175 3300045051 Bacteria 7069
784 Ga0451576_0025168 3300045051 Bacteria 6416
785 Ga0466958_0154382 3300045836 Bacteria 1449
786 Ga0495638_0191523 3300046460 Bacteria 1160
787 Ga0495651_0332618 3300046462 Bacteria 1009
788 Ga0495580_0217320 3300046472 Bacteria 1314
789 Ga0495664_0056002 3300046477 Bacteria 2345
790 Ga0495664_0069842 3300046477 Bacteria 2097
791 Ga0495616_0001229 3300046513 Bacteria 18020
792 Ga0495621_0031615 3300046539 Bacteria 1817
793 Ga0495645_0018541 3300046543 Bacteria 5000
794 Ga0495625_0013181 3300046660 Bacteria 6658
795 Ga0495625_0146774 3300046660 Bacteria 1588
796 Ga0495623_0043132 3300046679 Bacteria 2871
797 Ga0495647_0130193 3300046681 Bacteria 1066
798 Ga0495674_0601374 3300047319 Unclassified 871
799 Ga0495675_0167218 3300047444 Bacteria 1352
800 Ga0495684_0433600 3300047471 Bacteria 916
801 Ga0496100_0026018 3300048903 Bacteria 3584
802 Ga0496100_0033781 3300048903 Bacteria 3203
803 Ga0496100_0471390 3300048903 Bacteria 965
804 Ga0496101_0015013 3300048904 Bacteria 5212
805 Ga0496101_0241640 3300048904 Bacteria 1405
806 Ga0496101_0282933 3300048904 Bacteria 1296
807 Ga0496102_0056849 3300048905 Bacteria 3570
808 Ga0496102_0058024 3300048905 Bacteria 3536
809 Ga0496103_0075656 3300048906 Bacteria 2112
810 Ga0496103_0107426 3300048906 Bacteria 1770
811 Ga0496104_0008001 3300048907 Bacteria 9374
812 Ga0496104_0026945 3300048907 Bacteria 5314
813 Ga0496104_0708550 3300048907 Bacteria 914
814 Ga0496105_0012713 3300048908 Bacteria 6667
815 Ga0496105_0107189 3300048908 Bacteria 2306
816 Ga0496106_0000852 3300048909 Bacteria 22131
817 Ga0496106_0081744 3300048909 Bacteria 2482
818 Ga0496107_0021694 3300048910 Bacteria 4538
819 Ga0496107_0067426 3300048910 Bacteria 2596
820 Ga0496108_0019587 3300048911 Bacteria 5558
821 Ga0496108_0266329 3300048911 Bacteria 1491
822 Ga0496108_0321395 3300048911 Bacteria 1349
823 Ga0496109_0003510 3300048912 Bacteria 13099
824 Ga0496109_0019713 3300048912 Bacteria 5950
825 Ga0496109_0264746 3300048912 Bacteria 1619
826 Ga0496109_0477369 3300048912 Bacteria 1177
827 Ga0496110_0028598 3300048913 Bacteria 4790
828 Ga0496110_0092598 3300048913 Bacteria 2705
829 Ga0496110_0160414 3300048913 Bacteria 2038
830 Ga0496112_0005376 3300048915 Bacteria 11066
831 Ga0496112_0154131 3300048915 Bacteria 2265
832 Ga0496113_0301136 3300048916 Bacteria 1284
833 Ga0496113_0489886 3300048916 Bacteria 987
834 Ga0496113_0550787 3300048916 Bacteria 925
835 Ga0496114_0003360 3300048917 Bacteria 12292
836 Ga0496114_0120452 3300048917 Bacteria 2256
837 Ga0496114_0187330 3300048917 Bacteria 1809
838 Ga0496114_0250926 3300048917 Bacteria 1557
839 Ga0496114_0627911 3300048917 Unclassified 946
840 Ga0496115_0047387 3300048918 Bacteria 3437
841 Ga0496123_0041478 3300048926 Bacteria 3190
842 Ga0496124_0042317 3300048927 Bacteria 3923
843 Ga0496125_0029856 3300048928 Bacteria 4889
844 Ga0501297_001234 3300049520 Bacteria 2338
845 Ga0501300_004485 3300049523 Bacteria 2069
846 Ga0501034_0000456 3300049571 Bacteria 67493
847 Ga0501036_0339697 3300049572 Bacteria 1254
848 Ga0501039_0374436 3300049575 Bacteria 1119
849 Ga0501068_0000960 3300049584 Bacteria 15139
850 Ga0501068_0454928 3300049584 Unclassified 828
851 Ga0501070_0225770 3300049586 Bacteria 1535
852 Ga0501072_0003561 3300049588 Bacteria 11719
853 Ga0501073_0001375 3300049589 Bacteria 17975
854 Ga0501074_0335658 3300049590 Bacteria 1073
855 Ga0501077_0190580 3300049593 Bacteria 1302
856 Ga0501222_000756 3300049662 Bacteria 4681
857 Ga0501227_071474 3300049665 Bacteria 901
858 Ga0501233_012729 3300049668 Bacteria 1694
859 Ga0501253_003033 3300049683 Bacteria 1968
860 Ga0501255_000806 3300049684 Bacteria 2304
861 Ga0501221_000517 3300049704 Bacteria 6105
862 Ga0501080_0001249 3300049742 Bacteria 21171
863 Ga0501080_0721341 3300049742 Bacteria 878
864 Ga0501083_0209491 3300049744 Bacteria 1271
865 Ga0501269_026290 3300049766 Bacteria 735
866 Ga0501044_0440135 3300049823 Bacteria 1211
867 nmdc:mga0k408_8363_c1 3300050493 Bacteria 5552
868 nmdc:mga07m45_139459_c1 3300050496 Bacteria 1404
869 nmdc:mga07m45_93_c1 3300050496 Bacteria 34685
870 nmdc:mga05p37_430_c1 3300050507 Bacteria 45408
871 nmdc:mga05p37_46494_c1 3300050507 Bacteria 5336
872 nmdc:mga09592_26270_c1 3300050508 Bacteria 4823
873 nmdc:mga09592_37127_c1 3300050508 Bacteria 4085
874 nmdc:mga06r32_1291_c1 3300050510 Bacteria 22555
875 nmdc:mga08y16_105543_c1 3300050511 Bacteria 2933
876 nmdc:mga08y16_1565_c1 3300050511 Bacteria 23071
877 nmdc:mga08y16_328556_c1 3300050511 Bacteria 1573
878 nmdc:mga08y16_51927_c1 3300050511 Bacteria 4290
879 nmdc:mga0n895_346972_c1 3300050512 Bacteria 1503
880 nmdc:mga0n895_459037_c1 3300050512 Bacteria 1286
881 nmdc:mga0n895_634708_c1 3300050512 Bacteria 1068
882 nmdc:mga0n895_911144_c1 3300050512 Bacteria 864
883 nmdc:mga0rr50_400513_c1 3300050513 Bacteria 1159
884 nmdc:mga0rr50_8013_c1 3300050513 Bacteria 6552
885 Ga0495601_0073833 3300053077 Bacteria 2182
886 Ga0495595_0182127 3300053084 Bacteria 1042
887 Ga0495619_0400538 3300053085 Bacteria 948
888 Ga0500644_0009902 3300053088 Unclassified 2564
889 Ga0500616_0011463 3300053153 Bacteria 5233
890 Ga0501084_0156004 3300054114 Bacteria 1925
891 Ga0501082_0044702 3300060353 Bacteria 3820
892 2511378008 2511231024 Bacteria 5835885
893 2643744152 2643221544 Bacteria 5886209
894 2765584525 2765235841 Bacteria 6137024
895 3000019495 3000017691 Bacteria 3772574
896 8054931277 8054929484 Bacteria 5599761
897 8056140807 8056137416 Bacteria 6147080
898 Ga0075434_100153127
899 JGI24743J22301_10012326
900 JGI24749J21850_1023695
901 JGI24034J26672_10048157
902 JGI24742J22300_10057369
903 rootH1_10003216
904 rootL2_10002048
905 Ga0065712_10006136
906 Ga0065715_10139235
907 Ga0065715_10446243
908 Ga0070658_10019632
909 Ga0070658_10218595
910 Ga0070658_10410322
911 Ga0070676_10000712
912 Ga0070676_10010963
913 Ga0070676_10082019
914 Ga0070676_10398702
915 Ga0070683_100010112
916 Ga0070683_100285637
917 Ga0070683_100375282
918 Ga0070690_100001392
919 Ga0070690_100003483
920 Ga0070690_100018815
921 Ga0070690_100145969
922 Ga0070690_100448582
923 Ga0070670_100028486
924 Ga0070670_100046953
925 Ga0070670_100059340
926 Ga0070670_100103130
927 Ga0070670_100151800
928 Ga0070670_100205984
929 Ga0070670_100269697
930 Ga0070677_10030637
931 Ga0068869_100000631
932 Ga0068869_100001258
933 Ga0068869_100008561
934 Ga0068869_100210289
935 Ga0068869_100274296
936 Ga0070666_10001286
937 Ga0070666_10013719
938 Ga0070680_100599651
939 Ga0070682_100015068
940 Ga0070682_100405908
941 Ga0070682_100461479
942 Ga0068868_100001544
943 Ga0068868_100002946
944 Ga0068868_100281599
945 Ga0068868_100479627
946 Ga0070660_100003674
947 Ga0070660_100027048
948 Ga0070660_100040566
949 Ga0070689_100000781
950 Ga0070689_100003108
951 Ga0070689_100005522
952 Ga0070689_100042402
953 Ga0070689_100081017
954 Ga0070691_10035517
955 Ga0070687_100009949
956 Ga0070687_100028147
957 Ga0070687_100265424
958 Ga0070661_100009592
959 Ga0070661_100032273
960 Ga0070661_100047425
961 Ga0070661_100068496
962 Ga0070661_100119601
963 Ga0070661_100184529
964 Ga0070661_100210364
965 Ga0070661_100676822
966 Ga0070692_10010969
967 Ga0070692_10077601
968 Ga0070668_100001957
969 Ga0070668_100005291
970 Ga0070668_100065413
971 Ga0070668_100130810
972 Ga0070668_100427380
973 Ga0070669_100001265
974 Ga0070669_100078882
975 Ga0070669_100082815
976 Ga0070675_100018807
977 Ga0070675_100133188
978 Ga0070675_100182643
979 Ga0070675_100242682
980 Ga0070675_100510249
981 Ga0070675_100524603
982 Ga0070671_100012552
983 Ga0070671_100018529
984 Ga0070671_100023505
985 Ga0070671_100122018
986 Ga0070671_100126289
987 Ga0070671_100355246
988 Ga0070674_100071357
989 Ga0070674_100197260
990 Ga0070674_100229909
991 Ga0070674_100341933
992 Ga0070673_100012387
993 Ga0070673_100956517
994 Ga0070688_100018907
995 Ga0070688_100049737
996 Ga0070688_100287089
997 Ga0070688_100808024
998 Ga0070659_100000738
999 Ga0070659_100001702
1000 Ga0070659_100068711
1001 Ga0070659_100124765
1002 Ga0070659_100498199
1003 Ga0070659_100803268
1004 Ga0070667_100000537
1005 Ga0070667_100001294
1006 Ga0070667_100006565
1007 Ga0070667_100188580
1008 Ga0070709_10001554
1009 Ga0070709_10023418
1010 Ga0070709_10126273
1011 Ga0070709_10727809
1012 Ga0070714_100011182
1013 Ga0070714_100241805
1014 Ga0070714_100571301
1015 Ga0070713_100000093
1016 Ga0070713_100022947
1017 Ga0070713_100073880
1018 Ga0070710_10002620
1019 Ga0070710_10033776
1020 Ga0070710_10164745
1021 Ga0070701_10000512
1022 Ga0070701_10004791
1023 Ga0070701_10170488
1024 Ga0070701_10269498
1025 Ga0070711_100015980
1026 Ga0070711_100043941
1027 Ga0070705_100050350
1028 Ga0070700_100000680
1029 Ga0070700_100002925
1030 Ga0070700_100061027
1031 Ga0070700_100077251
1032 Ga0070694_100060463
1033 Ga0070694_100279301
1034 Ga0070708_100000235
1035 Ga0070708_100132795
1036 Ga0070708_100234089
1037 Ga0070663_100006029
1038 Ga0070663_100007958
1039 Ga0070663_100026121
1040 Ga0070663_100089174
1041 Ga0070663_100214383
1042 Ga0070678_100000115
1043 Ga0070678_100011176
1044 Ga0070678_100205014
1045 Ga0070678_100376935
1046 Ga0070678_100424961
1047 Ga0070662_100001899
1048 Ga0070662_100075514
1049 Ga0070662_100109767
1050 Ga0070662_100398670
1051 Ga0070662_100488439
1052 Ga0070681_10159048
1053 Ga0068867_100002089
1054 Ga0068867_100002384
1055 Ga0068867_100011849
1056 Ga0068867_100017076
1057 Ga0068867_100352997
1058 Ga0068867_100423508
1059 Ga0070685_10000280
1060 Ga0070685_10004000
1061 Ga0070706_100003250
1062 Ga0070698_100038927
1063 Ga0070698_100457357
1064 Ga0070699_100021973
1065 Ga0070679_100319854
1066 Ga0070684_100127045
1067 Ga0070684_101079181
1068 Ga0068853_100004240
1069 Ga0068853_100024944
1070 Ga0068853_100100019
1071 Ga0068853_100172200
1072 Ga0068853_100216891
1073 Ga0068853_100305750
1074 Ga0068853_100810180
1075 Ga0070672_100000912
1076 Ga0070672_100025764
1077 Ga0070672_100031779
1078 Ga0070672_100150637
1079 Ga0070686_100000973
1080 Ga0070686_100052252
1081 Ga0070686_100059674
1082 Ga0070686_100207589
1083 Ga0070695_100393133
1084 Ga0070696_100014415
1085 Ga0070696_100023215
1086 Ga0070696_100192159
1087 Ga0070693_100204317
1088 Ga0070665_100010968
1089 Ga0070665_100022112
1090 Ga0070665_100258975
1091 Ga0070665_100276442
1092 Ga0070704_100013168
1093 Ga0070704_100110206
1094 Ga0070704_100176187
1095 Ga0070704_100605632
1096 Ga0068855_100001097
1097 Ga0068855_100023399
1098 Ga0068855_100440046
1099 Ga0070664_100003001
1100 Ga0070664_100010765
1101 Ga0070664_100028505
1102 Ga0070664_100062529
1103 Ga0070664_100151426
1104 Ga0068857_100001800
1105 Ga0068857_100121668
1106 Ga0068857_100385254
1107 Ga0068854_100023280
1108 Ga0068854_100049838
1109 Ga0068854_100587588
1110 Ga0068856_100003602
1111 Ga0068856_100004835
1112 Ga0068856_100035198
1113 Ga0068856_100066958
1114 Ga0068856_100139215
1115 Ga0070702_100001461
1116 Ga0070702_100002888
1117 Ga0070702_100067716
1118 Ga0070702_100068538
1119 Ga0070702_100094931
1120 Ga0070702_100231428
1121 Ga0070702_100673200
1122 Ga0068852_100023710
1123 Ga0068852_100125206
1124 Ga0068852_100135834
1125 Ga0068852_100322172
1126 Ga0068859_100000548
1127 Ga0068859_100003142
1128 Ga0068859_100007100
1129 Ga0068859_100024433
1130 Ga0068859_100050112
1131 Ga0068859_100217700
1132 Ga0068859_101148230
1133 Ga0068864_100000759
1134 Ga0068864_100004336
1135 Ga0068864_100006912
1136 Ga0068864_100013541
1137 Ga0068864_100086324
1138 Ga0068864_100125126
1139 Ga0068864_100517332
1140 Ga0068866_10000632
1141 Ga0068866_10003761
1142 Ga0068866_10032069
1143 Ga0068866_10295129
1144 Ga0068861_100001692
1145 Ga0068861_100004985
1146 Ga0068861_100005833
1147 Ga0068861_100074737
1148 Ga0068861_100077602
1149 Ga0068861_100497862
1150 Ga0068861_100581050
1151 Ga0068851_10001169
1152 Ga0068851_10004676
1153 Ga0068851_10037191
1154 Ga0068851_10055432
1155 Ga0068851_10123578
1156 Ga0068870_10010668
1157 Ga0068870_10022434
1158 Ga0068870_10089571
1159 Ga0068870_10157105
1160 Ga0068863_100001304
1161 Ga0068863_100002477
1162 Ga0068863_100003845
1163 Ga0068863_100031144
1164 Ga0068863_100069978
1165 Ga0068863_100234342
1166 Ga0068863_100472998
1167 Ga0068858_100000652
1168 Ga0068858_100006770
1169 Ga0068858_100030416
1170 Ga0068858_100038945
1171 Ga0068858_100133876
1172 Ga0068860_100004322
1173 Ga0068860_100020811
1174 Ga0068860_100040991
1175 Ga0068860_100239423
1176 Ga0068860_100358405
1177 Ga0068860_100428198
1178 Ga0068862_100002384
1179 Ga0068862_100003241
1180 Ga0068862_100042079
1181 Ga0068862_100076173
1182 Ga0068862_100271715
1183 Ga0068862_100308854
1184 Ga0068862_100618267
1185 Ga0068862_100978901
1186 Ga0081540_1013533
1187 Ga0081539_10027713
1188 Ga0075363_100443198
1189 Ga0070715_10000885
1190 Ga0070712_100005914
1191 Ga0070712_100038639
1192 Ga0075366_10029069
1193 Ga0075366_10088002
1194 Ga0097621_100002419
1195 Ga0097621_100002825
1196 Ga0097621_100020672
1197 Ga0097621_100265158
1198 Ga0075370_10173486
1199 Ga0068871_100001447
1200 Ga0068871_100005154
1201 Ga0068871_100108277
1202 Ga0068871_100183402
1203 Ga0068871_100441896
1204 Ga0075428_100002872
1205 Ga0075428_100063847
1206 Ga0075431_100001468
1207 Ga0075434_100056642
1208 Ga0075434_100159143
1209 Ga0075434_100360468
1210 Ga0075434_100578741
1211 Ga0075429_100030854
1212 Ga0075429_100093494
1213 Ga0068865_100000305
1214 Ga0068865_100006566
1215 Ga0068865_100053296
1216 Ga0068865_100085032
1217 Ga0068865_100096792
1218 Ga0097620_100000548
1219 Ga0097620_100003142
1220 Ga0097620_100007100
1221 Ga0097620_100024433
1222 Ga0097620_100050112
1223 Ga0097620_100217712
1224 Ga0097620_101148334
1225 Ga0105251_10008897
1226 Ga0105240_10014974
1227 Ga0105240_10108406
1228 Ga0105240_10174218
1229 Ga0111539_10003134
1230 Ga0111539_10028863
1231 Ga0111539_10166724
1232 Ga0111539_10192785
1233 Ga0111539_11200814
1234 Ga0105245_10008300
1235 Ga0105245_10950510
1236 Ga0105247_10010870
1237 Ga0105247_10042203
1238 Ga0114129_10001566
1239 Ga0114129_10103578
1240 Ga0114129_10988474
1241 Ga0114129_11331391
1242 Ga0105243_10004538
1243 Ga0105241_10006534
1244 Ga0105241_10371043
1245 Ga0105242_10029601
1246 Ga0105242_10079223
1247 Ga0105242_10148426
1248 Ga0105242_10688935
1249 Ga0105248_10009060
1250 Ga0105248_10030473
1251 Ga0105248_10034915
1252 Ga0105248_10130909
1253 Ga0105248_10131205
1254 Ga0105248_10315236
1255 Ga0105237_10204634
1256 Ga0105237_10251426
1257 Ga0105237_10512691
1258 Ga0105237_11121596
1259 Ga0105238_10007180
1260 Ga0105238_10071679
1261 Ga0105249_10009105
1262 Ga0105249_10092530
1263 Ga0105249_10232227
1264 Ga0105249_10300942
1265 Ga0105249_11021939
1266 Ga0105239_10021898
1267 Ga0105239_10058956
1268 Ga0105239_10119122
1269 Ga0105239_10535735
1270 Ga0105246_10065155
1271 Ga0105246_10752466
1272 Ga0157373_10005110
1273 Ga0157373_10064475
1274 Ga0157373_10269897
1275 Ga0157371_10000330
1276 Ga0157371_10132508
1277 Ga0157371_10634718
1278 Ga0157370_10027517
1279 Ga0157370_10063967
1280 Ga0157369_10017713
1281 Ga0157369_10161662
1282 Ga0157369_10232934
1283 Ga0157369_10366923
1284 Ga0157369_10496390
1285 Ga0157374_10000286
1286 Ga0157374_10002810
1287 Ga0157374_10040877
1288 Ga0157374_10158128
1289 Ga0157374_10236500
1290 Ga0157374_11005309
1291 Ga0157378_10001140
1292 Ga0157378_10056612
1293 Ga0157378_10076042
1294 Ga0157378_10079153
1295 Ga0157378_10119157
1296 Ga0157378_10123996
1297 Ga0157378_10143688
1298 Ga0163162_10003799
1299 Ga0163162_10158951
1300 Ga0163162_10161614
1301 Ga0163162_10295960
1302 Ga0163162_11007096
1303 Ga0163162_11186080
1304 Ga0163162_12018871
1305 Ga0157372_10018145
1306 Ga0157372_10203107
1307 Ga0157372_10247440
1308 Ga0157372_10476525
1309 Ga0157375_10029021
1310 Ga0157375_10038446
1311 Ga0157375_10061001
1312 Ga0157375_10419192
1313 Ga0157375_10872079
1314 Ga0163163_10022213
1315 Ga0163163_10035753
1316 Ga0163163_10128168
1317 Ga0163163_10357665
1318 Ga0157380_10000449
1319 Ga0157380_10040064
1320 Ga0157380_10066986
1321 Ga0157380_10231317
1322 Ga0182008_10267819
1323 Ga0157377_10214265
1324 Ga0157379_10020080
1325 Ga0157379_10034811
1326 Ga0157379_10373771
1327 Ga0157379_11163853
1328 Ga0157376_10008963
1329 Ga0157376_10136242
1330 Ga0157376_11057459
1331 Ga0163161_10021490
1332 Ga0163161_10067580
1333 Ga0163161_10214259
1334 Ga0206354_11167538
1335 Ga0207697_10018755
1336 Ga0207656_10004890
1337 Ga0207656_10018064
1338 Ga0207656_10173677
1339 Ga0207656_10256049
1340 Ga0207656_10264257
1341 Ga0207713_1024027
1342 Ga0207682_10001309
1343 Ga0207692_10119800
1344 Ga0207692_10148269
1345 Ga0207642_10000855
1346 Ga0207642_10149201
1347 Ga0207710_10019811
1348 Ga0207710_10261838
1349 Ga0207688_10000064
1350 Ga0207680_10002662
1351 Ga0207680_10008244
1352 Ga0207680_10144850
1353 Ga0207699_10022518
1354 Ga0207699_10082855
1355 Ga0207699_10106843
1356 Ga0207699_10511103
1357 Ga0207645_10000517
1358 Ga0207645_10004266
1359 Ga0207645_10014722
1360 Ga0207645_10270136
1361 Ga0207645_10370344
1362 Ga0207643_10000593
1363 Ga0207643_10034526
1364 Ga0207643_10037936
1365 Ga0207643_10061840
1366 Ga0207643_10079348
1367 Ga0207705_10065087
1368 Ga0207705_10290055
1369 Ga0207684_10020548
1370 Ga0207654_10012461
1371 Ga0207707_10001948
1372 Ga0207707_10177929
1373 Ga0207695_10006723
1374 Ga0207695_10191046
1375 Ga0207671_10139784
1376 Ga0207671_10330991
1377 Ga0207693_10003485
1378 Ga0207693_10043597
1379 Ga0207663_10013001
1380 Ga0207660_10007884
1381 Ga0207662_10004084
1382 Ga0207662_10022451
1383 Ga0207662_10046069
1384 Ga0207657_10000745
1385 Ga0207657_10000927
1386 Ga0207657_10033548
1387 Ga0207657_10061986
1388 Ga0207649_10046725
1389 Ga0207649_10063546
1390 Ga0207649_10131544
1391 Ga0207649_10235537
1392 Ga0207652_10013940
1393 Ga0207652_10169230
1394 Ga0207652_10178783
1395 Ga0207652_10218140
1396 Ga0207681_10007743
1397 Ga0207681_10083857
1398 Ga0207681_10155468
1399 Ga0207681_10725148
1400 Ga0207694_10016717
1401 Ga0207650_10005701
1402 Ga0207650_10012515
1403 Ga0207650_10012972
1404 Ga0207650_10038721
1405 Ga0207650_10062656
1406 Ga0207650_10204871
1407 Ga0207650_10276376
1408 Ga0207659_10008481
1409 Ga0207659_10039126
1410 Ga0207659_10039639
1411 Ga0207659_10180953
1412 Ga0207659_10304532
1413 Ga0207659_10415873
1414 Ga0207687_10000800
1415 Ga0207687_10478042
1416 Ga0207700_10000073
1417 Ga0207700_10444260
1418 Ga0207664_10015163
1419 Ga0207644_10002067
1420 Ga0207644_10014673
1421 Ga0207644_10040602
1422 Ga0207644_10048940
1423 Ga0207644_10054154
1424 Ga0207644_10195795
1425 Ga0207644_10228680
1426 Ga0207644_10771129
1427 Ga0207690_10001061
1428 Ga0207690_10008488
1429 Ga0207690_10128236
1430 Ga0207690_10456793
1431 Ga0207690_10469206
1432 Ga0207690_10485170
1433 Ga0207706_10000023
1434 Ga0207706_10000585
1435 Ga0207706_10223969
1436 Ga0207706_10239475
1437 Ga0207706_10267134
1438 Ga0207706_10962515
1439 Ga0207686_10002242
1440 Ga0207686_10434218
1441 Ga0207686_10623116
1442 Ga0207709_10005847
1443 Ga0207670_10015865
1444 Ga0207670_10021052
1445 Ga0207670_10063507
1446 Ga0207670_10081540
1447 Ga0207669_10034323
1448 Ga0207669_10722320
1449 Ga0207704_10001417
1450 Ga0207704_10026988
1451 Ga0207704_10050304
1452 Ga0207704_10067624
1453 Ga0207691_10000688
1454 Ga0207691_10013470
1455 Ga0207691_10014621
1456 Ga0207691_10040386
1457 Ga0207691_10043574
1458 Ga0207691_10173810
1459 Ga0207711_10000087
1460 Ga0207711_10007347
1461 Ga0207711_10022461
1462 Ga0207711_10081565
1463 Ga0207711_10233237
1464 Ga0207689_10000069
1465 Ga0207689_10000642
1466 Ga0207689_10003820
1467 Ga0207689_10027555
1468 Ga0207661_10010000
1469 Ga0207679_10013781
1470 Ga0207679_10051343
1471 Ga0207679_10067061
1472 Ga0207679_10105109
1473 Ga0207679_10151238
1474 Ga0207679_10174401
1475 Ga0207679_10485927
1476 Ga0207679_10653644
1477 Ga0207667_10001383
1478 Ga0207667_10008157
1479 Ga0207667_10026225
1480 Ga0207667_10299919
1481 Ga0207667_10356438
1482 Ga0207651_10007432
1483 Ga0207651_10076905
1484 Ga0207651_10080674
1485 Ga0207712_10021014
1486 Ga0207712_10208263
1487 Ga0207668_10004330
1488 Ga0207668_10013121
1489 Ga0207668_10121321
1490 Ga0207640_10093279
1491 Ga0207640_10285338
1492 Ga0207658_10025203
1493 Ga0207658_10152481
1494 Ga0207658_10247727
1495 Ga0207677_10000700
1496 Ga0207677_10007124
1497 Ga0207677_10286087
1498 Ga0207677_10360332
1499 Ga0207677_10557167
1500 Ga0207703_10000994
1501 Ga0207703_10004909
1502 Ga0207703_10005565
1503 Ga0207703_10013743
1504 Ga0207703_10018715
1505 Ga0207639_10010939
1506 Ga0207639_10014491
1507 Ga0207639_10144669
1508 Ga0207639_10210511
1509 Ga0207639_10397560
1510 Ga0207639_10514032
1511 Ga0207678_10001787
1512 Ga0207678_10012488
1513 Ga0207678_10058005
1514 Ga0207678_10132633
1515 Ga0207678_10296284
1516 Ga0207708_10000102
1517 Ga0207708_10002194
1518 Ga0207708_10014181
1519 Ga0207708_10280486
1520 Ga0207702_10004398
1521 Ga0207702_10020136
1522 Ga0207702_10085787
1523 Ga0207641_10683779
1524 Ga0207648_10000048
1525 Ga0207648_10005941
1526 Ga0207648_10006115
1527 Ga0207648_10006307
1528 Ga0207648_10040528
1529 Ga0207676_10000140
1530 Ga0207676_10014793
1531 Ga0207676_10027398
1532 Ga0207676_10119335
1533 Ga0207676_10244230
1534 Ga0207676_10603737
1535 Ga0207674_10000429
1536 Ga0207674_10002511
1537 Ga0207674_10004730
1538 Ga0207674_10115494
1539 Ga0207674_10530958
1540 Ga0207675_100000527
1541 Ga0207675_100001991
1542 Ga0207675_100005190
1543 Ga0207675_100006094
1544 Ga0207675_100006419
1545 Ga0207675_100096997
1546 Ga0207675_100127263
1547 Ga0207675_100180959
1548 Ga0207675_100333972
1549 Ga0207683_10000258
1550 Ga0207683_10007413
1551 Ga0207683_10019835
1552 Ga0207683_10048403
1553 Ga0207683_10124070
1554 Ga0207683_10585378
1555 Ga0207683_10696537
1556 Ga0207698_10025921
1557 Ga0207698_10027312
1558 Ga0207698_10083504
1559 Ga0207698_10176926
1560 Ga0207698_10371191
1561 Ga0207698_10474750
1562 Ga0207698_10484567
1563 Ga0207698_10972935
1564 Ga0210000_1007201
1565 Ga0209971_1006278
1566 Ga0209974_10026864
1567 Ga0207428_10012525
1568 Ga0207428_10013315
1569 Ga0268266_10025724
1570 Ga0268266_10106968
1571 Ga0268266_10286865
1572 Ga0268265_10015056
1573 Ga0268265_10038563
1574 Ga0268265_10106839
1575 Ga0268265_10184640
1576 Ga0268265_10453058
1577 Ga0268265_10499085
1578 Ga0268264_10000523
1579 Ga0268264_10008062
1580 Ga0268264_10017643
1581 Ga0268264_10092267
1582 Ga0268264_10113457
1583 Ga0268264_10332787
1584 Ga0268264_10843934
1585 Ga0307515_10026788
1586 Ga0265329_10025516
1587 Ga0307408_100000006
1588 Ga0307408_100040552
1589 Ga0307408_100195641
1590 Ga0307408_100200318
1591 Ga0265314_10060431
1592 Ga0307405_10098914
1593 Ga0307413_10000525
1594 Ga0307413_10065374
1595 Ga0307410_10013194
1596 Ga0307406_10014179
1597 Ga0307406_10094907
1598 Ga0307407_10003999
1599 Ga0307407_10006770
1600 Ga0307407_10227855
1601 Ga0307412_10047662
1602 Ga0307409_100010145
1603 Ga0307409_100016686
1604 Ga0307409_100163097
1605 Ga0307409_100324843
1606 Ga0307416_100004232
1607 Ga0307416_100014686
1608 Ga0307416_100087493
1609 Ga0307414_10012002
1610 Ga0307414_10120681
1611 Ga0307411_10002182
1612 Ga0307411_10006514
1613 Ga0307411_10016744
1614 Ga0373934_0148616
1615 Ga0373940_0009372
1616 Ga0373923_0077260
1617 Ga0373936_0017734
1618 Ga0373936_0108957
1619 Ga0373939_0000089
1620 Ga0373953_0016078
1621 Ga0373954_0000495
1622 Ga0373954_0046201
1623 Ga0373956_0017278
1624 Ga0373957_0010986
1625 Ga0373960_0000853
1626 Ga0373960_0077176
1627 Ga0373943_0212706
1628 Ga0373955_0002775
1629 Ga0373955_0013970
1630 Ga0373955_0030278
1631 Ga0373955_0146636
1632 Ga0373955_0219442
1633 Ga0373924_0009262
1634 Ga0373931_0001113
1635 Ga0373931_0048919
1636 Ga0373931_0068163
1637 Ga0373935_0387188
1638 Ga0373935_0414952
1639 Ga0373927_0323704
1640 Ga0373933_0007482
1641 Ga0373933_0177656
1642 Ga0373933_0325194
1643 Ga0373947_0172210
1644 Ga0373947_0176670
1645 Ga0373937_0003673
1646 Ga0373937_0059200
1647 Ga0373937_0197746
1648 Ga0373937_0209720
1649 Ga0373937_0245343
1650 Ga0373937_0282294
1651 Ga0373937_0404930
1652 Ga0373925_0032323
1653 Ga0373925_0060497
1654 Ga0373925_0557647
1655 Ga0395899_0094005
1656 Ga0395900_0279153
1657 Ga0395898_0128534
1658 Ga0395898_0245420
1659 Ga0395905_0101849
1660 Ga0395905_0163713
1661 Ga0395901_0215998
1662 Ga0451797_0459451
1663 Ga0451798_1011580
1664 Ga0451802_1947593
1665 Ga0451807_0129515
1666 Ga0451807_1798842
1667 Ga0451837_0939764
1668 Ga0451855_1464634
1669 Ga0451853_0624379
1670 Ga0439445_0017454
1671 Ga0450913_006632
1672 Ga0450888_000605
1673 Ga0450891_000309
1674 Ga0450902_017625
1675 Ga0450916_008109
1676 Ga0450918_000034
1677 Ga0451577_0099787
1678 Ga0453684_0148943
1679 Ga0453684_1057083
1680 Ga0451576_0021175
1681 Ga0451576_0025168
1682 Ga0466958_0154382
1683 Ga0495638_0191523
1684 Ga0495651_0332618
1685 Ga0495580_0217320
1686 Ga0495664_0056002
1687 Ga0495664_0069842
1688 Ga0495616_0001229
1689 Ga0495621_0031615
1690 Ga0495645_0018541
1691 Ga0495625_0013181
1692 Ga0495625_0146774
1693 Ga0495623_0043132
1694 Ga0495647_0130193
1695 Ga0495674_0601374
1696 Ga0495675_0167218
1697 Ga0495684_0433600
1698 Ga0496100_0026018
1699 Ga0496100_0033781
1700 Ga0496100_0471390
1701 Ga0496101_0015013
1702 Ga0496101_0241640
1703 Ga0496101_0282933
1704 Ga0496102_0056849
1705 Ga0496102_0058024
1706 Ga0496103_0075656
1707 Ga0496103_0107426
1708 Ga0496104_0008001
1709 Ga0496104_0026945
1710 Ga0496104_0708550
1711 Ga0496105_0012713
1712 Ga0496105_0107189
1713 Ga0496106_0000852
1714 Ga0496106_0081744
1715 Ga0496107_0021694
1716 Ga0496107_0067426
1717 Ga0496108_0019587
1718 Ga0496108_0266329
1719 Ga0496108_0321395
1720 Ga0496109_0003510
1721 Ga0496109_0019713
1722 Ga0496109_0264746
1723 Ga0496109_0477369
1724 Ga0496110_0028598
1725 Ga0496110_0092598
1726 Ga0496110_0160414
1727 Ga0496112_0005376
1728 Ga0496112_0154131
1729 Ga0496113_0301136
1730 Ga0496113_0489886
1731 Ga0496113_0550787
1732 Ga0496114_0003360
1733 Ga0496114_0120452
1734 Ga0496114_0187330
1735 Ga0496114_0250926
1736 Ga0496114_0627911
1737 Ga0496115_0047387
1738 Ga0496123_0041478
1739 Ga0496124_0042317
1740 Ga0496125_0029856
1741 Ga0501297_001234
1742 Ga0501300_004485
1743 Ga0501034_0000456
1744 Ga0501036_0339697
1745 Ga0501039_0374436
1746 Ga0501068_0000960
1747 Ga0501068_0454928
1748 Ga0501070_0225770
1749 Ga0501072_0003561
1750 Ga0501073_0001375
1751 Ga0501074_0335658
1752 Ga0501077_0190580
1753 Ga0501222_000756
1754 Ga0501227_071474
1755 Ga0501233_012729
1756 Ga0501253_003033
1757 Ga0501255_000806
1758 Ga0501221_000517
1759 Ga0501080_0001249
1760 Ga0501080_0721341
1761 Ga0501083_0209491
1762 Ga0501269_026290
1763 Ga0501044_0440135
1764 nmdc:mga0k408_8363_c1
1765 nmdc:mga07m45_139459_c1
1766 nmdc:mga07m45_93_c1
1767 nmdc:mga05p37_430_c1
1768 nmdc:mga05p37_46494_c1
1769 nmdc:mga09592_26270_c1
1770 nmdc:mga09592_37127_c1
1771 nmdc:mga06r32_1291_c1
1772 nmdc:mga08y16_105543_c1
1773 nmdc:mga08y16_1565_c1
1774 nmdc:mga08y16_328556_c1
1775 nmdc:mga08y16_51927_c1
1776 nmdc:mga0n895_346972_c1
1777 nmdc:mga0n895_459037_c1
1778 nmdc:mga0n895_634708_c1
1779 nmdc:mga0n895_911144_c1
1780 nmdc:mga0rr50_400513_c1
1781 nmdc:mga0rr50_8013_c1
1782 Ga0495601_0073833
1783 Ga0495595_0182127
1784 Ga0495619_0400538
1785 Ga0500644_0009902
1786 Ga0500616_0011463
1787 Ga0501084_0156004
1788 Ga0501082_0044702
1789 2511378008
1790 2643744152
1791 2765584525
1792 3000019495
1793 8054931277
1794 8056140807

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13410

GST_C_2

Glutathione S-transferase, C-terminal domain

142

207

0.95

PF02798

GST_N

Glutathione S-transferase, N-terminal domain

21

96

0.93

PF13409

GST_N_2

Glutathione S-transferase, N-terminal domain

30

97

0.92

PF13417

GST_N_3

Glutathione S-transferase, N-terminal domain

25

103

0.88

PF00043

GST_C

Glutathione S-transferase, C-terminal domain

126

212

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
3m3m-assembly1.cif.gz_A crystal structure of glutathione s-transferase from pseudomonas fluorescens [pf-5] 0.9471 2 196
3m8n-assembly2.cif.gz_D crystal structure of a possible gutathione s-tranferase from rhodopseudomonas palustris 0.9372 4 198
3m8n-assembly2.cif.gz_C crystal structure of a possible gutathione s-tranferase from rhodopseudomonas palustris 0.9366 2 198
3m8n-assembly1.cif.gz_A crystal structure of a possible gutathione s-tranferase from rhodopseudomonas palustris 0.9363 2 198
4f0c-assembly1.cif.gz_A-2 crystal structure of the glutathione transferase ure2p5 from phanerochaete chrysosporium 0.9359 1 194
ID Description Score Start End Superfamily
af_Q54JU2_4_83_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9708 4 81 3.40.30.10
4pxoB01 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9641 7 75 3.40.30.10
af_Q9VHD2_18_96_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9639 7 80 3.40.30.10
af_B8A514_42_123_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9584 2 77 3.40.30.10
4yh2C01 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9581 4 79 3.40.30.10
ID Description Score Start End GO Terms
AF-A0A536ZHK8-F1-model_v4 Glutathione S-transferase 0.9943 1 208 GO:0016740
AF-A0A537C7K6-F1-model_v4 Glutathione S-transferase family protein 0.9887 1 211 GO:0016740
AF-A0A2Z2NWW5-F1-model_v4 Glutathione S-transferase GST-4.5 (EC 2.5.1.18) 0.9818 21 207 GO:0004364
AF-A0A3N5HRF6-F1-model_v4 Glutathione S-transferase 0.9812 1 175 GO:0016740
AF-A0A3C1AKK6-F1-model_v4 deleted 0.9802 1 203

Map