F485047

General Info

Members Datasets Scaffolds Average Seq Length
897 367 1794 361

Family's Representative Sequence

Representative Sequence 3300027665|Ga0209983_1003504|Ga0209983_10035042
Length 406
Sequence MLRYFAEWATQFHSGFNVFGYLTLRAILAALTALAISFIVGPYVIRRLAQHQVGQRVRSDGPQSHLSKAGTPTMGGALILVAIIAATLLWGDLGNRFVWIVLAVTAAFGLIGFWDDYLKLVVGDSRGLIARYKYLWQSVAGLGAAVALYITAQSDAETTLYVPFFKDVLVPLGAAFVVLAYFVIVGTSNAVNLTDGLDGLAIMPAVLVAAALGVFAYASGNVVFANYLAIPYIAGTGEVLVICAAIFGAGLGFLWFNTYPAQVFMGDIGALALGAALGVIAVVVRQEIVLFIMGGVFVMETVSVILQVASFKLTGKRIFKMAPIHHHYELKGWAEPKVIVRFWIITVVLVLFGRGKLSETMGDFGKGLREFKKGMNEPDREQPRLPQPEITPEQAVRAEAKTTREG

Samples

Sample ID Description Type Environment
1 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
26 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
27 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
28 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
29 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
30 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
31 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
32 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
33 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
34 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
35 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
36 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
37 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
38 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
39 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
40 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
41 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
42 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
43 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
44 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
45 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
46 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
47 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
48 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
49 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
50 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
51 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
52 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
53 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
54 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
55 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
56 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
57 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
58 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
59 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
60 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
61 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
62 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
63 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
64 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
65 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
66 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
67 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
68 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
69 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
70 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
71 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
72 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
73 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
74 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
75 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
76 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
77 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
78 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
79 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
80 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
81 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
82 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
83 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
84 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
85 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
86 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
87 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
88 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
89 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
90 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
91 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
92 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
93 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
94 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
95 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
96 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
97 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
98 3300009987 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_213 metaG Metagenome Rhizosphere
99 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
100 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
101 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
102 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
103 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
104 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
105 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
106 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
107 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
108 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
109 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
110 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
111 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
161 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
163 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
164 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
165 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
167 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
168 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
169 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
170 3300028016 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 Metagenome Rhizosphere
171 3300028036 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE2 Metagenome Rhizosphere
172 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
176 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
177 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
178 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
179 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
180 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
181 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
182 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
183 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
184 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
185 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
186 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
187 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
188 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
189 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
190 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
191 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
192 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
193 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
194 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
195 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
196 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
197 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
198 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
199 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
200 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
201 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
202 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
203 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
204 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
205 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
206 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
207 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
208 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
209 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
210 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
211 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
212 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
213 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
214 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
215 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
216 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
217 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
218 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
219 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
220 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
221 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
222 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
223 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
224 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
225 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
226 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
227 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
228 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
229 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
230 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
231 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
232 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
233 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
234 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
235 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
236 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
237 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
238 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
239 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
240 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
241 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
242 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
243 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
244 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
245 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
246 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
247 3300042132 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_070716_133 Metagenome Rhizosphere
248 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
249 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
250 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
251 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
252 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
253 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
254 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
255 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
256 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
257 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
258 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
259 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
260 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
261 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
262 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
263 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
264 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
265 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
266 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
267 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
268 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
269 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
270 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
271 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
272 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
273 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
274 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
275 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
276 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
277 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
278 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
279 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
280 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
281 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
282 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
283 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
284 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
285 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
286 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
287 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
288 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
289 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
290 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
291 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
292 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
293 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
294 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
295 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
296 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
297 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
298 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
299 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
300 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
301 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
302 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
303 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
304 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
305 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
306 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
307 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
308 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
309 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
310 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
311 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
312 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
313 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
314 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
315 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
316 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
317 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
318 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
319 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
320 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
321 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
322 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
323 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
324 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
325 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
326 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
327 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
328 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
329 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
330 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
331 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
332 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
333 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
334 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
335 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
336 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
337 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
338 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
339 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
340 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
341 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
342 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
343 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
344 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
345 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
346 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
347 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
348 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
349 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
350 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
351 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
352 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
353 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
354 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
355 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
356 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
357 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
358 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
359 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
360 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
361 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
362 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
363 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
364 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
365 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
366 2952252522 Salinicola sp. DM10 Isolate Unclassified
367 8002745576 Marinomonas spartinae USM8 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.55
Metatranscriptomes 0.22
Isolates 0.22

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.78
Nodule 0
Rhizoplane 5.35
Rhizosphere 90.08
Stem 0
Stem Tuber 0
Unclassified 0.45

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0209983_1003504 3300027665 Bacteria 3343
2 SwRhRL2b_contig_2759267 2162886007 Bacteria 2449
3 Ga0065704_10076288 3300005289 Bacteria 5183
4 Ga0065707_10015964 3300005295 Bacteria 2349
5 Ga0065707_10083843 3300005295 Bacteria 8121
6 Ga0065707_10095867 3300005295 Bacteria 3328
7 Ga0065707_10176552 3300005295 Bacteria 1447
8 Ga0070658_10006615 3300005327 Bacteria 9394
9 Ga0070658_10075762 3300005327 Bacteria 2760
10 Ga0070676_10003423 3300005328 Bacteria 8266
11 Ga0070676_10117600 3300005328 Bacteria 1664
12 Ga0070683_100143004 3300005329 Bacteria 2266
13 Ga0070690_100010979 3300005330 Bacteria 5288
14 Ga0070690_100024229 3300005330 Bacteria 3730
15 Ga0070670_100006897 3300005331 Bacteria 9627
16 Ga0070670_100068129 3300005331 Bacteria 3054
17 Ga0070670_100266576 3300005331 Bacteria 1494
18 Ga0068869_100066984 3300005334 Bacteria 2648
19 Ga0068869_100143151 3300005334 Bacteria 1848
20 Ga0070666_10000022 3300005335 Bacteria 166910
21 Ga0070666_10004216 3300005335 Bacteria 8728
22 Ga0070666_10004495 3300005335 Bacteria 8500
23 Ga0070666_10030981 3300005335 Bacteria 3528
24 Ga0070680_100018973 3300005336 Bacteria 5443
25 Ga0070682_100031123 3300005337 Bacteria 3226
26 Ga0068868_100000335 3300005338 Bacteria 31712
27 Ga0068868_100071254 3300005338 Bacteria 2772
28 Ga0070689_100004899 3300005340 Bacteria 9080
29 Ga0070689_100158597 3300005340 Bacteria 1828
30 Ga0070689_100273157 3300005340 Bacteria 1400
31 Ga0070687_100056482 3300005343 Bacteria 2054
32 Ga0070661_100011484 3300005344 Bacteria 6169
33 Ga0070661_100073164 3300005344 Bacteria 2523
34 Ga0070692_10182023 3300005345 Bacteria 1218
35 Ga0070668_100003462 3300005347 Bacteria 11651
36 Ga0070669_100000063 3300005353 Bacteria 107421
37 Ga0070669_100214548 3300005353 Bacteria 1520
38 Ga0070675_100173620 3300005354 Bacteria 1860
39 Ga0070671_100020407 3300005355 Bacteria 5404
40 Ga0070671_100089062 3300005355 Bacteria 2583
41 Ga0070671_100090939 3300005355 Bacteria 2555
42 Ga0070671_100272909 3300005355 Bacteria 1437
43 Ga0070674_100180841 3300005356 Bacteria 1615
44 Ga0070673_100024963 3300005364 Bacteria 4391
45 Ga0070688_100011955 3300005365 Bacteria 4848
46 Ga0070688_100122183 3300005365 Bacteria 1746
47 Ga0070659_100008033 3300005366 Bacteria 7693
48 Ga0070659_100033710 3300005366 Bacteria 3980
49 Ga0070667_100051440 3300005367 Bacteria 3473
50 Ga0070667_100062662 3300005367 Bacteria 3150
51 Ga0070667_100068877 3300005367 Bacteria 3011
52 Ga0070709_10000015 3300005434 Bacteria 145128
53 Ga0070709_10003270 3300005434 Bacteria 8710
54 Ga0070709_10010003 3300005434 Bacteria 5242
55 Ga0070709_10024673 3300005434 Bacteria 3542
56 Ga0070709_10031262 3300005434 Bacteria 3202
57 Ga0070709_10212313 3300005434 Bacteria 1376
58 Ga0070714_100011662 3300005435 Bacteria 6978
59 Ga0070714_100083547 3300005435 Bacteria 2785
60 Ga0070714_100207713 3300005435 Bacteria 1794
61 Ga0070713_100003974 3300005436 Bacteria 9835
62 Ga0070713_100013627 3300005436 Bacteria 6012
63 Ga0070713_100014591 3300005436 Bacteria 5843
64 Ga0070713_100267719 3300005436 Bacteria 1564
65 Ga0070710_10005226 3300005437 Bacteria 6154
66 Ga0070710_10134441 3300005437 Bacteria 1511
67 Ga0070701_10076302 3300005438 Bacteria 1804
68 Ga0070711_100007093 3300005439 Bacteria 6796
69 Ga0070711_100037985 3300005439 Bacteria 3233
70 Ga0070705_100002609 3300005440 Bacteria 9035
71 Ga0070705_100041258 3300005440 Bacteria 2630
72 Ga0070694_100075066 3300005444 Bacteria 2338
73 Ga0070694_100085740 3300005444 Bacteria 2200
74 Ga0070708_100011568 3300005445 Bacteria 7185
75 Ga0070708_100018282 3300005445 Bacteria 5865
76 Ga0070708_100117542 3300005445 Bacteria 2449
77 Ga0070662_100157134 3300005457 Bacteria 1776
78 Ga0070681_10009911 3300005458 Bacteria 9389
79 Ga0070681_10288130 3300005458 Bacteria 1552
80 Ga0070685_10025653 3300005466 Bacteria 3245
81 Ga0070685_10025909 3300005466 Bacteria 3230
82 Ga0070706_100027150 3300005467 Bacteria 5268
83 Ga0070706_100060215 3300005467 Bacteria 3504
84 Ga0070707_100105979 3300005468 Bacteria 2726
85 Ga0070707_100162186 3300005468 Bacteria 2178
86 Ga0070698_100012524 3300005471 Bacteria 8981
87 Ga0070698_100051691 3300005471 Bacteria 4184
88 Ga0070698_100120432 3300005471 Bacteria 2585
89 Ga0070699_100001328 3300005518 Bacteria 22789
90 Ga0070699_100004474 3300005518 Bacteria 12360
91 Ga0070699_100030505 3300005518 Bacteria 4655
92 Ga0070699_100035202 3300005518 Bacteria 4328
93 Ga0070699_100062476 3300005518 Bacteria 3228
94 Ga0070679_100007861 3300005530 Bacteria 10000
95 Ga0070679_100157154 3300005530 Bacteria 2248
96 Ga0070684_100427742 3300005535 Bacteria 1222
97 Ga0070697_100012849 3300005536 Bacteria 6560
98 Ga0070697_100020243 3300005536 Bacteria 5262
99 Ga0070697_100073823 3300005536 Bacteria 2801
100 Ga0070697_100140744 3300005536 Bacteria 2029
101 Ga0070672_100028443 3300005543 Bacteria 4182
102 Ga0070686_100045056 3300005544 Bacteria 2777
103 Ga0070695_100009232 3300005545 Bacteria 5864
104 Ga0070695_100016777 3300005545 Bacteria 4437
105 Ga0070695_100093510 3300005545 Bacteria 2012
106 Ga0070695_100279046 3300005545 Bacteria 1227
107 Ga0070696_100000697 3300005546 Bacteria 21497
108 Ga0070696_100005456 3300005546 Bacteria 8482
109 Ga0070696_100010314 3300005546 Bacteria 6258
110 Ga0070696_100301398 3300005546 Bacteria 1227
111 Ga0070693_100033408 3300005547 Bacteria 2839
112 Ga0070665_100002111 3300005548 Bacteria 22209
113 Ga0070665_100026421 3300005548 Bacteria 5846
114 Ga0070665_100029916 3300005548 Bacteria 5482
115 Ga0070665_100048673 3300005548 Bacteria 4255
116 Ga0070665_100096729 3300005548 Bacteria 2957
117 Ga0070665_100200883 3300005548 Bacteria 1994
118 Ga0070704_100010806 3300005549 Bacteria 5567
119 Ga0070704_100011465 3300005549 Bacteria 5433
120 Ga0068855_100001414 3300005563 Bacteria 29795
121 Ga0068855_100280852 3300005563 Bacteria 1849
122 Ga0070664_100002644 3300005564 Bacteria 14449
123 Ga0070664_100062046 3300005564 Bacteria 3186
124 Ga0068857_100141756 3300005577 Bacteria 2173
125 Ga0068856_100015431 3300005614 Bacteria 7383
126 Ga0068856_100199521 3300005614 Bacteria 2015
127 Ga0068856_100247823 3300005614 Bacteria 1796
128 Ga0068856_100284360 3300005614 Bacteria 1671
129 Ga0068859_100000517 3300005617 Bacteria 38279
130 Ga0068859_100001180 3300005617 Bacteria 26684
131 Ga0068859_100089188 3300005617 Bacteria 3134
132 Ga0068859_100369918 3300005617 Bacteria 1529
133 Ga0068864_100006506 3300005618 Bacteria 9574
134 Ga0068864_100233220 3300005618 Bacteria 1703
135 Ga0068866_10094860 3300005718 Bacteria 1633
136 Ga0068861_100013358 3300005719 Bacteria 5747
137 Ga0068861_100214914 3300005719 Bacteria 1622
138 Ga0068851_10095732 3300005834 Bacteria 1569
139 Ga0068863_100003133 3300005841 Bacteria 16328
140 Ga0068863_100006503 3300005841 Bacteria 11464
141 Ga0068858_100002263 3300005842 Bacteria 19465
142 Ga0068858_100003221 3300005842 Bacteria 16292
143 Ga0068858_100024505 3300005842 Bacteria 5621
144 Ga0068858_100223733 3300005842 Bacteria 1783
145 Ga0068858_100232624 3300005842 Bacteria 1747
146 Ga0068860_100002206 3300005843 Bacteria 20490
147 Ga0068860_100004354 3300005843 Bacteria 14469
148 Ga0068860_100105422 3300005843 Bacteria 2692
149 Ga0068860_100120611 3300005843 Bacteria 2511
150 Ga0068860_100134392 3300005843 Bacteria 2375
151 Ga0068862_100001650 3300005844 Bacteria 20295
152 Ga0068862_100011119 3300005844 Bacteria 7433
153 Ga0068862_100011686 3300005844 Bacteria 7245
154 Ga0068862_100027639 3300005844 Bacteria 4776
155 Ga0070717_10003728 3300006028 Bacteria 10945
156 Ga0075364_10183859 3300006051 Bacteria 1415
157 Ga0070715_10002837 3300006163 Bacteria 5398
158 Ga0070715_10009053 3300006163 Bacteria 3495
159 Ga0070716_100009434 3300006173 Bacteria 4864
160 Ga0070716_100009456 3300006173 Bacteria 4860
161 Ga0070716_100013212 3300006173 Bacteria 4204
162 Ga0070716_100059008 3300006173 Bacteria 2210
163 Ga0070716_100194583 3300006173 Bacteria 1343
164 Ga0070712_100007789 3300006175 Bacteria 6704
165 Ga0070712_100017652 3300006175 Bacteria 4621
166 Ga0070712_100020177 3300006175 Bacteria 4359
167 Ga0097621_100031912 3300006237 Bacteria 4182
168 Ga0097621_100040376 3300006237 Bacteria 3752
169 Ga0097621_100156963 3300006237 Bacteria 1953
170 Ga0068871_100024519 3300006358 Bacteria 4680
171 Ga0068871_100032869 3300006358 Bacteria 4102
172 Ga0068871_100059994 3300006358 Bacteria 3101
173 Ga0068871_100175812 3300006358 Bacteria 1838
174 Ga0075428_100012989 3300006844 Bacteria 9260
175 Ga0075428_100017441 3300006844 Bacteria 7936
176 Ga0075428_100055753 3300006844 Bacteria 4331
177 Ga0075428_100127043 3300006844 Bacteria 2774
178 Ga0075430_100050431 3300006846 Bacteria 3510
179 Ga0075430_100073742 3300006846 Bacteria 2861
180 Ga0075430_100214288 3300006846 Bacteria 1598
181 Ga0075431_100006814 3300006847 Bacteria 11347
182 Ga0075431_100053189 3300006847 Bacteria 4175
183 Ga0075431_100114036 3300006847 Bacteria 2790
184 Ga0075433_10002210 3300006852 Bacteria 14753
185 Ga0075433_10004587 3300006852 Bacteria 10778
186 Ga0075433_10015686 3300006852 Bacteria 6223
187 Ga0075433_10016652 3300006852 Bacteria 6066
188 Ga0075433_10017234 3300006852 Bacteria 5978
189 Ga0075433_10036290 3300006852 Bacteria 4245
190 Ga0075433_10354455 3300006852 Bacteria 1296
191 Ga0075434_100001437 3300006871 Bacteria 20000
192 Ga0075434_100029611 3300006871 Bacteria 5388
193 Ga0075434_100032679 3300006871 Bacteria 5132
194 Ga0075434_100087605 3300006871 Bacteria 3114
195 Ga0075434_100157955 3300006871 Bacteria 2287
196 Ga0075434_100210126 3300006871 Bacteria 1966
197 Ga0075434_100269799 3300006871 Bacteria 1721
198 Ga0075429_100040887 3300006880 Bacteria 4037
199 Ga0068865_100005883 3300006881 Bacteria 7463
200 Ga0075436_100000310 3300006914 Bacteria 31184
201 Ga0075436_100005105 3300006914 Bacteria 9033
202 Ga0075436_100011982 3300006914 Bacteria 5947
203 Ga0075436_100174032 3300006914 Bacteria 1520
204 Ga0075436_100243998 3300006914 Bacteria 1278
205 Ga0097620_100000517 3300006931 Bacteria 38279
206 Ga0097620_100001180 3300006931 Bacteria 26684
207 Ga0097620_100089192 3300006931 Bacteria 3134
208 Ga0097620_100369954 3300006931 Bacteria 1529
209 Ga0075435_100000015 3300007076 Bacteria 100708
210 Ga0075435_100033715 3300007076 Bacteria 4051
211 Ga0075435_100034863 3300007076 Bacteria 3991
212 Ga0099794_10000005 3300007265 Bacteria 131875
213 Ga0099794_10006626 3300007265 Bacteria 4704
214 Ga0099794_10015450 3300007265 Bacteria 3371
215 Ga0099794_10023668 3300007265 Bacteria 2812
216 Ga0099794_10048175 3300007265 Bacteria 2045
217 Ga0099794_10048471 3300007265 Bacteria 2039
218 Ga0099795_10000021 3300007788 Bacteria 58184
219 Ga0099795_10000327 3300007788 Bacteria 8586
220 Ga0099795_10009814 3300007788 Bacteria 2793
221 Ga0105250_10000008 3300009092 Bacteria 343965
222 Ga0105240_10000096 3300009093 Bacteria 179543
223 Ga0105240_10032169 3300009093 Bacteria 6793
224 Ga0105240_10037859 3300009093 Bacteria 6195
225 Ga0105240_10095884 3300009093 Bacteria 3616
226 Ga0105240_10127205 3300009093 Bacteria 3060
227 Ga0105240_10339773 3300009093 Bacteria 1706
228 Ga0111539_10004041 3300009094 Bacteria 19256
229 Ga0111539_10010716 3300009094 Bacteria 11538
230 Ga0111539_10166979 3300009094 Bacteria 2572
231 Ga0105245_10014445 3300009098 Bacteria 6879
232 Ga0105245_10014836 3300009098 Bacteria 6786
233 Ga0105245_10020382 3300009098 Bacteria 5815
234 Ga0105245_10405890 3300009098 Bacteria 1363
235 Ga0105247_10034236 3300009101 Bacteria 3094
236 Ga0114129_10007905 3300009147 Bacteria 15138
237 Ga0114129_10041629 3300009147 Bacteria 6471
238 Ga0114129_10145266 3300009147 Bacteria 3250
239 Ga0114129_10159665 3300009147 Bacteria 3081
240 Ga0105243_10280449 3300009148 Bacteria 1501
241 Ga0105241_10104934 3300009174 Bacteria 2253
242 Ga0105242_10012523 3300009176 Bacteria 6530
243 Ga0105242_10040823 3300009176 Bacteria 3739
244 Ga0105242_10113336 3300009176 Bacteria 2315
245 Ga0105242_10117595 3300009176 Bacteria 2276
246 Ga0105242_10246417 3300009176 Bacteria 1608
247 Ga0105248_10004174 3300009177 Bacteria 15957
248 Ga0105248_10006487 3300009177 Bacteria 12830
249 Ga0105248_10244360 3300009177 Bacteria 2020
250 Ga0105237_10026197 3300009545 Bacteria 5959
251 Ga0105238_10025529 3300009551 Bacteria 6024
252 Ga0105238_10065545 3300009551 Bacteria 3633
253 Ga0105238_10110020 3300009551 Bacteria 2736
254 Ga0105030_100378 3300009987 Bacteria 3911
255 Ga0099796_10000037 3300010159 Bacteria 27751
256 Ga0099796_10000544 3300010159 Bacteria 6440
257 Ga0099796_10001887 3300010159 Bacteria 4430
258 Ga0099796_10009673 3300010159 Bacteria 2618
259 Ga0105239_10065240 3300010375 Bacteria 3998
260 Ga0105239_10087150 3300010375 Bacteria 3441
261 Ga0105246_10002978 3300011119 Bacteria 10265
262 Ga0157374_10002345 3300013296 Bacteria 15995
263 Ga0157374_10061827 3300013296 Bacteria 3508
264 Ga0157374_10146878 3300013296 Bacteria 2290
265 Ga0157378_10000053 3300013297 Bacteria 99982
266 Ga0157378_10016842 3300013297 Bacteria 6407
267 Ga0157378_10018148 3300013297 Bacteria 6178
268 Ga0157378_10034424 3300013297 Bacteria 4480
269 Ga0157378_10061658 3300013297 Bacteria 3348
270 Ga0163162_10000132 3300013306 Bacteria 67582
271 Ga0163162_10004643 3300013306 Bacteria 13243
272 Ga0163162_10024479 3300013306 Bacteria 5959
273 Ga0163162_10115331 3300013306 Bacteria 2786
274 Ga0163162_10150941 3300013306 Bacteria 2441
275 Ga0157375_10079627 3300013308 Bacteria 3312
276 Ga0157375_10082715 3300013308 Bacteria 3253
277 Ga0157375_10125414 3300013308 Bacteria 2682
278 Ga0157375_10322092 3300013308 Bacteria 1710
279 Ga0163163_10001120 3300014325 Bacteria 22784
280 Ga0163163_10044763 3300014325 Bacteria 4343
281 Ga0163163_10107073 3300014325 Bacteria 2822
282 Ga0163163_10550097 3300014325 Bacteria 1217
283 Ga0157380_10004148 3300014326 Bacteria 10015
284 Ga0157380_10248435 3300014326 Bacteria 1609
285 Ga0157380_10327845 3300014326 Bacteria 1422
286 Ga0157379_10000026 3300014968 Bacteria 88552
287 Ga0157379_10000295 3300014968 Bacteria 39515
288 Ga0157379_10012640 3300014968 Bacteria 7376
289 Ga0157379_10067368 3300014968 Bacteria 3200
290 Ga0157379_10093250 3300014968 Bacteria 2701
291 Ga0157379_10144182 3300014968 Bacteria 2147
292 Ga0157379_10233123 3300014968 Bacteria 1669
293 Ga0157376_10000036 3300014969 Bacteria 145496
294 Ga0157376_10015665 3300014969 Bacteria 5734
295 Ga0157376_10025804 3300014969 Bacteria 4633
296 Ga0157376_10211166 3300014969 Bacteria 1792
297 Ga0182007_10034995 3300015262 Bacteria 1694
298 Ga0207696_1000119 3300025711 Bacteria 147213
299 Ga0207653_10033169 3300025885 Bacteria 1674
300 Ga0207692_10107137 3300025898 Bacteria 1544
301 Ga0207642_10014267 3300025899 Bacteria 2927
302 Ga0207710_10020281 3300025900 Bacteria 2841
303 Ga0207680_10000001 3300025903 Bacteria 1091453
304 Ga0207680_10111459 3300025903 Bacteria 1775
305 Ga0207680_10173645 3300025903 Bacteria 1453
306 Ga0207685_10004892 3300025905 Bacteria 3467
307 Ga0207685_10008743 3300025905 Bacteria 2903
308 Ga0207699_10000011 3300025906 Bacteria 282783
309 Ga0207699_10001312 3300025906 Bacteria 11824
310 Ga0207699_10002296 3300025906 Bacteria 9033
311 Ga0207699_10031431 3300025906 Bacteria 2981
312 Ga0207699_10094906 3300025906 Bacteria 1880
313 Ga0207699_10111106 3300025906 Bacteria 1756
314 Ga0207699_10120377 3300025906 Bacteria 1697
315 Ga0207705_10001121 3300025909 Bacteria 21795
316 Ga0207705_10046253 3300025909 Bacteria 3127
317 Ga0207705_10063995 3300025909 Bacteria 2658
318 Ga0207684_10061602 3300025910 Unclassified 3186
319 Ga0207684_10073495 3300025910 Bacteria 2904
320 Ga0207684_10083902 3300025910 Bacteria 2713
321 Ga0207707_10003235 3300025912 Bacteria 14463
322 Ga0207707_10212599 3300025912 Bacteria 1684
323 Ga0207695_10001779 3300025913 Bacteria 34026
324 Ga0207695_10085381 3300025913 Bacteria 3185
325 Ga0207671_10296383 3300025914 Bacteria 1277
326 Ga0207693_10000711 3300025915 Bacteria 29948
327 Ga0207693_10007605 3300025915 Bacteria 8901
328 Ga0207693_10012146 3300025915 Bacteria 6959
329 Ga0207693_10033837 3300025915 Bacteria 4032
330 Ga0207663_10235859 3300025916 Bacteria 1339
331 Ga0207660_10065319 3300025917 Bacteria 2629
332 Ga0207660_10306321 3300025917 Bacteria 1266
333 Ga0207662_10046348 3300025918 Bacteria 2572
334 Ga0207649_10094912 3300025920 Bacteria 1961
335 Ga0207652_10171961 3300025921 Bacteria 1944
336 Ga0207652_10335833 3300025921 Bacteria 1364
337 Ga0207646_10001298 3300025922 Bacteria 31112
338 Ga0207646_10040030 3300025922 Bacteria 4217
339 Ga0207646_10042859 3300025922 Unclassified 4066
340 Ga0207646_10103535 3300025922 Bacteria 2553
341 Ga0207681_10000015 3300025923 Bacteria 352892
342 Ga0207694_10000200 3300025924 Bacteria 59994
343 Ga0207694_10052693 3300025924 Bacteria 3154
344 Ga0207694_10054303 3300025924 Bacteria 3107
345 Ga0207650_10191940 3300025925 Bacteria 1632
346 Ga0207650_10232159 3300025925 Bacteria 1488
347 Ga0207659_10020972 3300025926 Bacteria 4329
348 Ga0207659_10098612 3300025926 Bacteria 2197
349 Ga0207659_10165535 3300025926 Bacteria 1740
350 Ga0207700_10009179 3300025928 Bacteria 6164
351 Ga0207700_10032030 3300025928 Bacteria 3744
352 Ga0207700_10127066 3300025928 Bacteria 2076
353 Ga0207700_10218671 3300025928 Bacteria 1614
354 Ga0207700_10322837 3300025928 Bacteria 1338
355 Ga0207664_10012252 3300025929 Bacteria 6129
356 Ga0207644_10145183 3300025931 Bacteria 1831
357 Ga0207706_10000427 3300025933 Bacteria 45237
358 Ga0207706_10116225 3300025933 Bacteria 2353
359 Ga0207686_10170237 3300025934 Bacteria 1535
360 Ga0207670_10015364 3300025936 Bacteria 4574
361 Ga0207704_10008728 3300025938 Bacteria 4862
362 Ga0207704_10160665 3300025938 Bacteria 1598
363 Ga0207665_10004089 3300025939 Bacteria 9737
364 Ga0207665_10020650 3300025939 Bacteria 4329
365 Ga0207665_10067295 3300025939 Unclassified 2439
366 Ga0207665_10107291 3300025939 Bacteria 1958
367 Ga0207691_10000868 3300025940 Bacteria 30058
368 Ga0207711_10011715 3300025941 Bacteria 7283
369 Ga0207711_10031197 3300025941 Bacteria 4498
370 Ga0207711_10141326 3300025941 Bacteria 2166
371 Ga0207711_10168711 3300025941 Bacteria 1985
372 Ga0207689_10169460 3300025942 Bacteria 1799
373 Ga0207661_10036948 3300025944 Bacteria 3816
374 Ga0207667_10019818 3300025949 Bacteria 7497
375 Ga0207667_10316386 3300025949 Bacteria 1594
376 Ga0207651_10007744 3300025960 Bacteria 5740
377 Ga0207668_10029380 3300025972 Bacteria 3603
378 Ga0207668_10146772 3300025972 Bacteria 1821
379 Ga0207640_10035463 3300025981 Bacteria 3123
380 Ga0207658_10043963 3300025986 Bacteria 3250
381 Ga0207658_10050777 3300025986 Bacteria 3053
382 Ga0207658_10118882 3300025986 Bacteria 2103
383 Ga0207658_10129613 3300025986 Bacteria 2024
384 Ga0207677_10073977 3300026023 Bacteria 2415
385 Ga0207677_10110702 3300026023 Bacteria 2044
386 Ga0207677_10142845 3300026023 Bacteria 1835
387 Ga0207677_10319129 3300026023 Bacteria 1290
388 Ga0207703_10000674 3300026035 Bacteria 34083
389 Ga0207703_10033403 3300026035 Bacteria 4078
390 Ga0207703_10114272 3300026035 Bacteria 2308
391 Ga0207703_10168155 3300026035 Bacteria 1926
392 Ga0207703_10196503 3300026035 Bacteria 1790
393 Ga0207708_10053465 3300026075 Bacteria 3077
394 Ga0207702_10022483 3300026078 Bacteria 5228
395 Ga0207702_10076235 3300026078 Bacteria 2898
396 Ga0207702_10082106 3300026078 Bacteria 2802
397 Ga0207702_10189288 3300026078 Bacteria 1900
398 Ga0207641_10003776 3300026088 Bacteria 13301
399 Ga0207641_10044664 3300026088 Bacteria 3727
400 Ga0207648_10000165 3300026089 Bacteria 68239
401 Ga0207648_10055950 3300026089 Bacteria 3443
402 Ga0207648_10103722 3300026089 Bacteria 2494
403 Ga0207676_10015072 3300026095 Bacteria 5573
404 Ga0207676_10063288 3300026095 Bacteria 2938
405 Ga0207675_100001139 3300026118 Bacteria 26331
406 Ga0207675_100004948 3300026118 Bacteria 12840
407 Ga0207675_100020910 3300026118 Bacteria 6101
408 Ga0207675_100267279 3300026118 Bacteria 1659
409 Ga0209967_1007762 3300027364 Bacteria 1471
410 Ga0209179_1000034 3300027512 Bacteria 31538
411 Ga0209179_1002995 3300027512 Bacteria 2370
412 Ga0209982_1005940 3300027552 Bacteria 1768
413 Ga0209970_1005333 3300027614 Bacteria 2124
414 Ga0210002_1004305 3300027617 Bacteria 2115
415 Ga0209588_1000006 3300027671 Bacteria 184445
416 Ga0209588_1001342 3300027671 Bacteria 6396
417 Ga0209588_1005287 3300027671 Bacteria 3690
418 Ga0209588_1031255 3300027671 Bacteria 1703
419 Ga0209971_1000284 3300027682 Bacteria 14126
420 Ga0209966_1005548 3300027695 Bacteria 2166
421 Ga0209974_10009351 3300027876 Bacteria 3325
422 Ga0209974_10064616 3300027876 Bacteria 1242
423 Ga0207428_10006585 3300027907 Bacteria 10699
424 Ga0207428_10016493 3300027907 Bacteria 6352
425 Ga0207428_10047954 3300027907 Bacteria 3429
426 Ga0207428_10160734 3300027907 Bacteria 1706
427 Ga0265354_1003477 3300028016 Bacteria 1759
428 Ga0265355_1003124 3300028036 Bacteria 1205
429 Ga0268266_10000075 3300028379 Bacteria 218045
430 Ga0268266_10001848 3300028379 Bacteria 23892
431 Ga0268266_10002891 3300028379 Bacteria 17806
432 Ga0268266_10010789 3300028379 Bacteria 7959
433 Ga0268266_10077262 3300028379 Bacteria 2894
434 Ga0268266_10216033 3300028379 Bacteria 1760
435 Ga0268265_10000522 3300028380 Bacteria 39151
436 Ga0268265_10016779 3300028380 Bacteria 5040
437 Ga0268265_10033964 3300028380 Bacteria 3714
438 Ga0268265_10122905 3300028380 Bacteria 2142
439 Ga0268265_10162375 3300028380 Bacteria 1900
440 Ga0268264_10008995 3300028381 Bacteria 8287
441 Ga0268264_10042241 3300028381 Bacteria 3774
442 Ga0268264_10180576 3300028381 Bacteria 1916
443 Ga0265326_10003887 3300028558 Bacteria 4851
444 Ga0265319_1018293 3300028563 Bacteria 2641
445 Ga0265334_10000110 3300028573 Bacteria 54049
446 Ga0265318_10000295 3300028577 Bacteria 40766
447 Ga0307515_10003416 3300028794 Bacteria 33442
448 Ga0307515_10312504 3300028794 Bacteria 1245
449 Ga0265338_10016148 3300028800 Bacteria 8145
450 Ga0265338_10032779 3300028800 Bacteria 5056
451 Ga0265338_10177319 3300028800 Bacteria 1628
452 Ga0265770_1000035 3300030878 Bacteria 13434
453 Ga0265760_10008613 3300031090 Bacteria 2913
454 Ga0265330_10013978 3300031235 Bacteria 3730
455 Ga0265332_10001472 3300031238 Bacteria 13160
456 Ga0265328_10000038 3300031239 Bacteria 91571
457 Ga0265328_10000462 3300031239 Bacteria 18873
458 Ga0265328_10003378 3300031239 Bacteria 7055
459 Ga0265328_10011778 3300031239 Bacteria 3489
460 Ga0265325_10009477 3300031241 Bacteria 5680
461 Ga0265329_10006707 3300031242 Bacteria 4543
462 Ga0265340_10037623 3300031247 Bacteria 2397
463 Ga0265339_10033981 3300031249 Bacteria 2868
464 Ga0265331_10000024 3300031250 Bacteria 235118
465 Ga0265331_10001740 3300031250 Bacteria 15656
466 Ga0265331_10004168 3300031250 Bacteria 9063
467 Ga0265327_10000079 3300031251 Bacteria 206892
468 Ga0265327_10000136 3300031251 Bacteria 160868
469 Ga0265327_10016591 3300031251 Bacteria 4666
470 Ga0265316_10032269 3300031344 Bacteria 4274
471 Ga0265316_10152095 3300031344 Bacteria 1733
472 Ga0307513_10112360 3300031456 Bacteria 2715
473 Ga0307509_10104733 3300031507 Bacteria 2853
474 Ga0265313_10011846 3300031595 Bacteria 5388
475 Ga0307508_10026008 3300031616 Bacteria 5306
476 Ga0316575_10000633 3300031665 Bacteria 10355
477 Ga0316579_10003266 3300031691 Bacteria 6292
478 Ga0265314_10027054 3300031711 Bacteria 4299
479 Ga0265342_10002639 3300031712 Bacteria 15324
480 Ga0316576_10055004 3300031727 Bacteria 2903
481 Ga0316576_10083410 3300031727 Bacteria 2374
482 Ga0316576_10112901 3300031727 Bacteria 2037
483 Ga0316578_10017501 3300031728 Bacteria 3901
484 Ga0316578_10047163 3300031728 Bacteria 2514
485 Ga0307516_10061762 3300031730 Bacteria 3634
486 Ga0316577_10015653 3300031733 Bacteria 4172
487 Ga0307413_10023699 3300031824 Bacteria 3330
488 Ga0307413_10037714 3300031824 Bacteria 2794
489 Ga0307410_10178489 3300031852 Bacteria 1606
490 Ga0307407_10063726 3300031903 Bacteria 2164
491 Ga0307412_10018737 3300031911 Bacteria 4174
492 Ga0307409_100015633 3300031995 Bacteria 4988
493 Ga0307409_100376669 3300031995 Bacteria 1348
494 Ga0307416_100003639 3300032002 Bacteria 9106
495 Ga0307415_100004865 3300032126 Bacteria 7048
496 Ga0316583_10001521 3300032133 Bacteria 7788
497 Ga0316583_10014851 3300032133 Bacteria 2804
498 Ga0307510_10016108 3300033180 Bacteria 8828
499 Ga0373929_0000009 3300035085 Bacteria 202242
500 Ga0373952_0002113 3300035092 Bacteria 3575
501 Ga0373954_0003004 3300035118 Bacteria 7115
502 Ga0373956_0042314 3300035119 Bacteria 2025
503 Ga0373956_0046070 3300035119 Bacteria 1947
504 Ga0373956_0058929 3300035119 Bacteria 1736
505 Ga0373956_0064618 3300035119 Bacteria 1662
506 Ga0373943_0110192 3300035170 Bacteria 1451
507 Ga0373946_0041439 3300035171 Bacteria 1889
508 Ga0373955_0001581 3300035172 Bacteria 9732
509 Ga0373955_0014508 3300035172 Bacteria 3835
510 Ga0373955_0041382 3300035172 Bacteria 2470
511 Ga0373961_0001487 3300035241 Bacteria 6858
512 Ga0316574_0004662 3300035398 Bacteria 7220
513 Ga0316574_0004807 3300035398 Bacteria 7146
514 Ga0316574_0179882 3300035398 Bacteria 1361
515 Ga0373924_0020978 3300035410 Bacteria 2545
516 Ga0373931_0015940 3300035691 Bacteria 3693
517 Ga0373931_0145446 3300035691 Bacteria 1377
518 Ga0373933_0000092 3300035724 Bacteria 56195
519 Ga0373937_0002321 3300036401 Bacteria 15898
520 Ga0373937_0101293 3300036401 Bacteria 2673
521 Ga0373937_0344076 3300036401 Bacteria 1412
522 Ga0373937_0362707 3300036401 Bacteria 1373
523 Ga0316582_0003446 3300036647 Bacteria 7763
524 Ga0316582_0007241 3300036647 Bacteria 5899
525 Ga0316582_0030585 3300036647 Bacteria 3281
526 Ga0316582_0037425 3300036647 Bacteria 3008
527 Ga0316584_0011477 3300036712 Bacteria 6226
528 Ga0316584_0014413 3300036712 Bacteria 5625
529 Ga0316584_0015665 3300036712 Bacteria 5425
530 Ga0316584_0021930 3300036712 Bacteria 4651
531 Ga0316584_0024602 3300036712 Bacteria 4408
532 Ga0316584_0052181 3300036712 Bacteria 3059
533 Ga0316584_0103189 3300036712 Bacteria 2135
534 Ga0373925_0075516 3300037068 Bacteria 2554
535 Ga0395900_0002653 3300037418 Bacteria 19542
536 Ga0395900_0156793 3300037418 Bacteria 2325
537 Ga0395900_0164995 3300037418 Unclassified 2258
538 Ga0395900_0261273 3300037418 Bacteria 1729
539 Ga0395898_0017594 3300037466 Bacteria 7295
540 Ga0395905_0003856 3300037471 Bacteria 15813
541 Ga0395905_0038631 3300037471 Bacteria 4479
542 Ga0395905_0054389 3300037471 Bacteria 3746
543 Ga0395905_0081840 3300037471 Bacteria 3026
544 Ga0395905_0187339 3300037471 Bacteria 1942
545 Ga0316581_0004257 3300037588 Bacteria 3638
546 Ga0316581_0020866 3300037588 Bacteria 1920
547 Ga0395901_0071050 3300038443 Bacteria 3627
548 Ga0400490_24818 3300038726 Bacteria 21658
549 Ga0400490_33485 3300038726 Bacteria 5044
550 Ga0400490_43208 3300038726 Bacteria 40847
551 Ga0400488_08624 3300038741 Bacteria 2237
552 Ga0400488_48288 3300038741 Bacteria 12907
553 Ga0400486_01259 3300038742 Bacteria 2531
554 Ga0400486_02595 3300038742 Bacteria 12059
555 Ga0400486_14746 3300038742 Bacteria 4261
556 Ga0400483_160384 3300039062 Bacteria 7215
557 Ga0400483_231710 3300039062 Bacteria 1844
558 Ga0400483_234508 3300039062 Bacteria 9530
559 Ga0400483_265969 3300039062 Bacteria 4344
560 Ga0400483_275498 3300039062 Bacteria 4322
561 Ga0400483_276356 3300039062 Bacteria 6970
562 Ga0400489_07775 3300039093 Bacteria 14176
563 Ga0400489_28828 3300039093 Bacteria 1705
564 Ga0400487_21516 3300039110 Bacteria 3346
565 Ga0436365_0389691 3300039437 Bacteria 2988
566 Ga0436361_0355668 3300039447 Bacteria 2519
567 Ga0436363_1471966 3300039450 Bacteria 13576
568 Ga0451800_0970504 3300041459 Bacteria 1354
569 Ga0450920_000110 3300042122 Bacteria 10927
570 Ga0450920_005305 3300042122 Bacteria 2286
571 Ga0450923_001003 3300042125 Bacteria 3518
572 Ga0450895_001307 3300042132 Bacteria 1707
573 Ga0450896_000066 3300042133 Bacteria 6782
574 Ga0450906_011326 3300042145 Bacteria 1669
575 Ga0439446_0001168 3300042156 Bacteria 5844
576 Ga0450908_000865 3300042184 Bacteria 5847
577 Ga0439435_0000053 3300042436 Bacteria 13174
578 Ga0439444_0001584 3300042437 Bacteria 2995
579 Ga0451577_0000074 3300042876 Bacteria 232698
580 Ga0451577_0000088 3300042876 Bacteria 206788
581 Ga0451577_0000193 3300042876 Bacteria 128594
582 Ga0451577_0000516 3300042876 Bacteria 64529
583 Ga0451577_0002021 3300042876 Bacteria 25151
584 Ga0451577_0003277 3300042876 Bacteria 18215
585 Ga0451577_0006444 3300042876 Bacteria 11709
586 Ga0451577_0009601 3300042876 Bacteria 9291
587 Ga0451577_0010031 3300042876 Bacteria 9073
588 Ga0451577_0010506 3300042876 Bacteria 8841
589 Ga0451577_0019877 3300042876 Bacteria 6169
590 Ga0451577_0032905 3300042876 Bacteria 4673
591 Ga0451577_0033295 3300042876 Bacteria 4645
592 Ga0451577_0067352 3300042876 Bacteria 3193
593 Ga0451577_0075149 3300042876 Bacteria 3013
594 Ga0451577_0096361 3300042876 Bacteria 2641
595 Ga0451577_0237681 3300042876 Bacteria 1648
596 Ga0453683_0000231 3300044673 Bacteria 74424
597 Ga0453683_0000513 3300044673 Bacteria 43919
598 Ga0453683_0002349 3300044673 Bacteria 14833
599 Ga0453683_0008408 3300044673 Bacteria 6928
600 Ga0453683_0009298 3300044673 Bacteria 6570
601 Ga0453683_0118656 3300044673 Bacteria 1665
602 Ga0466965_0009714 3300044683 Bacteria 4474
603 Ga0466966_0018497 3300044684 Bacteria 4595
604 Ga0466966_0093629 3300044684 Bacteria 1863
605 Ga0453684_0000309 3300044712 Bacteria 207063
606 Ga0453684_0000482 3300044712 Bacteria 158296
607 Ga0453684_0001270 3300044712 Bacteria 75637
608 Ga0453684_0001333 3300044712 Bacteria 72470
609 Ga0453684_0001824 3300044712 Bacteria 55944
610 Ga0453684_0002715 3300044712 Bacteria 41943
611 Ga0453684_0003190 3300044712 Bacteria 37571
612 Ga0453684_0005943 3300044712 Bacteria 23673
613 Ga0453684_0006807 3300044712 Bacteria 21495
614 Ga0453684_0014763 3300044712 Bacteria 12448
615 Ga0453684_0018374 3300044712 Bacteria 10733
616 Ga0453684_0027257 3300044712 Bacteria 8201
617 Ga0453684_0035614 3300044712 Bacteria 6876
618 Ga0453684_0046109 3300044712 Bacteria 5803
619 Ga0453684_0123234 3300044712 Bacteria 3125
620 Ga0453684_0155809 3300044712 Bacteria 2709
621 Ga0453684_0169857 3300044712 Bacteria 2572
622 Ga0453684_0253669 3300044712 Bacteria 2019
623 Ga0453684_0373282 3300044712 Bacteria 1603
624 Ga0453684_0424007 3300044712 Bacteria 1485
625 Ga0453684_0514618 3300044712 Bacteria 1323
626 Ga0453684_0584330 3300044712 Bacteria 1226
627 Ga0466959_0020277 3300045049 Bacteria 4896
628 Ga0466959_0139036 3300045049 Bacteria 1718
629 Ga0451576_0000469 3300045051 Bacteria 91565
630 Ga0451576_0000620 3300045051 Bacteria 74314
631 Ga0451576_0006546 3300045051 Bacteria 14258
632 Ga0451576_0011753 3300045051 Bacteria 9914
633 Ga0451576_0014196 3300045051 Bacteria 8877
634 Ga0451576_0108275 3300045051 Bacteria 2892
635 Ga0451576_0143835 3300045051 Bacteria 2486
636 Ga0451576_0228176 3300045051 Bacteria 1944
637 Ga0451576_0255411 3300045051 Bacteria 1832
638 Ga0466967_0182380 3300045976 Bacteria 1981
639 Ga0495603_0060758 3300046455 Bacteria 2232
640 Ga0495629_0064534 3300046459 Bacteria 2557
641 Ga0495651_0151232 3300046462 Bacteria 1673
642 Ga0495653_0064117 3300046463 Bacteria 2769
643 Ga0495650_0000338 3300046471 Bacteria 83352
644 Ga0495580_0009190 3300046472 Bacteria 7790
645 Ga0495580_0017932 3300046472 Bacteria 5280
646 Ga0495580_0042555 3300046472 Bacteria 3236
647 Ga0495580_0138108 3300046472 Bacteria 1690
648 Ga0495582_0000161 3300046473 Bacteria 36312
649 Ga0495664_0056199 3300046477 Bacteria 2341
650 Ga0495664_0057387 3300046477 Bacteria 2316
651 Ga0495594_0057509 3300046499 Bacteria 2147
652 Ga0495608_0019119 3300046511 Bacteria 4721
653 Ga0495618_0074668 3300046514 Bacteria 2159
654 Ga0495628_0071998 3300046516 Bacteria 2694
655 Ga0495628_0277021 3300046516 Bacteria 1247
656 Ga0495630_0294640 3300046517 Bacteria 1240
657 Ga0495644_0016363 3300046523 Bacteria 2838
658 Ga0495666_0033463 3300046526 Bacteria 2511
659 Ga0495665_0039971 3300046531 Bacteria 2498
660 Ga0495665_0063345 3300046531 Bacteria 1952
661 Ga0495665_0109156 3300046531 Bacteria 1452
662 Ga0495586_0025836 3300046535 Bacteria 3142
663 Ga0495587_0007281 3300046536 Bacteria 7174
664 Ga0495621_0005295 3300046539 Bacteria 3696
665 Ga0495667_0111924 3300046559 Bacteria 1764
666 Ga0495625_0057686 3300046660 Bacteria 2760
667 Ga0495635_0256187 3300046663 Bacteria 1179
668 Ga0495659_0000273 3300046664 Bacteria 21064
669 Ga0495588_0015942 3300046674 Bacteria 3625
670 Ga0495658_0002115 3300046683 Bacteria 10064
671 Ga0495658_0009606 3300046683 Bacteria 4823
672 Ga0495658_0012305 3300046683 Bacteria 4328
673 Ga0495613_0014054 3300046689 Bacteria 5940
674 Ga0495624_0050184 3300046690 Bacteria 2644
675 Ga0495670_0065380 3300046691 Bacteria 1833
676 Ga0495581_0014552 3300047315 Bacteria 4562
677 Ga0495581_0059115 3300047315 Bacteria 2215
678 Ga0495604_0000536 3300047317 Bacteria 33451
679 Ga0495674_0034504 3300047319 Bacteria 4575
680 Ga0495674_0048265 3300047319 Bacteria 3768
681 Ga0495674_0078309 3300047319 Bacteria 2840
682 Ga0495676_0016069 3300047321 Bacteria 6649
683 Ga0495680_0108332 3300047322 Bacteria 2062
684 Ga0496100_0052912 3300048903 Bacteria 2642
685 Ga0496100_0149182 3300048903 Bacteria 1665
686 Ga0496100_0168084 3300048903 Bacteria 1577
687 Ga0496101_0046317 3300048904 Bacteria 3118
688 Ga0496101_0243125 3300048904 Bacteria 1401
689 Ga0496102_0003185 3300048905 Bacteria 13912
690 Ga0496102_0032263 3300048905 Bacteria 4705
691 Ga0496102_0080326 3300048905 Bacteria 3004
692 Ga0496102_0251058 3300048905 Bacteria 1668
693 Ga0496103_0079556 3300048906 Bacteria 2060
694 Ga0496104_0020825 3300048907 Bacteria 6013
695 Ga0496104_0038861 3300048907 Bacteria 4454
696 Ga0496104_0046684 3300048907 Bacteria 4080
697 Ga0496104_0077839 3300048907 Bacteria 3160
698 Ga0496105_0015164 3300048908 Bacteria 6134
699 Ga0496105_0021234 3300048908 Bacteria 5253
700 Ga0496105_0045780 3300048908 Bacteria 3610
701 Ga0496105_0097234 3300048908 Bacteria 2432
702 Ga0496106_0002250 3300048909 Bacteria 14387
703 Ga0496106_0197863 3300048909 Bacteria 1599
704 Ga0496107_0043611 3300048910 Bacteria 3223
705 Ga0496107_0164940 3300048910 Bacteria 1642
706 Ga0496108_0047168 3300048911 Bacteria 3601
707 Ga0496108_0053892 3300048911 Bacteria 3374
708 Ga0496108_0111775 3300048911 Bacteria 2337
709 Ga0496108_0117005 3300048911 Bacteria 2284
710 Ga0496109_0018403 3300048912 Bacteria 6138
711 Ga0496109_0059938 3300048912 Bacteria 3477
712 Ga0496110_0041724 3300048913 Bacteria 4004
713 Ga0496111_0032056 3300048914 Bacteria 3746
714 Ga0496111_0045861 3300048914 Bacteria 3146
715 Ga0496112_0041978 3300048915 Bacteria 4475
716 Ga0496112_0191492 3300048915 Bacteria 2007
717 Ga0496113_0114544 3300048916 Bacteria 2102
718 Ga0496114_0000031 3300048917 Bacteria 168230
719 Ga0496114_0000525 3300048917 Bacteria 28205
720 Ga0496114_0006736 3300048917 Bacteria 9050
721 Ga0496114_0016484 3300048917 Bacteria 5955
722 Ga0496114_0028330 3300048917 Bacteria 4595
723 Ga0496114_0036753 3300048917 Bacteria 4049
724 Ga0496114_0103393 3300048917 Bacteria 2435
725 Ga0496114_0474424 3300048917 Bacteria 1107
726 Ga0496115_0001445 3300048918 Bacteria 17029
727 Ga0496115_0006113 3300048918 Bacteria 8799
728 Ga0496115_0044199 3300048918 Bacteria 3553
729 Ga0496115_0085986 3300048918 Bacteria 2565
730 Ga0496115_0300426 3300048918 Bacteria 1315
731 Ga0496116_0000005 3300048919 Bacteria 827804
732 Ga0496116_0048313 3300048919 Bacteria 2857
733 Ga0496118_0037737 3300048921 Bacteria 3884
734 Ga0496120_0000543 3300048923 Bacteria 57596
735 Ga0496121_0000029 3300048924 Bacteria 430303
736 Ga0496126_0046366 3300048929 Bacteria 3987
737 Ga0496126_0128815 3300048929 Bacteria 2189
738 Ga0501299_002008 3300049522 Bacteria 2759
739 Ga0501031_0024709 3300049568 Bacteria 3917
740 Ga0501031_0054975 3300049568 Bacteria 2594
741 Ga0501032_0001200 3300049569 Bacteria 20717
742 Ga0501032_0019635 3300049569 Bacteria 4724
743 Ga0501033_0000188 3300049570 Bacteria 59295
744 Ga0501033_0039594 3300049570 Bacteria 3521
745 Ga0501033_0115240 3300049570 Bacteria 1953
746 Ga0501033_0216832 3300049570 Bacteria 1363
747 Ga0501034_0097857 3300049571 Bacteria 2930
748 Ga0501034_0302030 3300049571 Bacteria 1537
749 Ga0501034_0391472 3300049571 Bacteria 1314
750 Ga0501036_0000718 3300049572 Bacteria 24523
751 Ga0501036_0000902 3300049572 Bacteria 22239
752 Ga0501036_0010990 3300049572 Bacteria 7485
753 Ga0501036_0023156 3300049572 Bacteria 5229
754 Ga0501036_0042245 3300049572 Bacteria 3861
755 Ga0501036_0066366 3300049572 Bacteria 3053
756 Ga0501037_0042101 3300049573 Bacteria 3357
757 Ga0501038_0001200 3300049574 Bacteria 23496
758 Ga0501038_0003652 3300049574 Bacteria 14338
759 Ga0501038_0003791 3300049574 Bacteria 14066
760 Ga0501038_0010501 3300049574 Bacteria 8469
761 Ga0501038_0135922 3300049574 Bacteria 2014
762 Ga0501038_0182637 3300049574 Bacteria 1692
763 Ga0501038_0276645 3300049574 Bacteria 1322
764 Ga0501039_0000129 3300049575 Bacteria 52452
765 Ga0501039_0005104 3300049575 Bacteria 9947
766 Ga0501039_0112887 3300049575 Bacteria 2125
767 Ga0501040_0003393 3300049576 Bacteria 10276
768 Ga0501040_0006313 3300049576 Bacteria 7694
769 Ga0501040_0061933 3300049576 Bacteria 2574
770 Ga0501040_0064519 3300049576 Bacteria 2521
771 Ga0501041_0002162 3300049577 Bacteria 11097
772 Ga0501041_0003644 3300049577 Bacteria 8861
773 Ga0501041_0073865 3300049577 Bacteria 2095
774 Ga0501041_0115207 3300049577 Bacteria 1669
775 Ga0501041_0143508 3300049577 Bacteria 1489
776 Ga0501042_0000149 3300049578 Bacteria 31256
777 Ga0501042_0005175 3300049578 Bacteria 8383
778 Ga0501042_0018209 3300049578 Bacteria 4860
779 Ga0501043_0002354 3300049579 Bacteria 16022
780 Ga0501043_0095087 3300049579 Bacteria 2342
781 Ga0501046_0009656 3300049580 Bacteria 8320
782 Ga0501046_0046060 3300049580 Bacteria 3462
783 Ga0501048_0024354 3300049582 Bacteria 4419
784 Ga0501048_0037853 3300049582 Bacteria 3464
785 Ga0501048_0052813 3300049582 Bacteria 2892
786 Ga0501067_0006534 3300049583 Bacteria 6463
787 Ga0501068_0017871 3300049584 Bacteria 4105
788 Ga0501068_0021037 3300049584 Bacteria 3807
789 Ga0501068_0098364 3300049584 Bacteria 1811
790 Ga0501068_0153522 3300049584 Bacteria 1448
791 Ga0501070_0144892 3300049586 Bacteria 1961
792 Ga0501071_0000172 3300049587 Bacteria 28277
793 Ga0501071_0003494 3300049587 Bacteria 9822
794 Ga0501071_0004103 3300049587 Bacteria 9209
795 Ga0501071_0101271 3300049587 Bacteria 2124
796 Ga0501071_0306798 3300049587 Bacteria 1204
797 Ga0501072_0006100 3300049588 Bacteria 9193
798 Ga0501072_0031664 3300049588 Bacteria 4142
799 Ga0501072_0036857 3300049588 Bacteria 3835
800 Ga0501073_0002463 3300049589 Bacteria 13830
801 Ga0501073_0023010 3300049589 Bacteria 4481
802 Ga0501074_0018601 3300049590 Bacteria 5047
803 Ga0501074_0111518 3300049590 Bacteria 1957
804 Ga0501075_0001132 3300049591 Bacteria 17193
805 Ga0501075_0003540 3300049591 Bacteria 10449
806 Ga0501075_0188170 3300049591 Bacteria 1574
807 Ga0501076_0007381 3300049592 Bacteria 8000
808 Ga0501076_0012915 3300049592 Bacteria 6251
809 Ga0501076_0027242 3300049592 Bacteria 4432
810 Ga0501076_0265233 3300049592 Bacteria 1406
811 Ga0501077_0002116 3300049593 Bacteria 11982
812 Ga0501077_0028830 3300049593 Bacteria 3528
813 Ga0501079_0001630 3300049741 Bacteria 15977
814 Ga0501079_0008901 3300049741 Bacteria 7601
815 Ga0501079_0020939 3300049741 Bacteria 4998
816 Ga0501079_0083687 3300049741 Bacteria 2468
817 Ga0501079_0105499 3300049741 Bacteria 2187
818 Ga0501079_0145180 3300049741 Bacteria 1849
819 Ga0501080_0004833 3300049742 Bacteria 12017
820 Ga0501080_0056162 3300049742 Bacteria 3667
821 Ga0501080_0063425 3300049742 Bacteria 3439
822 Ga0501080_0248776 3300049742 Bacteria 1621
823 Ga0501080_0303596 3300049742 Bacteria 1447
824 Ga0501081_0000276 3300049743 Bacteria 27057
825 Ga0501081_0011019 3300049743 Bacteria 5911
826 Ga0501081_0066545 3300049743 Bacteria 2506
827 Ga0501081_0079929 3300049743 Bacteria 2287
828 Ga0501081_0098678 3300049743 Bacteria 2063
829 Ga0501083_0035435 3300049744 Bacteria 3409
830 Ga0501035_0001470 3300049822 Bacteria 24148
831 Ga0501035_0006995 3300049822 Bacteria 10536
832 Ga0501035_0022885 3300049822 Bacteria 5739
833 Ga0501035_0066164 3300049822 Bacteria 3208
834 Ga0501035_0117281 3300049822 Bacteria 2329
835 Ga0501035_0160800 3300049822 Bacteria 1944
836 Ga0501044_0000700 3300049823 Bacteria 40445
837 Ga0501044_0028450 3300049823 Bacteria 5899
838 Ga0501044_0033347 3300049823 Bacteria 5413
839 Ga0501044_0466788 3300049823 Bacteria 1167
840 Ga0501045_0006043 3300049824 Bacteria 8385
841 Ga0501045_0030711 3300049824 Bacteria 3889
842 Ga0501045_0078367 3300049824 Bacteria 2436
843 Ga0501045_0108875 3300049824 Bacteria 2054
844 nmdc:mga05p37_256285_c1 3300050507 Bacteria 2096
845 nmdc:mga05p37_41777_c1 3300050507 Bacteria 5631
846 nmdc:mga09592_16932_c1 3300050508 Bacteria 5965
847 nmdc:mga09592_244208_c1 3300050508 Bacteria 1556
848 nmdc:mga09592_459294_c1 3300050508 Bacteria 1098
849 nmdc:mga0qj67_122349_c1 3300050509 Bacteria 2105
850 nmdc:mga0qj67_193141_c1 3300050509 Bacteria 1654
851 nmdc:mga06r32_14214_c1 3300050510 Bacteria 7219
852 nmdc:mga06r32_202114_c1 3300050510 Bacteria 1975
853 nmdc:mga06r32_46244_c1 3300050510 Bacteria 4153
854 nmdc:mga08y16_131428_c1 3300050511 Bacteria 2603
855 nmdc:mga08y16_3416_c1 3300050511 Bacteria 16476
856 nmdc:mga08y16_73378_c1 3300050511 Bacteria 3566
857 nmdc:mga0n895_107268_c1 3300050512 Bacteria 2807
858 nmdc:mga0n895_172046_c1 3300050512 Bacteria 2198
859 nmdc:mga0n895_219299_c1 3300050512 Bacteria 1931
860 nmdc:mga0n895_23293_c1 3300050512 Bacteria 5817
861 nmdc:mga0n895_285284_c1 3300050512 Bacteria 1674
862 nmdc:mga0n895_301_c1 3300050512 Bacteria 32672
863 nmdc:mga0n895_8070_c1 3300050512 Bacteria 9089
864 nmdc:mga0n895_9406_c1 3300050512 Bacteria 8549
865 nmdc:mga0rr50_25639_c1 3300050513 Bacteria 4101
866 nmdc:mga0rr50_28804_c1 3300050513 Bacteria 3908
867 nmdc:mga0rr50_5827_c1 3300050513 Bacteria 7404
868 nmdc:mga0rr50_6410_c1 3300050513 Bacteria 4966
869 nmdc:mga08x19_1345_c1 3300050514 Bacteria 15261
870 nmdc:mga08x19_1890_c1 3300050514 Bacteria 12822
871 nmdc:mga08x19_3396_c1 3300050514 Bacteria 9497
872 nmdc:mga08x19_38204_c1 3300050514 Bacteria 3049
873 nmdc:mga08x19_43084_c1 3300050514 Bacteria 2879
874 nmdc:mga08x19_67576_c1 3300050514 Bacteria 2325
875 nmdc:mga08x19_87373_c1 3300050514 Bacteria 2054
876 nmdc:mga0a205_128182_c1 3300050515 Bacteria 2437
877 nmdc:mga0a205_180_c1 3300050515 Bacteria 42950
878 nmdc:mga0a205_4503_c2 3300050515 Bacteria 12073
879 nmdc:mga0a205_56634_c1 3300050515 Bacteria 3785
880 Ga0500643_001494 3300053087 Bacteria 13401
881 Ga0500555_038946 3300053103 Bacteria 1328
882 Ga0500568_0012728 3300053139 Bacteria 3858
883 Ga0500622_0000011 3300053156 Bacteria 386096
884 Ga0500637_0001349 3300053178 Bacteria 10389
885 Ga0500611_003137 3300053727 Bacteria 2080
886 Ga0501084_0043016 3300054114 Bacteria 3778
887 Ga0501082_0002842 3300060353 Bacteria 15084
888 Ga0501082_0013727 3300060353 Bacteria 6963
889 Ga0501082_0239331 3300060353 Bacteria 1579
890 Ga0501082_0386152 3300060353 Bacteria 1222
891 Ga0530510_0004375 3300061734 Bacteria 9774
892 Ga0530510_0007524 3300061734 Bacteria 7586
893 Ga0530510_0010667 3300061734 Bacteria 6445
894 Ga0530510_0118386 3300061734 Bacteria 1943
895 Ga0530510_0261697 3300061734 Bacteria 1290
896 2952254800 2952252522 Bacteria 4171745
897 8002747459 8002745576 Bacteria 4840272
898 Ga0209983_1003504
899 SwRhRL2b_contig_2759267
900 Ga0065704_10076288
901 Ga0065707_10015964
902 Ga0065707_10083843
903 Ga0065707_10095867
904 Ga0065707_10176552
905 Ga0070658_10006615
906 Ga0070658_10075762
907 Ga0070676_10003423
908 Ga0070676_10117600
909 Ga0070683_100143004
910 Ga0070690_100010979
911 Ga0070690_100024229
912 Ga0070670_100006897
913 Ga0070670_100068129
914 Ga0070670_100266576
915 Ga0068869_100066984
916 Ga0068869_100143151
917 Ga0070666_10000022
918 Ga0070666_10004216
919 Ga0070666_10004495
920 Ga0070666_10030981
921 Ga0070680_100018973
922 Ga0070682_100031123
923 Ga0068868_100000335
924 Ga0068868_100071254
925 Ga0070689_100004899
926 Ga0070689_100158597
927 Ga0070689_100273157
928 Ga0070687_100056482
929 Ga0070661_100011484
930 Ga0070661_100073164
931 Ga0070692_10182023
932 Ga0070668_100003462
933 Ga0070669_100000063
934 Ga0070669_100214548
935 Ga0070675_100173620
936 Ga0070671_100020407
937 Ga0070671_100089062
938 Ga0070671_100090939
939 Ga0070671_100272909
940 Ga0070674_100180841
941 Ga0070673_100024963
942 Ga0070688_100011955
943 Ga0070688_100122183
944 Ga0070659_100008033
945 Ga0070659_100033710
946 Ga0070667_100051440
947 Ga0070667_100062662
948 Ga0070667_100068877
949 Ga0070709_10000015
950 Ga0070709_10003270
951 Ga0070709_10010003
952 Ga0070709_10024673
953 Ga0070709_10031262
954 Ga0070709_10212313
955 Ga0070714_100011662
956 Ga0070714_100083547
957 Ga0070714_100207713
958 Ga0070713_100003974
959 Ga0070713_100013627
960 Ga0070713_100014591
961 Ga0070713_100267719
962 Ga0070710_10005226
963 Ga0070710_10134441
964 Ga0070701_10076302
965 Ga0070711_100007093
966 Ga0070711_100037985
967 Ga0070705_100002609
968 Ga0070705_100041258
969 Ga0070694_100075066
970 Ga0070694_100085740
971 Ga0070708_100011568
972 Ga0070708_100018282
973 Ga0070708_100117542
974 Ga0070662_100157134
975 Ga0070681_10009911
976 Ga0070681_10288130
977 Ga0070685_10025653
978 Ga0070685_10025909
979 Ga0070706_100027150
980 Ga0070706_100060215
981 Ga0070707_100105979
982 Ga0070707_100162186
983 Ga0070698_100012524
984 Ga0070698_100051691
985 Ga0070698_100120432
986 Ga0070699_100001328
987 Ga0070699_100004474
988 Ga0070699_100030505
989 Ga0070699_100035202
990 Ga0070699_100062476
991 Ga0070679_100007861
992 Ga0070679_100157154
993 Ga0070684_100427742
994 Ga0070697_100012849
995 Ga0070697_100020243
996 Ga0070697_100073823
997 Ga0070697_100140744
998 Ga0070672_100028443
999 Ga0070686_100045056
1000 Ga0070695_100009232
1001 Ga0070695_100016777
1002 Ga0070695_100093510
1003 Ga0070695_100279046
1004 Ga0070696_100000697
1005 Ga0070696_100005456
1006 Ga0070696_100010314
1007 Ga0070696_100301398
1008 Ga0070693_100033408
1009 Ga0070665_100002111
1010 Ga0070665_100026421
1011 Ga0070665_100029916
1012 Ga0070665_100048673
1013 Ga0070665_100096729
1014 Ga0070665_100200883
1015 Ga0070704_100010806
1016 Ga0070704_100011465
1017 Ga0068855_100001414
1018 Ga0068855_100280852
1019 Ga0070664_100002644
1020 Ga0070664_100062046
1021 Ga0068857_100141756
1022 Ga0068856_100015431
1023 Ga0068856_100199521
1024 Ga0068856_100247823
1025 Ga0068856_100284360
1026 Ga0068859_100000517
1027 Ga0068859_100001180
1028 Ga0068859_100089188
1029 Ga0068859_100369918
1030 Ga0068864_100006506
1031 Ga0068864_100233220
1032 Ga0068866_10094860
1033 Ga0068861_100013358
1034 Ga0068861_100214914
1035 Ga0068851_10095732
1036 Ga0068863_100003133
1037 Ga0068863_100006503
1038 Ga0068858_100002263
1039 Ga0068858_100003221
1040 Ga0068858_100024505
1041 Ga0068858_100223733
1042 Ga0068858_100232624
1043 Ga0068860_100002206
1044 Ga0068860_100004354
1045 Ga0068860_100105422
1046 Ga0068860_100120611
1047 Ga0068860_100134392
1048 Ga0068862_100001650
1049 Ga0068862_100011119
1050 Ga0068862_100011686
1051 Ga0068862_100027639
1052 Ga0070717_10003728
1053 Ga0075364_10183859
1054 Ga0070715_10002837
1055 Ga0070715_10009053
1056 Ga0070716_100009434
1057 Ga0070716_100009456
1058 Ga0070716_100013212
1059 Ga0070716_100059008
1060 Ga0070716_100194583
1061 Ga0070712_100007789
1062 Ga0070712_100017652
1063 Ga0070712_100020177
1064 Ga0097621_100031912
1065 Ga0097621_100040376
1066 Ga0097621_100156963
1067 Ga0068871_100024519
1068 Ga0068871_100032869
1069 Ga0068871_100059994
1070 Ga0068871_100175812
1071 Ga0075428_100012989
1072 Ga0075428_100017441
1073 Ga0075428_100055753
1074 Ga0075428_100127043
1075 Ga0075430_100050431
1076 Ga0075430_100073742
1077 Ga0075430_100214288
1078 Ga0075431_100006814
1079 Ga0075431_100053189
1080 Ga0075431_100114036
1081 Ga0075433_10002210
1082 Ga0075433_10004587
1083 Ga0075433_10015686
1084 Ga0075433_10016652
1085 Ga0075433_10017234
1086 Ga0075433_10036290
1087 Ga0075433_10354455
1088 Ga0075434_100001437
1089 Ga0075434_100029611
1090 Ga0075434_100032679
1091 Ga0075434_100087605
1092 Ga0075434_100157955
1093 Ga0075434_100210126
1094 Ga0075434_100269799
1095 Ga0075429_100040887
1096 Ga0068865_100005883
1097 Ga0075436_100000310
1098 Ga0075436_100005105
1099 Ga0075436_100011982
1100 Ga0075436_100174032
1101 Ga0075436_100243998
1102 Ga0097620_100000517
1103 Ga0097620_100001180
1104 Ga0097620_100089192
1105 Ga0097620_100369954
1106 Ga0075435_100000015
1107 Ga0075435_100033715
1108 Ga0075435_100034863
1109 Ga0099794_10000005
1110 Ga0099794_10006626
1111 Ga0099794_10015450
1112 Ga0099794_10023668
1113 Ga0099794_10048175
1114 Ga0099794_10048471
1115 Ga0099795_10000021
1116 Ga0099795_10000327
1117 Ga0099795_10009814
1118 Ga0105250_10000008
1119 Ga0105240_10000096
1120 Ga0105240_10032169
1121 Ga0105240_10037859
1122 Ga0105240_10095884
1123 Ga0105240_10127205
1124 Ga0105240_10339773
1125 Ga0111539_10004041
1126 Ga0111539_10010716
1127 Ga0111539_10166979
1128 Ga0105245_10014445
1129 Ga0105245_10014836
1130 Ga0105245_10020382
1131 Ga0105245_10405890
1132 Ga0105247_10034236
1133 Ga0114129_10007905
1134 Ga0114129_10041629
1135 Ga0114129_10145266
1136 Ga0114129_10159665
1137 Ga0105243_10280449
1138 Ga0105241_10104934
1139 Ga0105242_10012523
1140 Ga0105242_10040823
1141 Ga0105242_10113336
1142 Ga0105242_10117595
1143 Ga0105242_10246417
1144 Ga0105248_10004174
1145 Ga0105248_10006487
1146 Ga0105248_10244360
1147 Ga0105237_10026197
1148 Ga0105238_10025529
1149 Ga0105238_10065545
1150 Ga0105238_10110020
1151 Ga0105030_100378
1152 Ga0099796_10000037
1153 Ga0099796_10000544
1154 Ga0099796_10001887
1155 Ga0099796_10009673
1156 Ga0105239_10065240
1157 Ga0105239_10087150
1158 Ga0105246_10002978
1159 Ga0157374_10002345
1160 Ga0157374_10061827
1161 Ga0157374_10146878
1162 Ga0157378_10000053
1163 Ga0157378_10016842
1164 Ga0157378_10018148
1165 Ga0157378_10034424
1166 Ga0157378_10061658
1167 Ga0163162_10000132
1168 Ga0163162_10004643
1169 Ga0163162_10024479
1170 Ga0163162_10115331
1171 Ga0163162_10150941
1172 Ga0157375_10079627
1173 Ga0157375_10082715
1174 Ga0157375_10125414
1175 Ga0157375_10322092
1176 Ga0163163_10001120
1177 Ga0163163_10044763
1178 Ga0163163_10107073
1179 Ga0163163_10550097
1180 Ga0157380_10004148
1181 Ga0157380_10248435
1182 Ga0157380_10327845
1183 Ga0157379_10000026
1184 Ga0157379_10000295
1185 Ga0157379_10012640
1186 Ga0157379_10067368
1187 Ga0157379_10093250
1188 Ga0157379_10144182
1189 Ga0157379_10233123
1190 Ga0157376_10000036
1191 Ga0157376_10015665
1192 Ga0157376_10025804
1193 Ga0157376_10211166
1194 Ga0182007_10034995
1195 Ga0207696_1000119
1196 Ga0207653_10033169
1197 Ga0207692_10107137
1198 Ga0207642_10014267
1199 Ga0207710_10020281
1200 Ga0207680_10000001
1201 Ga0207680_10111459
1202 Ga0207680_10173645
1203 Ga0207685_10004892
1204 Ga0207685_10008743
1205 Ga0207699_10000011
1206 Ga0207699_10001312
1207 Ga0207699_10002296
1208 Ga0207699_10031431
1209 Ga0207699_10094906
1210 Ga0207699_10111106
1211 Ga0207699_10120377
1212 Ga0207705_10001121
1213 Ga0207705_10046253
1214 Ga0207705_10063995
1215 Ga0207684_10061602
1216 Ga0207684_10073495
1217 Ga0207684_10083902
1218 Ga0207707_10003235
1219 Ga0207707_10212599
1220 Ga0207695_10001779
1221 Ga0207695_10085381
1222 Ga0207671_10296383
1223 Ga0207693_10000711
1224 Ga0207693_10007605
1225 Ga0207693_10012146
1226 Ga0207693_10033837
1227 Ga0207663_10235859
1228 Ga0207660_10065319
1229 Ga0207660_10306321
1230 Ga0207662_10046348
1231 Ga0207649_10094912
1232 Ga0207652_10171961
1233 Ga0207652_10335833
1234 Ga0207646_10001298
1235 Ga0207646_10040030
1236 Ga0207646_10042859
1237 Ga0207646_10103535
1238 Ga0207681_10000015
1239 Ga0207694_10000200
1240 Ga0207694_10052693
1241 Ga0207694_10054303
1242 Ga0207650_10191940
1243 Ga0207650_10232159
1244 Ga0207659_10020972
1245 Ga0207659_10098612
1246 Ga0207659_10165535
1247 Ga0207700_10009179
1248 Ga0207700_10032030
1249 Ga0207700_10127066
1250 Ga0207700_10218671
1251 Ga0207700_10322837
1252 Ga0207664_10012252
1253 Ga0207644_10145183
1254 Ga0207706_10000427
1255 Ga0207706_10116225
1256 Ga0207686_10170237
1257 Ga0207670_10015364
1258 Ga0207704_10008728
1259 Ga0207704_10160665
1260 Ga0207665_10004089
1261 Ga0207665_10020650
1262 Ga0207665_10067295
1263 Ga0207665_10107291
1264 Ga0207691_10000868
1265 Ga0207711_10011715
1266 Ga0207711_10031197
1267 Ga0207711_10141326
1268 Ga0207711_10168711
1269 Ga0207689_10169460
1270 Ga0207661_10036948
1271 Ga0207667_10019818
1272 Ga0207667_10316386
1273 Ga0207651_10007744
1274 Ga0207668_10029380
1275 Ga0207668_10146772
1276 Ga0207640_10035463
1277 Ga0207658_10043963
1278 Ga0207658_10050777
1279 Ga0207658_10118882
1280 Ga0207658_10129613
1281 Ga0207677_10073977
1282 Ga0207677_10110702
1283 Ga0207677_10142845
1284 Ga0207677_10319129
1285 Ga0207703_10000674
1286 Ga0207703_10033403
1287 Ga0207703_10114272
1288 Ga0207703_10168155
1289 Ga0207703_10196503
1290 Ga0207708_10053465
1291 Ga0207702_10022483
1292 Ga0207702_10076235
1293 Ga0207702_10082106
1294 Ga0207702_10189288
1295 Ga0207641_10003776
1296 Ga0207641_10044664
1297 Ga0207648_10000165
1298 Ga0207648_10055950
1299 Ga0207648_10103722
1300 Ga0207676_10015072
1301 Ga0207676_10063288
1302 Ga0207675_100001139
1303 Ga0207675_100004948
1304 Ga0207675_100020910
1305 Ga0207675_100267279
1306 Ga0209967_1007762
1307 Ga0209179_1000034
1308 Ga0209179_1002995
1309 Ga0209982_1005940
1310 Ga0209970_1005333
1311 Ga0210002_1004305
1312 Ga0209588_1000006
1313 Ga0209588_1001342
1314 Ga0209588_1005287
1315 Ga0209588_1031255
1316 Ga0209971_1000284
1317 Ga0209966_1005548
1318 Ga0209974_10009351
1319 Ga0209974_10064616
1320 Ga0207428_10006585
1321 Ga0207428_10016493
1322 Ga0207428_10047954
1323 Ga0207428_10160734
1324 Ga0265354_1003477
1325 Ga0265355_1003124
1326 Ga0268266_10000075
1327 Ga0268266_10001848
1328 Ga0268266_10002891
1329 Ga0268266_10010789
1330 Ga0268266_10077262
1331 Ga0268266_10216033
1332 Ga0268265_10000522
1333 Ga0268265_10016779
1334 Ga0268265_10033964
1335 Ga0268265_10122905
1336 Ga0268265_10162375
1337 Ga0268264_10008995
1338 Ga0268264_10042241
1339 Ga0268264_10180576
1340 Ga0265326_10003887
1341 Ga0265319_1018293
1342 Ga0265334_10000110
1343 Ga0265318_10000295
1344 Ga0307515_10003416
1345 Ga0307515_10312504
1346 Ga0265338_10016148
1347 Ga0265338_10032779
1348 Ga0265338_10177319
1349 Ga0265770_1000035
1350 Ga0265760_10008613
1351 Ga0265330_10013978
1352 Ga0265332_10001472
1353 Ga0265328_10000038
1354 Ga0265328_10000462
1355 Ga0265328_10003378
1356 Ga0265328_10011778
1357 Ga0265325_10009477
1358 Ga0265329_10006707
1359 Ga0265340_10037623
1360 Ga0265339_10033981
1361 Ga0265331_10000024
1362 Ga0265331_10001740
1363 Ga0265331_10004168
1364 Ga0265327_10000079
1365 Ga0265327_10000136
1366 Ga0265327_10016591
1367 Ga0265316_10032269
1368 Ga0265316_10152095
1369 Ga0307513_10112360
1370 Ga0307509_10104733
1371 Ga0265313_10011846
1372 Ga0307508_10026008
1373 Ga0316575_10000633
1374 Ga0316579_10003266
1375 Ga0265314_10027054
1376 Ga0265342_10002639
1377 Ga0316576_10055004
1378 Ga0316576_10083410
1379 Ga0316576_10112901
1380 Ga0316578_10017501
1381 Ga0316578_10047163
1382 Ga0307516_10061762
1383 Ga0316577_10015653
1384 Ga0307413_10023699
1385 Ga0307413_10037714
1386 Ga0307410_10178489
1387 Ga0307407_10063726
1388 Ga0307412_10018737
1389 Ga0307409_100015633
1390 Ga0307409_100376669
1391 Ga0307416_100003639
1392 Ga0307415_100004865
1393 Ga0316583_10001521
1394 Ga0316583_10014851
1395 Ga0307510_10016108
1396 Ga0373929_0000009
1397 Ga0373952_0002113
1398 Ga0373954_0003004
1399 Ga0373956_0042314
1400 Ga0373956_0046070
1401 Ga0373956_0058929
1402 Ga0373956_0064618
1403 Ga0373943_0110192
1404 Ga0373946_0041439
1405 Ga0373955_0001581
1406 Ga0373955_0014508
1407 Ga0373955_0041382
1408 Ga0373961_0001487
1409 Ga0316574_0004662
1410 Ga0316574_0004807
1411 Ga0316574_0179882
1412 Ga0373924_0020978
1413 Ga0373931_0015940
1414 Ga0373931_0145446
1415 Ga0373933_0000092
1416 Ga0373937_0002321
1417 Ga0373937_0101293
1418 Ga0373937_0344076
1419 Ga0373937_0362707
1420 Ga0316582_0003446
1421 Ga0316582_0007241
1422 Ga0316582_0030585
1423 Ga0316582_0037425
1424 Ga0316584_0011477
1425 Ga0316584_0014413
1426 Ga0316584_0015665
1427 Ga0316584_0021930
1428 Ga0316584_0024602
1429 Ga0316584_0052181
1430 Ga0316584_0103189
1431 Ga0373925_0075516
1432 Ga0395900_0002653
1433 Ga0395900_0156793
1434 Ga0395900_0164995
1435 Ga0395900_0261273
1436 Ga0395898_0017594
1437 Ga0395905_0003856
1438 Ga0395905_0038631
1439 Ga0395905_0054389
1440 Ga0395905_0081840
1441 Ga0395905_0187339
1442 Ga0316581_0004257
1443 Ga0316581_0020866
1444 Ga0395901_0071050
1445 Ga0400490_24818
1446 Ga0400490_33485
1447 Ga0400490_43208
1448 Ga0400488_08624
1449 Ga0400488_48288
1450 Ga0400486_01259
1451 Ga0400486_02595
1452 Ga0400486_14746
1453 Ga0400483_160384
1454 Ga0400483_231710
1455 Ga0400483_234508
1456 Ga0400483_265969
1457 Ga0400483_275498
1458 Ga0400483_276356
1459 Ga0400489_07775
1460 Ga0400489_28828
1461 Ga0400487_21516
1462 Ga0436365_0389691
1463 Ga0436361_0355668
1464 Ga0436363_1471966
1465 Ga0451800_0970504
1466 Ga0450920_000110
1467 Ga0450920_005305
1468 Ga0450923_001003
1469 Ga0450895_001307
1470 Ga0450896_000066
1471 Ga0450906_011326
1472 Ga0439446_0001168
1473 Ga0450908_000865
1474 Ga0439435_0000053
1475 Ga0439444_0001584
1476 Ga0451577_0000074
1477 Ga0451577_0000088
1478 Ga0451577_0000193
1479 Ga0451577_0000516
1480 Ga0451577_0002021
1481 Ga0451577_0003277
1482 Ga0451577_0006444
1483 Ga0451577_0009601
1484 Ga0451577_0010031
1485 Ga0451577_0010506
1486 Ga0451577_0019877
1487 Ga0451577_0032905
1488 Ga0451577_0033295
1489 Ga0451577_0067352
1490 Ga0451577_0075149
1491 Ga0451577_0096361
1492 Ga0451577_0237681
1493 Ga0453683_0000231
1494 Ga0453683_0000513
1495 Ga0453683_0002349
1496 Ga0453683_0008408
1497 Ga0453683_0009298
1498 Ga0453683_0118656
1499 Ga0466965_0009714
1500 Ga0466966_0018497
1501 Ga0466966_0093629
1502 Ga0453684_0000309
1503 Ga0453684_0000482
1504 Ga0453684_0001270
1505 Ga0453684_0001333
1506 Ga0453684_0001824
1507 Ga0453684_0002715
1508 Ga0453684_0003190
1509 Ga0453684_0005943
1510 Ga0453684_0006807
1511 Ga0453684_0014763
1512 Ga0453684_0018374
1513 Ga0453684_0027257
1514 Ga0453684_0035614
1515 Ga0453684_0046109
1516 Ga0453684_0123234
1517 Ga0453684_0155809
1518 Ga0453684_0169857
1519 Ga0453684_0253669
1520 Ga0453684_0373282
1521 Ga0453684_0424007
1522 Ga0453684_0514618
1523 Ga0453684_0584330
1524 Ga0466959_0020277
1525 Ga0466959_0139036
1526 Ga0451576_0000469
1527 Ga0451576_0000620
1528 Ga0451576_0006546
1529 Ga0451576_0011753
1530 Ga0451576_0014196
1531 Ga0451576_0108275
1532 Ga0451576_0143835
1533 Ga0451576_0228176
1534 Ga0451576_0255411
1535 Ga0466967_0182380
1536 Ga0495603_0060758
1537 Ga0495629_0064534
1538 Ga0495651_0151232
1539 Ga0495653_0064117
1540 Ga0495650_0000338
1541 Ga0495580_0009190
1542 Ga0495580_0017932
1543 Ga0495580_0042555
1544 Ga0495580_0138108
1545 Ga0495582_0000161
1546 Ga0495664_0056199
1547 Ga0495664_0057387
1548 Ga0495594_0057509
1549 Ga0495608_0019119
1550 Ga0495618_0074668
1551 Ga0495628_0071998
1552 Ga0495628_0277021
1553 Ga0495630_0294640
1554 Ga0495644_0016363
1555 Ga0495666_0033463
1556 Ga0495665_0039971
1557 Ga0495665_0063345
1558 Ga0495665_0109156
1559 Ga0495586_0025836
1560 Ga0495587_0007281
1561 Ga0495621_0005295
1562 Ga0495667_0111924
1563 Ga0495625_0057686
1564 Ga0495635_0256187
1565 Ga0495659_0000273
1566 Ga0495588_0015942
1567 Ga0495658_0002115
1568 Ga0495658_0009606
1569 Ga0495658_0012305
1570 Ga0495613_0014054
1571 Ga0495624_0050184
1572 Ga0495670_0065380
1573 Ga0495581_0014552
1574 Ga0495581_0059115
1575 Ga0495604_0000536
1576 Ga0495674_0034504
1577 Ga0495674_0048265
1578 Ga0495674_0078309
1579 Ga0495676_0016069
1580 Ga0495680_0108332
1581 Ga0496100_0052912
1582 Ga0496100_0149182
1583 Ga0496100_0168084
1584 Ga0496101_0046317
1585 Ga0496101_0243125
1586 Ga0496102_0003185
1587 Ga0496102_0032263
1588 Ga0496102_0080326
1589 Ga0496102_0251058
1590 Ga0496103_0079556
1591 Ga0496104_0020825
1592 Ga0496104_0038861
1593 Ga0496104_0046684
1594 Ga0496104_0077839
1595 Ga0496105_0015164
1596 Ga0496105_0021234
1597 Ga0496105_0045780
1598 Ga0496105_0097234
1599 Ga0496106_0002250
1600 Ga0496106_0197863
1601 Ga0496107_0043611
1602 Ga0496107_0164940
1603 Ga0496108_0047168
1604 Ga0496108_0053892
1605 Ga0496108_0111775
1606 Ga0496108_0117005
1607 Ga0496109_0018403
1608 Ga0496109_0059938
1609 Ga0496110_0041724
1610 Ga0496111_0032056
1611 Ga0496111_0045861
1612 Ga0496112_0041978
1613 Ga0496112_0191492
1614 Ga0496113_0114544
1615 Ga0496114_0000031
1616 Ga0496114_0000525
1617 Ga0496114_0006736
1618 Ga0496114_0016484
1619 Ga0496114_0028330
1620 Ga0496114_0036753
1621 Ga0496114_0103393
1622 Ga0496114_0474424
1623 Ga0496115_0001445
1624 Ga0496115_0006113
1625 Ga0496115_0044199
1626 Ga0496115_0085986
1627 Ga0496115_0300426
1628 Ga0496116_0000005
1629 Ga0496116_0048313
1630 Ga0496118_0037737
1631 Ga0496120_0000543
1632 Ga0496121_0000029
1633 Ga0496126_0046366
1634 Ga0496126_0128815
1635 Ga0501299_002008
1636 Ga0501031_0024709
1637 Ga0501031_0054975
1638 Ga0501032_0001200
1639 Ga0501032_0019635
1640 Ga0501033_0000188
1641 Ga0501033_0039594
1642 Ga0501033_0115240
1643 Ga0501033_0216832
1644 Ga0501034_0097857
1645 Ga0501034_0302030
1646 Ga0501034_0391472
1647 Ga0501036_0000718
1648 Ga0501036_0000902
1649 Ga0501036_0010990
1650 Ga0501036_0023156
1651 Ga0501036_0042245
1652 Ga0501036_0066366
1653 Ga0501037_0042101
1654 Ga0501038_0001200
1655 Ga0501038_0003652
1656 Ga0501038_0003791
1657 Ga0501038_0010501
1658 Ga0501038_0135922
1659 Ga0501038_0182637
1660 Ga0501038_0276645
1661 Ga0501039_0000129
1662 Ga0501039_0005104
1663 Ga0501039_0112887
1664 Ga0501040_0003393
1665 Ga0501040_0006313
1666 Ga0501040_0061933
1667 Ga0501040_0064519
1668 Ga0501041_0002162
1669 Ga0501041_0003644
1670 Ga0501041_0073865
1671 Ga0501041_0115207
1672 Ga0501041_0143508
1673 Ga0501042_0000149
1674 Ga0501042_0005175
1675 Ga0501042_0018209
1676 Ga0501043_0002354
1677 Ga0501043_0095087
1678 Ga0501046_0009656
1679 Ga0501046_0046060
1680 Ga0501048_0024354
1681 Ga0501048_0037853
1682 Ga0501048_0052813
1683 Ga0501067_0006534
1684 Ga0501068_0017871
1685 Ga0501068_0021037
1686 Ga0501068_0098364
1687 Ga0501068_0153522
1688 Ga0501070_0144892
1689 Ga0501071_0000172
1690 Ga0501071_0003494
1691 Ga0501071_0004103
1692 Ga0501071_0101271
1693 Ga0501071_0306798
1694 Ga0501072_0006100
1695 Ga0501072_0031664
1696 Ga0501072_0036857
1697 Ga0501073_0002463
1698 Ga0501073_0023010
1699 Ga0501074_0018601
1700 Ga0501074_0111518
1701 Ga0501075_0001132
1702 Ga0501075_0003540
1703 Ga0501075_0188170
1704 Ga0501076_0007381
1705 Ga0501076_0012915
1706 Ga0501076_0027242
1707 Ga0501076_0265233
1708 Ga0501077_0002116
1709 Ga0501077_0028830
1710 Ga0501079_0001630
1711 Ga0501079_0008901
1712 Ga0501079_0020939
1713 Ga0501079_0083687
1714 Ga0501079_0105499
1715 Ga0501079_0145180
1716 Ga0501080_0004833
1717 Ga0501080_0056162
1718 Ga0501080_0063425
1719 Ga0501080_0248776
1720 Ga0501080_0303596
1721 Ga0501081_0000276
1722 Ga0501081_0011019
1723 Ga0501081_0066545
1724 Ga0501081_0079929
1725 Ga0501081_0098678
1726 Ga0501083_0035435
1727 Ga0501035_0001470
1728 Ga0501035_0006995
1729 Ga0501035_0022885
1730 Ga0501035_0066164
1731 Ga0501035_0117281
1732 Ga0501035_0160800
1733 Ga0501044_0000700
1734 Ga0501044_0028450
1735 Ga0501044_0033347
1736 Ga0501044_0466788
1737 Ga0501045_0006043
1738 Ga0501045_0030711
1739 Ga0501045_0078367
1740 Ga0501045_0108875
1741 nmdc:mga05p37_256285_c1
1742 nmdc:mga05p37_41777_c1
1743 nmdc:mga09592_16932_c1
1744 nmdc:mga09592_244208_c1
1745 nmdc:mga09592_459294_c1
1746 nmdc:mga0qj67_122349_c1
1747 nmdc:mga0qj67_193141_c1
1748 nmdc:mga06r32_14214_c1
1749 nmdc:mga06r32_202114_c1
1750 nmdc:mga06r32_46244_c1
1751 nmdc:mga08y16_131428_c1
1752 nmdc:mga08y16_3416_c1
1753 nmdc:mga08y16_73378_c1
1754 nmdc:mga0n895_107268_c1
1755 nmdc:mga0n895_172046_c1
1756 nmdc:mga0n895_219299_c1
1757 nmdc:mga0n895_23293_c1
1758 nmdc:mga0n895_285284_c1
1759 nmdc:mga0n895_301_c1
1760 nmdc:mga0n895_8070_c1
1761 nmdc:mga0n895_9406_c1
1762 nmdc:mga0rr50_25639_c1
1763 nmdc:mga0rr50_28804_c1
1764 nmdc:mga0rr50_5827_c1
1765 nmdc:mga0rr50_6410_c1
1766 nmdc:mga08x19_1345_c1
1767 nmdc:mga08x19_1890_c1
1768 nmdc:mga08x19_3396_c1
1769 nmdc:mga08x19_38204_c1
1770 nmdc:mga08x19_43084_c1
1771 nmdc:mga08x19_67576_c1
1772 nmdc:mga08x19_87373_c1
1773 nmdc:mga0a205_128182_c1
1774 nmdc:mga0a205_180_c1
1775 nmdc:mga0a205_4503_c2
1776 nmdc:mga0a205_56634_c1
1777 Ga0500643_001494
1778 Ga0500555_038946
1779 Ga0500568_0012728
1780 Ga0500622_0000011
1781 Ga0500637_0001349
1782 Ga0500611_003137
1783 Ga0501084_0043016
1784 Ga0501082_0002842
1785 Ga0501082_0013727
1786 Ga0501082_0239331
1787 Ga0501082_0386152
1788 Ga0530510_0004375
1789 Ga0530510_0007524
1790 Ga0530510_0010667
1791 Ga0530510_0118386
1792 Ga0530510_0261697
1793 2952254800
1794 8002747459

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02416

TatA_B_E

mttA/Hcf106 family

338

397

0.91

PF10555

MraY_sig1

Phospho-N-acetylmuramoyl-pentapeptide-transferase signature 1

68

80

0.91

PF00953

Glycos_transf_4

Glycosyl transferase family 4

98

285

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
8cxr-assembly4.cif.gz_D crystal structure of mray bound to a sphaerimicin analogue 0.9842 24 358
8cxr-assembly1.cif.gz_A crystal structure of mray bound to a sphaerimicin analogue 0.9806 25 358
6oz6-assembly3.cif.gz_C error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.9792 25 358
6oyz-assembly2.cif.gz_C crystal structure of mray bound to capuramycin 0.9774 25 358
8cxr-assembly4.cif.gz_D crystal structure of mray bound to a sphaerimicin analogue 0.9745 24 358
ID Description Score Start End Superfamily
af_Q8WSV6_55_300_1.20.1260.140 Mainly Alpha;Up-down Bundle;Ferritin;Alternative oxidase 0.3369 178 358 1.20.1260.140
af_Q8BMA6_254_625_1.25.40.280 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;alix/aip1 like domains 0.334 22 147 1.25.40.280
af_P0ADJ8_1_145_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.3008 178 287 1.20.1250.20
af_A2CF25_588_744_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.2995 178 360 1.20.1250.20
af_A0A0G2L3Z8_323_518_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.294 175 356 1.20.1250.20
ID Description Score Start End GO Terms
AF-A0A1X0N8X3-F1-model_v4 Phospho-N-acetylmuramoyl-pentapeptide-transferase (EC 2.7.8.13) 1.001 209 360 GO:0005886
GO:0008360
GO:0008963
GO:0009252
GO:0046872
GO:0051301
GO:0071555
AF-A0A3S1VV32-F1-model_v4 deleted 1 191 343
AF-A0A7Y8RU87-F1-model_v4 Phospho-N-acetylmuramoyl-pentapeptide-transferase (EC 2.7.8.13) 0.9988 74 249 GO:0005886
GO:0008360
GO:0008963
GO:0009252
GO:0046872
GO:0051301
GO:0051992
GO:0071555
AF-A0A661FIK3-F1-model_v4 Phospho-N-acetylmuramoyl-pentapeptide-transferase (EC 2.7.8.13) 0.9985 68 360 GO:0005886
GO:0008360
GO:0008963
GO:0009252
GO:0046872
GO:0051301
GO:0051992
GO:0071555
AF-A0A1F6SX96-F1-model_v4 Phospho-N-acetylmuramoyl-pentapeptide-transferase (EC 2.7.8.13) 0.998 74 360 GO:0005886
GO:0008360
GO:0008963
GO:0009252
GO:0046872
GO:0051301
GO:0071555

Map