F485046
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 897 | 671 | 1795 | 257 |
Family's Representative Sequence
| Representative Sequence | 3300021327|Ga0214543_1000003|Ga0214543_1000003458 |
| Length | 265 |
| Sequence | MAEEACSGWFGIWESNFNWVVDPSYVKCHIDVMCGRFALTATPEELMGLFGLLEADDFPARFNIAPTQPIIVIVAADRAEPGSNLPERKALLVRWGFTPGWVKDPRKFPLLINARAETAVGKAAFRAAMRHRRIVVPASGFYEWRRPAKGGGEPSQAHVVAFAGLMETWSSADGSEVDTAAILTTDANRVVRHIHDRMPVVIEPEDFARWLDCRTQEPRDVTDLMVPAAEDYFEAIPISDKVNKVTNTGPEIQDEVAPDGQMSLF |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300021327 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 | Metagenome | Nodule |
| 2 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 3 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 4 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 5 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 6 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 7 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 8 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 9 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 10 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 11 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 12 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 13 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 14 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 15 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 16 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 17 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 18 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 19 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 20 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 21 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 22 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 23 | 3300003856 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz | Metagenome | Rhizosphere |
| 24 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 25 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 26 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 29 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 30 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 31 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 32 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 33 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 34 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 35 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 36 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 37 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 38 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 39 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 40 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 41 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 42 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 43 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 44 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 45 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 46 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 47 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 48 | 3300009763 | Root nodule microbial communities of legume samples collected from Mexico - Siratro Mexico nodule mix | Metagenome | Nodule |
| 49 | 3300009765 | Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule | Metagenome | Nodule |
| 50 | 3300009766 | Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule | Metagenome | Nodule |
| 51 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 52 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 53 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 54 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 55 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 56 | 3300013249 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 | Metagenome | Rhizosphere |
| 57 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 58 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 59 | 3300015690 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 | Metagenome | Rhizosphere |
| 60 | 3300021320 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 | Metagenome | Nodule |
| 61 | 3300021321 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 | Metagenome | Nodule |
| 62 | 3300022739 | Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules | Metagenome | Nodule |
| 63 | 3300022740 | Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules | Metagenome | Nodule |
| 64 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 65 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 66 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 67 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 68 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 69 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 70 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 71 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 72 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 73 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 74 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 75 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 76 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 77 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 78 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 79 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 80 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 81 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 82 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 83 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 84 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 85 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 91 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 93 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 95 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 96 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 97 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 98 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 99 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 100 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 101 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 102 | 3300031967 | Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules | Metagenome | Nodule |
| 103 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 104 | 3300033430 | Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules | Metagenome | Nodule |
| 105 | 3300033464 | Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules | Metagenome | Nodule |
| 106 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 107 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 108 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 109 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 110 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 111 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 112 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 113 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 114 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 115 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 116 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 117 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 118 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 119 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 120 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 121 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 122 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 123 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 124 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 125 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 126 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 127 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 128 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 130 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 158 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 159 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 160 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 161 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 162 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 163 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 164 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 165 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 166 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 167 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 168 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 169 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 170 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 171 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 172 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 173 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 174 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 175 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 176 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 177 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 179 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 180 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 181 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 182 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 183 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 184 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 185 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 186 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 187 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 188 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 189 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 190 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 191 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 192 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 193 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 194 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 195 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 196 | 3300053105 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere | Metagenome | Endosphere |
| 197 | 3300053107 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere | Metagenome | Endosphere |
| 198 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 199 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 200 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 201 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 202 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 203 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 204 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 205 | 3300053137 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere | Metagenome | Endosphere |
| 206 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 207 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 208 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 209 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 210 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 211 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 212 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 213 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 214 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 215 | 2508501122 | Ensifer yinggardensis WSM1721 | Isolate | Nodule |
| 216 | 2509276019 | Ensifer aridi TW10 | Isolate | Nodule |
| 217 | 2509276021 | Rhizobium leguminosarum bv. trifolii WSM597 | Isolate | Nodule |
| 218 | 2509276033 | Rhizobium leguminosarum bv. trifolii WSM2012 | Isolate | Nodule |
| 219 | 2510065019 | Rhizobium leguminosarum bv. trifolii WSM1689 | Isolate | Nodule |
| 220 | 2510065057 | Sinorhizobium meliloti WSM1022 | Isolate | Nodule |
| 221 | 2510917022 | Rhizobium sp. AP16 | Isolate | Rhizosphere |
| 222 | 2510917028 | Rhizobium sp. CF122 | Isolate | Rhizosphere |
| 223 | 2510917030 | Rhizobium sp. CF142 | Isolate | Rhizosphere |
| 224 | 2511231052 | Sinorhizobium meliloti AK58 | Isolate | Nodule |
| 225 | 2512047086 | Sinorhizobium arboris LMG 14919 | Isolate | Nodule |
| 226 | 2512875026 | Sinorhizobium medicae WSM1115 | Isolate | Nodule |
| 227 | 2513237085 | Rhizobium leguminosarum bv. viciae UPM1137 | Isolate | Nodule |
| 228 | 2513237086 | Sinorhizobium meliloti MVII-I | Isolate | Nodule |
| 229 | 2513237088 | Rhizobium mesoamericanum STM6155 | Isolate | Nodule |
| 230 | 2513237089 | Sinorhizobium medicae DI28 | Isolate | Nodule |
| 231 | 2513237091 | Sinorhizobium meliloti RRI128 | Isolate | Nodule |
| 232 | 2513237093 | Rhizobium leguminosarum bv. phaseoli FA23 | Isolate | Nodule |
| 233 | 2513237103 | Rhizobium leguminosarum bv. viciae VF39 | Isolate | Nodule |
| 234 | 2513237138 | Rhizobium favelukesii OR191 | Isolate | Nodule |
| 235 | 2513237140 | Sinorhizobium meliloti GVPV12 | Isolate | Nodule |
| 236 | 2513237143 | Sinorhizobium meliloti Mlalz-1 | Isolate | Nodule |
| 237 | 2513237156 | Sinorhizobium medicae WSM1369 | Isolate | Nodule |
| 238 | 2513237159 | Rhizobium giardinii bv. giardinii H152 | Isolate | Nodule |
| 239 | 2513237160 | Sinorhizobium medicae WSM244 | Isolate | Nodule |
| 240 | 2515154107 | Sinorhizobium meliloti 4H41 | Isolate | Nodule |
| 241 | 2515154134 | Rhizobium gallicum bv. gallicum R602sp | Isolate | Nodule |
| 242 | 2516143018 | Ensifer sp. BR816 | Isolate | Nodule |
| 243 | 2516653046 | Sinorhizobium meliloti BO21CC | Isolate | Nodule |
| 244 | 2516653085 | Rhizobium leguminosarum bv. phaseoli 4292 | Isolate | Nodule |
| 245 | 2517287029 | Rhizobium leguminosarum bv. trifolii SRDI565 | Isolate | Nodule |
| 246 | 2517487022 | Sinorhizobium medicae WSM4191 | Isolate | Nodule |
| 247 | 2524023207 | Ensifer sp. USDA 6670 | Isolate | Nodule |
| 248 | 2524023209 | Rhizobium leucaenae USDA 9039 | Isolate | Nodule |
| 249 | 2534681796 | Rhizobium grahamii CCGE 502 | Isolate | Nodule |
| 250 | 2537561587 | Agrobacterium tumefaciens Cherry 2E-2-2 | Isolate | Rhizosphere |
| 251 | 2551306084 | Sinorhizobium meliloti 5A14 | Isolate | Nodule |
| 252 | 2551306085 | Sinorhizobium meliloti AE608H | Isolate | Nodule |
| 253 | 2551306086 | Sinorhizobium meliloti AK11 | Isolate | Nodule |
| 254 | 2551306087 | Sinorhizobium meliloti A0643DD | Isolate | Nodule |
| 255 | 2551306089 | Sinorhizobium meliloti 1A42 | Isolate | Nodule |
| 256 | 2551306090 | Sinorhizobium meliloti A0641M | Isolate | Nodule |
| 257 | 2551306091 | Sinorhizobium meliloti C0431A | Isolate | Nodule |
| 258 | 2551306092 | Sinorhizobium meliloti AK75 | Isolate | Nodule |
| 259 | 2551306093 | Sinorhizobium meliloti C0438LL | Isolate | Nodule |
| 260 | 2554235003 | Agrobacterium tumefaciens WRT31 | Isolate | Rhizosphere |
| 261 | 2558860100 | Sinorhizobium sp. PC2 | Isolate | Nodule |
| 262 | 2558860242 | Agrobacterium fabacearum P4 | Isolate | Rhizosphere |
| 263 | 2558860983 | Allorhizobium undicola ATCC 700741 | Isolate | Rhizoplane |
| 264 | 2582581283 | Rhizobium sp. OK665 | Isolate | Rhizosphere |
| 265 | 2582581294 | Rhizobium sp. CF394 | Isolate | Rhizosphere |
| 266 | 2582581298 | Rhizobium alamii YR540 | Isolate | Rhizosphere |
| 267 | 2582581299 | Rhizobium leguminosarum OV483 | Isolate | Rhizosphere |
| 268 | 2582581307 | Rhizobium sp. YR060 | Isolate | Rhizosphere |
| 269 | 2582581308 | Rhizobium sp. OK494 | Isolate | Rhizosphere |
| 270 | 2582581315 | Agrobacterium rhizogenes YR147 | Isolate | Rhizosphere |
| 271 | 2582581316 | Agrobacterium rhizogenes OK036 | Isolate | Rhizosphere |
| 272 | 2582581866 | Rhizobium sp. CF097 | Isolate | Rhizosphere |
| 273 | 2582581867 | Rhizobium sp. OV201 | Isolate | Rhizosphere |
| 274 | 2585427526 | Rhizobium leguminosarum OV152 | Isolate | Rhizosphere |
| 275 | 2585427527 | Rhizobium lusitanum YR374 | Isolate | Rhizosphere |
| 276 | 2585427529 | Rhizobium alamii YR584 | Isolate | Rhizosphere |
| 277 | 2585427530 | Rhizobium tropici YR635 | Isolate | Rhizosphere |
| 278 | 2585427531 | Agrobacterium rhizogenes YR530 | Isolate | Rhizosphere |
| 279 | 2585427590 | Rhizobium sp. CF048 | Isolate | Rhizosphere |
| 280 | 2585427594 | Rhizobium sp. YR528 | Isolate | Rhizosphere |
| 281 | 2585427608 | Agrobacterium rhizogenes OV677 | Isolate | Rhizosphere |
| 282 | 2585427609 | Agrobacterium rhizogenes CF263 | Isolate | Rhizosphere |
| 283 | 2585428125 | Agrobacterium rhizogenes CF262 | Isolate | Rhizosphere |
| 284 | 2599185156 | Rhizobium sp. NFR03 | Isolate | Rhizoplane |
| 285 | 2599185210 | Rhizobium sp. NFACC06-2 | Isolate | Rhizoplane |
| 286 | 2599185236 | Rhizobium sp. NFR07 | Isolate | Rhizoplane |
| 287 | 2599185352 | Sinorhizobium sp. NFACC03 | Isolate | Rhizoplane |
| 288 | 2600255279 | Rhizobium sp. NFIX01 | Isolate | Rhizoplane |
| 289 | 2600255308 | Rhizobium sp. NFIX02 | Isolate | Rhizoplane |
| 290 | 2615840626 | Rhizobium lusitanum P1-7 | Isolate | Nodule |
| 291 | 2615840698 | Rhizobium multihospitium HAMBI 2975 | Isolate | Nodule |
| 292 | 2617270742 | Rhizobium miluonense HAMBI 2971 | Isolate | Nodule |
| 293 | 2643221557 | Ensifer sp. Root558 | Isolate | Unclassified |
| 294 | 2643221568 | Rhizobium sp. Root564 | Isolate | Unclassified |
| 295 | 2643221582 | Rhizobium sp. Root651 | Isolate | Unclassified |
| 296 | 2643221610 | Ensifer sp. Root74 | Isolate | Unclassified |
| 297 | 2643221618 | Ensifer sp. Root231 | Isolate | Unclassified |
| 298 | 2643221626 | Ensifer sp. Root31 | Isolate | Unclassified |
| 299 | 2643221634 | Rhizobium sp. Root1203 | Isolate | Unclassified |
| 300 | 2643221637 | Rhizobium sp. Root1212 | Isolate | Unclassified |
| 301 | 2643221653 | Rhizobium sp. Root1240 | Isolate | Unclassified |
| 302 | 2643221655 | Ensifer sp. Root1252 | Isolate | Unclassified |
| 303 | 2643221659 | Ensifer sp. Root127 | Isolate | Unclassified |
| 304 | 2643221668 | Ensifer sp. Root423 | Isolate | Unclassified |
| 305 | 2643221675 | Ensifer sp. Root1298 | Isolate | Unclassified |
| 306 | 2643221680 | Ensifer sp. Root1312 | Isolate | Unclassified |
| 307 | 2643221688 | Rhizobium sp. Root482 | Isolate | Unclassified |
| 308 | 2643221693 | Rhizobium sp. Root491 | Isolate | Unclassified |
| 309 | 2643221698 | Ensifer sp. Root142 | Isolate | Unclassified |
| 310 | 2643221712 | Ensifer sp. Root258 | Isolate | Unclassified |
| 311 | 2643221718 | Rhizobium sp. Root268 | Isolate | Unclassified |
| 312 | 2643221719 | Rhizobium sp. Root274 | Isolate | Unclassified |
| 313 | 2643221723 | Ensifer sp. Root278 | Isolate | Unclassified |
| 314 | 2643221726 | Ensifer sp. Root954 | Isolate | Unclassified |
| 315 | 2657244999 | Sinorhizobium sojae CCBAU 05684 | Isolate | Unclassified |
| 316 | 2667528174 | Rhizobium sp. NFR17 | Isolate | Rhizoplane |
| 317 | 2718217997 | Rhizobium phaseoli sv. phaseoli R723 | Isolate | Nodule |
| 318 | 2718218199 | Rhizobium phaseoli sv. phaseoli N261 | Isolate | Nodule |
| 319 | 2718218232 | Rhizobium phaseoli sv. phaseoli N161 | Isolate | Nodule |
| 320 | 2718218233 | Rhizobium phaseoli sv. phaseoli R744 | Isolate | Nodule |
| 321 | 2718218235 | Rhizobium phaseoli sv. phaseoli R620 | Isolate | Nodule |
| 322 | 2718218269 | Rhizobium phaseoli sv. phaseoli N671 | Isolate | Nodule |
| 323 | 2721755556 | Rhizobium phaseoli sv. phaseoli N931 | Isolate | Nodule |
| 324 | 2721755684 | Rhizobium phaseoli sv. phaseoli N841 | Isolate | Nodule |
| 325 | 2721755685 | Rhizobium phaseoli sv. phaseoli R611 | Isolate | Nodule |
| 326 | 2721755819 | Rhizobium phaseoli sv. phaseoli N771 | Isolate | Nodule |
| 327 | 2721755822 | Rhizobium phaseoli sv. phaseoli R650 | Isolate | Nodule |
| 328 | 2721755823 | Rhizobium phaseoli sv. phaseoli R630 | Isolate | Nodule |
| 329 | 2724679232 | Rhizobium leguminosarum Vaf12 | Isolate | Unclassified |
| 330 | 2728369352 | Rhizobium phaseoli sv. phaseoli N831 | Isolate | Nodule |
| 331 | 2738541293 | Rhizobium sp. GV031 | Isolate | Unclassified |
| 332 | 2751185821 | Ensifer shofinae CCBAU 251167 | Isolate | Unclassified |
| 333 | 2765235942 | Rhizobium sp. WYCCWR10014 | Isolate | Nodule |
| 334 | 2775507049 | Rhizobium sp. ACO-34A | Isolate | Unclassified |
| 335 | 2775507266 | Rhizobium tropici PRF 81 | Isolate | Nodule |
| 336 | 2791355082 | Ensifer alkalisoli YIC4027 | Isolate | Nodule |
| 337 | 2791355091 | Sinorhizobium sp. FG01 | Isolate | Nodule |
| 338 | 2791355092 | Sinorhizobium sp. NG07B | Isolate | Nodule |
| 339 | 2791355256 | Rhizobium sp. M10 | Isolate | Nodule |
| 340 | 2791355259 | Rhizobium hidalgonense FH14 | Isolate | Nodule |
| 341 | 2791355262 | Rhizobium sp. M1 | Isolate | Nodule |
| 342 | 2791355265 | Rhizobium sp. H4 | Isolate | Nodule |
| 343 | 2791355267 | Rhizobium sp. L18 | Isolate | Nodule |
| 344 | 2802428858 | Sinorhizobium medicae M14-1 | Isolate | Nodule |
| 345 | 2802428859 | Sinorhizobium medicae SF3.41 | Isolate | Nodule |
| 346 | 2802428860 | Sinorhizobium medicae M19-1 | Isolate | Nodule |
| 347 | 2802428861 | Sinorhizobium medicae USDA1037 | Isolate | Nodule |
| 348 | 2802428862 | Sinorhizobium medicae M7-4 | Isolate | Nodule |
| 349 | 2802428863 | Sinorhizobium medicae M26-2 | Isolate | Nodule |
| 350 | 2802429268 | Sinorhizobium sojae CCBAU 05684 | Isolate | Unclassified |
| 351 | 2802429605 | Rhizobium sophoriradicis L101 | Isolate | Nodule |
| 352 | 2802429606 | Rhizobium sophoriradicis JJW1 | Isolate | Nodule |
| 353 | 2808606387 | Rhizobium sp. SJZ105 | Isolate | Rhizosphere |
| 354 | 2818991272 | Rhizobium sp. SLBN-4 | Isolate | Unclassified |
| 355 | 2818991439 | Agrobacterium tumefaciens 1187 | Isolate | Unclassified |
| 356 | 2818991448 | Rhizobium miluonense 1234 | Isolate | Unclassified |
| 357 | 2818991453 | Rhizobium lusitanum 1158 | Isolate | Unclassified |
| 358 | 2838029111 | Rhizobium tropici SEMIA 4079 | Isolate | Nodule |
| 359 | 2838048938 | Rhizobium pisi 27/80 | Isolate | Nodule |
| 360 | 2838061910 | Rhizobium phaseoli L15 | Isolate | Nodule |
| 361 | 2838068647 | Rhizobium esperanzae VC28 | Isolate | Nodule |
| 362 | 2838074704 | Sinorhizobium terangae SEMIA 6460 | Isolate | Unclassified |
| 363 | 2838668709 | Rhizobium sophoriradicis SEMIA 403 | Isolate | Nodule |
| 364 | 2838675328 | Agrobacterium radiobacter SEMIA 410 | Isolate | Nodule |
| 365 | 2838686498 | Rhizobium leguminosarum SEMIA 416 | Isolate | Nodule |
| 366 | 2838701080 | Rhizobium aethiopicum SEMIA 428 | Isolate | Nodule |
| 367 | 2838714209 | Agrobacterium radiobacter SEMIA 435 | Isolate | Nodule |
| 368 | 2838719591 | Agrobacterium radiobacter SEMIA 436 | Isolate | Nodule |
| 369 | 2838724970 | Agrobacterium radiobacter SEMIA 437 | Isolate | Nodule |
| 370 | 2838729681 | Rhizobium leguminosarum SEMIA 445 | Isolate | Nodule |
| 371 | 2838742623 | Rhizobium leguminosarum SEMIA 449 | Isolate | Nodule |
| 372 | 2841846520 | Agrobacterium radiobacter SEMIA 440 | Isolate | Nodule |
| 373 | 2841851746 | Rhizobium leguminosarum SEMIA 498 | Isolate | Nodule |
| 374 | 2841859092 | Agrobacterium radiobacter SEMIA 4026 | Isolate | Nodule |
| 375 | 2842110456 | Rhizobium esperanzae SEMIA 414 | Isolate | Nodule |
| 376 | 2842124991 | Agrobacterium radiobacter SEMIA 434 | Isolate | Nodule |
| 377 | 2842130223 | Agrobacterium radiobacter SEMIA 441 | Isolate | Nodule |
| 378 | 2842146304 | Rhizobium sophoriradicis SEMIA 454 | Isolate | Nodule |
| 379 | 2842152218 | Agrobacterium radiobacter SEMIA 457 | Isolate | Nodule |
| 380 | 2842156927 | Rhizobium leguminosarum SEMIA 459 | Isolate | Nodule |
| 381 | 2842163707 | Rhizobium leguminosarum SEMIA 460 | Isolate | Nodule |
| 382 | 2842170452 | Agrobacterium radiobacter SEMIA 461 | Isolate | Nodule |
| 383 | 2842175837 | Agrobacterium radiobacter SEMIA 462 | Isolate | Nodule |
| 384 | 2842180545 | Rhizobium leguminosarum SEMIA 463 | Isolate | Nodule |
| 385 | 2842187318 | Agrobacterium radiobacter SEMIA 464 | Isolate | Nodule |
| 386 | 2842192696 | Rhizobium esperanzae SEMIA 468 | Isolate | Nodule |
| 387 | 2842205361 | Rhizobium etli SEMIA 471 | Isolate | Nodule |
| 388 | 2842211629 | Agrobacterium radiobacter SEMIA 472 | Isolate | Nodule |
| 389 | 2842217011 | Rhizobium leguminosarum SEMIA 475 | Isolate | Nodule |
| 390 | 2842224351 | Agrobacterium radiobacter SEMIA 480 | Isolate | Nodule |
| 391 | 2842229732 | Rhizobium leguminosarum SEMIA 481 | Isolate | Nodule |
| 392 | 2842243621 | Rhizobium leguminosarum SEMIA 483 | Isolate | Nodule |
| 393 | 2842250916 | Rhizobium etli SEMIA 484 | Isolate | Nodule |
| 394 | 2842257432 | Rhizobium leguminosarum SEMIA 485 | Isolate | Nodule |
| 395 | 2842264693 | Rhizobium phaseoli SEMIA 487 | Isolate | Nodule |
| 396 | 2842271015 | Rhizobium leguminosarum SEMIA 488 | Isolate | Nodule |
| 397 | 2842278818 | Rhizobium etli SEMIA 489 | Isolate | Nodule |
| 398 | 2842285085 | Rhizobium lentis SEMIA 490 | Isolate | Nodule |
| 399 | 2842298080 | Rhizobium leucaenae SEMIA 492 | Isolate | Nodule |
| 400 | 2842304105 | Rhizobium leguminosarum SEMIA 499 | Isolate | Nodule |
| 401 | 2842311132 | Rhizobium phaseoli SEMIA 4002 | Isolate | Nodule |
| 402 | 2842317721 | Rhizobium etli SEMIA 4004 | Isolate | Nodule |
| 403 | 2842341865 | Rhizobium leguminosarum SEMIA 4011 | Isolate | Nodule |
| 404 | 2842357229 | Rhizobium leucaenae SEMIA 4015 | Isolate | Nodule |
| 405 | 2842363717 | Rhizobium leguminosarum SEMIA 4016 | Isolate | Nodule |
| 406 | 2842402390 | Rhizobium lentis SEMIA 4033 | Isolate | Nodule |
| 407 | 2842409023 | Rhizobium lentis SEMIA 4034 | Isolate | Nodule |
| 408 | 2842415677 | Rhizobium lentis SEMIA 4036 | Isolate | Nodule |
| 409 | 2842422224 | Rhizobium esperanzae SEMIA 4042 | Isolate | Nodule |
| 410 | 2842428310 | Rhizobium phaseoli SEMIA 4050 | Isolate | Nodule |
| 411 | 2842434925 | Rhizobium esperanzae SEMIA 4051 | Isolate | Nodule |
| 412 | 2842441272 | Rhizobium esperanzae SEMIA 4053 | Isolate | Nodule |
| 413 | 2842447887 | Rhizobium esperanzae SEMIA 4055 | Isolate | Nodule |
| 414 | 2842462802 | Rhizobium phaseoli SEMIA 4057 | Isolate | Nodule |
| 415 | 2842469257 | Rhizobium phaseoli SEMIA 4058 | Isolate | Nodule |
| 416 | 2842475841 | Rhizobium tropici SEMIA 4059 | Isolate | Nodule |
| 417 | 2842482326 | Rhizobium lusitanum SEMIA 4060 | Isolate | Nodule |
| 418 | 2842489311 | Rhizobium sophoriradicis SEMIA 4061 | Isolate | Nodule |
| 419 | 2842495871 | Rhizobium etli SEMIA 4062 | Isolate | Nodule |
| 420 | 2842502639 | Rhizobium tropici SEMIA 4063 | Isolate | Nodule |
| 421 | 2842509118 | Rhizobium paranaense SEMIA 4064 | Isolate | Nodule |
| 422 | 2842515876 | Agrobacterium radiobacter SEMIA 4072 | Isolate | Nodule |
| 423 | 2842521101 | Rhizobium giardinii SEMIA 4084 | Isolate | Nodule |
| 424 | 2842922631 | Pararhizobium sp. R-72066 | Isolate | Unclassified |
| 425 | 2844163670 | Ensifer sp. 1H6 | Isolate | Unclassified |
| 426 | 2844454524 | Rhizobium leguminosarum bv. viciae BIHB 1217 | Isolate | Nodule |
| 427 | 2848992105 | Sinorhizobium fredii CCBAU 25509 | Isolate | Unclassified |
| 428 | 2850079185 | Ensifer aridi JNVU TP6 | Isolate | Unclassified |
| 429 | 2852387548 | Rhizobium jaguaris CCGE525 | Isolate | Unclassified |
| 430 | 2855825444 | Sinorhizobium meliloti CXM1-105 | Isolate | Nodule |
| 431 | 2855839649 | Sinorhizobium meliloti AK555 | Isolate | Unclassified |
| 432 | 2855872281 | Sinorhizobium fredii PCH1 | Isolate | Nodule |
| 433 | 2857516855 | Rhizobium sp. R-72456 | Isolate | Unclassified |
| 434 | 2858800743 | Sinorhizobium meliloti AK170 | Isolate | Unclassified |
| 435 | 2896384573 | Ensifer sp. MPMI2T | Isolate | Unclassified |
| 436 | 2899792073 | Agrobacterium deltaense CNPSo 3391 | Isolate | Nodule |
| 437 | 2899803654 | Agrobacterium sp. a22-2 | Isolate | Unclassified |
| 438 | 2899845264 | Agrobacterium fabacearum CNPSo 675 | Isolate | Unclassified |
| 439 | 2913295892 | Sinorhizobium kostiensis DSM 13372 | Isolate | Nodule |
| 440 | 2913308742 | Rhizobium halophytocola DSM 21600 | Isolate | Unclassified |
| 441 | 2915980308 | Sinorhizobium medicae USDA1149 | Isolate | Nodule |
| 442 | 2915986958 | Sinorhizobium meliloti USDA1659 | Isolate | Nodule |
| 443 | 2915993759 | Sinorhizobium meliloti USDA1336 | Isolate | Nodule |
| 444 | 2916000859 | Sinorhizobium meliloti USDA1562 | Isolate | Nodule |
| 445 | 2916007675 | Sinorhizobium meliloti USDA1289 | Isolate | Nodule |
| 446 | 2916014648 | Sinorhizobium meliloti USDA1583 | Isolate | Nodule |
| 447 | 2916021584 | Sinorhizobium meliloti USDA1550 | Isolate | Nodule |
| 448 | 2916028427 | Sinorhizobium meliloti USDA1613 | Isolate | Nodule |
| 449 | 2916035215 | Sinorhizobium meliloti 3011 | Isolate | Nodule |
| 450 | 2916041962 | Sinorhizobium meliloti USDA1795 | Isolate | Nodule |
| 451 | 2916048683 | Sinorhizobium meliloti USDA1796 | Isolate | Nodule |
| 452 | 2916055098 | Sinorhizobium meliloti USDA1770 | Isolate | Nodule |
| 453 | 2916061851 | Sinorhizobium medicae USDA1638 | Isolate | Nodule |
| 454 | 2916076590 | Sinorhizobium meliloti USDA1661 | Isolate | Nodule |
| 455 | 2919100787 | Rhizobium sp. 1399 | Isolate | Rhizosphere |
| 456 | 2919114240 | Agrobacterium tumefaciens 1457 | Isolate | Rhizosphere |
| 457 | 2919166419 | Agrobacterium cavarae 2074 | Isolate | Unclassified |
| 458 | 2919408235 | Rhizobium miluonense 3199 | Isolate | Unclassified |
| 459 | 2920760137 | Ensifer psoraleae CCBAU 65732 | Isolate | Unclassified |
| 460 | 2920822456 | Ensifer sesbaniae CCBAU 65729 | Isolate | Unclassified |
| 461 | 2921201388 | Sinorhizobium meliloti USDA1692 | Isolate | Nodule |
| 462 | 2921208531 | Sinorhizobium meliloti USDA1660 | Isolate | Nodule |
| 463 | 2921237296 | Sinorhizobium meliloti USDA1508 | Isolate | Nodule |
| 464 | 2921244191 | Sinorhizobium meliloti 2119 | Isolate | Nodule |
| 465 | 2921250672 | Sinorhizobium medicae USDA1169 | Isolate | Nodule |
| 466 | 2921257292 | Sinorhizobium meliloti USDA1320 | Isolate | Nodule |
| 467 | 2921263974 | Sinorhizobium meliloti USDA1107 | Isolate | Nodule |
| 468 | 2921282425 | Sinorhizobium meliloti USDA1203 | Isolate | Nodule |
| 469 | 2921289301 | Sinorhizobium meliloti USDA1730 | Isolate | Nodule |
| 470 | 2921296804 | Sinorhizobium meliloti USDA1200 | Isolate | Nodule |
| 471 | 2923556063 | Rhizobium tibeticum 3740 | Isolate | Unclassified |
| 472 | 2924144063 | Sinorhizobium meliloti USDA1022 | Isolate | Nodule |
| 473 | 2924150972 | Sinorhizobium meliloti USDA1700 | Isolate | Nodule |
| 474 | 2924158325 | Sinorhizobium meliloti USDA1146 | Isolate | Nodule |
| 475 | 2924165586 | Sinorhizobium meliloti USDA1264 | Isolate | Nodule |
| 476 | 2924172951 | Sinorhizobium meliloti USDA1626 | Isolate | Nodule |
| 477 | 2924179722 | Sinorhizobium meliloti USDA1280 | Isolate | Nodule |
| 478 | 2924186466 | Sinorhizobium meliloti USDA1389 | Isolate | Nodule |
| 479 | 2924193448 | Sinorhizobium meliloti USDA1158 | Isolate | Nodule |
| 480 | 2924200457 | Sinorhizobium meliloti USDA1007 | Isolate | Nodule |
| 481 | 2924207177 | Sinorhizobium meliloti USDA1589 | Isolate | Nodule |
| 482 | 2924214083 | Sinorhizobium meliloti USDA1702 | Isolate | Nodule |
| 483 | 2924221636 | Sinorhizobium meliloti USDA1416 | Isolate | Nodule |
| 484 | 2924228884 | Sinorhizobium meliloti USDA1581 | Isolate | Nodule |
| 485 | 2926754445 | Agrobacterium radiobacter SLBN-94 | Isolate | Rhizosphere |
| 486 | 2926760298 | Agrobacterium tumefaciens SLBN-170 | Isolate | Rhizosphere |
| 487 | 2933006813 | Rhizobium sp. SEMIA 439 | Isolate | Unclassified |
| 488 | 2933011516 | Rhizobium sp. SEMIA 4032 | Isolate | Unclassified |
| 489 | 2933570622 | Rhizobium leguminosarum SEMIA 409 | Isolate | Nodule |
| 490 | 2933586486 | Rhizobium leguminosarum SEMIA 4039 | Isolate | Nodule |
| 491 | 2933594066 | Agrobacterium fabrum 35/80 | Isolate | Nodule |
| 492 | 2933599457 | Rhizobium phaseoli M3 | Isolate | Nodule |
| 493 | 2935901341 | Rhizobium leguminosarum SEMIA 4082 | Isolate | Nodule |
| 494 | 2936367885 | Rhizobium changzhiense WYCCWR 11290 | Isolate | Nodule |
| 495 | 2936996657 | Sinorhizobium meliloti USDA1025 | Isolate | Nodule |
| 496 | 2937002841 | Sinorhizobium meliloti USDA1006 | Isolate | Nodule |
| 497 | 2937009748 | Sinorhizobium meliloti USDA1162 | Isolate | Nodule |
| 498 | 2937016420 | Sinorhizobium meliloti USDA1027 | Isolate | Nodule |
| 499 | 2937023124 | Sinorhizobium meliloti USDA1335 | Isolate | Nodule |
| 500 | 2937029754 | Sinorhizobium medicae USDA1624 | Isolate | Nodule |
| 501 | 2937036028 | Sinorhizobium medicae USDA1608 | Isolate | Nodule |
| 502 | 2937042894 | Sinorhizobium meliloti USDA1687 | Isolate | Nodule |
| 503 | 2937049772 | Sinorhizobium meliloti USDA1691 | Isolate | Nodule |
| 504 | 2937063883 | Sinorhizobium meliloti USDA1808 | Isolate | Nodule |
| 505 | 2937071275 | Sinorhizobium meliloti USDA1623 | Isolate | Nodule |
| 506 | 2937078374 | Sinorhizobium medicae USDA1004 | Isolate | Nodule |
| 507 | 2937084907 | Sinorhizobium medicae USDA1664 | Isolate | Nodule |
| 508 | 2937091812 | Sinorhizobium meliloti USDA1221 | Isolate | Nodule |
| 509 | 2937098957 | Sinorhizobium meliloti USDA1519 | Isolate | Nodule |
| 510 | 2937106411 | Sinorhizobium meliloti USDA1214 | Isolate | Nodule |
| 511 | 2937113482 | Sinorhizobium meliloti USDA1180 | Isolate | Nodule |
| 512 | 2937119839 | Sinorhizobium meliloti USDA1790 | Isolate | Nodule |
| 513 | 2937126314 | Sinorhizobium meliloti USDA1612 | Isolate | Nodule |
| 514 | 2941499720 | Ensifer sp. 4252 | Isolate | Rhizosphere |
| 515 | 2957375807 | Sinorhizobium medicae USDA1632 | Isolate | Nodule |
| 516 | 2957382221 | Sinorhizobium meliloti USDA1919 | Isolate | Nodule |
| 517 | 2957388812 | Sinorhizobium meliloti USDA1195 | Isolate | Nodule |
| 518 | 2957395598 | Sinorhizobium meliloti USDA1237 | Isolate | Nodule |
| 519 | 2957402308 | Sinorhizobium meliloti USDA1794 | Isolate | Nodule |
| 520 | 2957408893 | Sinorhizobium meliloti USDA1163 | Isolate | Nodule |
| 521 | 2957415311 | Sinorhizobium meliloti USDA1724 | Isolate | Nodule |
| 522 | 2957422303 | Sinorhizobium meliloti USDA1497 | Isolate | Nodule |
| 523 | 2957430029 | Sinorhizobium meliloti USDA1590 | Isolate | Nodule |
| 524 | 2957437181 | Sinorhizobium medicae USDA1694 | Isolate | Nodule |
| 525 | 2957443900 | Sinorhizobium meliloti USDA1734 | Isolate | Nodule |
| 526 | 2957450854 | Sinorhizobium meliloti USDA1655 | Isolate | Nodule |
| 527 | 2957457609 | Sinorhizobium meliloti USDA1751 | Isolate | Nodule |
| 528 | 2957464669 | Sinorhizobium meliloti USDA1520 | Isolate | Nodule |
| 529 | 2957471148 | Sinorhizobium meliloti USDA1204 | Isolate | Nodule |
| 530 | 2957478035 | Sinorhizobium meliloti USDA1171 | Isolate | Nodule |
| 531 | 2957484790 | Sinorhizobium meliloti USDA1464 | Isolate | Nodule |
| 532 | 2957491536 | Sinorhizobium meliloti USDA1804 | Isolate | Nodule |
| 533 | 2957498199 | Sinorhizobium meliloti USDA1561 | Isolate | Nodule |
| 534 | 2957505466 | Sinorhizobium meliloti USDA1696 | Isolate | Nodule |
| 535 | 2960584000 | Sinorhizobium meliloti USDA1530 | Isolate | Nodule |
| 536 | 2960591022 | Sinorhizobium medicae USDA1066 | Isolate | Nodule |
| 537 | 2960597568 | Sinorhizobium meliloti 3085 | Isolate | Nodule |
| 538 | 2960603979 | Sinorhizobium meliloti USDA1580 | Isolate | Nodule |
| 539 | 2960610863 | Sinorhizobium meliloti USDA1792 | Isolate | Nodule |
| 540 | 2960617483 | Sinorhizobium meliloti USDA1719 | Isolate | Nodule |
| 541 | 2960624210 | Sinorhizobium meliloti USDA1415 | Isolate | Nodule |
| 542 | 2960631154 | Sinorhizobium medicae USDA1629 | Isolate | Nodule |
| 543 | 2960637947 | Sinorhizobium meliloti USDA1202 | Isolate | Nodule |
| 544 | 2960645483 | Sinorhizobium meliloti USDA1703 | Isolate | Nodule |
| 545 | 2960652885 | Sinorhizobium meliloti USDA1199 | Isolate | Nodule |
| 546 | 2960660292 | Sinorhizobium meliloti USDA1883 | Isolate | Nodule |
| 547 | 2960667422 | Sinorhizobium meliloti USDA1170 | Isolate | Nodule |
| 548 | 2960680706 | Sinorhizobium medicae USDA1150 | Isolate | Nodule |
| 549 | 2960687367 | Sinorhizobium meliloti USDA1462 | Isolate | Nodule |
| 550 | 2960693952 | Sinorhizobium medicae USDA1630 | Isolate | Nodule |
| 551 | 2964615318 | Sinorhizobium meliloti USDA1248 | Isolate | Nodule |
| 552 | 2964621998 | Sinorhizobium meliloti USDA1235 | Isolate | Nodule |
| 553 | 2964628898 | Sinorhizobium meliloti USDA1191 | Isolate | Nodule |
| 554 | 2964636051 | Sinorhizobium meliloti USDA1594 | Isolate | Nodule |
| 555 | 2964643177 | Sinorhizobium meliloti USDA1760 | Isolate | Nodule |
| 556 | 2964649959 | Sinorhizobium meliloti USDA1591 | Isolate | Nodule |
| 557 | 2964656573 | Sinorhizobium meliloti USDA1308 | Isolate | Nodule |
| 558 | 2964663802 | Sinorhizobium meliloti USDA1688 | Isolate | Nodule |
| 559 | 2964670856 | Sinorhizobium meliloti USDA1211 | Isolate | Nodule |
| 560 | 2964678106 | Sinorhizobium meliloti USDA1210 | Isolate | Nodule |
| 561 | 2964685014 | Sinorhizobium meliloti USDA1232 | Isolate | Nodule |
| 562 | 2964691889 | Sinorhizobium meliloti USDA1379 | Isolate | Nodule |
| 563 | 2964698721 | Sinorhizobium meliloti USDA1656 | Isolate | Nodule |
| 564 | 2964705432 | Sinorhizobium meliloti USDA1614 | Isolate | Nodule |
| 565 | 2964712639 | Sinorhizobium meliloti USDA1616 | Isolate | Nodule |
| 566 | 2964719344 | Sinorhizobium meliloti USDA1456 | Isolate | Nodule |
| 567 | 2967664464 | Sinorhizobium meliloti USDA1208 | Isolate | Nodule |
| 568 | 2967671571 | Sinorhizobium meliloti USDA1496 | Isolate | Nodule |
| 569 | 2967678726 | Sinorhizobium meliloti USDA1467 | Isolate | Nodule |
| 570 | 2967686174 | Sinorhizobium medicae USDA1641 | Isolate | Nodule |
| 571 | 2967693043 | Sinorhizobium meliloti USDA1183 | Isolate | Nodule |
| 572 | 2967699805 | Sinorhizobium meliloti USDA1695 | Isolate | Nodule |
| 573 | 2967706974 | Sinorhizobium meliloti USDA1206 | Isolate | Nodule |
| 574 | 2967714385 | Sinorhizobium meliloti USDA1023 | Isolate | Nodule |
| 575 | 2967721400 | Sinorhizobium meliloti USDA1742 | Isolate | Nodule |
| 576 | 2967728569 | Sinorhizobium medicae USDA1607 | Isolate | Nodule |
| 577 | 2967735183 | Sinorhizobium meliloti USDA1710 | Isolate | Nodule |
| 578 | 2967742019 | Sinorhizobium meliloti USDA1676 | Isolate | Nodule |
| 579 | 2967748971 | Sinorhizobium meliloti USDA1024A | Isolate | Nodule |
| 580 | 2967755722 | Sinorhizobium meliloti USDA1302 | Isolate | Nodule |
| 581 | 2967762386 | Sinorhizobium meliloti USDA1397 | Isolate | Nodule |
| 582 | 2967769361 | Sinorhizobium meliloti USDA1005 | Isolate | Nodule |
| 583 | 2967775926 | Sinorhizobium meliloti USDA1678 | Isolate | Nodule |
| 584 | 2970019648 | Sinorhizobium meliloti USDA1603 | Isolate | Nodule |
| 585 | 2970026789 | Sinorhizobium medicae USDA1611 | Isolate | Nodule |
| 586 | 2970033650 | Sinorhizobium meliloti USDA1565 | Isolate | Nodule |
| 587 | 2970040964 | Sinorhizobium meliloti USDA1501 | Isolate | Nodule |
| 588 | 2970047711 | Sinorhizobium meliloti USDA1793 | Isolate | Nodule |
| 589 | 2970054988 | Sinorhizobium meliloti USDA1031 | Isolate | Nodule |
| 590 | 2970061556 | Sinorhizobium meliloti USDA1810 | Isolate | Nodule |
| 591 | 2970068827 | Sinorhizobium meliloti USDA1227 | Isolate | Nodule |
| 592 | 2970076120 | Sinorhizobium meliloti USDA1706 | Isolate | Nodule |
| 593 | 2970082768 | Sinorhizobium meliloti USDA1803 | Isolate | Nodule |
| 594 | 2970088815 | Sinorhizobium meliloti USDA1819 | Isolate | Nodule |
| 595 | 2970095765 | Sinorhizobium meliloti USDA1225 | Isolate | Nodule |
| 596 | 2970102677 | Sinorhizobium meliloti USDA1325 | Isolate | Nodule |
| 597 | 2970109326 | Sinorhizobium meliloti USDA1186 | Isolate | Nodule |
| 598 | 2970116247 | Sinorhizobium meliloti USDA1566 | Isolate | Nodule |
| 599 | 2970122695 | Sinorhizobium medicae 3082 | Isolate | Nodule |
| 600 | 2970129317 | Sinorhizobium meliloti USDA1008 | Isolate | Nodule |
| 601 | 2970136068 | Sinorhizobium meliloti USDA1699 | Isolate | Nodule |
| 602 | 2970143518 | Sinorhizobium medicae USDA1652 | Isolate | Nodule |
| 603 | 2970149975 | Sinorhizobium meliloti USDA1215 | Isolate | Nodule |
| 604 | 2970156795 | Sinorhizobium meliloti USDA1491 | Isolate | Nodule |
| 605 | 2970164137 | Sinorhizobium meliloti USDA1018 | Isolate | Nodule |
| 606 | 2970170962 | Sinorhizobium meliloti USDA1571 | Isolate | Nodule |
| 607 | 2970177841 | Sinorhizobium meliloti USDA1533 | Isolate | Nodule |
| 608 | 2970184632 | Sinorhizobium meliloti USDA1593 | Isolate | Nodule |
| 609 | 2970191845 | Sinorhizobium meliloti USDA1187 | Isolate | Nodule |
| 610 | 2977516862 | Sinorhizobium meliloti USDA1791 | Isolate | Nodule |
| 611 | 2977523885 | Sinorhizobium meliloti USDA1777 | Isolate | Nodule |
| 612 | 2977530762 | Sinorhizobium medicae USDA1606 | Isolate | Nodule |
| 613 | 2977537788 | Sinorhizobium meliloti USDA1184 | Isolate | Nodule |
| 614 | 2977544691 | Sinorhizobium medicae USDA1631 | Isolate | Nodule |
| 615 | 2977551784 | Sinorhizobium meliloti USDA1035 | Isolate | Nodule |
| 616 | 2977558990 | Sinorhizobium meliloti USDA1222 | Isolate | Nodule |
| 617 | 2977565890 | Sinorhizobium meliloti USDA1617 | Isolate | Nodule |
| 618 | 2977572785 | Sinorhizobium meliloti USDA1767 | Isolate | Nodule |
| 619 | 2977579622 | Sinorhizobium meliloti USDA1161 | Isolate | Nodule |
| 620 | 2978969890 | Agrobacterium sp. SORGH_AS 787 | Isolate | Unclassified |
| 621 | 2979089926 | Agrobacterium sp. SORGH_AS 745 | Isolate | Unclassified |
| 622 | 2979095461 | Agrobacterium tumefaciens SORGH_AS 749 | Isolate | Unclassified |
| 623 | 2979100975 | Agrobacterium pusense SORGH_AS 755 | Isolate | Unclassified |
| 624 | 2984509177 | Agrobacterium pusense SORGH_AS260 | Isolate | Aerial Root |
| 625 | 2984518228 | Agrobacterium pusense SORGH_AS285 | Isolate | Aerial Root |
| 626 | 2984537506 | Agrobacterium sp. SORGH_AS440 | Isolate | Aerial Root |
| 627 | 2984587000 | Agrobacterium larrymoorei SORGH_AS974 | Isolate | Aerial Root |
| 628 | 2984601300 | Rhizobium pusense SORGH_AS1083 | Isolate | Aerial Root |
| 629 | 2989771324 | Rhizobium rhizolycopersici DBTS2 | Isolate | Rhizosphere |
| 630 | 2989776772 | Rhizobium glycinendophyticum CL12 | Isolate | Unclassified |
| 631 | 2996887358 | Rhizobium sp. R711 | Isolate | Nodule |
| 632 | 3003930520 | Sinorhizobium sp. BG8 | Isolate | Unclassified |
| 633 | 3005409236 | Rhizobium sp. P32RR-XVIII | Isolate | Rhizosphere |
| 634 | 3005416602 | Rhizobium sp. P40RR-XXII | Isolate | Rhizosphere |
| 635 | 3005445848 | Rhizobium sp. WYJ-E13 | Isolate | Unclassified |
| 636 | 639633055 | Rhizobium leguminosarum bv. viciae 3841 | Isolate | Unclassified |
| 637 | 648276728 | Sinorhizobium meliloti BL225C | Isolate | Nodule |
| 638 | 650716007 | Agrobacterium fabacearum H13-3 | Isolate | Rhizosphere |
| 639 | 8003570095 | Agrobacterium rhizogenes GBBC3284 | Isolate | Unclassified |
| 640 | 8003992118 | Sinorhizobium meliloti RRI128 | Isolate | Nodule |
| 641 | 8003999396 | Sinorhizobium medicae WSM1115 | Isolate | Nodule |
| 642 | 8005246636 | Rhizobium wuzhouense W44 | Isolate | Rhizosphere |
| 643 | 8005258706 | Rhizobium sp. R693 | Isolate | Nodule |
| 644 | 8005282627 | Rhizobium phaseoli NC1 | Isolate | Nodule |
| 645 | 8005289223 | Rhizobium bangladeshense 1002 | Isolate | Nodule |
| 646 | 8005301065 | Rhizobium bangladeshense 1017 | Isolate | Nodule |
| 647 | 8005307578 | Rhizobium leguminosarum bv. phaseoli LCS0306 | Isolate | Unclassified |
| 648 | 8005314921 | Rhizobium sp. P28RR-XV | Isolate | Rhizosphere |
| 649 | 8005321885 | Rhizobium sp. R72 | Isolate | Nodule |
| 650 | 8005376324 | Rhizobium changzhiense WYCCWR 11279 | Isolate | Nodule |
| 651 | 8005430974 | Rhizobium phaseoli Y20 | Isolate | Nodule |
| 652 | 8005484373 | Rhizobium tropici SARCC-755 | Isolate | Nodule |
| 653 | 8005497431 | Rhizobium phaseoli CCGM8 | Isolate | Unclassified |
| 654 | 8005542996 | Rhizobium grahamii CCGM3 | Isolate | Unclassified |
| 655 | 8005626139 | Rhizobium phaseoli Y18 | Isolate | Nodule |
| 656 | 8005645114 | Rhizobium tropici IGFRI Rhizo-19 | Isolate | Rhizosphere |
| 657 | 8005658619 | Rhizobium terrae CC-HIH110 | Isolate | Unclassified |
| 658 | 8005668836 | Rhizobium phaseoli CCGM9 | Isolate | Unclassified |
| 659 | 8005682033 | Rhizobium dioscoreae S-93 | Isolate | Unclassified |
| 660 | 8005688590 | Rhizobium bangladeshense 1024 | Isolate | Nodule |
| 661 | 8023680758 | Rhizobium leguminosarum SARCC-132 | Isolate | Nodule |
| 662 | 8024479707 | Rhizobium leguminosarum Tri-43 | Isolate | Nodule |
| 663 | 8024486573 | Rhizobium tubonense CCBAU 85046 | Isolate | Nodule |
| 664 | 8024501048 | Rhizobium sp. H4 | Isolate | Nodule |
| 665 | 8046767195 | Rhizobium calliandrae CCGE524 | Isolate | Unclassified |
| 666 | 8049293176 | Ensifer alkalisoli YIC4027 | Isolate | Nodule |
| 667 | 8054460903 | Agrobacterium vaccinii B7.6 | Isolate | Unclassified |
| 668 | 8054558443 | Rhizobium alarense TRM95111 | Isolate | Nodule |
| 669 | 8056375014 | Rhizobium redzepovicii 18T | Isolate | Nodule |
| 670 | 8056382006 | Rhizobium croatiense 13T | Isolate | Nodule |
| 671 | 8057575449 | Rhizobium mayense CCGE526 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 49.05 |
| Metatranscriptomes | 0 |
| Isolates | 50.95 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.56 |
| Bulb | 0 |
| Endosphere | 18.84 |
| Nodule | 40.13 |
| Rhizoplane | 2.12 |
| Rhizosphere | 20.4 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0214543_1000003 | 3300021327 | Bacteria | 692327 |
| 2 | JGI25156J39149_1000153 | 3300002705 | Bacteria | 50769 |
| 3 | JGI25162J39368_1001013 | 3300002737 | Bacteria | 17524 |
| 4 | JGI25162J39368_1001160 | 3300002737 | Bacteria | 15673 |
| 5 | JGI25154J39366_1000152 | 3300002738 | Bacteria | 53779 |
| 6 | JGI25157J39369_1000061 | 3300002741 | Bacteria | 105511 |
| 7 | JGI25152J39213_1002047 | 3300002773 | Bacteria | 7941 |
| 8 | JGI25152J39213_1002225 | 3300002773 | Bacteria | 7543 |
| 9 | JGI25152J39213_1002746 | 3300002773 | Bacteria | 6408 |
| 10 | JGI25150J39212_1000031 | 3300002774 | Bacteria | 100456 |
| 11 | JGI25150J39212_1003104 | 3300002774 | Bacteria | 3972 |
| 12 | JGI25159J45721_1000002 | 3300002987 | Bacteria | 289163 |
| 13 | JGI25159J45721_1003211 | 3300002987 | Bacteria | 5855 |
| 14 | JGI25159J45721_1006113 | 3300002987 | Bacteria | 3654 |
| 15 | JGI25151J46595_10000062 | 3300003187 | Bacteria | 146687 |
| 16 | JGI25165J46597_1001286 | 3300003214 | Bacteria | 14575 |
| 17 | JGI25165J46597_1001705 | 3300003214 | Bacteria | 9846 |
| 18 | JGI25153J46596_10003455 | 3300003215 | Bacteria | 8847 |
| 19 | JGI25153J46596_10003797 | 3300003215 | Bacteria | 8334 |
| 20 | rootL2_10003072 | 3300003322 | Bacteria | 8988 |
| 21 | rootH1_10039003 | 3300003316 | Unclassified | 3494 |
| 22 | rootH1_10039003 | 3300003323 | Bacteria | 2350 |
| 23 | rootH1_10109493 | 3300003323 | Bacteria | 2025 |
| 24 | JGI25160J50197_1000008 | 3300003354 | Bacteria | 289163 |
| 25 | JGI25160J50197_1000052 | 3300003354 | Bacteria | 127795 |
| 26 | JGI25160J50197_1003609 | 3300003354 | Bacteria | 6872 |
| 27 | JGI25160J50197_1007244 | 3300003354 | Bacteria | 4362 |
| 28 | JGI25161J50226_1000005 | 3300003374 | Bacteria | 292548 |
| 29 | JGI25161J50226_1000113 | 3300003374 | Bacteria | 63092 |
| 30 | JGI25161J50226_1000133 | 3300003374 | Bacteria | 52508 |
| 31 | JGI25161J50226_1000527 | 3300003374 | Bacteria | 16442 |
| 32 | Ga0055526_1002912 | 3300003771 | Bacteria | 11251 |
| 33 | Ga0055526_1010220 | 3300003771 | Bacteria | 4392 |
| 34 | Ga0055526_1021727 | 3300003771 | Bacteria | 2217 |
| 35 | Ga0055526_1021737 | 3300003771 | Bacteria | 2217 |
| 36 | Ga0055524_1003487 | 3300003775 | Bacteria | 7620 |
| 37 | Ga0055524_1008616 | 3300003775 | Bacteria | 4222 |
| 38 | Ga0055524_1013056 | 3300003775 | Bacteria | 3155 |
| 39 | Ga0055536_1001375 | 3300003781 | Bacteria | 14778 |
| 40 | Ga0055528_1000149 | 3300003790 | Bacteria | 57620 |
| 41 | Ga0055528_1002648 | 3300003790 | Bacteria | 9454 |
| 42 | Ga0055528_1003478 | 3300003790 | Bacteria | 7867 |
| 43 | Ga0055528_1032191 | 3300003790 | Bacteria | 1345 |
| 44 | Ga0055530_10007424 | 3300003791 | Bacteria | 4620 |
| 45 | Ga0055540_1000406 | 3300003792 | Bacteria | 34874 |
| 46 | Ga0055540_1003151 | 3300003792 | Bacteria | 8152 |
| 47 | Ga0055540_1021733 | 3300003792 | Bacteria | 1658 |
| 48 | Ga0055540_1022589 | 3300003792 | Bacteria | 1605 |
| 49 | Ga0055531_10006368 | 3300003794 | Bacteria | 6715 |
| 50 | Ga0058692_1004840 | 3300003856 | Bacteria | 3918 |
| 51 | Ga0058692_1008392 | 3300003856 | Bacteria | 2666 |
| 52 | Ga0055543_1000035 | 3300004625 | Bacteria | 127833 |
| 53 | Ga0055543_1000040 | 3300004625 | Bacteria | 122485 |
| 54 | Ga0055543_1000048 | 3300004625 | Bacteria | 109807 |
| 55 | Ga0065165_1000015 | 3300005262 | Bacteria | 289201 |
| 56 | Ga0065165_1000253 | 3300005262 | Bacteria | 92969 |
| 57 | Ga0065165_1041411 | 3300005262 | Bacteria | 1368 |
| 58 | Ga0065165_1042784 | 3300005262 | Bacteria | 1334 |
| 59 | Ga0070668_100215604 | 3300005347 | Bacteria | 1581 |
| 60 | Ga0070665_100045283 | 3300005548 | Bacteria | 4419 |
| 61 | Ga0068855_100132280 | 3300005563 | Bacteria | 2848 |
| 62 | Ga0068854_100248889 | 3300005578 | Bacteria | 1418 |
| 63 | Ga0075365_10032765 | 3300006038 | Bacteria | 3344 |
| 64 | Ga0075365_10170024 | 3300006038 | Bacteria | 1521 |
| 65 | Ga0075368_10015434 | 3300006042 | Bacteria | 2834 |
| 66 | Ga0075363_100012152 | 3300006048 | Bacteria | 4142 |
| 67 | Ga0075363_100028918 | 3300006048 | Bacteria | 2856 |
| 68 | Ga0075363_100175105 | 3300006048 | Bacteria | 1219 |
| 69 | Ga0075364_10018980 | 3300006051 | Bacteria | 4313 |
| 70 | Ga0075364_10071929 | 3300006051 | Bacteria | 2279 |
| 71 | Ga0075362_10167814 | 3300006177 | Bacteria | 1059 |
| 72 | Ga0075367_10064973 | 3300006178 | Bacteria | 2184 |
| 73 | Ga0075369_10017027 | 3300006186 | Bacteria | 2941 |
| 74 | Ga0075369_10168820 | 3300006186 | Bacteria | 1004 |
| 75 | Ga0075370_10092110 | 3300006353 | Bacteria | 1749 |
| 76 | Ga0079104_1002273 | 3300006946 | Bacteria | 10662 |
| 77 | Ga0079104_1005092 | 3300006946 | Bacteria | 5353 |
| 78 | Ga0099826_10024949 | 3300006948 | Bacteria | 4437 |
| 79 | Ga0105244_10137878 | 3300009036 | Bacteria | 1175 |
| 80 | Ga0105250_10011058 | 3300009092 | Bacteria | 3752 |
| 81 | Ga0105240_10000032 | 3300009093 | Bacteria | 283907 |
| 82 | Ga0105247_10070341 | 3300009101 | Bacteria | 2186 |
| 83 | Ga0105243_10730612 | 3300009148 | Bacteria | 968 |
| 84 | Ga0105248_10264104 | 3300009177 | Bacteria | 1938 |
| 85 | Ga0105237_10064526 | 3300009545 | Bacteria | 3658 |
| 86 | Ga0105249_10219610 | 3300009553 | Bacteria | 1870 |
| 87 | Ga0123340_1068017 | 3300009763 | Bacteria | 892 |
| 88 | Ga0123341_1000048 | 3300009765 | Bacteria | 50946 |
| 89 | Ga0123341_1105859 | 3300009765 | Bacteria | 901 |
| 90 | Ga0123341_1109245 | 3300009765 | Bacteria | 866 |
| 91 | Ga0123342_1007095 | 3300009766 | Bacteria | 15043 |
| 92 | Ga0123342_1029411 | 3300009766 | Bacteria | 2856 |
| 93 | Ga0105239_10004104 | 3300010375 | Bacteria | 17509 |
| 94 | Ga0105239_10878567 | 3300010375 | Bacteria | 1029 |
| 95 | Ga0157373_10002050 | 3300013100 | Bacteria | 15264 |
| 96 | Ga0157371_10000380 | 3300013102 | Bacteria | 55836 |
| 97 | Ga0157371_10009535 | 3300013102 | Bacteria | 7635 |
| 98 | Ga0157370_10000748 | 3300013104 | Bacteria | 40596 |
| 99 | Ga0157370_10000986 | 3300013104 | Bacteria | 35999 |
| 100 | Ga0157369_10040067 | 3300013105 | Bacteria | 5117 |
| 101 | Ga0157369_10159803 | 3300013105 | Bacteria | 2379 |
| 102 | Ga0157369_10783606 | 3300013105 | Bacteria | 980 |
| 103 | Ga0171463_1001 | 3300013249 | Bacteria | 1406070 |
| 104 | Ga0182008_10037378 | 3300014497 | Bacteria | 2429 |
| 105 | Ga0182007_10009078 | 3300015262 | Bacteria | 4042 |
| 106 | Ga0183363_1336 | 3300015690 | Bacteria | 5813 |
| 107 | Ga0214544_1008762 | 3300021320 | Bacteria | 16495 |
| 108 | Ga0214542_1000006 | 3300021321 | Bacteria | 345164 |
| 109 | Ga0214542_1016338 | 3300021321 | Bacteria | 7243 |
| 110 | Ga0214543_1000014 | 3300021327 | Bacteria | 324986 |
| 111 | Ga0228711_1000001 | 3300022739 | Bacteria | 357377 |
| 112 | Ga0228710_1000001 | 3300022740 | Bacteria | 314328 |
| 113 | Ga0209435_100042 | 3300025206 | Bacteria | 105563 |
| 114 | Ga0209436_100064 | 3300025208 | Bacteria | 56015 |
| 115 | Ga0209436_101965 | 3300025208 | Bacteria | 6580 |
| 116 | Ga0209436_114010 | 3300025208 | Bacteria | 1292 |
| 117 | Ga0209437_100075 | 3300025233 | Bacteria | 297202 |
| 118 | Ga0209437_104465 | 3300025233 | Bacteria | 2464 |
| 119 | Ga0207425_1000031 | 3300025245 | Bacteria | 261181 |
| 120 | Ga0207425_1010912 | 3300025245 | Bacteria | 2192 |
| 121 | Ga0209646_1000145 | 3300025246 | Bacteria | 105563 |
| 122 | Ga0209646_1015396 | 3300025246 | Bacteria | 1142 |
| 123 | Ga0209026_1000160 | 3300025250 | Bacteria | 105563 |
| 124 | Ga0209759_1000177 | 3300025256 | Bacteria | 105563 |
| 125 | Ga0209129_1000053 | 3300025258 | Bacteria | 262823 |
| 126 | Ga0209129_1000362 | 3300025258 | Bacteria | 37617 |
| 127 | Ga0209129_1000592 | 3300025258 | Bacteria | 24759 |
| 128 | Ga0209129_1003898 | 3300025258 | Bacteria | 6203 |
| 129 | Ga0209129_1005412 | 3300025258 | Bacteria | 4532 |
| 130 | Ga0209129_1008053 | 3300025258 | Bacteria | 2999 |
| 131 | Ga0209233_1000056 | 3300025261 | Bacteria | 438104 |
| 132 | Ga0209233_1000064 | 3300025261 | Bacteria | 392156 |
| 133 | Ga0209233_1000209 | 3300025261 | Bacteria | 115124 |
| 134 | Ga0209455_1021847 | 3300025272 | Bacteria | 1232 |
| 135 | Ga0209673_1000041 | 3300025273 | Bacteria | 307397 |
| 136 | Ga0209673_1001371 | 3300025273 | Bacteria | 23980 |
| 137 | Ga0209673_1002349 | 3300025273 | Bacteria | 13347 |
| 138 | Ga0209673_1004542 | 3300025273 | Bacteria | 7382 |
| 139 | Ga0209673_1004827 | 3300025273 | Bacteria | 7064 |
| 140 | Ga0209673_1040928 | 3300025273 | Bacteria | 1321 |
| 141 | Ga0209130_1000006 | 3300025284 | Bacteria | 596528 |
| 142 | Ga0209130_1000007 | 3300025284 | Bacteria | 591584 |
| 143 | Ga0209130_1000018 | 3300025284 | Bacteria | 388301 |
| 144 | Ga0209676_1002385 | 3300025292 | Bacteria | 13465 |
| 145 | Ga0209676_1010840 | 3300025292 | Bacteria | 3744 |
| 146 | Ga0209676_1021427 | 3300025292 | Bacteria | 2171 |
| 147 | Ga0209025_1000074 | 3300025294 | Bacteria | 277445 |
| 148 | Ga0209025_1000080 | 3300025294 | Bacteria | 267244 |
| 149 | Ga0209025_1000087 | 3300025294 | Bacteria | 261181 |
| 150 | Ga0209025_1000100 | 3300025294 | Bacteria | 229182 |
| 151 | Ga0209025_1001310 | 3300025294 | Bacteria | 33978 |
| 152 | Ga0209025_1001555 | 3300025294 | Bacteria | 29161 |
| 153 | Ga0209025_1004857 | 3300025294 | Bacteria | 11340 |
| 154 | Ga0209025_1022221 | 3300025294 | Bacteria | 3375 |
| 155 | Ga0209025_1039784 | 3300025294 | Bacteria | 2046 |
| 156 | Ga0209025_1082794 | 3300025294 | Bacteria | 1082 |
| 157 | Ga0209564_1000439 | 3300025295 | Bacteria | 71637 |
| 158 | Ga0209564_1006429 | 3300025295 | Bacteria | 6339 |
| 159 | Ga0209564_1034872 | 3300025295 | Bacteria | 1467 |
| 160 | Ga0209564_1039856 | 3300025295 | Bacteria | 1284 |
| 161 | Ga0209758_1000081 | 3300025297 | Bacteria | 261181 |
| 162 | Ga0209758_1000737 | 3300025297 | Bacteria | 47765 |
| 163 | Ga0209758_1001677 | 3300025297 | Bacteria | 24975 |
| 164 | Ga0209758_1001702 | 3300025297 | Bacteria | 24700 |
| 165 | Ga0209758_1002164 | 3300025297 | Bacteria | 20648 |
| 166 | Ga0209758_1009144 | 3300025297 | Bacteria | 6236 |
| 167 | Ga0209758_1081554 | 3300025297 | Bacteria | 977 |
| 168 | Ga0209050_1001222 | 3300025298 | Bacteria | 29857 |
| 169 | Ga0209256_1002838 | 3300025299 | Bacteria | 13211 |
| 170 | Ga0209256_1002860 | 3300025299 | Bacteria | 13140 |
| 171 | Ga0209256_1003649 | 3300025299 | Bacteria | 10538 |
| 172 | Ga0209256_1007502 | 3300025299 | Bacteria | 5357 |
| 173 | Ga0209256_1010546 | 3300025299 | Bacteria | 3848 |
| 174 | Ga0207426_1000044 | 3300025302 | Bacteria | 428043 |
| 175 | Ga0207426_1000064 | 3300025302 | Bacteria | 358276 |
| 176 | Ga0207426_1000106 | 3300025302 | Bacteria | 244368 |
| 177 | Ga0207426_1000652 | 3300025302 | Bacteria | 42638 |
| 178 | Ga0209051_1000514 | 3300025303 | Bacteria | 48877 |
| 179 | Ga0209051_1001543 | 3300025303 | Bacteria | 19097 |
| 180 | Ga0209051_1002756 | 3300025303 | Bacteria | 12142 |
| 181 | Ga0209051_1012403 | 3300025303 | Bacteria | 4125 |
| 182 | Ga0209051_1043897 | 3300025303 | Bacteria | 1563 |
| 183 | Ga0209257_1001514 | 3300025304 | Bacteria | 27239 |
| 184 | Ga0207695_10000024 | 3300025913 | Bacteria | 632311 |
| 185 | Ga0207671_10000548 | 3300025914 | Bacteria | 50646 |
| 186 | Ga0207650_10002848 | 3300025925 | Bacteria | 11943 |
| 187 | Ga0207668_10763071 | 3300025972 | Bacteria | 854 |
| 188 | Ga0207702_10124998 | 3300026078 | Bacteria | 2307 |
| 189 | Ga0207702_10438948 | 3300026078 | Bacteria | 1265 |
| 190 | Ga0209281_1000266 | 3300027111 | Bacteria | 100574 |
| 191 | Ga0209281_1000332 | 3300027111 | Bacteria | 81534 |
| 192 | Ga0209371_1000021 | 3300027312 | Bacteria | 555864 |
| 193 | Ga0209371_1000714 | 3300027312 | Bacteria | 28089 |
| 194 | Ga0209371_1000939 | 3300027312 | Bacteria | 22794 |
| 195 | Ga0209371_1001387 | 3300027312 | Bacteria | 16641 |
| 196 | Ga0209371_1002086 | 3300027312 | Bacteria | 11883 |
| 197 | Ga0209282_1000007 | 3300027666 | Bacteria | 254917 |
| 198 | Ga0209282_1001768 | 3300027666 | Bacteria | 12106 |
| 199 | Ga0209282_1010070 | 3300027666 | Bacteria | 5975 |
| 200 | Ga0268266_10002687 | 3300028379 | Bacteria | 18670 |
| 201 | Ga0307515_10000070 | 3300028794 | Bacteria | 239322 |
| 202 | Ga0307515_10005751 | 3300028794 | Bacteria | 25053 |
| 203 | Ga0307515_10009829 | 3300028794 | Bacteria | 18427 |
| 204 | Ga0268256_1000020 | 3300030500 | Bacteria | 557873 |
| 205 | Ga0268256_1002318 | 3300030500 | Bacteria | 9849 |
| 206 | Ga0268256_1002341 | 3300030500 | Bacteria | 9769 |
| 207 | Ga0316181_1214954 | 3300030744 | Bacteria | 2409 |
| 208 | Ga0307513_10078688 | 3300031456 | Bacteria | 3409 |
| 209 | Ga0307513_10408317 | 3300031456 | Bacteria | 1091 |
| 210 | Ga0307513_10511683 | 3300031456 | Bacteria | 917 |
| 211 | Ga0307408_100039259 | 3300031548 | Bacteria | 3345 |
| 212 | Ga0307405_10095640 | 3300031731 | Bacteria | 1979 |
| 213 | Ga0307405_10200800 | 3300031731 | Bacteria | 1448 |
| 214 | Ga0307406_10069253 | 3300031901 | Bacteria | 2306 |
| 215 | Ga0307412_10399895 | 3300031911 | Bacteria | 1118 |
| 216 | Ga0315914_1000006 | 3300031967 | Bacteria | 239817 |
| 217 | Ga0307414_10307266 | 3300032004 | Bacteria | 1344 |
| 218 | Ga0315913_1000002 | 3300033430 | Bacteria | 241452 |
| 219 | Ga0315915_1000001 | 3300033464 | Bacteria | 481518 |
| 220 | Ga0439436_0009726 | 3300041404 | Bacteria | 2943 |
| 221 | Ga0439438_018012 | 3300041405 | Bacteria | 2020 |
| 222 | Ga0439439_0049938 | 3300041406 | Bacteria | 1095 |
| 223 | Ga0439439_0067162 | 3300041406 | Bacteria | 957 |
| 224 | Ga0439465_0005455 | 3300041413 | Bacteria | 4060 |
| 225 | Ga0439465_0013230 | 3300041413 | Bacteria | 2576 |
| 226 | Ga0439465_0021873 | 3300041413 | Bacteria | 2007 |
| 227 | Ga0439449_0004950 | 3300042007 | Bacteria | 5127 |
| 228 | Ga0439449_0027972 | 3300042007 | Bacteria | 2103 |
| 229 | Ga0439449_0090931 | 3300042007 | Bacteria | 1127 |
| 230 | Ga0439452_041598 | 3300042010 | Bacteria | 1080 |
| 231 | Ga0439462_0008441 | 3300042015 | Bacteria | 2597 |
| 232 | Ga0450920_028546 | 3300042122 | Bacteria | 1094 |
| 233 | Ga0450918_004033 | 3300042531 | Bacteria | 2696 |
| 234 | Ga0466967_0451317 | 3300045976 | Bacteria | 1257 |
| 235 | Ga0495627_041695 | 3300046453 | Bacteria | 1409 |
| 236 | Ga0495592_0054665 | 3300046454 | Bacteria | 2957 |
| 237 | Ga0495629_0020032 | 3300046459 | Bacteria | 4775 |
| 238 | Ga0495638_0000353 | 3300046460 | Bacteria | 57451 |
| 239 | Ga0495638_0023768 | 3300046460 | Bacteria | 4004 |
| 240 | Ga0495638_0023957 | 3300046460 | Bacteria | 3985 |
| 241 | Ga0495638_0103718 | 3300046460 | Bacteria | 1697 |
| 242 | Ga0495650_0030215 | 3300046471 | Bacteria | 2457 |
| 243 | Ga0495650_0117436 | 3300046471 | Bacteria | 982 |
| 244 | Ga0495605_0003895 | 3300046474 | Bacteria | 8843 |
| 245 | Ga0495605_0139735 | 3300046474 | Bacteria | 1087 |
| 246 | Ga0495662_0001957 | 3300046476 | Bacteria | 10343 |
| 247 | Ga0495664_0131601 | 3300046477 | Bacteria | 1515 |
| 248 | Ga0495585_0004076 | 3300046492 | Bacteria | 9596 |
| 249 | Ga0495607_0019235 | 3300046501 | Bacteria | 4340 |
| 250 | Ga0495583_0002283 | 3300046506 | Bacteria | 16772 |
| 251 | Ga0495583_0112426 | 3300046506 | Bacteria | 1153 |
| 252 | Ga0495606_0015262 | 3300046507 | Bacteria | 5930 |
| 253 | Ga0495606_0045156 | 3300046507 | Bacteria | 2923 |
| 254 | Ga0495606_0072624 | 3300046507 | Bacteria | 2161 |
| 255 | Ga0495606_0096192 | 3300046507 | Bacteria | 1812 |
| 256 | Ga0495606_0175183 | 3300046507 | Bacteria | 1241 |
| 257 | Ga0495610_0002493 | 3300046512 | Bacteria | 15389 |
| 258 | Ga0495610_0002941 | 3300046512 | Bacteria | 13760 |
| 259 | Ga0495610_0045308 | 3300046512 | Bacteria | 2177 |
| 260 | Ga0495620_0007860 | 3300046515 | Bacteria | 5754 |
| 261 | Ga0495620_0011636 | 3300046515 | Bacteria | 4581 |
| 262 | Ga0495620_0142101 | 3300046515 | Bacteria | 938 |
| 263 | Ga0495631_0054359 | 3300046518 | Bacteria | 1746 |
| 264 | Ga0495632_0010045 | 3300046519 | Bacteria | 5640 |
| 265 | Ga0495643_0017310 | 3300046522 | Bacteria | 4215 |
| 266 | Ga0495643_0028312 | 3300046522 | Bacteria | 3142 |
| 267 | Ga0495643_0041252 | 3300046522 | Bacteria | 2517 |
| 268 | Ga0495643_0076128 | 3300046522 | Bacteria | 1755 |
| 269 | Ga0495648_0166355 | 3300046524 | Bacteria | 1135 |
| 270 | Ga0495587_0078106 | 3300046536 | Bacteria | 1921 |
| 271 | Ga0495609_0034081 | 3300046538 | Bacteria | 2309 |
| 272 | Ga0495609_0065063 | 3300046538 | Bacteria | 1608 |
| 273 | Ga0495622_0024264 | 3300046557 | Bacteria | 2832 |
| 274 | Ga0495656_0005975 | 3300046615 | Bacteria | 4235 |
| 275 | Ga0495668_0011053 | 3300046616 | Bacteria | 5426 |
| 276 | Ga0495611_0046435 | 3300046648 | Bacteria | 1947 |
| 277 | Ga0495625_0002953 | 3300046660 | Bacteria | 17720 |
| 278 | Ga0495625_0098360 | 3300046660 | Bacteria | 2013 |
| 279 | Ga0495625_0111291 | 3300046660 | Bacteria | 1871 |
| 280 | Ga0495625_0170050 | 3300046660 | Bacteria | 1456 |
| 281 | Ga0495625_0410637 | 3300046660 | Bacteria | 844 |
| 282 | Ga0495661_0230077 | 3300046665 | Bacteria | 956 |
| 283 | Ga0495588_0002348 | 3300046674 | Bacteria | 8102 |
| 284 | Ga0495657_0084561 | 3300046675 | Bacteria | 2046 |
| 285 | Ga0495646_0060439 | 3300046680 | Bacteria | 2260 |
| 286 | Ga0495658_0016347 | 3300046683 | Bacteria | 3820 |
| 287 | Ga0495671_0005749 | 3300046692 | Bacteria | 7230 |
| 288 | Ga0495649_0016416 | 3300046694 | Bacteria | 4196 |
| 289 | Ga0495600_0208314 | 3300046809 | Bacteria | 1253 |
| 290 | Ga0495660_0011331 | 3300046810 | Bacteria | 5176 |
| 291 | Ga0495660_0064545 | 3300046810 | Bacteria | 1957 |
| 292 | Ga0495604_0022047 | 3300047317 | Bacteria | 5084 |
| 293 | Ga0495636_0008083 | 3300047318 | Bacteria | 4145 |
| 294 | Ga0495636_0036703 | 3300047318 | Bacteria | 2022 |
| 295 | Ga0495674_0606196 | 3300047319 | Bacteria | 867 |
| 296 | Ga0495672_0019712 | 3300047320 | Bacteria | 4443 |
| 297 | Ga0495687_012527 | 3300047443 | Bacteria | 4477 |
| 298 | Ga0495681_0003515 | 3300047470 | Bacteria | 10888 |
| 299 | Ga0495681_0027899 | 3300047470 | Bacteria | 2915 |
| 300 | Ga0495686_0001094 | 3300047472 | Bacteria | 32227 |
| 301 | Ga0495686_0019106 | 3300047472 | Bacteria | 4583 |
| 302 | Ga0495686_0020261 | 3300047472 | Bacteria | 4435 |
| 303 | Ga0495686_0082205 | 3300047472 | Bacteria | 1966 |
| 304 | Ga0495686_0242667 | 3300047472 | Bacteria | 1015 |
| 305 | Ga0496100_0030953 | 3300048903 | Bacteria | 3323 |
| 306 | Ga0496101_0040266 | 3300048904 | Bacteria | 3328 |
| 307 | Ga0496102_0009938 | 3300048905 | Bacteria | 8184 |
| 308 | Ga0496103_0016955 | 3300048906 | Bacteria | 4351 |
| 309 | Ga0496104_0081484 | 3300048907 | Bacteria | 3086 |
| 310 | Ga0496105_0024101 | 3300048908 | Bacteria | 4942 |
| 311 | Ga0496106_0000154 | 3300048909 | Bacteria | 50775 |
| 312 | Ga0496110_0020523 | 3300048913 | Bacteria | 5579 |
| 313 | Ga0496110_0569989 | 3300048913 | Bacteria | 1028 |
| 314 | Ga0496113_0030606 | 3300048916 | Bacteria | 3898 |
| 315 | Ga0496113_0184075 | 3300048916 | Bacteria | 1656 |
| 316 | Ga0496116_0000036 | 3300048919 | Bacteria | 388508 |
| 317 | Ga0496116_0008404 | 3300048919 | Bacteria | 8961 |
| 318 | Ga0496116_0028293 | 3300048919 | Bacteria | 4063 |
| 319 | Ga0496116_0035383 | 3300048919 | Bacteria | 3508 |
| 320 | Ga0496116_0042428 | 3300048919 | Bacteria | 3109 |
| 321 | Ga0496116_0052565 | 3300048919 | Bacteria | 2698 |
| 322 | Ga0496116_0145435 | 3300048919 | Bacteria | 1326 |
| 323 | Ga0496116_0146612 | 3300048919 | Bacteria | 1318 |
| 324 | Ga0496117_0000002 | 3300048920 | Bacteria | 2483758 |
| 325 | Ga0496117_0003863 | 3300048920 | Bacteria | 17044 |
| 326 | Ga0496117_0023642 | 3300048920 | Bacteria | 4889 |
| 327 | Ga0496117_0038413 | 3300048920 | Bacteria | 3550 |
| 328 | Ga0496117_0139004 | 3300048920 | Bacteria | 1458 |
| 329 | Ga0496118_0000214 | 3300048921 | Bacteria | 100898 |
| 330 | Ga0496118_0000695 | 3300048921 | Bacteria | 54668 |
| 331 | Ga0496118_0016185 | 3300048921 | Bacteria | 6855 |
| 332 | Ga0496118_0055406 | 3300048921 | Bacteria | 2992 |
| 333 | Ga0496118_0172834 | 3300048921 | Bacteria | 1317 |
| 334 | Ga0496119_0019601 | 3300048922 | Bacteria | 4970 |
| 335 | Ga0496119_0024841 | 3300048922 | Bacteria | 4201 |
| 336 | Ga0496119_0037148 | 3300048922 | Bacteria | 3168 |
| 337 | Ga0496119_0050740 | 3300048922 | Bacteria | 2554 |
| 338 | Ga0496120_0000125 | 3300048923 | Bacteria | 128983 |
| 339 | Ga0496120_0011557 | 3300048923 | Bacteria | 6063 |
| 340 | Ga0496120_0019199 | 3300048923 | Bacteria | 4381 |
| 341 | Ga0496121_0000001 | 3300048924 | Bacteria | 1830318 |
| 342 | Ga0496121_0001632 | 3300048924 | Bacteria | 37117 |
| 343 | Ga0496121_0008842 | 3300048924 | Bacteria | 11731 |
| 344 | Ga0496121_0056492 | 3300048924 | Bacteria | 3260 |
| 345 | Ga0496121_0064083 | 3300048924 | Bacteria | 2998 |
| 346 | Ga0496121_0100649 | 3300048924 | Bacteria | 2230 |
| 347 | Ga0496121_0123759 | 3300048924 | Bacteria | 1948 |
| 348 | Ga0496121_0253687 | 3300048924 | Bacteria | 1218 |
| 349 | Ga0496121_0291130 | 3300048924 | Bacteria | 1112 |
| 350 | Ga0496122_0000001 | 3300048925 | Bacteria | 1827766 |
| 351 | Ga0496122_0003139 | 3300048925 | Bacteria | 22132 |
| 352 | Ga0496122_0011597 | 3300048925 | Bacteria | 8896 |
| 353 | Ga0496122_0015314 | 3300048925 | Bacteria | 7337 |
| 354 | Ga0496122_0029200 | 3300048925 | Bacteria | 4657 |
| 355 | Ga0496122_0039743 | 3300048925 | Bacteria | 3747 |
| 356 | Ga0496122_0046659 | 3300048925 | Bacteria | 3352 |
| 357 | Ga0496122_0085214 | 3300048925 | Bacteria | 2181 |
| 358 | Ga0496122_0158141 | 3300048925 | Bacteria | 1386 |
| 359 | Ga0496123_0000001 | 3300048926 | Bacteria | 1831497 |
| 360 | Ga0496123_0014608 | 3300048926 | Bacteria | 6493 |
| 361 | Ga0496123_0031063 | 3300048926 | Bacteria | 3895 |
| 362 | Ga0496123_0043197 | 3300048926 | Bacteria | 3099 |
| 363 | Ga0496123_0044820 | 3300048926 | Bacteria | 3020 |
| 364 | Ga0496123_0045608 | 3300048926 | Bacteria | 2984 |
| 365 | Ga0496123_0065335 | 3300048926 | Bacteria | 2313 |
| 366 | Ga0496123_0081819 | 3300048926 | Bacteria | 1960 |
| 367 | Ga0496124_0000349 | 3300048927 | Bacteria | 84498 |
| 368 | Ga0496124_0003191 | 3300048927 | Bacteria | 20248 |
| 369 | Ga0496124_0007143 | 3300048927 | Bacteria | 11954 |
| 370 | Ga0496124_0019584 | 3300048927 | Bacteria | 6289 |
| 371 | Ga0496124_0028228 | 3300048927 | Bacteria | 5022 |
| 372 | Ga0496124_0028358 | 3300048927 | Bacteria | 5009 |
| 373 | Ga0496124_0051756 | 3300048927 | Bacteria | 3492 |
| 374 | Ga0496124_0067367 | 3300048927 | Bacteria | 2979 |
| 375 | Ga0496124_0081804 | 3300048927 | Bacteria | 2652 |
| 376 | Ga0496124_0137086 | 3300048927 | Bacteria | 1936 |
| 377 | Ga0496124_0227902 | 3300048927 | Bacteria | 1395 |
| 378 | Ga0496125_0000001 | 3300048928 | Bacteria | 1766138 |
| 379 | Ga0496125_0030512 | 3300048928 | Bacteria | 4821 |
| 380 | Ga0496125_0037930 | 3300048928 | Bacteria | 4182 |
| 381 | Ga0496125_0040651 | 3300048928 | Bacteria | 3985 |
| 382 | Ga0496125_0057948 | 3300048928 | Bacteria | 3132 |
| 383 | Ga0496125_0075324 | 3300048928 | Bacteria | 2612 |
| 384 | Ga0496125_0173303 | 3300048928 | Bacteria | 1447 |
| 385 | Ga0496126_0000156 | 3300048929 | Bacteria | 158537 |
| 386 | Ga0496126_0015545 | 3300048929 | Bacteria | 7648 |
| 387 | Ga0496126_0022022 | 3300048929 | Bacteria | 6209 |
| 388 | Ga0496126_0042324 | 3300048929 | Bacteria | 4207 |
| 389 | Ga0496126_0044809 | 3300048929 | Bacteria | 4070 |
| 390 | Ga0496126_0136926 | 3300048929 | Bacteria | 2111 |
| 391 | Ga0495678_018576 | 3300049459 | Bacteria | 3122 |
| 392 | Ga0501032_0142497 | 3300049569 | Bacteria | 1578 |
| 393 | Ga0501036_0190742 | 3300049572 | Bacteria | 1724 |
| 394 | Ga0501037_0357475 | 3300049573 | Bacteria | 1006 |
| 395 | Ga0501038_0035728 | 3300049574 | Bacteria | 4362 |
| 396 | Ga0501039_0030216 | 3300049575 | Bacteria | 4177 |
| 397 | Ga0501043_0048985 | 3300049579 | Bacteria | 3321 |
| 398 | Ga0501080_0197346 | 3300049742 | Bacteria | 1848 |
| 399 | Ga0501044_0085835 | 3300049823 | Bacteria | 3180 |
| 400 | nmdc:mga03683_13499_c1 | 3300050489 | Bacteria | 3008 |
| 401 | nmdc:mga03n38_277182_c1 | 3300050490 | Bacteria | 894 |
| 402 | nmdc:mga00v17_187_c1 | 3300050491 | Bacteria | 37112 |
| 403 | nmdc:mga00v17_38216_c1 | 3300050491 | Bacteria | 2869 |
| 404 | nmdc:mga00v17_97953_c1 | 3300050491 | Bacteria | 1849 |
| 405 | nmdc:mga0yw44_66884_c1 | 3300050492 | Bacteria | 2219 |
| 406 | nmdc:mga06z11_141938_c1 | 3300050494 | Bacteria | 1359 |
| 407 | nmdc:mga07m45_163483_c1 | 3300050496 | Bacteria | 1293 |
| 408 | nmdc:mga07m45_199365_c1 | 3300050496 | Bacteria | 1164 |
| 409 | nmdc:mga07m45_214477_c1 | 3300050496 | Bacteria | 1120 |
| 410 | nmdc:mga0sz30_56083_c1 | 3300050516 | Bacteria | 1677 |
| 411 | nmdc:mga0sz30_839_c1 | 3300050516 | Bacteria | 11098 |
| 412 | Ga0500578_0207158 | 3300053086 | Bacteria | 1197 |
| 413 | Ga0500578_0291571 | 3300053086 | Bacteria | 970 |
| 414 | Ga0500644_0017456 | 3300053088 | Bacteria | 2084 |
| 415 | Ga0500651_0206886 | 3300053093 | Bacteria | 1156 |
| 416 | Ga0500557_000546 | 3300053105 | Bacteria | 5068 |
| 417 | Ga0500560_003419 | 3300053107 | Bacteria | 3207 |
| 418 | Ga0500560_015522 | 3300053107 | Bacteria | 2056 |
| 419 | Ga0500569_000769 | 3300053109 | Bacteria | 5615 |
| 420 | Ga0500569_012526 | 3300053109 | Bacteria | 2054 |
| 421 | Ga0500572_002424 | 3300053111 | Bacteria | 4490 |
| 422 | Ga0500594_0004786 | 3300053118 | Bacteria | 2991 |
| 423 | Ga0500608_030543 | 3300053122 | Bacteria | 2554 |
| 424 | Ga0500618_008277 | 3300053125 | Bacteria | 2912 |
| 425 | Ga0500618_025679 | 3300053125 | Bacteria | 1411 |
| 426 | Ga0500658_0003389 | 3300053134 | Bacteria | 6029 |
| 427 | Ga0500559_0068113 | 3300053136 | Bacteria | 1598 |
| 428 | Ga0500561_0000280 | 3300053137 | Bacteria | 8887 |
| 429 | Ga0500568_0000565 | 3300053139 | Bacteria | 27186 |
| 430 | Ga0500568_0000811 | 3300053139 | Bacteria | 21961 |
| 431 | Ga0500588_0012449 | 3300053146 | Bacteria | 2110 |
| 432 | Ga0500590_002679 | 3300053148 | Bacteria | 7994 |
| 433 | Ga0500616_0005562 | 3300053153 | Bacteria | 8526 |
| 434 | Ga0500622_0000322 | 3300053156 | Bacteria | 48225 |
| 435 | Ga0500622_0004590 | 3300053156 | Bacteria | 8600 |
| 436 | Ga0500624_000569 | 3300053157 | Bacteria | 10203 |
| 437 | Ga0500633_0000343 | 3300053160 | Bacteria | 7038 |
| 438 | Ga0500634_0001745 | 3300053161 | Bacteria | 8717 |
| 439 | Ga0500634_0015611 | 3300053161 | Bacteria | 4037 |
| 440 | Ga0500636_0000004 | 3300053177 | Bacteria | 202392 |
| 441 | Ga0500636_0008484 | 3300053177 | Bacteria | 5959 |
| 442 | 2509108498 | 2508501122 | Bacteria | 6292184 |
| 443 | 2509374475 | 2509276019 | Bacteria | 6802256 |
| 444 | 2509387744 | 2509276021 | Bacteria | 7634384 |
| 445 | 2509443105 | 2509276033 | Bacteria | 7180565 |
| 446 | 2510132273 | 2510065019 | Bacteria | 6903379 |
| 447 | 2510306632 | 2510065057 | Bacteria | 6649661 |
| 448 | 2511133519 | 2510917022 | Bacteria | 6504556 |
| 449 | 2511183369 | 2510917028 | Bacteria | 6185411 |
| 450 | 2511197228 | 2510917030 | Bacteria | 7460662 |
| 451 | 2511500996 | 2511231052 | Bacteria | 6974333 |
| 452 | 2512532409 | 2512047086 | Bacteria | 6850303 |
| 453 | 2512972266 | 2512875026 | Bacteria | 6861065 |
| 454 | 2513580747 | 2513237085 | Bacteria | 7695351 |
| 455 | 2513583464 | 2513237086 | Bacteria | 7265287 |
| 456 | 2513596220 | 2513237088 | Bacteria | 6927906 |
| 457 | 2513603345 | 2513237089 | Bacteria | 6553624 |
| 458 | 2513618927 | 2513237091 | Bacteria | 6900273 |
| 459 | 2513632781 | 2513237093 | Bacteria | 7545552 |
| 460 | 2513709232 | 2513237103 | Bacteria | 7647401 |
| 461 | 2513868738 | 2513237138 | Bacteria | 7368160 |
| 462 | 2513881115 | 2513237140 | Bacteria | 7076289 |
| 463 | 2513902351 | 2513237143 | Bacteria | 6664116 |
| 464 | 2513983950 | 2513237156 | Bacteria | 6402557 |
| 465 | 2513999545 | 2513237159 | Bacteria | 6810126 |
| 466 | 2514004800 | 2513237160 | Bacteria | 6650282 |
| 467 | 2515608108 | 2515154107 | Bacteria | 6795637 |
| 468 | 2515740435 | 2515154134 | Bacteria | 7220242 |
| 469 | 2516208862 | 2516143018 | Bacteria | 6951533 |
| 470 | 2516892278 | 2516653046 | Bacteria | 6989037 |
| 471 | 2517075440 | 2516653085 | Bacteria | 7346596 |
| 472 | 2517405843 | 2517287029 | Bacteria | 6905599 |
| 473 | 2517569069 | 2517487022 | Bacteria | 7227575 |
| 474 | 2524451154 | 2524023207 | Bacteria | 6813453 |
| 475 | 2524460679 | 2524023209 | Bacteria | 6679728 |
| 476 | 2535515689 | 2534681796 | Bacteria | 7146037 |
| 477 | 2537874050 | 2537561587 | Bacteria | 5425293 |
| 478 | 2551676457 | 2551306084 | Bacteria | 8942552 |
| 479 | 2551687186 | 2551306085 | Bacteria | 7347181 |
| 480 | 2551693802 | 2551306086 | Bacteria | 6843938 |
| 481 | 2551704617 | 2551306087 | Bacteria | 7351905 |
| 482 | 2551715563 | 2551306089 | Bacteria | 7162724 |
| 483 | 2551720647 | 2551306090 | Bacteria | 7953713 |
| 484 | 2551725407 | 2551306091 | Bacteria | 7086830 |
| 485 | 2551734345 | 2551306092 | Bacteria | 6992595 |
| 486 | 2551740426 | 2551306093 | Bacteria | 7064773 |
| 487 | 2554247082 | 2554235003 | Bacteria | 5877155 |
| 488 | 2558863502 | 2558860100 | Bacteria | 8458965 |
| 489 | 2559294306 | 2558860242 | Bacteria | 5568029 |
| 490 | 2561466031 | 2558860983 | Bacteria | 4133860 |
| 491 | 2585165522 | 2582581283 | Bacteria | 6030556 |
| 492 | 2585203049 | 2582581294 | Bacteria | 6626667 |
| 493 | 2585220967 | 2582581298 | Bacteria | 7315509 |
| 494 | 2585231524 | 2582581299 | Bacteria | 6518058 |
| 495 | 2585273289 | 2582581307 | Bacteria | 6597605 |
| 496 | 2585278876 | 2582581308 | Bacteria | 7413247 |
| 497 | 2585325510 | 2582581315 | Bacteria | 7318924 |
| 498 | 2585329664 | 2582581316 | Bacteria | 7774528 |
| 499 | 2585392691 | 2582581866 | Bacteria | 6859583 |
| 500 | 2585400155 | 2582581867 | Bacteria | 7184437 |
| 501 | 2585527937 | 2585427526 | Bacteria | 7258840 |
| 502 | 2585530674 | 2585427527 | Bacteria | 7273426 |
| 503 | 2585549933 | 2585427529 | Bacteria | 7395659 |
| 504 | 2585554854 | 2585427530 | Bacteria | 7383882 |
| 505 | 2585559411 | 2585427531 | Bacteria | 6992870 |
| 506 | 2585822714 | 2585427590 | Bacteria | 6824633 |
| 507 | 2585847247 | 2585427594 | Bacteria | 6180594 |
| 508 | 2585902081 | 2585427608 | Bacteria | 6544331 |
| 509 | 2585905213 | 2585427609 | Bacteria | 6667127 |
| 510 | 2587979672 | 2585428125 | Bacteria | 6662905 |
| 511 | 2599333798 | 2599185156 | Bacteria | 5403036 |
| 512 | 2599602629 | 2599185210 | Bacteria | 5624189 |
| 513 | 2599723104 | 2599185236 | Bacteria | 6875203 |
| 514 | 2600191911 | 2599185352 | Bacteria | 7228948 |
| 515 | 2601608706 | 2600255279 | Bacteria | 5605316 |
| 516 | 2601745480 | 2600255308 | Bacteria | 5611129 |
| 517 | 2616305850 | 2615840626 | Bacteria | 7921970 |
| 518 | 2616553908 | 2615840698 | Bacteria | 7319877 |
| 519 | 2617383834 | 2617270742 | Bacteria | 6808054 |
| 520 | 2643807224 | 2643221557 | Bacteria | 7184309 |
| 521 | 2643855896 | 2643221568 | Bacteria | 5187270 |
| 522 | 2643918681 | 2643221582 | Bacteria | 5804683 |
| 523 | 2644069510 | 2643221610 | Bacteria | 7480339 |
| 524 | 2644109014 | 2643221618 | Bacteria | 7717186 |
| 525 | 2644151536 | 2643221626 | Bacteria | 8069654 |
| 526 | 2644196485 | 2643221634 | Bacteria | 6705461 |
| 527 | 2644206228 | 2643221637 | Bacteria | 5345260 |
| 528 | 2644296865 | 2643221653 | Bacteria | 4569637 |
| 529 | 2644311670 | 2643221655 | Bacteria | 7722067 |
| 530 | 2644329928 | 2643221659 | Bacteria | 7890716 |
| 531 | 2644380606 | 2643221668 | Bacteria | 7306521 |
| 532 | 2644420664 | 2643221675 | Bacteria | 7473456 |
| 533 | 2644454189 | 2643221680 | Bacteria | 7473610 |
| 534 | 2644493421 | 2643221688 | Bacteria | 5260751 |
| 535 | 2644518776 | 2643221693 | Bacteria | 5513853 |
| 536 | 2644546602 | 2643221698 | Bacteria | 7756764 |
| 537 | 2644617469 | 2643221712 | Bacteria | 7729434 |
| 538 | 2644649875 | 2643221718 | Bacteria | 5345506 |
| 539 | 2644655119 | 2643221719 | Bacteria | 4568197 |
| 540 | 2644675673 | 2643221723 | Bacteria | 7095460 |
| 541 | 2644689526 | 2643221726 | Bacteria | 7455827 |
| 542 | 2657683280 | 2657244999 | Bacteria | 5946535 |
| 543 | 2671115343 | 2667528174 | Bacteria | 6435400 |
| 544 | 2719664586 | 2718217997 | Bacteria | 6740740 |
| 545 | 2720491006 | 2718218199 | Bacteria | 6740745 |
| 546 | 2720612368 | 2718218232 | Bacteria | 6720332 |
| 547 | 2720619206 | 2718218233 | Bacteria | 6662049 |
| 548 | 2720630608 | 2718218235 | Bacteria | 6630699 |
| 549 | 2720774301 | 2718218269 | Bacteria | 6906114 |
| 550 | 2723026028 | 2721755556 | Bacteria | 6745503 |
| 551 | 2723559572 | 2721755684 | Bacteria | 6859907 |
| 552 | 2723566189 | 2721755685 | Bacteria | 6704835 |
| 553 | 2724088908 | 2721755819 | Bacteria | 6906405 |
| 554 | 2724103454 | 2721755822 | Bacteria | 6726041 |
| 555 | 2724109299 | 2721755823 | Bacteria | 6752556 |
| 556 | 2725948457 | 2724679232 | Bacteria | 7646494 |
| 557 | 2730106964 | 2728369352 | Bacteria | 6745171 |
| 558 | 2738802133 | 2738541293 | Bacteria | 7065685 |
| 559 | 2753460790 | 2751185821 | Bacteria | 6189929 |
| 560 | 2766067630 | 2765235942 | Bacteria | 7445910 |
| 561 | 2776912738 | 2775507049 | Bacteria | 6284736 |
| 562 | 2778177434 | 2775507266 | Bacteria | 7392367 |
| 563 | 2792584147 | 2791355082 | Bacteria | 5973319 |
| 564 | 2792622702 | 2791355091 | Bacteria | 6135441 |
| 565 | 2792628377 | 2791355092 | Bacteria | 6248105 |
| 566 | 2793296174 | 2791355256 | Bacteria | 6798008 |
| 567 | 2793317497 | 2791355259 | Bacteria | 7254731 |
| 568 | 2793333588 | 2791355262 | Bacteria | 6774204 |
| 569 | 2793353543 | 2791355265 | Bacteria | 6539969 |
| 570 | 2793367820 | 2791355267 | Bacteria | 7222458 |
| 571 | 2802717712 | 2802428858 | Bacteria | 6636079 |
| 572 | 2802723360 | 2802428859 | Bacteria | 6667919 |
| 573 | 2802733222 | 2802428860 | Bacteria | 6525526 |
| 574 | 2802736196 | 2802428861 | Bacteria | 6534206 |
| 575 | 2802743594 | 2802428862 | Bacteria | 6633353 |
| 576 | 2802750694 | 2802428863 | Bacteria | 6410669 |
| 577 | 2804751331 | 2802429268 | Bacteria | 6094027 |
| 578 | 2805926603 | 2802429605 | Bacteria | 6875453 |
| 579 | 2805933410 | 2802429606 | Bacteria | 6346811 |
| 580 | 2808985919 | 2808606387 | Bacteria | 5697198 |
| 581 | 2819242580 | 2818991272 | Bacteria | 4622173 |
| 582 | 2819556039 | 2818991439 | Bacteria | 6907412 |
| 583 | 2819612239 | 2818991448 | Bacteria | 6772224 |
| 584 | 2819639279 | 2818991453 | Bacteria | 7181617 |
| 585 | 2838031389 | 2838029111 | Bacteria | 6603031 |
| 586 | 2838049261 | 2838048938 | Bacteria | 6044578 |
| 587 | 2838063294 | 2838061910 | Bacteria | 6794874 |
| 588 | 2838074120 | 2838068647 | Bacteria | 6208656 |
| 589 | 2838076422 | 2838074704 | Bacteria | 6785777 |
| 590 | 2838670821 | 2838668709 | Bacteria | 6671819 |
| 591 | 2838676765 | 2838675328 | Bacteria | 4909118 |
| 592 | 2838688644 | 2838686498 | Bacteria | 7807632 |
| 593 | 2838703192 | 2838701080 | Bacteria | 6669771 |
| 594 | 2838715649 | 2838714209 | Bacteria | 5525906 |
| 595 | 2838720551 | 2838719591 | Bacteria | 5523910 |
| 596 | 2838726405 | 2838724970 | Bacteria | 4908691 |
| 597 | 2838730939 | 2838729681 | Bacteria | 7400765 |
| 598 | 2838744167 | 2838742623 | Bacteria | 7396178 |
| 599 | 2841847485 | 2841846520 | Bacteria | 5345850 |
| 600 | 2841856848 | 2841851746 | Bacteria | 7532261 |
| 601 | 2841859979 | 2841859092 | Bacteria | 5436171 |
| 602 | 2842117817 | 2842110456 | Bacteria | 7656360 |
| 603 | 2842126485 | 2842124991 | Bacteria | 5346824 |
| 604 | 2842131658 | 2842130223 | Bacteria | 4909145 |
| 605 | 2842147584 | 2842146304 | Bacteria | 5957337 |
| 606 | 2842153173 | 2842152218 | Bacteria | 4908957 |
| 607 | 2842160018 | 2842156927 | Bacteria | 6894975 |
| 608 | 2842168260 | 2842163707 | Bacteria | 6916235 |
| 609 | 2842171892 | 2842170452 | Bacteria | 5525737 |
| 610 | 2842176792 | 2842175837 | Bacteria | 4908771 |
| 611 | 2842183365 | 2842180545 | Bacteria | 6888678 |
| 612 | 2842188757 | 2842187318 | Bacteria | 5524014 |
| 613 | 2842197924 | 2842192696 | Bacteria | 6147454 |
| 614 | 2842207728 | 2842205361 | Bacteria | 6340321 |
| 615 | 2842213068 | 2842211629 | Bacteria | 5523832 |
| 616 | 2842221176 | 2842217011 | Bacteria | 7497767 |
| 617 | 2842225313 | 2842224351 | Bacteria | 5524473 |
| 618 | 2842235034 | 2842229732 | Bacteria | 7475766 |
| 619 | 2842245631 | 2842243621 | Bacteria | 7421798 |
| 620 | 2842252650 | 2842250916 | Bacteria | 6579627 |
| 621 | 2842259719 | 2842257432 | Bacteria | 7401195 |
| 622 | 2842266960 | 2842264693 | Bacteria | 6472963 |
| 623 | 2842274558 | 2842271015 | Bacteria | 7807131 |
| 624 | 2842281477 | 2842278818 | Bacteria | 6340002 |
| 625 | 2842287144 | 2842285085 | Bacteria | 6011953 |
| 626 | 2842302483 | 2842298080 | Bacteria | 6123127 |
| 627 | 2842306802 | 2842304105 | Bacteria | 7023636 |
| 628 | 2842314715 | 2842311132 | Bacteria | 6616990 |
| 629 | 2842318678 | 2842317721 | Bacteria | 6793725 |
| 630 | 2842343629 | 2842341865 | Bacteria | 7003929 |
| 631 | 2842360784 | 2842357229 | Bacteria | 6485165 |
| 632 | 2842365215 | 2842363717 | Bacteria | 6844742 |
| 633 | 2842404412 | 2842402390 | Bacteria | 6681310 |
| 634 | 2842410903 | 2842409023 | Bacteria | 6687331 |
| 635 | 2842417641 | 2842415677 | Bacteria | 6596907 |
| 636 | 2842427326 | 2842422224 | Bacteria | 6239196 |
| 637 | 2842431091 | 2842428310 | Bacteria | 6767288 |
| 638 | 2842436911 | 2842434925 | Bacteria | 6502746 |
| 639 | 2842442989 | 2842441272 | Bacteria | 6769273 |
| 640 | 2842453210 | 2842447887 | Bacteria | 6754142 |
| 641 | 2842465000 | 2842462802 | Bacteria | 6588055 |
| 642 | 2842471774 | 2842469257 | Bacteria | 6752936 |
| 643 | 2842478016 | 2842475841 | Bacteria | 6603183 |
| 644 | 2842482825 | 2842482326 | Bacteria | 7212537 |
| 645 | 2842493731 | 2842489311 | Bacteria | 6620893 |
| 646 | 2842497313 | 2842495871 | Bacteria | 6820686 |
| 647 | 2842504825 | 2842502639 | Bacteria | 6604161 |
| 648 | 2842509696 | 2842509118 | Bacteria | 6850950 |
| 649 | 2842516764 | 2842515876 | Bacteria | 5436280 |
| 650 | 2842525338 | 2842521101 | Bacteria | 6569494 |
| 651 | 2842924764 | 2842922631 | Bacteria | 5824079 |
| 652 | 2844168539 | 2844163670 | Bacteria | 7266046 |
| 653 | 2844455161 | 2844454524 | Bacteria | 7952546 |
| 654 | 2848993064 | 2848992105 | Bacteria | 6810864 |
| 655 | 2850080459 | 2850079185 | Bacteria | 6848280 |
| 656 | 2852389040 | 2852387548 | Bacteria | 8025568 |
| 657 | 2855831348 | 2855825444 | Bacteria | 6785811 |
| 658 | 2855840474 | 2855839649 | Bacteria | 7135830 |
| 659 | 2855879202 | 2855872281 | Bacteria | 6964271 |
| 660 | 2857520319 | 2857516855 | Bacteria | 7787325 |
| 661 | 2858801002 | 2858800743 | Bacteria | 6603254 |
| 662 | 2896386623 | 2896384573 | Bacteria | 7700774 |
| 663 | 2899796570 | 2899792073 | Bacteria | 4926588 |
| 664 | 2899803744 | 2899803654 | Bacteria | 5577784 |
| 665 | 2899847164 | 2899845264 | Bacteria | 5672268 |
| 666 | 2913297461 | 2913295892 | Bacteria | 6333755 |
| 667 | 2913311011 | 2913308742 | Bacteria | 5350706 |
| 668 | 2915986192 | 2915980308 | Bacteria | 6624279 |
| 669 | 2915990062 | 2915986958 | Bacteria | 6739310 |
| 670 | 2915996233 | 2915993759 | Bacteria | 7016183 |
| 671 | 2916001812 | 2916000859 | Bacteria | 6865702 |
| 672 | 2916014177 | 2916007675 | Bacteria | 6898660 |
| 673 | 2916016589 | 2916014648 | Bacteria | 6946486 |
| 674 | 2916024788 | 2916021584 | Bacteria | 6854472 |
| 675 | 2916032155 | 2916028427 | Bacteria | 6748433 |
| 676 | 2916038190 | 2916035215 | Bacteria | 6755766 |
| 677 | 2916047160 | 2916041962 | Bacteria | 6820487 |
| 678 | 2916053188 | 2916048683 | Bacteria | 6543552 |
| 679 | 2916055332 | 2916055098 | Bacteria | 6758838 |
| 680 | 2916062843 | 2916061851 | Bacteria | 6737736 |
| 681 | 2916076837 | 2916076590 | Bacteria | 6596108 |
| 682 | 2919103803 | 2919100787 | Bacteria | 7710546 |
| 683 | 2919115851 | 2919114240 | Bacteria | 5700270 |
| 684 | 2919167338 | 2919166419 | Bacteria | 4952238 |
| 685 | 2919409273 | 2919408235 | Bacteria | 6149349 |
| 686 | 2920762892 | 2920760137 | Bacteria | 7427611 |
| 687 | 2920823824 | 2920822456 | Bacteria | 6897201 |
| 688 | 2921206448 | 2921201388 | Bacteria | 6926299 |
| 689 | 2921214424 | 2921208531 | Bacteria | 6745326 |
| 690 | 2921237951 | 2921237296 | Bacteria | 6876710 |
| 691 | 2921247490 | 2921244191 | Bacteria | 6568419 |
| 692 | 2921250974 | 2921250672 | Bacteria | 6677771 |
| 693 | 2921259978 | 2921257292 | Bacteria | 6808382 |
| 694 | 2921264209 | 2921263974 | Bacteria | 6864552 |
| 695 | 2921283009 | 2921282425 | Bacteria | 6826397 |
| 696 | 2921290104 | 2921289301 | Bacteria | 7316391 |
| 697 | 2921300137 | 2921296804 | Bacteria | 7176999 |
| 698 | 2923557600 | 2923556063 | Bacteria | 6793593 |
| 699 | 2924145573 | 2924144063 | Bacteria | 6883928 |
| 700 | 2924155908 | 2924150972 | Bacteria | 7169444 |
| 701 | 2924160601 | 2924158325 | Bacteria | 7188855 |
| 702 | 2924168125 | 2924165586 | Bacteria | 7260590 |
| 703 | 2924177821 | 2924172951 | Bacteria | 6749356 |
| 704 | 2924185550 | 2924179722 | Bacteria | 6843264 |
| 705 | 2924189538 | 2924186466 | Bacteria | 6876637 |
| 706 | 2924199791 | 2924193448 | Bacteria | 6955718 |
| 707 | 2924204032 | 2924200457 | Bacteria | 6757188 |
| 708 | 2924209934 | 2924207177 | Bacteria | 6917007 |
| 709 | 2924221333 | 2924214083 | Bacteria | 7080103 |
| 710 | 2924222956 | 2924221636 | Bacteria | 7113495 |
| 711 | 2924234960 | 2924228884 | Bacteria | 6633132 |
| 712 | 2926756792 | 2926754445 | Bacteria | 5964435 |
| 713 | 2926761031 | 2926760298 | Bacteria | 5505990 |
| 714 | 2933007816 | 2933006813 | Bacteria | 4912075 |
| 715 | 2933012594 | 2933011516 | Bacteria | 5439334 |
| 716 | 2933573084 | 2933570622 | Bacteria | 7023390 |
| 717 | 2933591346 | 2933586486 | Bacteria | 7667493 |
| 718 | 2933595037 | 2933594066 | Bacteria | 5594265 |
| 719 | 2933604575 | 2933599457 | Bacteria | 5858799 |
| 720 | 2935904166 | 2935901341 | Bacteria | 7341747 |
| 721 | 2936368154 | 2936367885 | Bacteria | 7324495 |
| 722 | 2937001074 | 2936996657 | Bacteria | 6298727 |
| 723 | 2937009488 | 2937002841 | Bacteria | 6934057 |
| 724 | 2937010912 | 2937009748 | Bacteria | 6746052 |
| 725 | 2937018958 | 2937016420 | Bacteria | 6782579 |
| 726 | 2937027898 | 2937023124 | Bacteria | 6815156 |
| 727 | 2937029847 | 2937029754 | Bacteria | 6424026 |
| 728 | 2937036873 | 2937036028 | Bacteria | 6846469 |
| 729 | 2937043309 | 2937042894 | Bacteria | 6741576 |
| 730 | 2937056257 | 2937049772 | Bacteria | 6757901 |
| 731 | 2937069270 | 2937063883 | Bacteria | 7199456 |
| 732 | 2937077099 | 2937071275 | Bacteria | 6984483 |
| 733 | 2937082954 | 2937078374 | Bacteria | 6610289 |
| 734 | 2937091232 | 2937084907 | Bacteria | 6618516 |
| 735 | 2937095617 | 2937091812 | Bacteria | 6979387 |
| 736 | 2937104190 | 2937098957 | Bacteria | 7249374 |
| 737 | 2937112520 | 2937106411 | Bacteria | 6947143 |
| 738 | 2937118294 | 2937113482 | Bacteria | 6505872 |
| 739 | 2937121212 | 2937119839 | Bacteria | 6597547 |
| 740 | 2937129845 | 2937126314 | Bacteria | 6771275 |
| 741 | 2941500238 | 2941499720 | Bacteria | 7599444 |
| 742 | 2957380006 | 2957375807 | Bacteria | 6425588 |
| 743 | 2957385043 | 2957382221 | Bacteria | 6737050 |
| 744 | 2957389104 | 2957388812 | Bacteria | 6778072 |
| 745 | 2957396422 | 2957395598 | Bacteria | 6822399 |
| 746 | 2957406506 | 2957402308 | Bacteria | 6741770 |
| 747 | 2957409828 | 2957408893 | Bacteria | 6558585 |
| 748 | 2957419225 | 2957415311 | Bacteria | 6991633 |
| 749 | 2957423028 | 2957422303 | Bacteria | 7172205 |
| 750 | 2957431065 | 2957430029 | Bacteria | 7022557 |
| 751 | 2957442043 | 2957437181 | Bacteria | 6568994 |
| 752 | 2957446626 | 2957443900 | Bacteria | 6869977 |
| 753 | 2957454216 | 2957450854 | Bacteria | 6765715 |
| 754 | 2957462424 | 2957457609 | Bacteria | 6967680 |
| 755 | 2957467722 | 2957464669 | Bacteria | 6568877 |
| 756 | 2957476674 | 2957471148 | Bacteria | 6797643 |
| 757 | 2957480602 | 2957478035 | Bacteria | 6756658 |
| 758 | 2957490212 | 2957484790 | Bacteria | 6703082 |
| 759 | 2957496020 | 2957491536 | Bacteria | 6695180 |
| 760 | 2957501062 | 2957498199 | Bacteria | 7126688 |
| 761 | 2957509618 | 2957505466 | Bacteria | 7253085 |
| 762 | 2960586670 | 2960584000 | Bacteria | 6864594 |
| 763 | 2960595592 | 2960591022 | Bacteria | 6622873 |
| 764 | 2960602753 | 2960597568 | Bacteria | 6550735 |
| 765 | 2960610449 | 2960603979 | Bacteria | 6898737 |
| 766 | 2960611615 | 2960610863 | Bacteria | 6691244 |
| 767 | 2960617728 | 2960617483 | Bacteria | 6727748 |
| 768 | 2960625461 | 2960624210 | Bacteria | 6875384 |
| 769 | 2960633207 | 2960631154 | Bacteria | 6732508 |
| 770 | 2960640233 | 2960637947 | Bacteria | 7296468 |
| 771 | 2960646153 | 2960645483 | Bacteria | 7211087 |
| 772 | 2960660149 | 2960652885 | Bacteria | 7083688 |
| 773 | 2960666432 | 2960660292 | Bacteria | 7041660 |
| 774 | 2960673951 | 2960667422 | Bacteria | 6763020 |
| 775 | 2960684181 | 2960680706 | Bacteria | 6624464 |
| 776 | 2960692000 | 2960687367 | Bacteria | 6535474 |
| 777 | 2960699296 | 2960693952 | Bacteria | 6749742 |
| 778 | 2964619981 | 2964615318 | Bacteria | 6809089 |
| 779 | 2964622999 | 2964621998 | Bacteria | 6834995 |
| 780 | 2964633091 | 2964628898 | Bacteria | 7083044 |
| 781 | 2964641308 | 2964636051 | Bacteria | 7091832 |
| 782 | 2964646187 | 2964643177 | Bacteria | 6820887 |
| 783 | 2964653131 | 2964649959 | Bacteria | 6675118 |
| 784 | 2964659270 | 2964656573 | Bacteria | 7100150 |
| 785 | 2964665947 | 2964663802 | Bacteria | 7019362 |
| 786 | 2964672839 | 2964670856 | Bacteria | 6851364 |
| 787 | 2964679234 | 2964678106 | Bacteria | 6792020 |
| 788 | 2964688134 | 2964685014 | Bacteria | 6839111 |
| 789 | 2964695867 | 2964691889 | Bacteria | 6802758 |
| 790 | 2964702261 | 2964698721 | Bacteria | 6765331 |
| 791 | 2964708068 | 2964705432 | Bacteria | 7114648 |
| 792 | 2964716325 | 2964712639 | Bacteria | 6695970 |
| 793 | 2964726064 | 2964719344 | Bacteria | 7286602 |
| 794 | 2967671115 | 2967664464 | Bacteria | 6948836 |
| 795 | 2967672118 | 2967671571 | Bacteria | 7021409 |
| 796 | 2967681071 | 2967678726 | Bacteria | 7264382 |
| 797 | 2967687054 | 2967686174 | Bacteria | 6678622 |
| 798 | 2967693273 | 2967693043 | Bacteria | 6804451 |
| 799 | 2967701149 | 2967699805 | Bacteria | 6854538 |
| 800 | 2967707477 | 2967706974 | Bacteria | 7186053 |
| 801 | 2967716501 | 2967714385 | Bacteria | 7000047 |
| 802 | 2967724615 | 2967721400 | Bacteria | 7073753 |
| 803 | 2967734715 | 2967728569 | Bacteria | 6641507 |
| 804 | 2967737551 | 2967735183 | Bacteria | 6827012 |
| 805 | 2967742639 | 2967742019 | Bacteria | 6794534 |
| 806 | 2967752079 | 2967748971 | Bacteria | 6733771 |
| 807 | 2967760545 | 2967755722 | Bacteria | 6814706 |
| 808 | 2967764459 | 2967762386 | Bacteria | 6923502 |
| 809 | 2967770818 | 2967769361 | Bacteria | 6587838 |
| 810 | 2967782203 | 2967775926 | Bacteria | 6738189 |
| 811 | 2970026099 | 2970019648 | Bacteria | 7072033 |
| 812 | 2970029120 | 2970026789 | Bacteria | 6785236 |
| 813 | 2970038812 | 2970033650 | Bacteria | 7118744 |
| 814 | 2970044567 | 2970040964 | Bacteria | 6731123 |
| 815 | 2970052860 | 2970047711 | Bacteria | 7088379 |
| 816 | 2970059582 | 2970054988 | Bacteria | 6611507 |
| 817 | 2970068779 | 2970061556 | Bacteria | 7099761 |
| 818 | 2970073887 | 2970068827 | Bacteria | 7123112 |
| 819 | 2970076943 | 2970076120 | Bacteria | 6697332 |
| 820 | 2970085302 | 2970082768 | Bacteria | 6183754 |
| 821 | 2970094407 | 2970088815 | Bacteria | 6933825 |
| 822 | 2970096742 | 2970095765 | Bacteria | 6936963 |
| 823 | 2970106902 | 2970102677 | Bacteria | 6812532 |
| 824 | 2970115839 | 2970109326 | Bacteria | 6863976 |
| 825 | 2970117941 | 2970116247 | Bacteria | 6501857 |
| 826 | 2970124440 | 2970122695 | Bacteria | 6625855 |
| 827 | 2970129545 | 2970129317 | Bacteria | 6806560 |
| 828 | 2970136743 | 2970136068 | Bacteria | 7207982 |
| 829 | 2970144392 | 2970143518 | Bacteria | 6446480 |
| 830 | 2970153788 | 2970149975 | Bacteria | 6779706 |
| 831 | 2970163666 | 2970156795 | Bacteria | 7168044 |
| 832 | 2970167530 | 2970164137 | Bacteria | 6861252 |
| 833 | 2970171820 | 2970170962 | Bacteria | 6876229 |
| 834 | 2970182790 | 2970177841 | Bacteria | 6768001 |
| 835 | 2970188283 | 2970184632 | Bacteria | 7054431 |
| 836 | 2970198298 | 2970191845 | Bacteria | 7032787 |
| 837 | 2977517889 | 2977516862 | Bacteria | 6940108 |
| 838 | 2977527682 | 2977523885 | Bacteria | 6960446 |
| 839 | 2977531918 | 2977530762 | Bacteria | 6951399 |
| 840 | 2977538014 | 2977537788 | Bacteria | 6929320 |
| 841 | 2977546075 | 2977544691 | Bacteria | 6875412 |
| 842 | 2977552015 | 2977551784 | Bacteria | 7125765 |
| 843 | 2977561645 | 2977558990 | Bacteria | 6863948 |
| 844 | 2977569008 | 2977565890 | Bacteria | 6901543 |
| 845 | 2977578935 | 2977572785 | Bacteria | 6763888 |
| 846 | 2977581467 | 2977579622 | Bacteria | 6772100 |
| 847 | 2978973770 | 2978969890 | Bacteria | 5400756 |
| 848 | 2979093691 | 2979089926 | Bacteria | 5670289 |
| 849 | 2979098926 | 2979095461 | Bacteria | 5669583 |
| 850 | 2979105668 | 2979100975 | Bacteria | 5423623 |
| 851 | 2984512486 | 2984509177 | Bacteria | 5274802 |
| 852 | 2984521153 | 2984518228 | Bacteria | 5277463 |
| 853 | 2984540447 | 2984537506 | Bacteria | 5277481 |
| 854 | 2984589118 | 2984587000 | Bacteria | 5263363 |
| 855 | 2984602644 | 2984601300 | Bacteria | 5455244 |
| 856 | 2989772030 | 2989771324 | Bacteria | 5605128 |
| 857 | 2989778147 | 2989776772 | Bacteria | 4843317 |
| 858 | 2996890835 | 2996887358 | Bacteria | 5795980 |
| 859 | 3003932643 | 3003930520 | Bacteria | 5667563 |
| 860 | 3005412415 | 3005409236 | Bacteria | 7188837 |
| 861 | 3005417112 | 3005416602 | Bacteria | 7064308 |
| 862 | 3005446731 | 3005445848 | Bacteria | 6906074 |
| 863 | 639647408 | 639633055 | Bacteria | 7751309 |
| 864 | 648736392 | 648276728 | Bacteria | 6968865 |
| 865 | 650739503 | 650716007 | Bacteria | 5573770 |
| 866 | 8003570546 | 8003570095 | Bacteria | 5747666 |
| 867 | 8003992972 | 8003992118 | Bacteria | 7266902 |
| 868 | 8004000202 | 8003999396 | Bacteria | 7063185 |
| 869 | 8005251356 | 8005246636 | Bacteria | 4933972 |
| 870 | 8005261776 | 8005258706 | Bacteria | 6184835 |
| 871 | 8005284812 | 8005282627 | Bacteria | 6675747 |
| 872 | 8005292766 | 8005289223 | Bacteria | 6634003 |
| 873 | 8005304566 | 8005301065 | Bacteria | 6614431 |
| 874 | 8005309138 | 8005307578 | Bacteria | 7395396 |
| 875 | 8005315173 | 8005314921 | Bacteria | 7072929 |
| 876 | 8005325362 | 8005321885 | Bacteria | 5795980 |
| 877 | 8005376641 | 8005376324 | Bacteria | 6590079 |
| 878 | 8005432237 | 8005430974 | Bacteria | 6689030 |
| 879 | 8005485658 | 8005484373 | Bacteria | 6297373 |
| 880 | 8005499301 | 8005497431 | Bacteria | 6477605 |
| 881 | 8005544320 | 8005542996 | Bacteria | 7077758 |
| 882 | 8005627538 | 8005626139 | Bacteria | 6534237 |
| 883 | 8005648324 | 8005645114 | Bacteria | 6950293 |
| 884 | 8005660008 | 8005658619 | Bacteria | 4500593 |
| 885 | 8005670717 | 8005668836 | Bacteria | 6953162 |
| 886 | 8005684605 | 8005682033 | Bacteria | 6726518 |
| 887 | 8005690989 | 8005688590 | Bacteria | 6610080 |
| 888 | 8023686986 | 8023680758 | Bacteria | 7729763 |
| 889 | 8024481076 | 8024479707 | Bacteria | 6954785 |
| 890 | 8024489780 | 8024486573 | Bacteria | 6540512 |
| 891 | 8024503278 | 8024501048 | Bacteria | 6427847 |
| 892 | 8046767648 | 8046767195 | Bacteria | 7547379 |
| 893 | 8049293905 | 8049293176 | Bacteria | 6128433 |
| 894 | 8054461872 | 8054460903 | Bacteria | 4872905 |
| 895 | 8054562111 | 8054558443 | Bacteria | 5204801 |
| 896 | 8056380701 | 8056375014 | Bacteria | 7006639 |
| 897 | 8056384783 | 8056382006 | Bacteria | 6408074 |
| 898 | 8057582231 | 8057575449 | Bacteria | 7367519 |
| 899 | Ga0214543_1000003 | |||
| 900 | JGI25156J39149_1000153 | |||
| 901 | JGI25162J39368_1001013 | |||
| 902 | JGI25162J39368_1001160 | |||
| 903 | JGI25154J39366_1000152 | |||
| 904 | JGI25157J39369_1000061 | |||
| 905 | JGI25152J39213_1002047 | |||
| 906 | JGI25152J39213_1002225 | |||
| 907 | JGI25152J39213_1002746 | |||
| 908 | JGI25150J39212_1000031 | |||
| 909 | JGI25150J39212_1003104 | |||
| 910 | JGI25159J45721_1000002 | |||
| 911 | JGI25159J45721_1003211 | |||
| 912 | JGI25159J45721_1006113 | |||
| 913 | JGI25151J46595_10000062 | |||
| 914 | JGI25165J46597_1001286 | |||
| 915 | JGI25165J46597_1001705 | |||
| 916 | JGI25153J46596_10003455 | |||
| 917 | JGI25153J46596_10003797 | |||
| 918 | rootL2_10003072 | |||
| 919 | rootH1_10039003 | |||
| 920 | rootH1_10109493 | |||
| 921 | JGI25160J50197_1000008 | |||
| 922 | JGI25160J50197_1000052 | |||
| 923 | JGI25160J50197_1003609 | |||
| 924 | JGI25160J50197_1007244 | |||
| 925 | JGI25161J50226_1000005 | |||
| 926 | JGI25161J50226_1000113 | |||
| 927 | JGI25161J50226_1000133 | |||
| 928 | JGI25161J50226_1000527 | |||
| 929 | Ga0055526_1002912 | |||
| 930 | Ga0055526_1010220 | |||
| 931 | Ga0055526_1021727 | |||
| 932 | Ga0055526_1021737 | |||
| 933 | Ga0055524_1003487 | |||
| 934 | Ga0055524_1008616 | |||
| 935 | Ga0055524_1013056 | |||
| 936 | Ga0055536_1001375 | |||
| 937 | Ga0055528_1000149 | |||
| 938 | Ga0055528_1002648 | |||
| 939 | Ga0055528_1003478 | |||
| 940 | Ga0055528_1032191 | |||
| 941 | Ga0055530_10007424 | |||
| 942 | Ga0055540_1000406 | |||
| 943 | Ga0055540_1003151 | |||
| 944 | Ga0055540_1021733 | |||
| 945 | Ga0055540_1022589 | |||
| 946 | Ga0055531_10006368 | |||
| 947 | Ga0058692_1004840 | |||
| 948 | Ga0058692_1008392 | |||
| 949 | Ga0055543_1000035 | |||
| 950 | Ga0055543_1000040 | |||
| 951 | Ga0055543_1000048 | |||
| 952 | Ga0065165_1000015 | |||
| 953 | Ga0065165_1000253 | |||
| 954 | Ga0065165_1041411 | |||
| 955 | Ga0065165_1042784 | |||
| 956 | Ga0070668_100215604 | |||
| 957 | Ga0070665_100045283 | |||
| 958 | Ga0068855_100132280 | |||
| 959 | Ga0068854_100248889 | |||
| 960 | Ga0075365_10032765 | |||
| 961 | Ga0075365_10170024 | |||
| 962 | Ga0075368_10015434 | |||
| 963 | Ga0075363_100012152 | |||
| 964 | Ga0075363_100028918 | |||
| 965 | Ga0075363_100175105 | |||
| 966 | Ga0075364_10018980 | |||
| 967 | Ga0075364_10071929 | |||
| 968 | Ga0075362_10167814 | |||
| 969 | Ga0075367_10064973 | |||
| 970 | Ga0075369_10017027 | |||
| 971 | Ga0075369_10168820 | |||
| 972 | Ga0075370_10092110 | |||
| 973 | Ga0079104_1002273 | |||
| 974 | Ga0079104_1005092 | |||
| 975 | Ga0099826_10024949 | |||
| 976 | Ga0105244_10137878 | |||
| 977 | Ga0105250_10011058 | |||
| 978 | Ga0105240_10000032 | |||
| 979 | Ga0105247_10070341 | |||
| 980 | Ga0105243_10730612 | |||
| 981 | Ga0105248_10264104 | |||
| 982 | Ga0105237_10064526 | |||
| 983 | Ga0105249_10219610 | |||
| 984 | Ga0123340_1068017 | |||
| 985 | Ga0123341_1000048 | |||
| 986 | Ga0123341_1105859 | |||
| 987 | Ga0123341_1109245 | |||
| 988 | Ga0123342_1007095 | |||
| 989 | Ga0123342_1029411 | |||
| 990 | Ga0105239_10004104 | |||
| 991 | Ga0105239_10878567 | |||
| 992 | Ga0157373_10002050 | |||
| 993 | Ga0157371_10000380 | |||
| 994 | Ga0157371_10009535 | |||
| 995 | Ga0157370_10000748 | |||
| 996 | Ga0157370_10000986 | |||
| 997 | Ga0157369_10040067 | |||
| 998 | Ga0157369_10159803 | |||
| 999 | Ga0157369_10783606 | |||
| 1000 | Ga0171463_1001 | |||
| 1001 | Ga0182008_10037378 | |||
| 1002 | Ga0182007_10009078 | |||
| 1003 | Ga0183363_1336 | |||
| 1004 | Ga0214544_1008762 | |||
| 1005 | Ga0214542_1000006 | |||
| 1006 | Ga0214542_1016338 | |||
| 1007 | Ga0214543_1000014 | |||
| 1008 | Ga0228711_1000001 | |||
| 1009 | Ga0228710_1000001 | |||
| 1010 | Ga0209435_100042 | |||
| 1011 | Ga0209436_100064 | |||
| 1012 | Ga0209436_101965 | |||
| 1013 | Ga0209436_114010 | |||
| 1014 | Ga0209437_100075 | |||
| 1015 | Ga0209437_104465 | |||
| 1016 | Ga0207425_1000031 | |||
| 1017 | Ga0207425_1010912 | |||
| 1018 | Ga0209646_1000145 | |||
| 1019 | Ga0209646_1015396 | |||
| 1020 | Ga0209026_1000160 | |||
| 1021 | Ga0209759_1000177 | |||
| 1022 | Ga0209129_1000053 | |||
| 1023 | Ga0209129_1000362 | |||
| 1024 | Ga0209129_1000592 | |||
| 1025 | Ga0209129_1003898 | |||
| 1026 | Ga0209129_1005412 | |||
| 1027 | Ga0209129_1008053 | |||
| 1028 | Ga0209233_1000056 | |||
| 1029 | Ga0209233_1000064 | |||
| 1030 | Ga0209233_1000209 | |||
| 1031 | Ga0209455_1021847 | |||
| 1032 | Ga0209673_1000041 | |||
| 1033 | Ga0209673_1001371 | |||
| 1034 | Ga0209673_1002349 | |||
| 1035 | Ga0209673_1004542 | |||
| 1036 | Ga0209673_1004827 | |||
| 1037 | Ga0209673_1040928 | |||
| 1038 | Ga0209130_1000006 | |||
| 1039 | Ga0209130_1000007 | |||
| 1040 | Ga0209130_1000018 | |||
| 1041 | Ga0209676_1002385 | |||
| 1042 | Ga0209676_1010840 | |||
| 1043 | Ga0209676_1021427 | |||
| 1044 | Ga0209025_1000074 | |||
| 1045 | Ga0209025_1000080 | |||
| 1046 | Ga0209025_1000087 | |||
| 1047 | Ga0209025_1000100 | |||
| 1048 | Ga0209025_1001310 | |||
| 1049 | Ga0209025_1001555 | |||
| 1050 | Ga0209025_1004857 | |||
| 1051 | Ga0209025_1022221 | |||
| 1052 | Ga0209025_1039784 | |||
| 1053 | Ga0209025_1082794 | |||
| 1054 | Ga0209564_1000439 | |||
| 1055 | Ga0209564_1006429 | |||
| 1056 | Ga0209564_1034872 | |||
| 1057 | Ga0209564_1039856 | |||
| 1058 | Ga0209758_1000081 | |||
| 1059 | Ga0209758_1000737 | |||
| 1060 | Ga0209758_1001677 | |||
| 1061 | Ga0209758_1001702 | |||
| 1062 | Ga0209758_1002164 | |||
| 1063 | Ga0209758_1009144 | |||
| 1064 | Ga0209758_1081554 | |||
| 1065 | Ga0209050_1001222 | |||
| 1066 | Ga0209256_1002838 | |||
| 1067 | Ga0209256_1002860 | |||
| 1068 | Ga0209256_1003649 | |||
| 1069 | Ga0209256_1007502 | |||
| 1070 | Ga0209256_1010546 | |||
| 1071 | Ga0207426_1000044 | |||
| 1072 | Ga0207426_1000064 | |||
| 1073 | Ga0207426_1000106 | |||
| 1074 | Ga0207426_1000652 | |||
| 1075 | Ga0209051_1000514 | |||
| 1076 | Ga0209051_1001543 | |||
| 1077 | Ga0209051_1002756 | |||
| 1078 | Ga0209051_1012403 | |||
| 1079 | Ga0209051_1043897 | |||
| 1080 | Ga0209257_1001514 | |||
| 1081 | Ga0207695_10000024 | |||
| 1082 | Ga0207671_10000548 | |||
| 1083 | Ga0207650_10002848 | |||
| 1084 | Ga0207668_10763071 | |||
| 1085 | Ga0207702_10124998 | |||
| 1086 | Ga0207702_10438948 | |||
| 1087 | Ga0209281_1000266 | |||
| 1088 | Ga0209281_1000332 | |||
| 1089 | Ga0209371_1000021 | |||
| 1090 | Ga0209371_1000714 | |||
| 1091 | Ga0209371_1000939 | |||
| 1092 | Ga0209371_1001387 | |||
| 1093 | Ga0209371_1002086 | |||
| 1094 | Ga0209282_1000007 | |||
| 1095 | Ga0209282_1001768 | |||
| 1096 | Ga0209282_1010070 | |||
| 1097 | Ga0268266_10002687 | |||
| 1098 | Ga0307515_10000070 | |||
| 1099 | Ga0307515_10005751 | |||
| 1100 | Ga0307515_10009829 | |||
| 1101 | Ga0268256_1000020 | |||
| 1102 | Ga0268256_1002318 | |||
| 1103 | Ga0268256_1002341 | |||
| 1104 | Ga0316181_1214954 | |||
| 1105 | Ga0307513_10078688 | |||
| 1106 | Ga0307513_10408317 | |||
| 1107 | Ga0307513_10511683 | |||
| 1108 | Ga0307408_100039259 | |||
| 1109 | Ga0307405_10095640 | |||
| 1110 | Ga0307405_10200800 | |||
| 1111 | Ga0307406_10069253 | |||
| 1112 | Ga0307412_10399895 | |||
| 1113 | Ga0315914_1000006 | |||
| 1114 | Ga0307414_10307266 | |||
| 1115 | Ga0315913_1000002 | |||
| 1116 | Ga0315915_1000001 | |||
| 1117 | Ga0439436_0009726 | |||
| 1118 | Ga0439438_018012 | |||
| 1119 | Ga0439439_0049938 | |||
| 1120 | Ga0439439_0067162 | |||
| 1121 | Ga0439465_0005455 | |||
| 1122 | Ga0439465_0013230 | |||
| 1123 | Ga0439465_0021873 | |||
| 1124 | Ga0439449_0004950 | |||
| 1125 | Ga0439449_0027972 | |||
| 1126 | Ga0439449_0090931 | |||
| 1127 | Ga0439452_041598 | |||
| 1128 | Ga0439462_0008441 | |||
| 1129 | Ga0450920_028546 | |||
| 1130 | Ga0450918_004033 | |||
| 1131 | Ga0466967_0451317 | |||
| 1132 | Ga0495627_041695 | |||
| 1133 | Ga0495592_0054665 | |||
| 1134 | Ga0495629_0020032 | |||
| 1135 | Ga0495638_0000353 | |||
| 1136 | Ga0495638_0023768 | |||
| 1137 | Ga0495638_0023957 | |||
| 1138 | Ga0495638_0103718 | |||
| 1139 | Ga0495650_0030215 | |||
| 1140 | Ga0495650_0117436 | |||
| 1141 | Ga0495605_0003895 | |||
| 1142 | Ga0495605_0139735 | |||
| 1143 | Ga0495662_0001957 | |||
| 1144 | Ga0495664_0131601 | |||
| 1145 | Ga0495585_0004076 | |||
| 1146 | Ga0495607_0019235 | |||
| 1147 | Ga0495583_0002283 | |||
| 1148 | Ga0495583_0112426 | |||
| 1149 | Ga0495606_0015262 | |||
| 1150 | Ga0495606_0045156 | |||
| 1151 | Ga0495606_0072624 | |||
| 1152 | Ga0495606_0096192 | |||
| 1153 | Ga0495606_0175183 | |||
| 1154 | Ga0495610_0002493 | |||
| 1155 | Ga0495610_0002941 | |||
| 1156 | Ga0495610_0045308 | |||
| 1157 | Ga0495620_0007860 | |||
| 1158 | Ga0495620_0011636 | |||
| 1159 | Ga0495620_0142101 | |||
| 1160 | Ga0495631_0054359 | |||
| 1161 | Ga0495632_0010045 | |||
| 1162 | Ga0495643_0017310 | |||
| 1163 | Ga0495643_0028312 | |||
| 1164 | Ga0495643_0041252 | |||
| 1165 | Ga0495643_0076128 | |||
| 1166 | Ga0495648_0166355 | |||
| 1167 | Ga0495587_0078106 | |||
| 1168 | Ga0495609_0034081 | |||
| 1169 | Ga0495609_0065063 | |||
| 1170 | Ga0495622_0024264 | |||
| 1171 | Ga0495656_0005975 | |||
| 1172 | Ga0495668_0011053 | |||
| 1173 | Ga0495611_0046435 | |||
| 1174 | Ga0495625_0002953 | |||
| 1175 | Ga0495625_0098360 | |||
| 1176 | Ga0495625_0111291 | |||
| 1177 | Ga0495625_0170050 | |||
| 1178 | Ga0495625_0410637 | |||
| 1179 | Ga0495661_0230077 | |||
| 1180 | Ga0495588_0002348 | |||
| 1181 | Ga0495657_0084561 | |||
| 1182 | Ga0495646_0060439 | |||
| 1183 | Ga0495658_0016347 | |||
| 1184 | Ga0495671_0005749 | |||
| 1185 | Ga0495649_0016416 | |||
| 1186 | Ga0495600_0208314 | |||
| 1187 | Ga0495660_0011331 | |||
| 1188 | Ga0495660_0064545 | |||
| 1189 | Ga0495604_0022047 | |||
| 1190 | Ga0495636_0008083 | |||
| 1191 | Ga0495636_0036703 | |||
| 1192 | Ga0495674_0606196 | |||
| 1193 | Ga0495672_0019712 | |||
| 1194 | Ga0495687_012527 | |||
| 1195 | Ga0495681_0003515 | |||
| 1196 | Ga0495681_0027899 | |||
| 1197 | Ga0495686_0001094 | |||
| 1198 | Ga0495686_0019106 | |||
| 1199 | Ga0495686_0020261 | |||
| 1200 | Ga0495686_0082205 | |||
| 1201 | Ga0495686_0242667 | |||
| 1202 | Ga0496100_0030953 | |||
| 1203 | Ga0496101_0040266 | |||
| 1204 | Ga0496102_0009938 | |||
| 1205 | Ga0496103_0016955 | |||
| 1206 | Ga0496104_0081484 | |||
| 1207 | Ga0496105_0024101 | |||
| 1208 | Ga0496106_0000154 | |||
| 1209 | Ga0496110_0020523 | |||
| 1210 | Ga0496110_0569989 | |||
| 1211 | Ga0496113_0030606 | |||
| 1212 | Ga0496113_0184075 | |||
| 1213 | Ga0496116_0000036 | |||
| 1214 | Ga0496116_0008404 | |||
| 1215 | Ga0496116_0028293 | |||
| 1216 | Ga0496116_0035383 | |||
| 1217 | Ga0496116_0042428 | |||
| 1218 | Ga0496116_0052565 | |||
| 1219 | Ga0496116_0145435 | |||
| 1220 | Ga0496116_0146612 | |||
| 1221 | Ga0496117_0000002 | |||
| 1222 | Ga0496117_0003863 | |||
| 1223 | Ga0496117_0023642 | |||
| 1224 | Ga0496117_0038413 | |||
| 1225 | Ga0496117_0139004 | |||
| 1226 | Ga0496118_0000214 | |||
| 1227 | Ga0496118_0000695 | |||
| 1228 | Ga0496118_0016185 | |||
| 1229 | Ga0496118_0055406 | |||
| 1230 | Ga0496118_0172834 | |||
| 1231 | Ga0496119_0019601 | |||
| 1232 | Ga0496119_0024841 | |||
| 1233 | Ga0496119_0037148 | |||
| 1234 | Ga0496119_0050740 | |||
| 1235 | Ga0496120_0000125 | |||
| 1236 | Ga0496120_0011557 | |||
| 1237 | Ga0496120_0019199 | |||
| 1238 | Ga0496121_0000001 | |||
| 1239 | Ga0496121_0001632 | |||
| 1240 | Ga0496121_0008842 | |||
| 1241 | Ga0496121_0056492 | |||
| 1242 | Ga0496121_0064083 | |||
| 1243 | Ga0496121_0100649 | |||
| 1244 | Ga0496121_0123759 | |||
| 1245 | Ga0496121_0253687 | |||
| 1246 | Ga0496121_0291130 | |||
| 1247 | Ga0496122_0000001 | |||
| 1248 | Ga0496122_0003139 | |||
| 1249 | Ga0496122_0011597 | |||
| 1250 | Ga0496122_0015314 | |||
| 1251 | Ga0496122_0029200 | |||
| 1252 | Ga0496122_0039743 | |||
| 1253 | Ga0496122_0046659 | |||
| 1254 | Ga0496122_0085214 | |||
| 1255 | Ga0496122_0158141 | |||
| 1256 | Ga0496123_0000001 | |||
| 1257 | Ga0496123_0014608 | |||
| 1258 | Ga0496123_0031063 | |||
| 1259 | Ga0496123_0043197 | |||
| 1260 | Ga0496123_0044820 | |||
| 1261 | Ga0496123_0045608 | |||
| 1262 | Ga0496123_0065335 | |||
| 1263 | Ga0496123_0081819 | |||
| 1264 | Ga0496124_0000349 | |||
| 1265 | Ga0496124_0003191 | |||
| 1266 | Ga0496124_0007143 | |||
| 1267 | Ga0496124_0019584 | |||
| 1268 | Ga0496124_0028228 | |||
| 1269 | Ga0496124_0028358 | |||
| 1270 | Ga0496124_0051756 | |||
| 1271 | Ga0496124_0067367 | |||
| 1272 | Ga0496124_0081804 | |||
| 1273 | Ga0496124_0137086 | |||
| 1274 | Ga0496124_0227902 | |||
| 1275 | Ga0496125_0000001 | |||
| 1276 | Ga0496125_0030512 | |||
| 1277 | Ga0496125_0037930 | |||
| 1278 | Ga0496125_0040651 | |||
| 1279 | Ga0496125_0057948 | |||
| 1280 | Ga0496125_0075324 | |||
| 1281 | Ga0496125_0173303 | |||
| 1282 | Ga0496126_0000156 | |||
| 1283 | Ga0496126_0015545 | |||
| 1284 | Ga0496126_0022022 | |||
| 1285 | Ga0496126_0042324 | |||
| 1286 | Ga0496126_0044809 | |||
| 1287 | Ga0496126_0136926 | |||
| 1288 | Ga0495678_018576 | |||
| 1289 | Ga0501032_0142497 | |||
| 1290 | Ga0501036_0190742 | |||
| 1291 | Ga0501037_0357475 | |||
| 1292 | Ga0501038_0035728 | |||
| 1293 | Ga0501039_0030216 | |||
| 1294 | Ga0501043_0048985 | |||
| 1295 | Ga0501080_0197346 | |||
| 1296 | Ga0501044_0085835 | |||
| 1297 | nmdc:mga03683_13499_c1 | |||
| 1298 | nmdc:mga03n38_277182_c1 | |||
| 1299 | nmdc:mga00v17_187_c1 | |||
| 1300 | nmdc:mga00v17_38216_c1 | |||
| 1301 | nmdc:mga00v17_97953_c1 | |||
| 1302 | nmdc:mga0yw44_66884_c1 | |||
| 1303 | nmdc:mga06z11_141938_c1 | |||
| 1304 | nmdc:mga07m45_163483_c1 | |||
| 1305 | nmdc:mga07m45_199365_c1 | |||
| 1306 | nmdc:mga07m45_214477_c1 | |||
| 1307 | nmdc:mga0sz30_56083_c1 | |||
| 1308 | nmdc:mga0sz30_839_c1 | |||
| 1309 | Ga0500578_0207158 | |||
| 1310 | Ga0500578_0291571 | |||
| 1311 | Ga0500644_0017456 | |||
| 1312 | Ga0500651_0206886 | |||
| 1313 | Ga0500557_000546 | |||
| 1314 | Ga0500560_003419 | |||
| 1315 | Ga0500560_015522 | |||
| 1316 | Ga0500569_000769 | |||
| 1317 | Ga0500569_012526 | |||
| 1318 | Ga0500572_002424 | |||
| 1319 | Ga0500594_0004786 | |||
| 1320 | Ga0500608_030543 | |||
| 1321 | Ga0500618_008277 | |||
| 1322 | Ga0500618_025679 | |||
| 1323 | Ga0500658_0003389 | |||
| 1324 | Ga0500559_0068113 | |||
| 1325 | Ga0500561_0000280 | |||
| 1326 | Ga0500568_0000565 | |||
| 1327 | Ga0500568_0000811 | |||
| 1328 | Ga0500588_0012449 | |||
| 1329 | Ga0500590_002679 | |||
| 1330 | Ga0500616_0005562 | |||
| 1331 | Ga0500622_0000322 | |||
| 1332 | Ga0500622_0004590 | |||
| 1333 | Ga0500624_000569 | |||
| 1334 | Ga0500633_0000343 | |||
| 1335 | Ga0500634_0001745 | |||
| 1336 | Ga0500634_0015611 | |||
| 1337 | Ga0500636_0000004 | |||
| 1338 | Ga0500636_0008484 | |||
| 1339 | 2509108498 | |||
| 1340 | 2509374475 | |||
| 1341 | 2509387744 | |||
| 1342 | 2509443105 | |||
| 1343 | 2510132273 | |||
| 1344 | 2510306632 | |||
| 1345 | 2511133519 | |||
| 1346 | 2511183369 | |||
| 1347 | 2511197228 | |||
| 1348 | 2511500996 | |||
| 1349 | 2512532409 | |||
| 1350 | 2512972266 | |||
| 1351 | 2513580747 | |||
| 1352 | 2513583464 | |||
| 1353 | 2513596220 | |||
| 1354 | 2513603345 | |||
| 1355 | 2513618927 | |||
| 1356 | 2513632781 | |||
| 1357 | 2513709232 | |||
| 1358 | 2513868738 | |||
| 1359 | 2513881115 | |||
| 1360 | 2513902351 | |||
| 1361 | 2513983950 | |||
| 1362 | 2513999545 | |||
| 1363 | 2514004800 | |||
| 1364 | 2515608108 | |||
| 1365 | 2515740435 | |||
| 1366 | 2516208862 | |||
| 1367 | 2516892278 | |||
| 1368 | 2517075440 | |||
| 1369 | 2517405843 | |||
| 1370 | 2517569069 | |||
| 1371 | 2524451154 | |||
| 1372 | 2524460679 | |||
| 1373 | 2535515689 | |||
| 1374 | 2537874050 | |||
| 1375 | 2551676457 | |||
| 1376 | 2551687186 | |||
| 1377 | 2551693802 | |||
| 1378 | 2551704617 | |||
| 1379 | 2551715563 | |||
| 1380 | 2551720647 | |||
| 1381 | 2551725407 | |||
| 1382 | 2551734345 | |||
| 1383 | 2551740426 | |||
| 1384 | 2554247082 | |||
| 1385 | 2558863502 | |||
| 1386 | 2559294306 | |||
| 1387 | 2561466031 | |||
| 1388 | 2585165522 | |||
| 1389 | 2585203049 | |||
| 1390 | 2585220967 | |||
| 1391 | 2585231524 | |||
| 1392 | 2585273289 | |||
| 1393 | 2585278876 | |||
| 1394 | 2585325510 | |||
| 1395 | 2585329664 | |||
| 1396 | 2585392691 | |||
| 1397 | 2585400155 | |||
| 1398 | 2585527937 | |||
| 1399 | 2585530674 | |||
| 1400 | 2585549933 | |||
| 1401 | 2585554854 | |||
| 1402 | 2585559411 | |||
| 1403 | 2585822714 | |||
| 1404 | 2585847247 | |||
| 1405 | 2585902081 | |||
| 1406 | 2585905213 | |||
| 1407 | 2587979672 | |||
| 1408 | 2599333798 | |||
| 1409 | 2599602629 | |||
| 1410 | 2599723104 | |||
| 1411 | 2600191911 | |||
| 1412 | 2601608706 | |||
| 1413 | 2601745480 | |||
| 1414 | 2616305850 | |||
| 1415 | 2616553908 | |||
| 1416 | 2617383834 | |||
| 1417 | 2643807224 | |||
| 1418 | 2643855896 | |||
| 1419 | 2643918681 | |||
| 1420 | 2644069510 | |||
| 1421 | 2644109014 | |||
| 1422 | 2644151536 | |||
| 1423 | 2644196485 | |||
| 1424 | 2644206228 | |||
| 1425 | 2644296865 | |||
| 1426 | 2644311670 | |||
| 1427 | 2644329928 | |||
| 1428 | 2644380606 | |||
| 1429 | 2644420664 | |||
| 1430 | 2644454189 | |||
| 1431 | 2644493421 | |||
| 1432 | 2644518776 | |||
| 1433 | 2644546602 | |||
| 1434 | 2644617469 | |||
| 1435 | 2644649875 | |||
| 1436 | 2644655119 | |||
| 1437 | 2644675673 | |||
| 1438 | 2644689526 | |||
| 1439 | 2657683280 | |||
| 1440 | 2671115343 | |||
| 1441 | 2719664586 | |||
| 1442 | 2720491006 | |||
| 1443 | 2720612368 | |||
| 1444 | 2720619206 | |||
| 1445 | 2720630608 | |||
| 1446 | 2720774301 | |||
| 1447 | 2723026028 | |||
| 1448 | 2723559572 | |||
| 1449 | 2723566189 | |||
| 1450 | 2724088908 | |||
| 1451 | 2724103454 | |||
| 1452 | 2724109299 | |||
| 1453 | 2725948457 | |||
| 1454 | 2730106964 | |||
| 1455 | 2738802133 | |||
| 1456 | 2753460790 | |||
| 1457 | 2766067630 | |||
| 1458 | 2776912738 | |||
| 1459 | 2778177434 | |||
| 1460 | 2792584147 | |||
| 1461 | 2792622702 | |||
| 1462 | 2792628377 | |||
| 1463 | 2793296174 | |||
| 1464 | 2793317497 | |||
| 1465 | 2793333588 | |||
| 1466 | 2793353543 | |||
| 1467 | 2793367820 | |||
| 1468 | 2802717712 | |||
| 1469 | 2802723360 | |||
| 1470 | 2802733222 | |||
| 1471 | 2802736196 | |||
| 1472 | 2802743594 | |||
| 1473 | 2802750694 | |||
| 1474 | 2804751331 | |||
| 1475 | 2805926603 | |||
| 1476 | 2805933410 | |||
| 1477 | 2808985919 | |||
| 1478 | 2819242580 | |||
| 1479 | 2819556039 | |||
| 1480 | 2819612239 | |||
| 1481 | 2819639279 | |||
| 1482 | 2838031389 | |||
| 1483 | 2838049261 | |||
| 1484 | 2838063294 | |||
| 1485 | 2838074120 | |||
| 1486 | 2838076422 | |||
| 1487 | 2838670821 | |||
| 1488 | 2838676765 | |||
| 1489 | 2838688644 | |||
| 1490 | 2838703192 | |||
| 1491 | 2838715649 | |||
| 1492 | 2838720551 | |||
| 1493 | 2838726405 | |||
| 1494 | 2838730939 | |||
| 1495 | 2838744167 | |||
| 1496 | 2841847485 | |||
| 1497 | 2841856848 | |||
| 1498 | 2841859979 | |||
| 1499 | 2842117817 | |||
| 1500 | 2842126485 | |||
| 1501 | 2842131658 | |||
| 1502 | 2842147584 | |||
| 1503 | 2842153173 | |||
| 1504 | 2842160018 | |||
| 1505 | 2842168260 | |||
| 1506 | 2842171892 | |||
| 1507 | 2842176792 | |||
| 1508 | 2842183365 | |||
| 1509 | 2842188757 | |||
| 1510 | 2842197924 | |||
| 1511 | 2842207728 | |||
| 1512 | 2842213068 | |||
| 1513 | 2842221176 | |||
| 1514 | 2842225313 | |||
| 1515 | 2842235034 | |||
| 1516 | 2842245631 | |||
| 1517 | 2842252650 | |||
| 1518 | 2842259719 | |||
| 1519 | 2842266960 | |||
| 1520 | 2842274558 | |||
| 1521 | 2842281477 | |||
| 1522 | 2842287144 | |||
| 1523 | 2842302483 | |||
| 1524 | 2842306802 | |||
| 1525 | 2842314715 | |||
| 1526 | 2842318678 | |||
| 1527 | 2842343629 | |||
| 1528 | 2842360784 | |||
| 1529 | 2842365215 | |||
| 1530 | 2842404412 | |||
| 1531 | 2842410903 | |||
| 1532 | 2842417641 | |||
| 1533 | 2842427326 | |||
| 1534 | 2842431091 | |||
| 1535 | 2842436911 | |||
| 1536 | 2842442989 | |||
| 1537 | 2842453210 | |||
| 1538 | 2842465000 | |||
| 1539 | 2842471774 | |||
| 1540 | 2842478016 | |||
| 1541 | 2842482825 | |||
| 1542 | 2842493731 | |||
| 1543 | 2842497313 | |||
| 1544 | 2842504825 | |||
| 1545 | 2842509696 | |||
| 1546 | 2842516764 | |||
| 1547 | 2842525338 | |||
| 1548 | 2842924764 | |||
| 1549 | 2844168539 | |||
| 1550 | 2844455161 | |||
| 1551 | 2848993064 | |||
| 1552 | 2850080459 | |||
| 1553 | 2852389040 | |||
| 1554 | 2855831348 | |||
| 1555 | 2855840474 | |||
| 1556 | 2855879202 | |||
| 1557 | 2857520319 | |||
| 1558 | 2858801002 | |||
| 1559 | 2896386623 | |||
| 1560 | 2899796570 | |||
| 1561 | 2899803744 | |||
| 1562 | 2899847164 | |||
| 1563 | 2913297461 | |||
| 1564 | 2913311011 | |||
| 1565 | 2915986192 | |||
| 1566 | 2915990062 | |||
| 1567 | 2915996233 | |||
| 1568 | 2916001812 | |||
| 1569 | 2916014177 | |||
| 1570 | 2916016589 | |||
| 1571 | 2916024788 | |||
| 1572 | 2916032155 | |||
| 1573 | 2916038190 | |||
| 1574 | 2916047160 | |||
| 1575 | 2916053188 | |||
| 1576 | 2916055332 | |||
| 1577 | 2916062843 | |||
| 1578 | 2916076837 | |||
| 1579 | 2919103803 | |||
| 1580 | 2919115851 | |||
| 1581 | 2919167338 | |||
| 1582 | 2919409273 | |||
| 1583 | 2920762892 | |||
| 1584 | 2920823824 | |||
| 1585 | 2921206448 | |||
| 1586 | 2921214424 | |||
| 1587 | 2921237951 | |||
| 1588 | 2921247490 | |||
| 1589 | 2921250974 | |||
| 1590 | 2921259978 | |||
| 1591 | 2921264209 | |||
| 1592 | 2921283009 | |||
| 1593 | 2921290104 | |||
| 1594 | 2921300137 | |||
| 1595 | 2923557600 | |||
| 1596 | 2924145573 | |||
| 1597 | 2924155908 | |||
| 1598 | 2924160601 | |||
| 1599 | 2924168125 | |||
| 1600 | 2924177821 | |||
| 1601 | 2924185550 | |||
| 1602 | 2924189538 | |||
| 1603 | 2924199791 | |||
| 1604 | 2924204032 | |||
| 1605 | 2924209934 | |||
| 1606 | 2924221333 | |||
| 1607 | 2924222956 | |||
| 1608 | 2924234960 | |||
| 1609 | 2926756792 | |||
| 1610 | 2926761031 | |||
| 1611 | 2933007816 | |||
| 1612 | 2933012594 | |||
| 1613 | 2933573084 | |||
| 1614 | 2933591346 | |||
| 1615 | 2933595037 | |||
| 1616 | 2933604575 | |||
| 1617 | 2935904166 | |||
| 1618 | 2936368154 | |||
| 1619 | 2937001074 | |||
| 1620 | 2937009488 | |||
| 1621 | 2937010912 | |||
| 1622 | 2937018958 | |||
| 1623 | 2937027898 | |||
| 1624 | 2937029847 | |||
| 1625 | 2937036873 | |||
| 1626 | 2937043309 | |||
| 1627 | 2937056257 | |||
| 1628 | 2937069270 | |||
| 1629 | 2937077099 | |||
| 1630 | 2937082954 | |||
| 1631 | 2937091232 | |||
| 1632 | 2937095617 | |||
| 1633 | 2937104190 | |||
| 1634 | 2937112520 | |||
| 1635 | 2937118294 | |||
| 1636 | 2937121212 | |||
| 1637 | 2937129845 | |||
| 1638 | 2941500238 | |||
| 1639 | 2957380006 | |||
| 1640 | 2957385043 | |||
| 1641 | 2957389104 | |||
| 1642 | 2957396422 | |||
| 1643 | 2957406506 | |||
| 1644 | 2957409828 | |||
| 1645 | 2957419225 | |||
| 1646 | 2957423028 | |||
| 1647 | 2957431065 | |||
| 1648 | 2957442043 | |||
| 1649 | 2957446626 | |||
| 1650 | 2957454216 | |||
| 1651 | 2957462424 | |||
| 1652 | 2957467722 | |||
| 1653 | 2957476674 | |||
| 1654 | 2957480602 | |||
| 1655 | 2957490212 | |||
| 1656 | 2957496020 | |||
| 1657 | 2957501062 | |||
| 1658 | 2957509618 | |||
| 1659 | 2960586670 | |||
| 1660 | 2960595592 | |||
| 1661 | 2960602753 | |||
| 1662 | 2960610449 | |||
| 1663 | 2960611615 | |||
| 1664 | 2960617728 | |||
| 1665 | 2960625461 | |||
| 1666 | 2960633207 | |||
| 1667 | 2960640233 | |||
| 1668 | 2960646153 | |||
| 1669 | 2960660149 | |||
| 1670 | 2960666432 | |||
| 1671 | 2960673951 | |||
| 1672 | 2960684181 | |||
| 1673 | 2960692000 | |||
| 1674 | 2960699296 | |||
| 1675 | 2964619981 | |||
| 1676 | 2964622999 | |||
| 1677 | 2964633091 | |||
| 1678 | 2964641308 | |||
| 1679 | 2964646187 | |||
| 1680 | 2964653131 | |||
| 1681 | 2964659270 | |||
| 1682 | 2964665947 | |||
| 1683 | 2964672839 | |||
| 1684 | 2964679234 | |||
| 1685 | 2964688134 | |||
| 1686 | 2964695867 | |||
| 1687 | 2964702261 | |||
| 1688 | 2964708068 | |||
| 1689 | 2964716325 | |||
| 1690 | 2964726064 | |||
| 1691 | 2967671115 | |||
| 1692 | 2967672118 | |||
| 1693 | 2967681071 | |||
| 1694 | 2967687054 | |||
| 1695 | 2967693273 | |||
| 1696 | 2967701149 | |||
| 1697 | 2967707477 | |||
| 1698 | 2967716501 | |||
| 1699 | 2967724615 | |||
| 1700 | 2967734715 | |||
| 1701 | 2967737551 | |||
| 1702 | 2967742639 | |||
| 1703 | 2967752079 | |||
| 1704 | 2967760545 | |||
| 1705 | 2967764459 | |||
| 1706 | 2967770818 | |||
| 1707 | 2967782203 | |||
| 1708 | 2970026099 | |||
| 1709 | 2970029120 | |||
| 1710 | 2970038812 | |||
| 1711 | 2970044567 | |||
| 1712 | 2970052860 | |||
| 1713 | 2970059582 | |||
| 1714 | 2970068779 | |||
| 1715 | 2970073887 | |||
| 1716 | 2970076943 | |||
| 1717 | 2970085302 | |||
| 1718 | 2970094407 | |||
| 1719 | 2970096742 | |||
| 1720 | 2970106902 | |||
| 1721 | 2970115839 | |||
| 1722 | 2970117941 | |||
| 1723 | 2970124440 | |||
| 1724 | 2970129545 | |||
| 1725 | 2970136743 | |||
| 1726 | 2970144392 | |||
| 1727 | 2970153788 | |||
| 1728 | 2970163666 | |||
| 1729 | 2970167530 | |||
| 1730 | 2970171820 | |||
| 1731 | 2970182790 | |||
| 1732 | 2970188283 | |||
| 1733 | 2970198298 | |||
| 1734 | 2977517889 | |||
| 1735 | 2977527682 | |||
| 1736 | 2977531918 | |||
| 1737 | 2977538014 | |||
| 1738 | 2977546075 | |||
| 1739 | 2977552015 | |||
| 1740 | 2977561645 | |||
| 1741 | 2977569008 | |||
| 1742 | 2977578935 | |||
| 1743 | 2977581467 | |||
| 1744 | 2978973770 | |||
| 1745 | 2979093691 | |||
| 1746 | 2979098926 | |||
| 1747 | 2979105668 | |||
| 1748 | 2984512486 | |||
| 1749 | 2984521153 | |||
| 1750 | 2984540447 | |||
| 1751 | 2984589118 | |||
| 1752 | 2984602644 | |||
| 1753 | 2989772030 | |||
| 1754 | 2989778147 | |||
| 1755 | 2996890835 | |||
| 1756 | 3003932643 | |||
| 1757 | 3005412415 | |||
| 1758 | 3005417112 | |||
| 1759 | 3005446731 | |||
| 1760 | 639647408 | |||
| 1761 | 648736392 | |||
| 1762 | 650739503 | |||
| 1763 | 8003570546 | |||
| 1764 | 8003992972 | |||
| 1765 | 8004000202 | |||
| 1766 | 8005251356 | |||
| 1767 | 8005261776 | |||
| 1768 | 8005284812 | |||
| 1769 | 8005292766 | |||
| 1770 | 8005304566 | |||
| 1771 | 8005309138 | |||
| 1772 | 8005315173 | |||
| 1773 | 8005325362 | |||
| 1774 | 8005376641 | |||
| 1775 | 8005432237 | |||
| 1776 | 8005485658 | |||
| 1777 | 8005499301 | |||
| 1778 | 8005544320 | |||
| 1779 | 8005627538 | |||
| 1780 | 8005648324 | |||
| 1781 | 8005660008 | |||
| 1782 | 8005670717 | |||
| 1783 | 8005684605 | |||
| 1784 | 8005690989 | |||
| 1785 | 8023686986 | |||
| 1786 | 8024481076 | |||
| 1787 | 8024489780 | |||
| 1788 | 8024503278 | |||
| 1789 | 8046767648 | |||
| 1790 | 8049293905 | |||
| 1791 | 8054461872 | |||
| 1792 | 8054562111 | |||
| 1793 | 8056380701 | |||
| 1794 | 8056384783 | |||
| 1795 | 8057582231 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6oeb-assembly1.cif.gz_A | crystal structure of hmces srap domain in complex with 3' overhang dna | 0.8331 | 6 | 226 |
| 5ko9-assembly1.cif.gz_A | crystal structure of the srap domain of human hmces protein | 0.831 | 18 | 227 |
| 8d2m-assembly2.cif.gz_B | covalent schiff base complex of yedk c2a and abasic dna | 0.8285 | 3 | 228 |
| 8d2m-assembly1.cif.gz_A | covalent schiff base complex of yedk c2a and abasic dna | 0.8255 | 4 | 229 |
| 6oea-assembly1.cif.gz_A | crystal structure of hmces srap domain in complex with longer 3' overhang dna | 0.8215 | 6 | 226 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2f20B00 | Alpha Beta;Alpha-Beta Complex;hypothetical protein yedk fold;SOS response associated peptidase-like | 0.8443 | 25 | 227 | 3.90.1680.10 |
| 6nlcA00 | Alpha Beta;Alpha-Beta Complex;hypothetical protein yedk fold;SOS response associated peptidase-like | 0.8194 | 6 | 226 | 3.90.1680.10 |
| af_I1KYZ5_1_237_3.90.1680.10 | Alpha Beta;Alpha-Beta Complex;hypothetical protein yedk fold;SOS response associated peptidase-like | 0.8152 | 2 | 230 | 3.90.1680.10 |
| af_O05872_1_242_3.90.1680.10 | Alpha Beta;Alpha-Beta Complex;hypothetical protein yedk fold;SOS response associated peptidase-like | 0.8047 | 1 | 226 | 3.90.1680.10 |
| af_Q04471_25_258_3.90.1680.10 | Alpha Beta;Alpha-Beta Complex;hypothetical protein yedk fold;SOS response associated peptidase-like | 0.8042 | 15 | 227 | 3.90.1680.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3M1JQD9-F1-model_v4 | Abasic site processing protein (EC 3.4.-.-) | 0.9599 | 122 | 227 |
GO:0003697
GO:0006508 GO:0008233 GO:0016829 GO:0106300 |
| AF-A0A2N2L8D2-F1-model_v4 | Abasic site processing protein (EC 3.4.-.-) | 0.9591 | 73 | 209 |
GO:0003697
GO:0006508 GO:0008233 GO:0016829 GO:0106300 |
| AF-A0A382LKZ6-F1-model_v4 | Abasic site processing protein | 0.9513 | 120 | 226 |
GO:0003697
GO:0006508 GO:0008233 GO:0016829 GO:0106300 |
| AF-A0A2V9WDH9-F1-model_v4 | Abasic site processing protein (EC 3.4.-.-) | 0.9498 | 73 | 214 |
GO:0003697
GO:0006508 GO:0008233 GO:0016829 GO:0106300 |
| AF-A0A7V5ZEX6-F1-model_v4 | Abasic site processing protein (EC 3.4.-.-) | 0.9492 | 100 | 226 |
GO:0003697
GO:0006508 GO:0008233 GO:0016829 GO:0106300 |