F485046

General Info

Members Datasets Scaffolds Average Seq Length
897 671 1795 257

Family's Representative Sequence

Representative Sequence 3300021327|Ga0214543_1000003|Ga0214543_1000003458
Length 265
Sequence MAEEACSGWFGIWESNFNWVVDPSYVKCHIDVMCGRFALTATPEELMGLFGLLEADDFPARFNIAPTQPIIVIVAADRAEPGSNLPERKALLVRWGFTPGWVKDPRKFPLLINARAETAVGKAAFRAAMRHRRIVVPASGFYEWRRPAKGGGEPSQAHVVAFAGLMETWSSADGSEVDTAAILTTDANRVVRHIHDRMPVVIEPEDFARWLDCRTQEPRDVTDLMVPAAEDYFEAIPISDKVNKVTNTGPEIQDEVAPDGQMSLF

Samples

Sample ID Description Type Environment
1 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
2 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
3 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
4 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
5 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
6 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
7 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
8 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
9 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
10 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
11 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
12 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
13 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
14 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
15 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
16 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
17 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
18 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
19 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
20 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
21 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
22 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
23 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
24 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
25 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
26 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
27 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
28 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
29 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
30 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
31 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
32 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
33 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
34 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
35 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
36 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
37 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
38 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
39 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
40 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
41 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
42 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
43 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
44 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
45 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
46 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
47 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
48 3300009763 Root nodule microbial communities of legume samples collected from Mexico - Siratro Mexico nodule mix Metagenome Nodule
49 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
50 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
51 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
52 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
53 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
54 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
55 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
56 3300013249 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 Metagenome Rhizosphere
57 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
58 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
59 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
60 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
61 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
62 3300022739 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules Metagenome Nodule
63 3300022740 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules Metagenome Nodule
64 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
65 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
66 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
67 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
68 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
69 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
70 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
71 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
72 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
73 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
74 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
75 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
76 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
77 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
78 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
79 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
80 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
81 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
82 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
83 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
84 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
85 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
91 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
92 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
93 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
95 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
96 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
97 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
98 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
99 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
100 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
101 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
102 3300031967 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules Metagenome Nodule
103 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
104 3300033430 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules Metagenome Nodule
105 3300033464 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules Metagenome Nodule
106 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
107 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
108 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
109 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
110 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
111 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
112 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
113 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
114 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
115 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
116 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
117 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
118 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
119 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
120 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
121 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
122 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
123 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
124 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
125 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
126 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
127 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
128 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
129 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
130 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
131 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
132 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
133 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
134 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
135 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
136 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
137 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
138 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
139 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
140 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
141 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
142 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
143 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
144 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
145 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
146 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
147 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
148 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
149 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
150 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
151 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
152 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
153 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
154 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
155 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
156 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
157 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
158 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
159 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
160 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
161 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
162 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
163 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
164 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
165 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
166 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
167 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
168 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
169 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
170 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
171 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
172 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
173 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
174 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
175 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
176 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
177 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
178 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
179 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
180 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
181 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
182 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
183 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
184 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
185 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
186 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
187 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
188 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
189 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
190 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
191 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
192 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
193 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
194 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
195 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
196 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
197 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
198 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
199 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
200 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
201 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
202 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
203 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
204 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
205 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
206 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
207 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
208 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
209 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
210 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
211 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
212 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
213 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
214 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
215 2508501122 Ensifer yinggardensis WSM1721 Isolate Nodule
216 2509276019 Ensifer aridi TW10 Isolate Nodule
217 2509276021 Rhizobium leguminosarum bv. trifolii WSM597 Isolate Nodule
218 2509276033 Rhizobium leguminosarum bv. trifolii WSM2012 Isolate Nodule
219 2510065019 Rhizobium leguminosarum bv. trifolii WSM1689 Isolate Nodule
220 2510065057 Sinorhizobium meliloti WSM1022 Isolate Nodule
221 2510917022 Rhizobium sp. AP16 Isolate Rhizosphere
222 2510917028 Rhizobium sp. CF122 Isolate Rhizosphere
223 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
224 2511231052 Sinorhizobium meliloti AK58 Isolate Nodule
225 2512047086 Sinorhizobium arboris LMG 14919 Isolate Nodule
226 2512875026 Sinorhizobium medicae WSM1115 Isolate Nodule
227 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
228 2513237086 Sinorhizobium meliloti MVII-I Isolate Nodule
229 2513237088 Rhizobium mesoamericanum STM6155 Isolate Nodule
230 2513237089 Sinorhizobium medicae DI28 Isolate Nodule
231 2513237091 Sinorhizobium meliloti RRI128 Isolate Nodule
232 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
233 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
234 2513237138 Rhizobium favelukesii OR191 Isolate Nodule
235 2513237140 Sinorhizobium meliloti GVPV12 Isolate Nodule
236 2513237143 Sinorhizobium meliloti Mlalz-1 Isolate Nodule
237 2513237156 Sinorhizobium medicae WSM1369 Isolate Nodule
238 2513237159 Rhizobium giardinii bv. giardinii H152 Isolate Nodule
239 2513237160 Sinorhizobium medicae WSM244 Isolate Nodule
240 2515154107 Sinorhizobium meliloti 4H41 Isolate Nodule
241 2515154134 Rhizobium gallicum bv. gallicum R602sp Isolate Nodule
242 2516143018 Ensifer sp. BR816 Isolate Nodule
243 2516653046 Sinorhizobium meliloti BO21CC Isolate Nodule
244 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
245 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
246 2517487022 Sinorhizobium medicae WSM4191 Isolate Nodule
247 2524023207 Ensifer sp. USDA 6670 Isolate Nodule
248 2524023209 Rhizobium leucaenae USDA 9039 Isolate Nodule
249 2534681796 Rhizobium grahamii CCGE 502 Isolate Nodule
250 2537561587 Agrobacterium tumefaciens Cherry 2E-2-2 Isolate Rhizosphere
251 2551306084 Sinorhizobium meliloti 5A14 Isolate Nodule
252 2551306085 Sinorhizobium meliloti AE608H Isolate Nodule
253 2551306086 Sinorhizobium meliloti AK11 Isolate Nodule
254 2551306087 Sinorhizobium meliloti A0643DD Isolate Nodule
255 2551306089 Sinorhizobium meliloti 1A42 Isolate Nodule
256 2551306090 Sinorhizobium meliloti A0641M Isolate Nodule
257 2551306091 Sinorhizobium meliloti C0431A Isolate Nodule
258 2551306092 Sinorhizobium meliloti AK75 Isolate Nodule
259 2551306093 Sinorhizobium meliloti C0438LL Isolate Nodule
260 2554235003 Agrobacterium tumefaciens WRT31 Isolate Rhizosphere
261 2558860100 Sinorhizobium sp. PC2 Isolate Nodule
262 2558860242 Agrobacterium fabacearum P4 Isolate Rhizosphere
263 2558860983 Allorhizobium undicola ATCC 700741 Isolate Rhizoplane
264 2582581283 Rhizobium sp. OK665 Isolate Rhizosphere
265 2582581294 Rhizobium sp. CF394 Isolate Rhizosphere
266 2582581298 Rhizobium alamii YR540 Isolate Rhizosphere
267 2582581299 Rhizobium leguminosarum OV483 Isolate Rhizosphere
268 2582581307 Rhizobium sp. YR060 Isolate Rhizosphere
269 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
270 2582581315 Agrobacterium rhizogenes YR147 Isolate Rhizosphere
271 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
272 2582581866 Rhizobium sp. CF097 Isolate Rhizosphere
273 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
274 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
275 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
276 2585427529 Rhizobium alamii YR584 Isolate Rhizosphere
277 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
278 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
279 2585427590 Rhizobium sp. CF048 Isolate Rhizosphere
280 2585427594 Rhizobium sp. YR528 Isolate Rhizosphere
281 2585427608 Agrobacterium rhizogenes OV677 Isolate Rhizosphere
282 2585427609 Agrobacterium rhizogenes CF263 Isolate Rhizosphere
283 2585428125 Agrobacterium rhizogenes CF262 Isolate Rhizosphere
284 2599185156 Rhizobium sp. NFR03 Isolate Rhizoplane
285 2599185210 Rhizobium sp. NFACC06-2 Isolate Rhizoplane
286 2599185236 Rhizobium sp. NFR07 Isolate Rhizoplane
287 2599185352 Sinorhizobium sp. NFACC03 Isolate Rhizoplane
288 2600255279 Rhizobium sp. NFIX01 Isolate Rhizoplane
289 2600255308 Rhizobium sp. NFIX02 Isolate Rhizoplane
290 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
291 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
292 2617270742 Rhizobium miluonense HAMBI 2971 Isolate Nodule
293 2643221557 Ensifer sp. Root558 Isolate Unclassified
294 2643221568 Rhizobium sp. Root564 Isolate Unclassified
295 2643221582 Rhizobium sp. Root651 Isolate Unclassified
296 2643221610 Ensifer sp. Root74 Isolate Unclassified
297 2643221618 Ensifer sp. Root231 Isolate Unclassified
298 2643221626 Ensifer sp. Root31 Isolate Unclassified
299 2643221634 Rhizobium sp. Root1203 Isolate Unclassified
300 2643221637 Rhizobium sp. Root1212 Isolate Unclassified
301 2643221653 Rhizobium sp. Root1240 Isolate Unclassified
302 2643221655 Ensifer sp. Root1252 Isolate Unclassified
303 2643221659 Ensifer sp. Root127 Isolate Unclassified
304 2643221668 Ensifer sp. Root423 Isolate Unclassified
305 2643221675 Ensifer sp. Root1298 Isolate Unclassified
306 2643221680 Ensifer sp. Root1312 Isolate Unclassified
307 2643221688 Rhizobium sp. Root482 Isolate Unclassified
308 2643221693 Rhizobium sp. Root491 Isolate Unclassified
309 2643221698 Ensifer sp. Root142 Isolate Unclassified
310 2643221712 Ensifer sp. Root258 Isolate Unclassified
311 2643221718 Rhizobium sp. Root268 Isolate Unclassified
312 2643221719 Rhizobium sp. Root274 Isolate Unclassified
313 2643221723 Ensifer sp. Root278 Isolate Unclassified
314 2643221726 Ensifer sp. Root954 Isolate Unclassified
315 2657244999 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
316 2667528174 Rhizobium sp. NFR17 Isolate Rhizoplane
317 2718217997 Rhizobium phaseoli sv. phaseoli R723 Isolate Nodule
318 2718218199 Rhizobium phaseoli sv. phaseoli N261 Isolate Nodule
319 2718218232 Rhizobium phaseoli sv. phaseoli N161 Isolate Nodule
320 2718218233 Rhizobium phaseoli sv. phaseoli R744 Isolate Nodule
321 2718218235 Rhizobium phaseoli sv. phaseoli R620 Isolate Nodule
322 2718218269 Rhizobium phaseoli sv. phaseoli N671 Isolate Nodule
323 2721755556 Rhizobium phaseoli sv. phaseoli N931 Isolate Nodule
324 2721755684 Rhizobium phaseoli sv. phaseoli N841 Isolate Nodule
325 2721755685 Rhizobium phaseoli sv. phaseoli R611 Isolate Nodule
326 2721755819 Rhizobium phaseoli sv. phaseoli N771 Isolate Nodule
327 2721755822 Rhizobium phaseoli sv. phaseoli R650 Isolate Nodule
328 2721755823 Rhizobium phaseoli sv. phaseoli R630 Isolate Nodule
329 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
330 2728369352 Rhizobium phaseoli sv. phaseoli N831 Isolate Nodule
331 2738541293 Rhizobium sp. GV031 Isolate Unclassified
332 2751185821 Ensifer shofinae CCBAU 251167 Isolate Unclassified
333 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
334 2775507049 Rhizobium sp. ACO-34A Isolate Unclassified
335 2775507266 Rhizobium tropici PRF 81 Isolate Nodule
336 2791355082 Ensifer alkalisoli YIC4027 Isolate Nodule
337 2791355091 Sinorhizobium sp. FG01 Isolate Nodule
338 2791355092 Sinorhizobium sp. NG07B Isolate Nodule
339 2791355256 Rhizobium sp. M10 Isolate Nodule
340 2791355259 Rhizobium hidalgonense FH14 Isolate Nodule
341 2791355262 Rhizobium sp. M1 Isolate Nodule
342 2791355265 Rhizobium sp. H4 Isolate Nodule
343 2791355267 Rhizobium sp. L18 Isolate Nodule
344 2802428858 Sinorhizobium medicae M14-1 Isolate Nodule
345 2802428859 Sinorhizobium medicae SF3.41 Isolate Nodule
346 2802428860 Sinorhizobium medicae M19-1 Isolate Nodule
347 2802428861 Sinorhizobium medicae USDA1037 Isolate Nodule
348 2802428862 Sinorhizobium medicae M7-4 Isolate Nodule
349 2802428863 Sinorhizobium medicae M26-2 Isolate Nodule
350 2802429268 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
351 2802429605 Rhizobium sophoriradicis L101 Isolate Nodule
352 2802429606 Rhizobium sophoriradicis JJW1 Isolate Nodule
353 2808606387 Rhizobium sp. SJZ105 Isolate Rhizosphere
354 2818991272 Rhizobium sp. SLBN-4 Isolate Unclassified
355 2818991439 Agrobacterium tumefaciens 1187 Isolate Unclassified
356 2818991448 Rhizobium miluonense 1234 Isolate Unclassified
357 2818991453 Rhizobium lusitanum 1158 Isolate Unclassified
358 2838029111 Rhizobium tropici SEMIA 4079 Isolate Nodule
359 2838048938 Rhizobium pisi 27/80 Isolate Nodule
360 2838061910 Rhizobium phaseoli L15 Isolate Nodule
361 2838068647 Rhizobium esperanzae VC28 Isolate Nodule
362 2838074704 Sinorhizobium terangae SEMIA 6460 Isolate Unclassified
363 2838668709 Rhizobium sophoriradicis SEMIA 403 Isolate Nodule
364 2838675328 Agrobacterium radiobacter SEMIA 410 Isolate Nodule
365 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
366 2838701080 Rhizobium aethiopicum SEMIA 428 Isolate Nodule
367 2838714209 Agrobacterium radiobacter SEMIA 435 Isolate Nodule
368 2838719591 Agrobacterium radiobacter SEMIA 436 Isolate Nodule
369 2838724970 Agrobacterium radiobacter SEMIA 437 Isolate Nodule
370 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
371 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
372 2841846520 Agrobacterium radiobacter SEMIA 440 Isolate Nodule
373 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
374 2841859092 Agrobacterium radiobacter SEMIA 4026 Isolate Nodule
375 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
376 2842124991 Agrobacterium radiobacter SEMIA 434 Isolate Nodule
377 2842130223 Agrobacterium radiobacter SEMIA 441 Isolate Nodule
378 2842146304 Rhizobium sophoriradicis SEMIA 454 Isolate Nodule
379 2842152218 Agrobacterium radiobacter SEMIA 457 Isolate Nodule
380 2842156927 Rhizobium leguminosarum SEMIA 459 Isolate Nodule
381 2842163707 Rhizobium leguminosarum SEMIA 460 Isolate Nodule
382 2842170452 Agrobacterium radiobacter SEMIA 461 Isolate Nodule
383 2842175837 Agrobacterium radiobacter SEMIA 462 Isolate Nodule
384 2842180545 Rhizobium leguminosarum SEMIA 463 Isolate Nodule
385 2842187318 Agrobacterium radiobacter SEMIA 464 Isolate Nodule
386 2842192696 Rhizobium esperanzae SEMIA 468 Isolate Nodule
387 2842205361 Rhizobium etli SEMIA 471 Isolate Nodule
388 2842211629 Agrobacterium radiobacter SEMIA 472 Isolate Nodule
389 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
390 2842224351 Agrobacterium radiobacter SEMIA 480 Isolate Nodule
391 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
392 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
393 2842250916 Rhizobium etli SEMIA 484 Isolate Nodule
394 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
395 2842264693 Rhizobium phaseoli SEMIA 487 Isolate Nodule
396 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
397 2842278818 Rhizobium etli SEMIA 489 Isolate Nodule
398 2842285085 Rhizobium lentis SEMIA 490 Isolate Nodule
399 2842298080 Rhizobium leucaenae SEMIA 492 Isolate Nodule
400 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
401 2842311132 Rhizobium phaseoli SEMIA 4002 Isolate Nodule
402 2842317721 Rhizobium etli SEMIA 4004 Isolate Nodule
403 2842341865 Rhizobium leguminosarum SEMIA 4011 Isolate Nodule
404 2842357229 Rhizobium leucaenae SEMIA 4015 Isolate Nodule
405 2842363717 Rhizobium leguminosarum SEMIA 4016 Isolate Nodule
406 2842402390 Rhizobium lentis SEMIA 4033 Isolate Nodule
407 2842409023 Rhizobium lentis SEMIA 4034 Isolate Nodule
408 2842415677 Rhizobium lentis SEMIA 4036 Isolate Nodule
409 2842422224 Rhizobium esperanzae SEMIA 4042 Isolate Nodule
410 2842428310 Rhizobium phaseoli SEMIA 4050 Isolate Nodule
411 2842434925 Rhizobium esperanzae SEMIA 4051 Isolate Nodule
412 2842441272 Rhizobium esperanzae SEMIA 4053 Isolate Nodule
413 2842447887 Rhizobium esperanzae SEMIA 4055 Isolate Nodule
414 2842462802 Rhizobium phaseoli SEMIA 4057 Isolate Nodule
415 2842469257 Rhizobium phaseoli SEMIA 4058 Isolate Nodule
416 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
417 2842482326 Rhizobium lusitanum SEMIA 4060 Isolate Nodule
418 2842489311 Rhizobium sophoriradicis SEMIA 4061 Isolate Nodule
419 2842495871 Rhizobium etli SEMIA 4062 Isolate Nodule
420 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
421 2842509118 Rhizobium paranaense SEMIA 4064 Isolate Nodule
422 2842515876 Agrobacterium radiobacter SEMIA 4072 Isolate Nodule
423 2842521101 Rhizobium giardinii SEMIA 4084 Isolate Nodule
424 2842922631 Pararhizobium sp. R-72066 Isolate Unclassified
425 2844163670 Ensifer sp. 1H6 Isolate Unclassified
426 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
427 2848992105 Sinorhizobium fredii CCBAU 25509 Isolate Unclassified
428 2850079185 Ensifer aridi JNVU TP6 Isolate Unclassified
429 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
430 2855825444 Sinorhizobium meliloti CXM1-105 Isolate Nodule
431 2855839649 Sinorhizobium meliloti AK555 Isolate Unclassified
432 2855872281 Sinorhizobium fredii PCH1 Isolate Nodule
433 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
434 2858800743 Sinorhizobium meliloti AK170 Isolate Unclassified
435 2896384573 Ensifer sp. MPMI2T Isolate Unclassified
436 2899792073 Agrobacterium deltaense CNPSo 3391 Isolate Nodule
437 2899803654 Agrobacterium sp. a22-2 Isolate Unclassified
438 2899845264 Agrobacterium fabacearum CNPSo 675 Isolate Unclassified
439 2913295892 Sinorhizobium kostiensis DSM 13372 Isolate Nodule
440 2913308742 Rhizobium halophytocola DSM 21600 Isolate Unclassified
441 2915980308 Sinorhizobium medicae USDA1149 Isolate Nodule
442 2915986958 Sinorhizobium meliloti USDA1659 Isolate Nodule
443 2915993759 Sinorhizobium meliloti USDA1336 Isolate Nodule
444 2916000859 Sinorhizobium meliloti USDA1562 Isolate Nodule
445 2916007675 Sinorhizobium meliloti USDA1289 Isolate Nodule
446 2916014648 Sinorhizobium meliloti USDA1583 Isolate Nodule
447 2916021584 Sinorhizobium meliloti USDA1550 Isolate Nodule
448 2916028427 Sinorhizobium meliloti USDA1613 Isolate Nodule
449 2916035215 Sinorhizobium meliloti 3011 Isolate Nodule
450 2916041962 Sinorhizobium meliloti USDA1795 Isolate Nodule
451 2916048683 Sinorhizobium meliloti USDA1796 Isolate Nodule
452 2916055098 Sinorhizobium meliloti USDA1770 Isolate Nodule
453 2916061851 Sinorhizobium medicae USDA1638 Isolate Nodule
454 2916076590 Sinorhizobium meliloti USDA1661 Isolate Nodule
455 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
456 2919114240 Agrobacterium tumefaciens 1457 Isolate Rhizosphere
457 2919166419 Agrobacterium cavarae 2074 Isolate Unclassified
458 2919408235 Rhizobium miluonense 3199 Isolate Unclassified
459 2920760137 Ensifer psoraleae CCBAU 65732 Isolate Unclassified
460 2920822456 Ensifer sesbaniae CCBAU 65729 Isolate Unclassified
461 2921201388 Sinorhizobium meliloti USDA1692 Isolate Nodule
462 2921208531 Sinorhizobium meliloti USDA1660 Isolate Nodule
463 2921237296 Sinorhizobium meliloti USDA1508 Isolate Nodule
464 2921244191 Sinorhizobium meliloti 2119 Isolate Nodule
465 2921250672 Sinorhizobium medicae USDA1169 Isolate Nodule
466 2921257292 Sinorhizobium meliloti USDA1320 Isolate Nodule
467 2921263974 Sinorhizobium meliloti USDA1107 Isolate Nodule
468 2921282425 Sinorhizobium meliloti USDA1203 Isolate Nodule
469 2921289301 Sinorhizobium meliloti USDA1730 Isolate Nodule
470 2921296804 Sinorhizobium meliloti USDA1200 Isolate Nodule
471 2923556063 Rhizobium tibeticum 3740 Isolate Unclassified
472 2924144063 Sinorhizobium meliloti USDA1022 Isolate Nodule
473 2924150972 Sinorhizobium meliloti USDA1700 Isolate Nodule
474 2924158325 Sinorhizobium meliloti USDA1146 Isolate Nodule
475 2924165586 Sinorhizobium meliloti USDA1264 Isolate Nodule
476 2924172951 Sinorhizobium meliloti USDA1626 Isolate Nodule
477 2924179722 Sinorhizobium meliloti USDA1280 Isolate Nodule
478 2924186466 Sinorhizobium meliloti USDA1389 Isolate Nodule
479 2924193448 Sinorhizobium meliloti USDA1158 Isolate Nodule
480 2924200457 Sinorhizobium meliloti USDA1007 Isolate Nodule
481 2924207177 Sinorhizobium meliloti USDA1589 Isolate Nodule
482 2924214083 Sinorhizobium meliloti USDA1702 Isolate Nodule
483 2924221636 Sinorhizobium meliloti USDA1416 Isolate Nodule
484 2924228884 Sinorhizobium meliloti USDA1581 Isolate Nodule
485 2926754445 Agrobacterium radiobacter SLBN-94 Isolate Rhizosphere
486 2926760298 Agrobacterium tumefaciens SLBN-170 Isolate Rhizosphere
487 2933006813 Rhizobium sp. SEMIA 439 Isolate Unclassified
488 2933011516 Rhizobium sp. SEMIA 4032 Isolate Unclassified
489 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
490 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
491 2933594066 Agrobacterium fabrum 35/80 Isolate Nodule
492 2933599457 Rhizobium phaseoli M3 Isolate Nodule
493 2935901341 Rhizobium leguminosarum SEMIA 4082 Isolate Nodule
494 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
495 2936996657 Sinorhizobium meliloti USDA1025 Isolate Nodule
496 2937002841 Sinorhizobium meliloti USDA1006 Isolate Nodule
497 2937009748 Sinorhizobium meliloti USDA1162 Isolate Nodule
498 2937016420 Sinorhizobium meliloti USDA1027 Isolate Nodule
499 2937023124 Sinorhizobium meliloti USDA1335 Isolate Nodule
500 2937029754 Sinorhizobium medicae USDA1624 Isolate Nodule
501 2937036028 Sinorhizobium medicae USDA1608 Isolate Nodule
502 2937042894 Sinorhizobium meliloti USDA1687 Isolate Nodule
503 2937049772 Sinorhizobium meliloti USDA1691 Isolate Nodule
504 2937063883 Sinorhizobium meliloti USDA1808 Isolate Nodule
505 2937071275 Sinorhizobium meliloti USDA1623 Isolate Nodule
506 2937078374 Sinorhizobium medicae USDA1004 Isolate Nodule
507 2937084907 Sinorhizobium medicae USDA1664 Isolate Nodule
508 2937091812 Sinorhizobium meliloti USDA1221 Isolate Nodule
509 2937098957 Sinorhizobium meliloti USDA1519 Isolate Nodule
510 2937106411 Sinorhizobium meliloti USDA1214 Isolate Nodule
511 2937113482 Sinorhizobium meliloti USDA1180 Isolate Nodule
512 2937119839 Sinorhizobium meliloti USDA1790 Isolate Nodule
513 2937126314 Sinorhizobium meliloti USDA1612 Isolate Nodule
514 2941499720 Ensifer sp. 4252 Isolate Rhizosphere
515 2957375807 Sinorhizobium medicae USDA1632 Isolate Nodule
516 2957382221 Sinorhizobium meliloti USDA1919 Isolate Nodule
517 2957388812 Sinorhizobium meliloti USDA1195 Isolate Nodule
518 2957395598 Sinorhizobium meliloti USDA1237 Isolate Nodule
519 2957402308 Sinorhizobium meliloti USDA1794 Isolate Nodule
520 2957408893 Sinorhizobium meliloti USDA1163 Isolate Nodule
521 2957415311 Sinorhizobium meliloti USDA1724 Isolate Nodule
522 2957422303 Sinorhizobium meliloti USDA1497 Isolate Nodule
523 2957430029 Sinorhizobium meliloti USDA1590 Isolate Nodule
524 2957437181 Sinorhizobium medicae USDA1694 Isolate Nodule
525 2957443900 Sinorhizobium meliloti USDA1734 Isolate Nodule
526 2957450854 Sinorhizobium meliloti USDA1655 Isolate Nodule
527 2957457609 Sinorhizobium meliloti USDA1751 Isolate Nodule
528 2957464669 Sinorhizobium meliloti USDA1520 Isolate Nodule
529 2957471148 Sinorhizobium meliloti USDA1204 Isolate Nodule
530 2957478035 Sinorhizobium meliloti USDA1171 Isolate Nodule
531 2957484790 Sinorhizobium meliloti USDA1464 Isolate Nodule
532 2957491536 Sinorhizobium meliloti USDA1804 Isolate Nodule
533 2957498199 Sinorhizobium meliloti USDA1561 Isolate Nodule
534 2957505466 Sinorhizobium meliloti USDA1696 Isolate Nodule
535 2960584000 Sinorhizobium meliloti USDA1530 Isolate Nodule
536 2960591022 Sinorhizobium medicae USDA1066 Isolate Nodule
537 2960597568 Sinorhizobium meliloti 3085 Isolate Nodule
538 2960603979 Sinorhizobium meliloti USDA1580 Isolate Nodule
539 2960610863 Sinorhizobium meliloti USDA1792 Isolate Nodule
540 2960617483 Sinorhizobium meliloti USDA1719 Isolate Nodule
541 2960624210 Sinorhizobium meliloti USDA1415 Isolate Nodule
542 2960631154 Sinorhizobium medicae USDA1629 Isolate Nodule
543 2960637947 Sinorhizobium meliloti USDA1202 Isolate Nodule
544 2960645483 Sinorhizobium meliloti USDA1703 Isolate Nodule
545 2960652885 Sinorhizobium meliloti USDA1199 Isolate Nodule
546 2960660292 Sinorhizobium meliloti USDA1883 Isolate Nodule
547 2960667422 Sinorhizobium meliloti USDA1170 Isolate Nodule
548 2960680706 Sinorhizobium medicae USDA1150 Isolate Nodule
549 2960687367 Sinorhizobium meliloti USDA1462 Isolate Nodule
550 2960693952 Sinorhizobium medicae USDA1630 Isolate Nodule
551 2964615318 Sinorhizobium meliloti USDA1248 Isolate Nodule
552 2964621998 Sinorhizobium meliloti USDA1235 Isolate Nodule
553 2964628898 Sinorhizobium meliloti USDA1191 Isolate Nodule
554 2964636051 Sinorhizobium meliloti USDA1594 Isolate Nodule
555 2964643177 Sinorhizobium meliloti USDA1760 Isolate Nodule
556 2964649959 Sinorhizobium meliloti USDA1591 Isolate Nodule
557 2964656573 Sinorhizobium meliloti USDA1308 Isolate Nodule
558 2964663802 Sinorhizobium meliloti USDA1688 Isolate Nodule
559 2964670856 Sinorhizobium meliloti USDA1211 Isolate Nodule
560 2964678106 Sinorhizobium meliloti USDA1210 Isolate Nodule
561 2964685014 Sinorhizobium meliloti USDA1232 Isolate Nodule
562 2964691889 Sinorhizobium meliloti USDA1379 Isolate Nodule
563 2964698721 Sinorhizobium meliloti USDA1656 Isolate Nodule
564 2964705432 Sinorhizobium meliloti USDA1614 Isolate Nodule
565 2964712639 Sinorhizobium meliloti USDA1616 Isolate Nodule
566 2964719344 Sinorhizobium meliloti USDA1456 Isolate Nodule
567 2967664464 Sinorhizobium meliloti USDA1208 Isolate Nodule
568 2967671571 Sinorhizobium meliloti USDA1496 Isolate Nodule
569 2967678726 Sinorhizobium meliloti USDA1467 Isolate Nodule
570 2967686174 Sinorhizobium medicae USDA1641 Isolate Nodule
571 2967693043 Sinorhizobium meliloti USDA1183 Isolate Nodule
572 2967699805 Sinorhizobium meliloti USDA1695 Isolate Nodule
573 2967706974 Sinorhizobium meliloti USDA1206 Isolate Nodule
574 2967714385 Sinorhizobium meliloti USDA1023 Isolate Nodule
575 2967721400 Sinorhizobium meliloti USDA1742 Isolate Nodule
576 2967728569 Sinorhizobium medicae USDA1607 Isolate Nodule
577 2967735183 Sinorhizobium meliloti USDA1710 Isolate Nodule
578 2967742019 Sinorhizobium meliloti USDA1676 Isolate Nodule
579 2967748971 Sinorhizobium meliloti USDA1024A Isolate Nodule
580 2967755722 Sinorhizobium meliloti USDA1302 Isolate Nodule
581 2967762386 Sinorhizobium meliloti USDA1397 Isolate Nodule
582 2967769361 Sinorhizobium meliloti USDA1005 Isolate Nodule
583 2967775926 Sinorhizobium meliloti USDA1678 Isolate Nodule
584 2970019648 Sinorhizobium meliloti USDA1603 Isolate Nodule
585 2970026789 Sinorhizobium medicae USDA1611 Isolate Nodule
586 2970033650 Sinorhizobium meliloti USDA1565 Isolate Nodule
587 2970040964 Sinorhizobium meliloti USDA1501 Isolate Nodule
588 2970047711 Sinorhizobium meliloti USDA1793 Isolate Nodule
589 2970054988 Sinorhizobium meliloti USDA1031 Isolate Nodule
590 2970061556 Sinorhizobium meliloti USDA1810 Isolate Nodule
591 2970068827 Sinorhizobium meliloti USDA1227 Isolate Nodule
592 2970076120 Sinorhizobium meliloti USDA1706 Isolate Nodule
593 2970082768 Sinorhizobium meliloti USDA1803 Isolate Nodule
594 2970088815 Sinorhizobium meliloti USDA1819 Isolate Nodule
595 2970095765 Sinorhizobium meliloti USDA1225 Isolate Nodule
596 2970102677 Sinorhizobium meliloti USDA1325 Isolate Nodule
597 2970109326 Sinorhizobium meliloti USDA1186 Isolate Nodule
598 2970116247 Sinorhizobium meliloti USDA1566 Isolate Nodule
599 2970122695 Sinorhizobium medicae 3082 Isolate Nodule
600 2970129317 Sinorhizobium meliloti USDA1008 Isolate Nodule
601 2970136068 Sinorhizobium meliloti USDA1699 Isolate Nodule
602 2970143518 Sinorhizobium medicae USDA1652 Isolate Nodule
603 2970149975 Sinorhizobium meliloti USDA1215 Isolate Nodule
604 2970156795 Sinorhizobium meliloti USDA1491 Isolate Nodule
605 2970164137 Sinorhizobium meliloti USDA1018 Isolate Nodule
606 2970170962 Sinorhizobium meliloti USDA1571 Isolate Nodule
607 2970177841 Sinorhizobium meliloti USDA1533 Isolate Nodule
608 2970184632 Sinorhizobium meliloti USDA1593 Isolate Nodule
609 2970191845 Sinorhizobium meliloti USDA1187 Isolate Nodule
610 2977516862 Sinorhizobium meliloti USDA1791 Isolate Nodule
611 2977523885 Sinorhizobium meliloti USDA1777 Isolate Nodule
612 2977530762 Sinorhizobium medicae USDA1606 Isolate Nodule
613 2977537788 Sinorhizobium meliloti USDA1184 Isolate Nodule
614 2977544691 Sinorhizobium medicae USDA1631 Isolate Nodule
615 2977551784 Sinorhizobium meliloti USDA1035 Isolate Nodule
616 2977558990 Sinorhizobium meliloti USDA1222 Isolate Nodule
617 2977565890 Sinorhizobium meliloti USDA1617 Isolate Nodule
618 2977572785 Sinorhizobium meliloti USDA1767 Isolate Nodule
619 2977579622 Sinorhizobium meliloti USDA1161 Isolate Nodule
620 2978969890 Agrobacterium sp. SORGH_AS 787 Isolate Unclassified
621 2979089926 Agrobacterium sp. SORGH_AS 745 Isolate Unclassified
622 2979095461 Agrobacterium tumefaciens SORGH_AS 749 Isolate Unclassified
623 2979100975 Agrobacterium pusense SORGH_AS 755 Isolate Unclassified
624 2984509177 Agrobacterium pusense SORGH_AS260 Isolate Aerial Root
625 2984518228 Agrobacterium pusense SORGH_AS285 Isolate Aerial Root
626 2984537506 Agrobacterium sp. SORGH_AS440 Isolate Aerial Root
627 2984587000 Agrobacterium larrymoorei SORGH_AS974 Isolate Aerial Root
628 2984601300 Rhizobium pusense SORGH_AS1083 Isolate Aerial Root
629 2989771324 Rhizobium rhizolycopersici DBTS2 Isolate Rhizosphere
630 2989776772 Rhizobium glycinendophyticum CL12 Isolate Unclassified
631 2996887358 Rhizobium sp. R711 Isolate Nodule
632 3003930520 Sinorhizobium sp. BG8 Isolate Unclassified
633 3005409236 Rhizobium sp. P32RR-XVIII Isolate Rhizosphere
634 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
635 3005445848 Rhizobium sp. WYJ-E13 Isolate Unclassified
636 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
637 648276728 Sinorhizobium meliloti BL225C Isolate Nodule
638 650716007 Agrobacterium fabacearum H13-3 Isolate Rhizosphere
639 8003570095 Agrobacterium rhizogenes GBBC3284 Isolate Unclassified
640 8003992118 Sinorhizobium meliloti RRI128 Isolate Nodule
641 8003999396 Sinorhizobium medicae WSM1115 Isolate Nodule
642 8005246636 Rhizobium wuzhouense W44 Isolate Rhizosphere
643 8005258706 Rhizobium sp. R693 Isolate Nodule
644 8005282627 Rhizobium phaseoli NC1 Isolate Nodule
645 8005289223 Rhizobium bangladeshense 1002 Isolate Nodule
646 8005301065 Rhizobium bangladeshense 1017 Isolate Nodule
647 8005307578 Rhizobium leguminosarum bv. phaseoli LCS0306 Isolate Unclassified
648 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
649 8005321885 Rhizobium sp. R72 Isolate Nodule
650 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
651 8005430974 Rhizobium phaseoli Y20 Isolate Nodule
652 8005484373 Rhizobium tropici SARCC-755 Isolate Nodule
653 8005497431 Rhizobium phaseoli CCGM8 Isolate Unclassified
654 8005542996 Rhizobium grahamii CCGM3 Isolate Unclassified
655 8005626139 Rhizobium phaseoli Y18 Isolate Nodule
656 8005645114 Rhizobium tropici IGFRI Rhizo-19 Isolate Rhizosphere
657 8005658619 Rhizobium terrae CC-HIH110 Isolate Unclassified
658 8005668836 Rhizobium phaseoli CCGM9 Isolate Unclassified
659 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified
660 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule
661 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule
662 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule
663 8024486573 Rhizobium tubonense CCBAU 85046 Isolate Nodule
664 8024501048 Rhizobium sp. H4 Isolate Nodule
665 8046767195 Rhizobium calliandrae CCGE524 Isolate Unclassified
666 8049293176 Ensifer alkalisoli YIC4027 Isolate Nodule
667 8054460903 Agrobacterium vaccinii B7.6 Isolate Unclassified
668 8054558443 Rhizobium alarense TRM95111 Isolate Nodule
669 8056375014 Rhizobium redzepovicii 18T Isolate Nodule
670 8056382006 Rhizobium croatiense 13T Isolate Nodule
671 8057575449 Rhizobium mayense CCGE526 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 49.05
Metatranscriptomes 0
Isolates 50.95

Biome Distribution

Category Percentage (%)
Aerial Root 0.56
Bulb 0
Endosphere 18.84
Nodule 40.13
Rhizoplane 2.12
Rhizosphere 20.4
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0214543_1000003 3300021327 Bacteria 692327
2 JGI25156J39149_1000153 3300002705 Bacteria 50769
3 JGI25162J39368_1001013 3300002737 Bacteria 17524
4 JGI25162J39368_1001160 3300002737 Bacteria 15673
5 JGI25154J39366_1000152 3300002738 Bacteria 53779
6 JGI25157J39369_1000061 3300002741 Bacteria 105511
7 JGI25152J39213_1002047 3300002773 Bacteria 7941
8 JGI25152J39213_1002225 3300002773 Bacteria 7543
9 JGI25152J39213_1002746 3300002773 Bacteria 6408
10 JGI25150J39212_1000031 3300002774 Bacteria 100456
11 JGI25150J39212_1003104 3300002774 Bacteria 3972
12 JGI25159J45721_1000002 3300002987 Bacteria 289163
13 JGI25159J45721_1003211 3300002987 Bacteria 5855
14 JGI25159J45721_1006113 3300002987 Bacteria 3654
15 JGI25151J46595_10000062 3300003187 Bacteria 146687
16 JGI25165J46597_1001286 3300003214 Bacteria 14575
17 JGI25165J46597_1001705 3300003214 Bacteria 9846
18 JGI25153J46596_10003455 3300003215 Bacteria 8847
19 JGI25153J46596_10003797 3300003215 Bacteria 8334
20 rootL2_10003072 3300003322 Bacteria 8988
21 rootH1_10039003 3300003316 Unclassified 3494
22 rootH1_10039003 3300003323 Bacteria 2350
23 rootH1_10109493 3300003323 Bacteria 2025
24 JGI25160J50197_1000008 3300003354 Bacteria 289163
25 JGI25160J50197_1000052 3300003354 Bacteria 127795
26 JGI25160J50197_1003609 3300003354 Bacteria 6872
27 JGI25160J50197_1007244 3300003354 Bacteria 4362
28 JGI25161J50226_1000005 3300003374 Bacteria 292548
29 JGI25161J50226_1000113 3300003374 Bacteria 63092
30 JGI25161J50226_1000133 3300003374 Bacteria 52508
31 JGI25161J50226_1000527 3300003374 Bacteria 16442
32 Ga0055526_1002912 3300003771 Bacteria 11251
33 Ga0055526_1010220 3300003771 Bacteria 4392
34 Ga0055526_1021727 3300003771 Bacteria 2217
35 Ga0055526_1021737 3300003771 Bacteria 2217
36 Ga0055524_1003487 3300003775 Bacteria 7620
37 Ga0055524_1008616 3300003775 Bacteria 4222
38 Ga0055524_1013056 3300003775 Bacteria 3155
39 Ga0055536_1001375 3300003781 Bacteria 14778
40 Ga0055528_1000149 3300003790 Bacteria 57620
41 Ga0055528_1002648 3300003790 Bacteria 9454
42 Ga0055528_1003478 3300003790 Bacteria 7867
43 Ga0055528_1032191 3300003790 Bacteria 1345
44 Ga0055530_10007424 3300003791 Bacteria 4620
45 Ga0055540_1000406 3300003792 Bacteria 34874
46 Ga0055540_1003151 3300003792 Bacteria 8152
47 Ga0055540_1021733 3300003792 Bacteria 1658
48 Ga0055540_1022589 3300003792 Bacteria 1605
49 Ga0055531_10006368 3300003794 Bacteria 6715
50 Ga0058692_1004840 3300003856 Bacteria 3918
51 Ga0058692_1008392 3300003856 Bacteria 2666
52 Ga0055543_1000035 3300004625 Bacteria 127833
53 Ga0055543_1000040 3300004625 Bacteria 122485
54 Ga0055543_1000048 3300004625 Bacteria 109807
55 Ga0065165_1000015 3300005262 Bacteria 289201
56 Ga0065165_1000253 3300005262 Bacteria 92969
57 Ga0065165_1041411 3300005262 Bacteria 1368
58 Ga0065165_1042784 3300005262 Bacteria 1334
59 Ga0070668_100215604 3300005347 Bacteria 1581
60 Ga0070665_100045283 3300005548 Bacteria 4419
61 Ga0068855_100132280 3300005563 Bacteria 2848
62 Ga0068854_100248889 3300005578 Bacteria 1418
63 Ga0075365_10032765 3300006038 Bacteria 3344
64 Ga0075365_10170024 3300006038 Bacteria 1521
65 Ga0075368_10015434 3300006042 Bacteria 2834
66 Ga0075363_100012152 3300006048 Bacteria 4142
67 Ga0075363_100028918 3300006048 Bacteria 2856
68 Ga0075363_100175105 3300006048 Bacteria 1219
69 Ga0075364_10018980 3300006051 Bacteria 4313
70 Ga0075364_10071929 3300006051 Bacteria 2279
71 Ga0075362_10167814 3300006177 Bacteria 1059
72 Ga0075367_10064973 3300006178 Bacteria 2184
73 Ga0075369_10017027 3300006186 Bacteria 2941
74 Ga0075369_10168820 3300006186 Bacteria 1004
75 Ga0075370_10092110 3300006353 Bacteria 1749
76 Ga0079104_1002273 3300006946 Bacteria 10662
77 Ga0079104_1005092 3300006946 Bacteria 5353
78 Ga0099826_10024949 3300006948 Bacteria 4437
79 Ga0105244_10137878 3300009036 Bacteria 1175
80 Ga0105250_10011058 3300009092 Bacteria 3752
81 Ga0105240_10000032 3300009093 Bacteria 283907
82 Ga0105247_10070341 3300009101 Bacteria 2186
83 Ga0105243_10730612 3300009148 Bacteria 968
84 Ga0105248_10264104 3300009177 Bacteria 1938
85 Ga0105237_10064526 3300009545 Bacteria 3658
86 Ga0105249_10219610 3300009553 Bacteria 1870
87 Ga0123340_1068017 3300009763 Bacteria 892
88 Ga0123341_1000048 3300009765 Bacteria 50946
89 Ga0123341_1105859 3300009765 Bacteria 901
90 Ga0123341_1109245 3300009765 Bacteria 866
91 Ga0123342_1007095 3300009766 Bacteria 15043
92 Ga0123342_1029411 3300009766 Bacteria 2856
93 Ga0105239_10004104 3300010375 Bacteria 17509
94 Ga0105239_10878567 3300010375 Bacteria 1029
95 Ga0157373_10002050 3300013100 Bacteria 15264
96 Ga0157371_10000380 3300013102 Bacteria 55836
97 Ga0157371_10009535 3300013102 Bacteria 7635
98 Ga0157370_10000748 3300013104 Bacteria 40596
99 Ga0157370_10000986 3300013104 Bacteria 35999
100 Ga0157369_10040067 3300013105 Bacteria 5117
101 Ga0157369_10159803 3300013105 Bacteria 2379
102 Ga0157369_10783606 3300013105 Bacteria 980
103 Ga0171463_1001 3300013249 Bacteria 1406070
104 Ga0182008_10037378 3300014497 Bacteria 2429
105 Ga0182007_10009078 3300015262 Bacteria 4042
106 Ga0183363_1336 3300015690 Bacteria 5813
107 Ga0214544_1008762 3300021320 Bacteria 16495
108 Ga0214542_1000006 3300021321 Bacteria 345164
109 Ga0214542_1016338 3300021321 Bacteria 7243
110 Ga0214543_1000014 3300021327 Bacteria 324986
111 Ga0228711_1000001 3300022739 Bacteria 357377
112 Ga0228710_1000001 3300022740 Bacteria 314328
113 Ga0209435_100042 3300025206 Bacteria 105563
114 Ga0209436_100064 3300025208 Bacteria 56015
115 Ga0209436_101965 3300025208 Bacteria 6580
116 Ga0209436_114010 3300025208 Bacteria 1292
117 Ga0209437_100075 3300025233 Bacteria 297202
118 Ga0209437_104465 3300025233 Bacteria 2464
119 Ga0207425_1000031 3300025245 Bacteria 261181
120 Ga0207425_1010912 3300025245 Bacteria 2192
121 Ga0209646_1000145 3300025246 Bacteria 105563
122 Ga0209646_1015396 3300025246 Bacteria 1142
123 Ga0209026_1000160 3300025250 Bacteria 105563
124 Ga0209759_1000177 3300025256 Bacteria 105563
125 Ga0209129_1000053 3300025258 Bacteria 262823
126 Ga0209129_1000362 3300025258 Bacteria 37617
127 Ga0209129_1000592 3300025258 Bacteria 24759
128 Ga0209129_1003898 3300025258 Bacteria 6203
129 Ga0209129_1005412 3300025258 Bacteria 4532
130 Ga0209129_1008053 3300025258 Bacteria 2999
131 Ga0209233_1000056 3300025261 Bacteria 438104
132 Ga0209233_1000064 3300025261 Bacteria 392156
133 Ga0209233_1000209 3300025261 Bacteria 115124
134 Ga0209455_1021847 3300025272 Bacteria 1232
135 Ga0209673_1000041 3300025273 Bacteria 307397
136 Ga0209673_1001371 3300025273 Bacteria 23980
137 Ga0209673_1002349 3300025273 Bacteria 13347
138 Ga0209673_1004542 3300025273 Bacteria 7382
139 Ga0209673_1004827 3300025273 Bacteria 7064
140 Ga0209673_1040928 3300025273 Bacteria 1321
141 Ga0209130_1000006 3300025284 Bacteria 596528
142 Ga0209130_1000007 3300025284 Bacteria 591584
143 Ga0209130_1000018 3300025284 Bacteria 388301
144 Ga0209676_1002385 3300025292 Bacteria 13465
145 Ga0209676_1010840 3300025292 Bacteria 3744
146 Ga0209676_1021427 3300025292 Bacteria 2171
147 Ga0209025_1000074 3300025294 Bacteria 277445
148 Ga0209025_1000080 3300025294 Bacteria 267244
149 Ga0209025_1000087 3300025294 Bacteria 261181
150 Ga0209025_1000100 3300025294 Bacteria 229182
151 Ga0209025_1001310 3300025294 Bacteria 33978
152 Ga0209025_1001555 3300025294 Bacteria 29161
153 Ga0209025_1004857 3300025294 Bacteria 11340
154 Ga0209025_1022221 3300025294 Bacteria 3375
155 Ga0209025_1039784 3300025294 Bacteria 2046
156 Ga0209025_1082794 3300025294 Bacteria 1082
157 Ga0209564_1000439 3300025295 Bacteria 71637
158 Ga0209564_1006429 3300025295 Bacteria 6339
159 Ga0209564_1034872 3300025295 Bacteria 1467
160 Ga0209564_1039856 3300025295 Bacteria 1284
161 Ga0209758_1000081 3300025297 Bacteria 261181
162 Ga0209758_1000737 3300025297 Bacteria 47765
163 Ga0209758_1001677 3300025297 Bacteria 24975
164 Ga0209758_1001702 3300025297 Bacteria 24700
165 Ga0209758_1002164 3300025297 Bacteria 20648
166 Ga0209758_1009144 3300025297 Bacteria 6236
167 Ga0209758_1081554 3300025297 Bacteria 977
168 Ga0209050_1001222 3300025298 Bacteria 29857
169 Ga0209256_1002838 3300025299 Bacteria 13211
170 Ga0209256_1002860 3300025299 Bacteria 13140
171 Ga0209256_1003649 3300025299 Bacteria 10538
172 Ga0209256_1007502 3300025299 Bacteria 5357
173 Ga0209256_1010546 3300025299 Bacteria 3848
174 Ga0207426_1000044 3300025302 Bacteria 428043
175 Ga0207426_1000064 3300025302 Bacteria 358276
176 Ga0207426_1000106 3300025302 Bacteria 244368
177 Ga0207426_1000652 3300025302 Bacteria 42638
178 Ga0209051_1000514 3300025303 Bacteria 48877
179 Ga0209051_1001543 3300025303 Bacteria 19097
180 Ga0209051_1002756 3300025303 Bacteria 12142
181 Ga0209051_1012403 3300025303 Bacteria 4125
182 Ga0209051_1043897 3300025303 Bacteria 1563
183 Ga0209257_1001514 3300025304 Bacteria 27239
184 Ga0207695_10000024 3300025913 Bacteria 632311
185 Ga0207671_10000548 3300025914 Bacteria 50646
186 Ga0207650_10002848 3300025925 Bacteria 11943
187 Ga0207668_10763071 3300025972 Bacteria 854
188 Ga0207702_10124998 3300026078 Bacteria 2307
189 Ga0207702_10438948 3300026078 Bacteria 1265
190 Ga0209281_1000266 3300027111 Bacteria 100574
191 Ga0209281_1000332 3300027111 Bacteria 81534
192 Ga0209371_1000021 3300027312 Bacteria 555864
193 Ga0209371_1000714 3300027312 Bacteria 28089
194 Ga0209371_1000939 3300027312 Bacteria 22794
195 Ga0209371_1001387 3300027312 Bacteria 16641
196 Ga0209371_1002086 3300027312 Bacteria 11883
197 Ga0209282_1000007 3300027666 Bacteria 254917
198 Ga0209282_1001768 3300027666 Bacteria 12106
199 Ga0209282_1010070 3300027666 Bacteria 5975
200 Ga0268266_10002687 3300028379 Bacteria 18670
201 Ga0307515_10000070 3300028794 Bacteria 239322
202 Ga0307515_10005751 3300028794 Bacteria 25053
203 Ga0307515_10009829 3300028794 Bacteria 18427
204 Ga0268256_1000020 3300030500 Bacteria 557873
205 Ga0268256_1002318 3300030500 Bacteria 9849
206 Ga0268256_1002341 3300030500 Bacteria 9769
207 Ga0316181_1214954 3300030744 Bacteria 2409
208 Ga0307513_10078688 3300031456 Bacteria 3409
209 Ga0307513_10408317 3300031456 Bacteria 1091
210 Ga0307513_10511683 3300031456 Bacteria 917
211 Ga0307408_100039259 3300031548 Bacteria 3345
212 Ga0307405_10095640 3300031731 Bacteria 1979
213 Ga0307405_10200800 3300031731 Bacteria 1448
214 Ga0307406_10069253 3300031901 Bacteria 2306
215 Ga0307412_10399895 3300031911 Bacteria 1118
216 Ga0315914_1000006 3300031967 Bacteria 239817
217 Ga0307414_10307266 3300032004 Bacteria 1344
218 Ga0315913_1000002 3300033430 Bacteria 241452
219 Ga0315915_1000001 3300033464 Bacteria 481518
220 Ga0439436_0009726 3300041404 Bacteria 2943
221 Ga0439438_018012 3300041405 Bacteria 2020
222 Ga0439439_0049938 3300041406 Bacteria 1095
223 Ga0439439_0067162 3300041406 Bacteria 957
224 Ga0439465_0005455 3300041413 Bacteria 4060
225 Ga0439465_0013230 3300041413 Bacteria 2576
226 Ga0439465_0021873 3300041413 Bacteria 2007
227 Ga0439449_0004950 3300042007 Bacteria 5127
228 Ga0439449_0027972 3300042007 Bacteria 2103
229 Ga0439449_0090931 3300042007 Bacteria 1127
230 Ga0439452_041598 3300042010 Bacteria 1080
231 Ga0439462_0008441 3300042015 Bacteria 2597
232 Ga0450920_028546 3300042122 Bacteria 1094
233 Ga0450918_004033 3300042531 Bacteria 2696
234 Ga0466967_0451317 3300045976 Bacteria 1257
235 Ga0495627_041695 3300046453 Bacteria 1409
236 Ga0495592_0054665 3300046454 Bacteria 2957
237 Ga0495629_0020032 3300046459 Bacteria 4775
238 Ga0495638_0000353 3300046460 Bacteria 57451
239 Ga0495638_0023768 3300046460 Bacteria 4004
240 Ga0495638_0023957 3300046460 Bacteria 3985
241 Ga0495638_0103718 3300046460 Bacteria 1697
242 Ga0495650_0030215 3300046471 Bacteria 2457
243 Ga0495650_0117436 3300046471 Bacteria 982
244 Ga0495605_0003895 3300046474 Bacteria 8843
245 Ga0495605_0139735 3300046474 Bacteria 1087
246 Ga0495662_0001957 3300046476 Bacteria 10343
247 Ga0495664_0131601 3300046477 Bacteria 1515
248 Ga0495585_0004076 3300046492 Bacteria 9596
249 Ga0495607_0019235 3300046501 Bacteria 4340
250 Ga0495583_0002283 3300046506 Bacteria 16772
251 Ga0495583_0112426 3300046506 Bacteria 1153
252 Ga0495606_0015262 3300046507 Bacteria 5930
253 Ga0495606_0045156 3300046507 Bacteria 2923
254 Ga0495606_0072624 3300046507 Bacteria 2161
255 Ga0495606_0096192 3300046507 Bacteria 1812
256 Ga0495606_0175183 3300046507 Bacteria 1241
257 Ga0495610_0002493 3300046512 Bacteria 15389
258 Ga0495610_0002941 3300046512 Bacteria 13760
259 Ga0495610_0045308 3300046512 Bacteria 2177
260 Ga0495620_0007860 3300046515 Bacteria 5754
261 Ga0495620_0011636 3300046515 Bacteria 4581
262 Ga0495620_0142101 3300046515 Bacteria 938
263 Ga0495631_0054359 3300046518 Bacteria 1746
264 Ga0495632_0010045 3300046519 Bacteria 5640
265 Ga0495643_0017310 3300046522 Bacteria 4215
266 Ga0495643_0028312 3300046522 Bacteria 3142
267 Ga0495643_0041252 3300046522 Bacteria 2517
268 Ga0495643_0076128 3300046522 Bacteria 1755
269 Ga0495648_0166355 3300046524 Bacteria 1135
270 Ga0495587_0078106 3300046536 Bacteria 1921
271 Ga0495609_0034081 3300046538 Bacteria 2309
272 Ga0495609_0065063 3300046538 Bacteria 1608
273 Ga0495622_0024264 3300046557 Bacteria 2832
274 Ga0495656_0005975 3300046615 Bacteria 4235
275 Ga0495668_0011053 3300046616 Bacteria 5426
276 Ga0495611_0046435 3300046648 Bacteria 1947
277 Ga0495625_0002953 3300046660 Bacteria 17720
278 Ga0495625_0098360 3300046660 Bacteria 2013
279 Ga0495625_0111291 3300046660 Bacteria 1871
280 Ga0495625_0170050 3300046660 Bacteria 1456
281 Ga0495625_0410637 3300046660 Bacteria 844
282 Ga0495661_0230077 3300046665 Bacteria 956
283 Ga0495588_0002348 3300046674 Bacteria 8102
284 Ga0495657_0084561 3300046675 Bacteria 2046
285 Ga0495646_0060439 3300046680 Bacteria 2260
286 Ga0495658_0016347 3300046683 Bacteria 3820
287 Ga0495671_0005749 3300046692 Bacteria 7230
288 Ga0495649_0016416 3300046694 Bacteria 4196
289 Ga0495600_0208314 3300046809 Bacteria 1253
290 Ga0495660_0011331 3300046810 Bacteria 5176
291 Ga0495660_0064545 3300046810 Bacteria 1957
292 Ga0495604_0022047 3300047317 Bacteria 5084
293 Ga0495636_0008083 3300047318 Bacteria 4145
294 Ga0495636_0036703 3300047318 Bacteria 2022
295 Ga0495674_0606196 3300047319 Bacteria 867
296 Ga0495672_0019712 3300047320 Bacteria 4443
297 Ga0495687_012527 3300047443 Bacteria 4477
298 Ga0495681_0003515 3300047470 Bacteria 10888
299 Ga0495681_0027899 3300047470 Bacteria 2915
300 Ga0495686_0001094 3300047472 Bacteria 32227
301 Ga0495686_0019106 3300047472 Bacteria 4583
302 Ga0495686_0020261 3300047472 Bacteria 4435
303 Ga0495686_0082205 3300047472 Bacteria 1966
304 Ga0495686_0242667 3300047472 Bacteria 1015
305 Ga0496100_0030953 3300048903 Bacteria 3323
306 Ga0496101_0040266 3300048904 Bacteria 3328
307 Ga0496102_0009938 3300048905 Bacteria 8184
308 Ga0496103_0016955 3300048906 Bacteria 4351
309 Ga0496104_0081484 3300048907 Bacteria 3086
310 Ga0496105_0024101 3300048908 Bacteria 4942
311 Ga0496106_0000154 3300048909 Bacteria 50775
312 Ga0496110_0020523 3300048913 Bacteria 5579
313 Ga0496110_0569989 3300048913 Bacteria 1028
314 Ga0496113_0030606 3300048916 Bacteria 3898
315 Ga0496113_0184075 3300048916 Bacteria 1656
316 Ga0496116_0000036 3300048919 Bacteria 388508
317 Ga0496116_0008404 3300048919 Bacteria 8961
318 Ga0496116_0028293 3300048919 Bacteria 4063
319 Ga0496116_0035383 3300048919 Bacteria 3508
320 Ga0496116_0042428 3300048919 Bacteria 3109
321 Ga0496116_0052565 3300048919 Bacteria 2698
322 Ga0496116_0145435 3300048919 Bacteria 1326
323 Ga0496116_0146612 3300048919 Bacteria 1318
324 Ga0496117_0000002 3300048920 Bacteria 2483758
325 Ga0496117_0003863 3300048920 Bacteria 17044
326 Ga0496117_0023642 3300048920 Bacteria 4889
327 Ga0496117_0038413 3300048920 Bacteria 3550
328 Ga0496117_0139004 3300048920 Bacteria 1458
329 Ga0496118_0000214 3300048921 Bacteria 100898
330 Ga0496118_0000695 3300048921 Bacteria 54668
331 Ga0496118_0016185 3300048921 Bacteria 6855
332 Ga0496118_0055406 3300048921 Bacteria 2992
333 Ga0496118_0172834 3300048921 Bacteria 1317
334 Ga0496119_0019601 3300048922 Bacteria 4970
335 Ga0496119_0024841 3300048922 Bacteria 4201
336 Ga0496119_0037148 3300048922 Bacteria 3168
337 Ga0496119_0050740 3300048922 Bacteria 2554
338 Ga0496120_0000125 3300048923 Bacteria 128983
339 Ga0496120_0011557 3300048923 Bacteria 6063
340 Ga0496120_0019199 3300048923 Bacteria 4381
341 Ga0496121_0000001 3300048924 Bacteria 1830318
342 Ga0496121_0001632 3300048924 Bacteria 37117
343 Ga0496121_0008842 3300048924 Bacteria 11731
344 Ga0496121_0056492 3300048924 Bacteria 3260
345 Ga0496121_0064083 3300048924 Bacteria 2998
346 Ga0496121_0100649 3300048924 Bacteria 2230
347 Ga0496121_0123759 3300048924 Bacteria 1948
348 Ga0496121_0253687 3300048924 Bacteria 1218
349 Ga0496121_0291130 3300048924 Bacteria 1112
350 Ga0496122_0000001 3300048925 Bacteria 1827766
351 Ga0496122_0003139 3300048925 Bacteria 22132
352 Ga0496122_0011597 3300048925 Bacteria 8896
353 Ga0496122_0015314 3300048925 Bacteria 7337
354 Ga0496122_0029200 3300048925 Bacteria 4657
355 Ga0496122_0039743 3300048925 Bacteria 3747
356 Ga0496122_0046659 3300048925 Bacteria 3352
357 Ga0496122_0085214 3300048925 Bacteria 2181
358 Ga0496122_0158141 3300048925 Bacteria 1386
359 Ga0496123_0000001 3300048926 Bacteria 1831497
360 Ga0496123_0014608 3300048926 Bacteria 6493
361 Ga0496123_0031063 3300048926 Bacteria 3895
362 Ga0496123_0043197 3300048926 Bacteria 3099
363 Ga0496123_0044820 3300048926 Bacteria 3020
364 Ga0496123_0045608 3300048926 Bacteria 2984
365 Ga0496123_0065335 3300048926 Bacteria 2313
366 Ga0496123_0081819 3300048926 Bacteria 1960
367 Ga0496124_0000349 3300048927 Bacteria 84498
368 Ga0496124_0003191 3300048927 Bacteria 20248
369 Ga0496124_0007143 3300048927 Bacteria 11954
370 Ga0496124_0019584 3300048927 Bacteria 6289
371 Ga0496124_0028228 3300048927 Bacteria 5022
372 Ga0496124_0028358 3300048927 Bacteria 5009
373 Ga0496124_0051756 3300048927 Bacteria 3492
374 Ga0496124_0067367 3300048927 Bacteria 2979
375 Ga0496124_0081804 3300048927 Bacteria 2652
376 Ga0496124_0137086 3300048927 Bacteria 1936
377 Ga0496124_0227902 3300048927 Bacteria 1395
378 Ga0496125_0000001 3300048928 Bacteria 1766138
379 Ga0496125_0030512 3300048928 Bacteria 4821
380 Ga0496125_0037930 3300048928 Bacteria 4182
381 Ga0496125_0040651 3300048928 Bacteria 3985
382 Ga0496125_0057948 3300048928 Bacteria 3132
383 Ga0496125_0075324 3300048928 Bacteria 2612
384 Ga0496125_0173303 3300048928 Bacteria 1447
385 Ga0496126_0000156 3300048929 Bacteria 158537
386 Ga0496126_0015545 3300048929 Bacteria 7648
387 Ga0496126_0022022 3300048929 Bacteria 6209
388 Ga0496126_0042324 3300048929 Bacteria 4207
389 Ga0496126_0044809 3300048929 Bacteria 4070
390 Ga0496126_0136926 3300048929 Bacteria 2111
391 Ga0495678_018576 3300049459 Bacteria 3122
392 Ga0501032_0142497 3300049569 Bacteria 1578
393 Ga0501036_0190742 3300049572 Bacteria 1724
394 Ga0501037_0357475 3300049573 Bacteria 1006
395 Ga0501038_0035728 3300049574 Bacteria 4362
396 Ga0501039_0030216 3300049575 Bacteria 4177
397 Ga0501043_0048985 3300049579 Bacteria 3321
398 Ga0501080_0197346 3300049742 Bacteria 1848
399 Ga0501044_0085835 3300049823 Bacteria 3180
400 nmdc:mga03683_13499_c1 3300050489 Bacteria 3008
401 nmdc:mga03n38_277182_c1 3300050490 Bacteria 894
402 nmdc:mga00v17_187_c1 3300050491 Bacteria 37112
403 nmdc:mga00v17_38216_c1 3300050491 Bacteria 2869
404 nmdc:mga00v17_97953_c1 3300050491 Bacteria 1849
405 nmdc:mga0yw44_66884_c1 3300050492 Bacteria 2219
406 nmdc:mga06z11_141938_c1 3300050494 Bacteria 1359
407 nmdc:mga07m45_163483_c1 3300050496 Bacteria 1293
408 nmdc:mga07m45_199365_c1 3300050496 Bacteria 1164
409 nmdc:mga07m45_214477_c1 3300050496 Bacteria 1120
410 nmdc:mga0sz30_56083_c1 3300050516 Bacteria 1677
411 nmdc:mga0sz30_839_c1 3300050516 Bacteria 11098
412 Ga0500578_0207158 3300053086 Bacteria 1197
413 Ga0500578_0291571 3300053086 Bacteria 970
414 Ga0500644_0017456 3300053088 Bacteria 2084
415 Ga0500651_0206886 3300053093 Bacteria 1156
416 Ga0500557_000546 3300053105 Bacteria 5068
417 Ga0500560_003419 3300053107 Bacteria 3207
418 Ga0500560_015522 3300053107 Bacteria 2056
419 Ga0500569_000769 3300053109 Bacteria 5615
420 Ga0500569_012526 3300053109 Bacteria 2054
421 Ga0500572_002424 3300053111 Bacteria 4490
422 Ga0500594_0004786 3300053118 Bacteria 2991
423 Ga0500608_030543 3300053122 Bacteria 2554
424 Ga0500618_008277 3300053125 Bacteria 2912
425 Ga0500618_025679 3300053125 Bacteria 1411
426 Ga0500658_0003389 3300053134 Bacteria 6029
427 Ga0500559_0068113 3300053136 Bacteria 1598
428 Ga0500561_0000280 3300053137 Bacteria 8887
429 Ga0500568_0000565 3300053139 Bacteria 27186
430 Ga0500568_0000811 3300053139 Bacteria 21961
431 Ga0500588_0012449 3300053146 Bacteria 2110
432 Ga0500590_002679 3300053148 Bacteria 7994
433 Ga0500616_0005562 3300053153 Bacteria 8526
434 Ga0500622_0000322 3300053156 Bacteria 48225
435 Ga0500622_0004590 3300053156 Bacteria 8600
436 Ga0500624_000569 3300053157 Bacteria 10203
437 Ga0500633_0000343 3300053160 Bacteria 7038
438 Ga0500634_0001745 3300053161 Bacteria 8717
439 Ga0500634_0015611 3300053161 Bacteria 4037
440 Ga0500636_0000004 3300053177 Bacteria 202392
441 Ga0500636_0008484 3300053177 Bacteria 5959
442 2509108498 2508501122 Bacteria 6292184
443 2509374475 2509276019 Bacteria 6802256
444 2509387744 2509276021 Bacteria 7634384
445 2509443105 2509276033 Bacteria 7180565
446 2510132273 2510065019 Bacteria 6903379
447 2510306632 2510065057 Bacteria 6649661
448 2511133519 2510917022 Bacteria 6504556
449 2511183369 2510917028 Bacteria 6185411
450 2511197228 2510917030 Bacteria 7460662
451 2511500996 2511231052 Bacteria 6974333
452 2512532409 2512047086 Bacteria 6850303
453 2512972266 2512875026 Bacteria 6861065
454 2513580747 2513237085 Bacteria 7695351
455 2513583464 2513237086 Bacteria 7265287
456 2513596220 2513237088 Bacteria 6927906
457 2513603345 2513237089 Bacteria 6553624
458 2513618927 2513237091 Bacteria 6900273
459 2513632781 2513237093 Bacteria 7545552
460 2513709232 2513237103 Bacteria 7647401
461 2513868738 2513237138 Bacteria 7368160
462 2513881115 2513237140 Bacteria 7076289
463 2513902351 2513237143 Bacteria 6664116
464 2513983950 2513237156 Bacteria 6402557
465 2513999545 2513237159 Bacteria 6810126
466 2514004800 2513237160 Bacteria 6650282
467 2515608108 2515154107 Bacteria 6795637
468 2515740435 2515154134 Bacteria 7220242
469 2516208862 2516143018 Bacteria 6951533
470 2516892278 2516653046 Bacteria 6989037
471 2517075440 2516653085 Bacteria 7346596
472 2517405843 2517287029 Bacteria 6905599
473 2517569069 2517487022 Bacteria 7227575
474 2524451154 2524023207 Bacteria 6813453
475 2524460679 2524023209 Bacteria 6679728
476 2535515689 2534681796 Bacteria 7146037
477 2537874050 2537561587 Bacteria 5425293
478 2551676457 2551306084 Bacteria 8942552
479 2551687186 2551306085 Bacteria 7347181
480 2551693802 2551306086 Bacteria 6843938
481 2551704617 2551306087 Bacteria 7351905
482 2551715563 2551306089 Bacteria 7162724
483 2551720647 2551306090 Bacteria 7953713
484 2551725407 2551306091 Bacteria 7086830
485 2551734345 2551306092 Bacteria 6992595
486 2551740426 2551306093 Bacteria 7064773
487 2554247082 2554235003 Bacteria 5877155
488 2558863502 2558860100 Bacteria 8458965
489 2559294306 2558860242 Bacteria 5568029
490 2561466031 2558860983 Bacteria 4133860
491 2585165522 2582581283 Bacteria 6030556
492 2585203049 2582581294 Bacteria 6626667
493 2585220967 2582581298 Bacteria 7315509
494 2585231524 2582581299 Bacteria 6518058
495 2585273289 2582581307 Bacteria 6597605
496 2585278876 2582581308 Bacteria 7413247
497 2585325510 2582581315 Bacteria 7318924
498 2585329664 2582581316 Bacteria 7774528
499 2585392691 2582581866 Bacteria 6859583
500 2585400155 2582581867 Bacteria 7184437
501 2585527937 2585427526 Bacteria 7258840
502 2585530674 2585427527 Bacteria 7273426
503 2585549933 2585427529 Bacteria 7395659
504 2585554854 2585427530 Bacteria 7383882
505 2585559411 2585427531 Bacteria 6992870
506 2585822714 2585427590 Bacteria 6824633
507 2585847247 2585427594 Bacteria 6180594
508 2585902081 2585427608 Bacteria 6544331
509 2585905213 2585427609 Bacteria 6667127
510 2587979672 2585428125 Bacteria 6662905
511 2599333798 2599185156 Bacteria 5403036
512 2599602629 2599185210 Bacteria 5624189
513 2599723104 2599185236 Bacteria 6875203
514 2600191911 2599185352 Bacteria 7228948
515 2601608706 2600255279 Bacteria 5605316
516 2601745480 2600255308 Bacteria 5611129
517 2616305850 2615840626 Bacteria 7921970
518 2616553908 2615840698 Bacteria 7319877
519 2617383834 2617270742 Bacteria 6808054
520 2643807224 2643221557 Bacteria 7184309
521 2643855896 2643221568 Bacteria 5187270
522 2643918681 2643221582 Bacteria 5804683
523 2644069510 2643221610 Bacteria 7480339
524 2644109014 2643221618 Bacteria 7717186
525 2644151536 2643221626 Bacteria 8069654
526 2644196485 2643221634 Bacteria 6705461
527 2644206228 2643221637 Bacteria 5345260
528 2644296865 2643221653 Bacteria 4569637
529 2644311670 2643221655 Bacteria 7722067
530 2644329928 2643221659 Bacteria 7890716
531 2644380606 2643221668 Bacteria 7306521
532 2644420664 2643221675 Bacteria 7473456
533 2644454189 2643221680 Bacteria 7473610
534 2644493421 2643221688 Bacteria 5260751
535 2644518776 2643221693 Bacteria 5513853
536 2644546602 2643221698 Bacteria 7756764
537 2644617469 2643221712 Bacteria 7729434
538 2644649875 2643221718 Bacteria 5345506
539 2644655119 2643221719 Bacteria 4568197
540 2644675673 2643221723 Bacteria 7095460
541 2644689526 2643221726 Bacteria 7455827
542 2657683280 2657244999 Bacteria 5946535
543 2671115343 2667528174 Bacteria 6435400
544 2719664586 2718217997 Bacteria 6740740
545 2720491006 2718218199 Bacteria 6740745
546 2720612368 2718218232 Bacteria 6720332
547 2720619206 2718218233 Bacteria 6662049
548 2720630608 2718218235 Bacteria 6630699
549 2720774301 2718218269 Bacteria 6906114
550 2723026028 2721755556 Bacteria 6745503
551 2723559572 2721755684 Bacteria 6859907
552 2723566189 2721755685 Bacteria 6704835
553 2724088908 2721755819 Bacteria 6906405
554 2724103454 2721755822 Bacteria 6726041
555 2724109299 2721755823 Bacteria 6752556
556 2725948457 2724679232 Bacteria 7646494
557 2730106964 2728369352 Bacteria 6745171
558 2738802133 2738541293 Bacteria 7065685
559 2753460790 2751185821 Bacteria 6189929
560 2766067630 2765235942 Bacteria 7445910
561 2776912738 2775507049 Bacteria 6284736
562 2778177434 2775507266 Bacteria 7392367
563 2792584147 2791355082 Bacteria 5973319
564 2792622702 2791355091 Bacteria 6135441
565 2792628377 2791355092 Bacteria 6248105
566 2793296174 2791355256 Bacteria 6798008
567 2793317497 2791355259 Bacteria 7254731
568 2793333588 2791355262 Bacteria 6774204
569 2793353543 2791355265 Bacteria 6539969
570 2793367820 2791355267 Bacteria 7222458
571 2802717712 2802428858 Bacteria 6636079
572 2802723360 2802428859 Bacteria 6667919
573 2802733222 2802428860 Bacteria 6525526
574 2802736196 2802428861 Bacteria 6534206
575 2802743594 2802428862 Bacteria 6633353
576 2802750694 2802428863 Bacteria 6410669
577 2804751331 2802429268 Bacteria 6094027
578 2805926603 2802429605 Bacteria 6875453
579 2805933410 2802429606 Bacteria 6346811
580 2808985919 2808606387 Bacteria 5697198
581 2819242580 2818991272 Bacteria 4622173
582 2819556039 2818991439 Bacteria 6907412
583 2819612239 2818991448 Bacteria 6772224
584 2819639279 2818991453 Bacteria 7181617
585 2838031389 2838029111 Bacteria 6603031
586 2838049261 2838048938 Bacteria 6044578
587 2838063294 2838061910 Bacteria 6794874
588 2838074120 2838068647 Bacteria 6208656
589 2838076422 2838074704 Bacteria 6785777
590 2838670821 2838668709 Bacteria 6671819
591 2838676765 2838675328 Bacteria 4909118
592 2838688644 2838686498 Bacteria 7807632
593 2838703192 2838701080 Bacteria 6669771
594 2838715649 2838714209 Bacteria 5525906
595 2838720551 2838719591 Bacteria 5523910
596 2838726405 2838724970 Bacteria 4908691
597 2838730939 2838729681 Bacteria 7400765
598 2838744167 2838742623 Bacteria 7396178
599 2841847485 2841846520 Bacteria 5345850
600 2841856848 2841851746 Bacteria 7532261
601 2841859979 2841859092 Bacteria 5436171
602 2842117817 2842110456 Bacteria 7656360
603 2842126485 2842124991 Bacteria 5346824
604 2842131658 2842130223 Bacteria 4909145
605 2842147584 2842146304 Bacteria 5957337
606 2842153173 2842152218 Bacteria 4908957
607 2842160018 2842156927 Bacteria 6894975
608 2842168260 2842163707 Bacteria 6916235
609 2842171892 2842170452 Bacteria 5525737
610 2842176792 2842175837 Bacteria 4908771
611 2842183365 2842180545 Bacteria 6888678
612 2842188757 2842187318 Bacteria 5524014
613 2842197924 2842192696 Bacteria 6147454
614 2842207728 2842205361 Bacteria 6340321
615 2842213068 2842211629 Bacteria 5523832
616 2842221176 2842217011 Bacteria 7497767
617 2842225313 2842224351 Bacteria 5524473
618 2842235034 2842229732 Bacteria 7475766
619 2842245631 2842243621 Bacteria 7421798
620 2842252650 2842250916 Bacteria 6579627
621 2842259719 2842257432 Bacteria 7401195
622 2842266960 2842264693 Bacteria 6472963
623 2842274558 2842271015 Bacteria 7807131
624 2842281477 2842278818 Bacteria 6340002
625 2842287144 2842285085 Bacteria 6011953
626 2842302483 2842298080 Bacteria 6123127
627 2842306802 2842304105 Bacteria 7023636
628 2842314715 2842311132 Bacteria 6616990
629 2842318678 2842317721 Bacteria 6793725
630 2842343629 2842341865 Bacteria 7003929
631 2842360784 2842357229 Bacteria 6485165
632 2842365215 2842363717 Bacteria 6844742
633 2842404412 2842402390 Bacteria 6681310
634 2842410903 2842409023 Bacteria 6687331
635 2842417641 2842415677 Bacteria 6596907
636 2842427326 2842422224 Bacteria 6239196
637 2842431091 2842428310 Bacteria 6767288
638 2842436911 2842434925 Bacteria 6502746
639 2842442989 2842441272 Bacteria 6769273
640 2842453210 2842447887 Bacteria 6754142
641 2842465000 2842462802 Bacteria 6588055
642 2842471774 2842469257 Bacteria 6752936
643 2842478016 2842475841 Bacteria 6603183
644 2842482825 2842482326 Bacteria 7212537
645 2842493731 2842489311 Bacteria 6620893
646 2842497313 2842495871 Bacteria 6820686
647 2842504825 2842502639 Bacteria 6604161
648 2842509696 2842509118 Bacteria 6850950
649 2842516764 2842515876 Bacteria 5436280
650 2842525338 2842521101 Bacteria 6569494
651 2842924764 2842922631 Bacteria 5824079
652 2844168539 2844163670 Bacteria 7266046
653 2844455161 2844454524 Bacteria 7952546
654 2848993064 2848992105 Bacteria 6810864
655 2850080459 2850079185 Bacteria 6848280
656 2852389040 2852387548 Bacteria 8025568
657 2855831348 2855825444 Bacteria 6785811
658 2855840474 2855839649 Bacteria 7135830
659 2855879202 2855872281 Bacteria 6964271
660 2857520319 2857516855 Bacteria 7787325
661 2858801002 2858800743 Bacteria 6603254
662 2896386623 2896384573 Bacteria 7700774
663 2899796570 2899792073 Bacteria 4926588
664 2899803744 2899803654 Bacteria 5577784
665 2899847164 2899845264 Bacteria 5672268
666 2913297461 2913295892 Bacteria 6333755
667 2913311011 2913308742 Bacteria 5350706
668 2915986192 2915980308 Bacteria 6624279
669 2915990062 2915986958 Bacteria 6739310
670 2915996233 2915993759 Bacteria 7016183
671 2916001812 2916000859 Bacteria 6865702
672 2916014177 2916007675 Bacteria 6898660
673 2916016589 2916014648 Bacteria 6946486
674 2916024788 2916021584 Bacteria 6854472
675 2916032155 2916028427 Bacteria 6748433
676 2916038190 2916035215 Bacteria 6755766
677 2916047160 2916041962 Bacteria 6820487
678 2916053188 2916048683 Bacteria 6543552
679 2916055332 2916055098 Bacteria 6758838
680 2916062843 2916061851 Bacteria 6737736
681 2916076837 2916076590 Bacteria 6596108
682 2919103803 2919100787 Bacteria 7710546
683 2919115851 2919114240 Bacteria 5700270
684 2919167338 2919166419 Bacteria 4952238
685 2919409273 2919408235 Bacteria 6149349
686 2920762892 2920760137 Bacteria 7427611
687 2920823824 2920822456 Bacteria 6897201
688 2921206448 2921201388 Bacteria 6926299
689 2921214424 2921208531 Bacteria 6745326
690 2921237951 2921237296 Bacteria 6876710
691 2921247490 2921244191 Bacteria 6568419
692 2921250974 2921250672 Bacteria 6677771
693 2921259978 2921257292 Bacteria 6808382
694 2921264209 2921263974 Bacteria 6864552
695 2921283009 2921282425 Bacteria 6826397
696 2921290104 2921289301 Bacteria 7316391
697 2921300137 2921296804 Bacteria 7176999
698 2923557600 2923556063 Bacteria 6793593
699 2924145573 2924144063 Bacteria 6883928
700 2924155908 2924150972 Bacteria 7169444
701 2924160601 2924158325 Bacteria 7188855
702 2924168125 2924165586 Bacteria 7260590
703 2924177821 2924172951 Bacteria 6749356
704 2924185550 2924179722 Bacteria 6843264
705 2924189538 2924186466 Bacteria 6876637
706 2924199791 2924193448 Bacteria 6955718
707 2924204032 2924200457 Bacteria 6757188
708 2924209934 2924207177 Bacteria 6917007
709 2924221333 2924214083 Bacteria 7080103
710 2924222956 2924221636 Bacteria 7113495
711 2924234960 2924228884 Bacteria 6633132
712 2926756792 2926754445 Bacteria 5964435
713 2926761031 2926760298 Bacteria 5505990
714 2933007816 2933006813 Bacteria 4912075
715 2933012594 2933011516 Bacteria 5439334
716 2933573084 2933570622 Bacteria 7023390
717 2933591346 2933586486 Bacteria 7667493
718 2933595037 2933594066 Bacteria 5594265
719 2933604575 2933599457 Bacteria 5858799
720 2935904166 2935901341 Bacteria 7341747
721 2936368154 2936367885 Bacteria 7324495
722 2937001074 2936996657 Bacteria 6298727
723 2937009488 2937002841 Bacteria 6934057
724 2937010912 2937009748 Bacteria 6746052
725 2937018958 2937016420 Bacteria 6782579
726 2937027898 2937023124 Bacteria 6815156
727 2937029847 2937029754 Bacteria 6424026
728 2937036873 2937036028 Bacteria 6846469
729 2937043309 2937042894 Bacteria 6741576
730 2937056257 2937049772 Bacteria 6757901
731 2937069270 2937063883 Bacteria 7199456
732 2937077099 2937071275 Bacteria 6984483
733 2937082954 2937078374 Bacteria 6610289
734 2937091232 2937084907 Bacteria 6618516
735 2937095617 2937091812 Bacteria 6979387
736 2937104190 2937098957 Bacteria 7249374
737 2937112520 2937106411 Bacteria 6947143
738 2937118294 2937113482 Bacteria 6505872
739 2937121212 2937119839 Bacteria 6597547
740 2937129845 2937126314 Bacteria 6771275
741 2941500238 2941499720 Bacteria 7599444
742 2957380006 2957375807 Bacteria 6425588
743 2957385043 2957382221 Bacteria 6737050
744 2957389104 2957388812 Bacteria 6778072
745 2957396422 2957395598 Bacteria 6822399
746 2957406506 2957402308 Bacteria 6741770
747 2957409828 2957408893 Bacteria 6558585
748 2957419225 2957415311 Bacteria 6991633
749 2957423028 2957422303 Bacteria 7172205
750 2957431065 2957430029 Bacteria 7022557
751 2957442043 2957437181 Bacteria 6568994
752 2957446626 2957443900 Bacteria 6869977
753 2957454216 2957450854 Bacteria 6765715
754 2957462424 2957457609 Bacteria 6967680
755 2957467722 2957464669 Bacteria 6568877
756 2957476674 2957471148 Bacteria 6797643
757 2957480602 2957478035 Bacteria 6756658
758 2957490212 2957484790 Bacteria 6703082
759 2957496020 2957491536 Bacteria 6695180
760 2957501062 2957498199 Bacteria 7126688
761 2957509618 2957505466 Bacteria 7253085
762 2960586670 2960584000 Bacteria 6864594
763 2960595592 2960591022 Bacteria 6622873
764 2960602753 2960597568 Bacteria 6550735
765 2960610449 2960603979 Bacteria 6898737
766 2960611615 2960610863 Bacteria 6691244
767 2960617728 2960617483 Bacteria 6727748
768 2960625461 2960624210 Bacteria 6875384
769 2960633207 2960631154 Bacteria 6732508
770 2960640233 2960637947 Bacteria 7296468
771 2960646153 2960645483 Bacteria 7211087
772 2960660149 2960652885 Bacteria 7083688
773 2960666432 2960660292 Bacteria 7041660
774 2960673951 2960667422 Bacteria 6763020
775 2960684181 2960680706 Bacteria 6624464
776 2960692000 2960687367 Bacteria 6535474
777 2960699296 2960693952 Bacteria 6749742
778 2964619981 2964615318 Bacteria 6809089
779 2964622999 2964621998 Bacteria 6834995
780 2964633091 2964628898 Bacteria 7083044
781 2964641308 2964636051 Bacteria 7091832
782 2964646187 2964643177 Bacteria 6820887
783 2964653131 2964649959 Bacteria 6675118
784 2964659270 2964656573 Bacteria 7100150
785 2964665947 2964663802 Bacteria 7019362
786 2964672839 2964670856 Bacteria 6851364
787 2964679234 2964678106 Bacteria 6792020
788 2964688134 2964685014 Bacteria 6839111
789 2964695867 2964691889 Bacteria 6802758
790 2964702261 2964698721 Bacteria 6765331
791 2964708068 2964705432 Bacteria 7114648
792 2964716325 2964712639 Bacteria 6695970
793 2964726064 2964719344 Bacteria 7286602
794 2967671115 2967664464 Bacteria 6948836
795 2967672118 2967671571 Bacteria 7021409
796 2967681071 2967678726 Bacteria 7264382
797 2967687054 2967686174 Bacteria 6678622
798 2967693273 2967693043 Bacteria 6804451
799 2967701149 2967699805 Bacteria 6854538
800 2967707477 2967706974 Bacteria 7186053
801 2967716501 2967714385 Bacteria 7000047
802 2967724615 2967721400 Bacteria 7073753
803 2967734715 2967728569 Bacteria 6641507
804 2967737551 2967735183 Bacteria 6827012
805 2967742639 2967742019 Bacteria 6794534
806 2967752079 2967748971 Bacteria 6733771
807 2967760545 2967755722 Bacteria 6814706
808 2967764459 2967762386 Bacteria 6923502
809 2967770818 2967769361 Bacteria 6587838
810 2967782203 2967775926 Bacteria 6738189
811 2970026099 2970019648 Bacteria 7072033
812 2970029120 2970026789 Bacteria 6785236
813 2970038812 2970033650 Bacteria 7118744
814 2970044567 2970040964 Bacteria 6731123
815 2970052860 2970047711 Bacteria 7088379
816 2970059582 2970054988 Bacteria 6611507
817 2970068779 2970061556 Bacteria 7099761
818 2970073887 2970068827 Bacteria 7123112
819 2970076943 2970076120 Bacteria 6697332
820 2970085302 2970082768 Bacteria 6183754
821 2970094407 2970088815 Bacteria 6933825
822 2970096742 2970095765 Bacteria 6936963
823 2970106902 2970102677 Bacteria 6812532
824 2970115839 2970109326 Bacteria 6863976
825 2970117941 2970116247 Bacteria 6501857
826 2970124440 2970122695 Bacteria 6625855
827 2970129545 2970129317 Bacteria 6806560
828 2970136743 2970136068 Bacteria 7207982
829 2970144392 2970143518 Bacteria 6446480
830 2970153788 2970149975 Bacteria 6779706
831 2970163666 2970156795 Bacteria 7168044
832 2970167530 2970164137 Bacteria 6861252
833 2970171820 2970170962 Bacteria 6876229
834 2970182790 2970177841 Bacteria 6768001
835 2970188283 2970184632 Bacteria 7054431
836 2970198298 2970191845 Bacteria 7032787
837 2977517889 2977516862 Bacteria 6940108
838 2977527682 2977523885 Bacteria 6960446
839 2977531918 2977530762 Bacteria 6951399
840 2977538014 2977537788 Bacteria 6929320
841 2977546075 2977544691 Bacteria 6875412
842 2977552015 2977551784 Bacteria 7125765
843 2977561645 2977558990 Bacteria 6863948
844 2977569008 2977565890 Bacteria 6901543
845 2977578935 2977572785 Bacteria 6763888
846 2977581467 2977579622 Bacteria 6772100
847 2978973770 2978969890 Bacteria 5400756
848 2979093691 2979089926 Bacteria 5670289
849 2979098926 2979095461 Bacteria 5669583
850 2979105668 2979100975 Bacteria 5423623
851 2984512486 2984509177 Bacteria 5274802
852 2984521153 2984518228 Bacteria 5277463
853 2984540447 2984537506 Bacteria 5277481
854 2984589118 2984587000 Bacteria 5263363
855 2984602644 2984601300 Bacteria 5455244
856 2989772030 2989771324 Bacteria 5605128
857 2989778147 2989776772 Bacteria 4843317
858 2996890835 2996887358 Bacteria 5795980
859 3003932643 3003930520 Bacteria 5667563
860 3005412415 3005409236 Bacteria 7188837
861 3005417112 3005416602 Bacteria 7064308
862 3005446731 3005445848 Bacteria 6906074
863 639647408 639633055 Bacteria 7751309
864 648736392 648276728 Bacteria 6968865
865 650739503 650716007 Bacteria 5573770
866 8003570546 8003570095 Bacteria 5747666
867 8003992972 8003992118 Bacteria 7266902
868 8004000202 8003999396 Bacteria 7063185
869 8005251356 8005246636 Bacteria 4933972
870 8005261776 8005258706 Bacteria 6184835
871 8005284812 8005282627 Bacteria 6675747
872 8005292766 8005289223 Bacteria 6634003
873 8005304566 8005301065 Bacteria 6614431
874 8005309138 8005307578 Bacteria 7395396
875 8005315173 8005314921 Bacteria 7072929
876 8005325362 8005321885 Bacteria 5795980
877 8005376641 8005376324 Bacteria 6590079
878 8005432237 8005430974 Bacteria 6689030
879 8005485658 8005484373 Bacteria 6297373
880 8005499301 8005497431 Bacteria 6477605
881 8005544320 8005542996 Bacteria 7077758
882 8005627538 8005626139 Bacteria 6534237
883 8005648324 8005645114 Bacteria 6950293
884 8005660008 8005658619 Bacteria 4500593
885 8005670717 8005668836 Bacteria 6953162
886 8005684605 8005682033 Bacteria 6726518
887 8005690989 8005688590 Bacteria 6610080
888 8023686986 8023680758 Bacteria 7729763
889 8024481076 8024479707 Bacteria 6954785
890 8024489780 8024486573 Bacteria 6540512
891 8024503278 8024501048 Bacteria 6427847
892 8046767648 8046767195 Bacteria 7547379
893 8049293905 8049293176 Bacteria 6128433
894 8054461872 8054460903 Bacteria 4872905
895 8054562111 8054558443 Bacteria 5204801
896 8056380701 8056375014 Bacteria 7006639
897 8056384783 8056382006 Bacteria 6408074
898 8057582231 8057575449 Bacteria 7367519
899 Ga0214543_1000003
900 JGI25156J39149_1000153
901 JGI25162J39368_1001013
902 JGI25162J39368_1001160
903 JGI25154J39366_1000152
904 JGI25157J39369_1000061
905 JGI25152J39213_1002047
906 JGI25152J39213_1002225
907 JGI25152J39213_1002746
908 JGI25150J39212_1000031
909 JGI25150J39212_1003104
910 JGI25159J45721_1000002
911 JGI25159J45721_1003211
912 JGI25159J45721_1006113
913 JGI25151J46595_10000062
914 JGI25165J46597_1001286
915 JGI25165J46597_1001705
916 JGI25153J46596_10003455
917 JGI25153J46596_10003797
918 rootL2_10003072
919 rootH1_10039003
920 rootH1_10109493
921 JGI25160J50197_1000008
922 JGI25160J50197_1000052
923 JGI25160J50197_1003609
924 JGI25160J50197_1007244
925 JGI25161J50226_1000005
926 JGI25161J50226_1000113
927 JGI25161J50226_1000133
928 JGI25161J50226_1000527
929 Ga0055526_1002912
930 Ga0055526_1010220
931 Ga0055526_1021727
932 Ga0055526_1021737
933 Ga0055524_1003487
934 Ga0055524_1008616
935 Ga0055524_1013056
936 Ga0055536_1001375
937 Ga0055528_1000149
938 Ga0055528_1002648
939 Ga0055528_1003478
940 Ga0055528_1032191
941 Ga0055530_10007424
942 Ga0055540_1000406
943 Ga0055540_1003151
944 Ga0055540_1021733
945 Ga0055540_1022589
946 Ga0055531_10006368
947 Ga0058692_1004840
948 Ga0058692_1008392
949 Ga0055543_1000035
950 Ga0055543_1000040
951 Ga0055543_1000048
952 Ga0065165_1000015
953 Ga0065165_1000253
954 Ga0065165_1041411
955 Ga0065165_1042784
956 Ga0070668_100215604
957 Ga0070665_100045283
958 Ga0068855_100132280
959 Ga0068854_100248889
960 Ga0075365_10032765
961 Ga0075365_10170024
962 Ga0075368_10015434
963 Ga0075363_100012152
964 Ga0075363_100028918
965 Ga0075363_100175105
966 Ga0075364_10018980
967 Ga0075364_10071929
968 Ga0075362_10167814
969 Ga0075367_10064973
970 Ga0075369_10017027
971 Ga0075369_10168820
972 Ga0075370_10092110
973 Ga0079104_1002273
974 Ga0079104_1005092
975 Ga0099826_10024949
976 Ga0105244_10137878
977 Ga0105250_10011058
978 Ga0105240_10000032
979 Ga0105247_10070341
980 Ga0105243_10730612
981 Ga0105248_10264104
982 Ga0105237_10064526
983 Ga0105249_10219610
984 Ga0123340_1068017
985 Ga0123341_1000048
986 Ga0123341_1105859
987 Ga0123341_1109245
988 Ga0123342_1007095
989 Ga0123342_1029411
990 Ga0105239_10004104
991 Ga0105239_10878567
992 Ga0157373_10002050
993 Ga0157371_10000380
994 Ga0157371_10009535
995 Ga0157370_10000748
996 Ga0157370_10000986
997 Ga0157369_10040067
998 Ga0157369_10159803
999 Ga0157369_10783606
1000 Ga0171463_1001
1001 Ga0182008_10037378
1002 Ga0182007_10009078
1003 Ga0183363_1336
1004 Ga0214544_1008762
1005 Ga0214542_1000006
1006 Ga0214542_1016338
1007 Ga0214543_1000014
1008 Ga0228711_1000001
1009 Ga0228710_1000001
1010 Ga0209435_100042
1011 Ga0209436_100064
1012 Ga0209436_101965
1013 Ga0209436_114010
1014 Ga0209437_100075
1015 Ga0209437_104465
1016 Ga0207425_1000031
1017 Ga0207425_1010912
1018 Ga0209646_1000145
1019 Ga0209646_1015396
1020 Ga0209026_1000160
1021 Ga0209759_1000177
1022 Ga0209129_1000053
1023 Ga0209129_1000362
1024 Ga0209129_1000592
1025 Ga0209129_1003898
1026 Ga0209129_1005412
1027 Ga0209129_1008053
1028 Ga0209233_1000056
1029 Ga0209233_1000064
1030 Ga0209233_1000209
1031 Ga0209455_1021847
1032 Ga0209673_1000041
1033 Ga0209673_1001371
1034 Ga0209673_1002349
1035 Ga0209673_1004542
1036 Ga0209673_1004827
1037 Ga0209673_1040928
1038 Ga0209130_1000006
1039 Ga0209130_1000007
1040 Ga0209130_1000018
1041 Ga0209676_1002385
1042 Ga0209676_1010840
1043 Ga0209676_1021427
1044 Ga0209025_1000074
1045 Ga0209025_1000080
1046 Ga0209025_1000087
1047 Ga0209025_1000100
1048 Ga0209025_1001310
1049 Ga0209025_1001555
1050 Ga0209025_1004857
1051 Ga0209025_1022221
1052 Ga0209025_1039784
1053 Ga0209025_1082794
1054 Ga0209564_1000439
1055 Ga0209564_1006429
1056 Ga0209564_1034872
1057 Ga0209564_1039856
1058 Ga0209758_1000081
1059 Ga0209758_1000737
1060 Ga0209758_1001677
1061 Ga0209758_1001702
1062 Ga0209758_1002164
1063 Ga0209758_1009144
1064 Ga0209758_1081554
1065 Ga0209050_1001222
1066 Ga0209256_1002838
1067 Ga0209256_1002860
1068 Ga0209256_1003649
1069 Ga0209256_1007502
1070 Ga0209256_1010546
1071 Ga0207426_1000044
1072 Ga0207426_1000064
1073 Ga0207426_1000106
1074 Ga0207426_1000652
1075 Ga0209051_1000514
1076 Ga0209051_1001543
1077 Ga0209051_1002756
1078 Ga0209051_1012403
1079 Ga0209051_1043897
1080 Ga0209257_1001514
1081 Ga0207695_10000024
1082 Ga0207671_10000548
1083 Ga0207650_10002848
1084 Ga0207668_10763071
1085 Ga0207702_10124998
1086 Ga0207702_10438948
1087 Ga0209281_1000266
1088 Ga0209281_1000332
1089 Ga0209371_1000021
1090 Ga0209371_1000714
1091 Ga0209371_1000939
1092 Ga0209371_1001387
1093 Ga0209371_1002086
1094 Ga0209282_1000007
1095 Ga0209282_1001768
1096 Ga0209282_1010070
1097 Ga0268266_10002687
1098 Ga0307515_10000070
1099 Ga0307515_10005751
1100 Ga0307515_10009829
1101 Ga0268256_1000020
1102 Ga0268256_1002318
1103 Ga0268256_1002341
1104 Ga0316181_1214954
1105 Ga0307513_10078688
1106 Ga0307513_10408317
1107 Ga0307513_10511683
1108 Ga0307408_100039259
1109 Ga0307405_10095640
1110 Ga0307405_10200800
1111 Ga0307406_10069253
1112 Ga0307412_10399895
1113 Ga0315914_1000006
1114 Ga0307414_10307266
1115 Ga0315913_1000002
1116 Ga0315915_1000001
1117 Ga0439436_0009726
1118 Ga0439438_018012
1119 Ga0439439_0049938
1120 Ga0439439_0067162
1121 Ga0439465_0005455
1122 Ga0439465_0013230
1123 Ga0439465_0021873
1124 Ga0439449_0004950
1125 Ga0439449_0027972
1126 Ga0439449_0090931
1127 Ga0439452_041598
1128 Ga0439462_0008441
1129 Ga0450920_028546
1130 Ga0450918_004033
1131 Ga0466967_0451317
1132 Ga0495627_041695
1133 Ga0495592_0054665
1134 Ga0495629_0020032
1135 Ga0495638_0000353
1136 Ga0495638_0023768
1137 Ga0495638_0023957
1138 Ga0495638_0103718
1139 Ga0495650_0030215
1140 Ga0495650_0117436
1141 Ga0495605_0003895
1142 Ga0495605_0139735
1143 Ga0495662_0001957
1144 Ga0495664_0131601
1145 Ga0495585_0004076
1146 Ga0495607_0019235
1147 Ga0495583_0002283
1148 Ga0495583_0112426
1149 Ga0495606_0015262
1150 Ga0495606_0045156
1151 Ga0495606_0072624
1152 Ga0495606_0096192
1153 Ga0495606_0175183
1154 Ga0495610_0002493
1155 Ga0495610_0002941
1156 Ga0495610_0045308
1157 Ga0495620_0007860
1158 Ga0495620_0011636
1159 Ga0495620_0142101
1160 Ga0495631_0054359
1161 Ga0495632_0010045
1162 Ga0495643_0017310
1163 Ga0495643_0028312
1164 Ga0495643_0041252
1165 Ga0495643_0076128
1166 Ga0495648_0166355
1167 Ga0495587_0078106
1168 Ga0495609_0034081
1169 Ga0495609_0065063
1170 Ga0495622_0024264
1171 Ga0495656_0005975
1172 Ga0495668_0011053
1173 Ga0495611_0046435
1174 Ga0495625_0002953
1175 Ga0495625_0098360
1176 Ga0495625_0111291
1177 Ga0495625_0170050
1178 Ga0495625_0410637
1179 Ga0495661_0230077
1180 Ga0495588_0002348
1181 Ga0495657_0084561
1182 Ga0495646_0060439
1183 Ga0495658_0016347
1184 Ga0495671_0005749
1185 Ga0495649_0016416
1186 Ga0495600_0208314
1187 Ga0495660_0011331
1188 Ga0495660_0064545
1189 Ga0495604_0022047
1190 Ga0495636_0008083
1191 Ga0495636_0036703
1192 Ga0495674_0606196
1193 Ga0495672_0019712
1194 Ga0495687_012527
1195 Ga0495681_0003515
1196 Ga0495681_0027899
1197 Ga0495686_0001094
1198 Ga0495686_0019106
1199 Ga0495686_0020261
1200 Ga0495686_0082205
1201 Ga0495686_0242667
1202 Ga0496100_0030953
1203 Ga0496101_0040266
1204 Ga0496102_0009938
1205 Ga0496103_0016955
1206 Ga0496104_0081484
1207 Ga0496105_0024101
1208 Ga0496106_0000154
1209 Ga0496110_0020523
1210 Ga0496110_0569989
1211 Ga0496113_0030606
1212 Ga0496113_0184075
1213 Ga0496116_0000036
1214 Ga0496116_0008404
1215 Ga0496116_0028293
1216 Ga0496116_0035383
1217 Ga0496116_0042428
1218 Ga0496116_0052565
1219 Ga0496116_0145435
1220 Ga0496116_0146612
1221 Ga0496117_0000002
1222 Ga0496117_0003863
1223 Ga0496117_0023642
1224 Ga0496117_0038413
1225 Ga0496117_0139004
1226 Ga0496118_0000214
1227 Ga0496118_0000695
1228 Ga0496118_0016185
1229 Ga0496118_0055406
1230 Ga0496118_0172834
1231 Ga0496119_0019601
1232 Ga0496119_0024841
1233 Ga0496119_0037148
1234 Ga0496119_0050740
1235 Ga0496120_0000125
1236 Ga0496120_0011557
1237 Ga0496120_0019199
1238 Ga0496121_0000001
1239 Ga0496121_0001632
1240 Ga0496121_0008842
1241 Ga0496121_0056492
1242 Ga0496121_0064083
1243 Ga0496121_0100649
1244 Ga0496121_0123759
1245 Ga0496121_0253687
1246 Ga0496121_0291130
1247 Ga0496122_0000001
1248 Ga0496122_0003139
1249 Ga0496122_0011597
1250 Ga0496122_0015314
1251 Ga0496122_0029200
1252 Ga0496122_0039743
1253 Ga0496122_0046659
1254 Ga0496122_0085214
1255 Ga0496122_0158141
1256 Ga0496123_0000001
1257 Ga0496123_0014608
1258 Ga0496123_0031063
1259 Ga0496123_0043197
1260 Ga0496123_0044820
1261 Ga0496123_0045608
1262 Ga0496123_0065335
1263 Ga0496123_0081819
1264 Ga0496124_0000349
1265 Ga0496124_0003191
1266 Ga0496124_0007143
1267 Ga0496124_0019584
1268 Ga0496124_0028228
1269 Ga0496124_0028358
1270 Ga0496124_0051756
1271 Ga0496124_0067367
1272 Ga0496124_0081804
1273 Ga0496124_0137086
1274 Ga0496124_0227902
1275 Ga0496125_0000001
1276 Ga0496125_0030512
1277 Ga0496125_0037930
1278 Ga0496125_0040651
1279 Ga0496125_0057948
1280 Ga0496125_0075324
1281 Ga0496125_0173303
1282 Ga0496126_0000156
1283 Ga0496126_0015545
1284 Ga0496126_0022022
1285 Ga0496126_0042324
1286 Ga0496126_0044809
1287 Ga0496126_0136926
1288 Ga0495678_018576
1289 Ga0501032_0142497
1290 Ga0501036_0190742
1291 Ga0501037_0357475
1292 Ga0501038_0035728
1293 Ga0501039_0030216
1294 Ga0501043_0048985
1295 Ga0501080_0197346
1296 Ga0501044_0085835
1297 nmdc:mga03683_13499_c1
1298 nmdc:mga03n38_277182_c1
1299 nmdc:mga00v17_187_c1
1300 nmdc:mga00v17_38216_c1
1301 nmdc:mga00v17_97953_c1
1302 nmdc:mga0yw44_66884_c1
1303 nmdc:mga06z11_141938_c1
1304 nmdc:mga07m45_163483_c1
1305 nmdc:mga07m45_199365_c1
1306 nmdc:mga07m45_214477_c1
1307 nmdc:mga0sz30_56083_c1
1308 nmdc:mga0sz30_839_c1
1309 Ga0500578_0207158
1310 Ga0500578_0291571
1311 Ga0500644_0017456
1312 Ga0500651_0206886
1313 Ga0500557_000546
1314 Ga0500560_003419
1315 Ga0500560_015522
1316 Ga0500569_000769
1317 Ga0500569_012526
1318 Ga0500572_002424
1319 Ga0500594_0004786
1320 Ga0500608_030543
1321 Ga0500618_008277
1322 Ga0500618_025679
1323 Ga0500658_0003389
1324 Ga0500559_0068113
1325 Ga0500561_0000280
1326 Ga0500568_0000565
1327 Ga0500568_0000811
1328 Ga0500588_0012449
1329 Ga0500590_002679
1330 Ga0500616_0005562
1331 Ga0500622_0000322
1332 Ga0500622_0004590
1333 Ga0500624_000569
1334 Ga0500633_0000343
1335 Ga0500634_0001745
1336 Ga0500634_0015611
1337 Ga0500636_0000004
1338 Ga0500636_0008484
1339 2509108498
1340 2509374475
1341 2509387744
1342 2509443105
1343 2510132273
1344 2510306632
1345 2511133519
1346 2511183369
1347 2511197228
1348 2511500996
1349 2512532409
1350 2512972266
1351 2513580747
1352 2513583464
1353 2513596220
1354 2513603345
1355 2513618927
1356 2513632781
1357 2513709232
1358 2513868738
1359 2513881115
1360 2513902351
1361 2513983950
1362 2513999545
1363 2514004800
1364 2515608108
1365 2515740435
1366 2516208862
1367 2516892278
1368 2517075440
1369 2517405843
1370 2517569069
1371 2524451154
1372 2524460679
1373 2535515689
1374 2537874050
1375 2551676457
1376 2551687186
1377 2551693802
1378 2551704617
1379 2551715563
1380 2551720647
1381 2551725407
1382 2551734345
1383 2551740426
1384 2554247082
1385 2558863502
1386 2559294306
1387 2561466031
1388 2585165522
1389 2585203049
1390 2585220967
1391 2585231524
1392 2585273289
1393 2585278876
1394 2585325510
1395 2585329664
1396 2585392691
1397 2585400155
1398 2585527937
1399 2585530674
1400 2585549933
1401 2585554854
1402 2585559411
1403 2585822714
1404 2585847247
1405 2585902081
1406 2585905213
1407 2587979672
1408 2599333798
1409 2599602629
1410 2599723104
1411 2600191911
1412 2601608706
1413 2601745480
1414 2616305850
1415 2616553908
1416 2617383834
1417 2643807224
1418 2643855896
1419 2643918681
1420 2644069510
1421 2644109014
1422 2644151536
1423 2644196485
1424 2644206228
1425 2644296865
1426 2644311670
1427 2644329928
1428 2644380606
1429 2644420664
1430 2644454189
1431 2644493421
1432 2644518776
1433 2644546602
1434 2644617469
1435 2644649875
1436 2644655119
1437 2644675673
1438 2644689526
1439 2657683280
1440 2671115343
1441 2719664586
1442 2720491006
1443 2720612368
1444 2720619206
1445 2720630608
1446 2720774301
1447 2723026028
1448 2723559572
1449 2723566189
1450 2724088908
1451 2724103454
1452 2724109299
1453 2725948457
1454 2730106964
1455 2738802133
1456 2753460790
1457 2766067630
1458 2776912738
1459 2778177434
1460 2792584147
1461 2792622702
1462 2792628377
1463 2793296174
1464 2793317497
1465 2793333588
1466 2793353543
1467 2793367820
1468 2802717712
1469 2802723360
1470 2802733222
1471 2802736196
1472 2802743594
1473 2802750694
1474 2804751331
1475 2805926603
1476 2805933410
1477 2808985919
1478 2819242580
1479 2819556039
1480 2819612239
1481 2819639279
1482 2838031389
1483 2838049261
1484 2838063294
1485 2838074120
1486 2838076422
1487 2838670821
1488 2838676765
1489 2838688644
1490 2838703192
1491 2838715649
1492 2838720551
1493 2838726405
1494 2838730939
1495 2838744167
1496 2841847485
1497 2841856848
1498 2841859979
1499 2842117817
1500 2842126485
1501 2842131658
1502 2842147584
1503 2842153173
1504 2842160018
1505 2842168260
1506 2842171892
1507 2842176792
1508 2842183365
1509 2842188757
1510 2842197924
1511 2842207728
1512 2842213068
1513 2842221176
1514 2842225313
1515 2842235034
1516 2842245631
1517 2842252650
1518 2842259719
1519 2842266960
1520 2842274558
1521 2842281477
1522 2842287144
1523 2842302483
1524 2842306802
1525 2842314715
1526 2842318678
1527 2842343629
1528 2842360784
1529 2842365215
1530 2842404412
1531 2842410903
1532 2842417641
1533 2842427326
1534 2842431091
1535 2842436911
1536 2842442989
1537 2842453210
1538 2842465000
1539 2842471774
1540 2842478016
1541 2842482825
1542 2842493731
1543 2842497313
1544 2842504825
1545 2842509696
1546 2842516764
1547 2842525338
1548 2842924764
1549 2844168539
1550 2844455161
1551 2848993064
1552 2850080459
1553 2852389040
1554 2855831348
1555 2855840474
1556 2855879202
1557 2857520319
1558 2858801002
1559 2896386623
1560 2899796570
1561 2899803744
1562 2899847164
1563 2913297461
1564 2913311011
1565 2915986192
1566 2915990062
1567 2915996233
1568 2916001812
1569 2916014177
1570 2916016589
1571 2916024788
1572 2916032155
1573 2916038190
1574 2916047160
1575 2916053188
1576 2916055332
1577 2916062843
1578 2916076837
1579 2919103803
1580 2919115851
1581 2919167338
1582 2919409273
1583 2920762892
1584 2920823824
1585 2921206448
1586 2921214424
1587 2921237951
1588 2921247490
1589 2921250974
1590 2921259978
1591 2921264209
1592 2921283009
1593 2921290104
1594 2921300137
1595 2923557600
1596 2924145573
1597 2924155908
1598 2924160601
1599 2924168125
1600 2924177821
1601 2924185550
1602 2924189538
1603 2924199791
1604 2924204032
1605 2924209934
1606 2924221333
1607 2924222956
1608 2924234960
1609 2926756792
1610 2926761031
1611 2933007816
1612 2933012594
1613 2933573084
1614 2933591346
1615 2933595037
1616 2933604575
1617 2935904166
1618 2936368154
1619 2937001074
1620 2937009488
1621 2937010912
1622 2937018958
1623 2937027898
1624 2937029847
1625 2937036873
1626 2937043309
1627 2937056257
1628 2937069270
1629 2937077099
1630 2937082954
1631 2937091232
1632 2937095617
1633 2937104190
1634 2937112520
1635 2937118294
1636 2937121212
1637 2937129845
1638 2941500238
1639 2957380006
1640 2957385043
1641 2957389104
1642 2957396422
1643 2957406506
1644 2957409828
1645 2957419225
1646 2957423028
1647 2957431065
1648 2957442043
1649 2957446626
1650 2957454216
1651 2957462424
1652 2957467722
1653 2957476674
1654 2957480602
1655 2957490212
1656 2957496020
1657 2957501062
1658 2957509618
1659 2960586670
1660 2960595592
1661 2960602753
1662 2960610449
1663 2960611615
1664 2960617728
1665 2960625461
1666 2960633207
1667 2960640233
1668 2960646153
1669 2960660149
1670 2960666432
1671 2960673951
1672 2960684181
1673 2960692000
1674 2960699296
1675 2964619981
1676 2964622999
1677 2964633091
1678 2964641308
1679 2964646187
1680 2964653131
1681 2964659270
1682 2964665947
1683 2964672839
1684 2964679234
1685 2964688134
1686 2964695867
1687 2964702261
1688 2964708068
1689 2964716325
1690 2964726064
1691 2967671115
1692 2967672118
1693 2967681071
1694 2967687054
1695 2967693273
1696 2967701149
1697 2967707477
1698 2967716501
1699 2967724615
1700 2967734715
1701 2967737551
1702 2967742639
1703 2967752079
1704 2967760545
1705 2967764459
1706 2967770818
1707 2967782203
1708 2970026099
1709 2970029120
1710 2970038812
1711 2970044567
1712 2970052860
1713 2970059582
1714 2970068779
1715 2970073887
1716 2970076943
1717 2970085302
1718 2970094407
1719 2970096742
1720 2970106902
1721 2970115839
1722 2970117941
1723 2970124440
1724 2970129545
1725 2970136743
1726 2970144392
1727 2970153788
1728 2970163666
1729 2970167530
1730 2970171820
1731 2970182790
1732 2970188283
1733 2970198298
1734 2977517889
1735 2977527682
1736 2977531918
1737 2977538014
1738 2977546075
1739 2977552015
1740 2977561645
1741 2977569008
1742 2977578935
1743 2977581467
1744 2978973770
1745 2979093691
1746 2979098926
1747 2979105668
1748 2984512486
1749 2984521153
1750 2984540447
1751 2984589118
1752 2984602644
1753 2989772030
1754 2989778147
1755 2996890835
1756 3003932643
1757 3005412415
1758 3005417112
1759 3005446731
1760 639647408
1761 648736392
1762 650739503
1763 8003570546
1764 8003992972
1765 8004000202
1766 8005251356
1767 8005261776
1768 8005284812
1769 8005292766
1770 8005304566
1771 8005309138
1772 8005315173
1773 8005325362
1774 8005376641
1775 8005432237
1776 8005485658
1777 8005499301
1778 8005544320
1779 8005627538
1780 8005648324
1781 8005660008
1782 8005670717
1783 8005684605
1784 8005690989
1785 8023686986
1786 8024481076
1787 8024489780
1788 8024503278
1789 8046767648
1790 8049293905
1791 8054461872
1792 8054562111
1793 8056380701
1794 8056384783
1795 8057582231

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02586

SRAP

SOS response associated peptidase (SRAP)

33

245

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
6oeb-assembly1.cif.gz_A crystal structure of hmces srap domain in complex with 3' overhang dna 0.8331 6 226
5ko9-assembly1.cif.gz_A crystal structure of the srap domain of human hmces protein 0.831 18 227
8d2m-assembly2.cif.gz_B covalent schiff base complex of yedk c2a and abasic dna 0.8285 3 228
8d2m-assembly1.cif.gz_A covalent schiff base complex of yedk c2a and abasic dna 0.8255 4 229
6oea-assembly1.cif.gz_A crystal structure of hmces srap domain in complex with longer 3' overhang dna 0.8215 6 226
ID Description Score Start End Superfamily
2f20B00 Alpha Beta;Alpha-Beta Complex;hypothetical protein yedk fold;SOS response associated peptidase-like 0.8443 25 227 3.90.1680.10
6nlcA00 Alpha Beta;Alpha-Beta Complex;hypothetical protein yedk fold;SOS response associated peptidase-like 0.8194 6 226 3.90.1680.10
af_I1KYZ5_1_237_3.90.1680.10 Alpha Beta;Alpha-Beta Complex;hypothetical protein yedk fold;SOS response associated peptidase-like 0.8152 2 230 3.90.1680.10
af_O05872_1_242_3.90.1680.10 Alpha Beta;Alpha-Beta Complex;hypothetical protein yedk fold;SOS response associated peptidase-like 0.8047 1 226 3.90.1680.10
af_Q04471_25_258_3.90.1680.10 Alpha Beta;Alpha-Beta Complex;hypothetical protein yedk fold;SOS response associated peptidase-like 0.8042 15 227 3.90.1680.10
ID Description Score Start End GO Terms
AF-A0A3M1JQD9-F1-model_v4 Abasic site processing protein (EC 3.4.-.-) 0.9599 122 227 GO:0003697
GO:0006508
GO:0008233
GO:0016829
GO:0106300
AF-A0A2N2L8D2-F1-model_v4 Abasic site processing protein (EC 3.4.-.-) 0.9591 73 209 GO:0003697
GO:0006508
GO:0008233
GO:0016829
GO:0106300
AF-A0A382LKZ6-F1-model_v4 Abasic site processing protein 0.9513 120 226 GO:0003697
GO:0006508
GO:0008233
GO:0016829
GO:0106300
AF-A0A2V9WDH9-F1-model_v4 Abasic site processing protein (EC 3.4.-.-) 0.9498 73 214 GO:0003697
GO:0006508
GO:0008233
GO:0016829
GO:0106300
AF-A0A7V5ZEX6-F1-model_v4 Abasic site processing protein (EC 3.4.-.-) 0.9492 100 226 GO:0003697
GO:0006508
GO:0008233
GO:0016829
GO:0106300

Map