F485047
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 897 | 367 | 1794 | 361 |
Family's Representative Sequence
| Representative Sequence | 3300027665|Ga0209983_1003504|Ga0209983_10035042 |
| Length | 406 |
| Sequence | MLRYFAEWATQFHSGFNVFGYLTLRAILAALTALAISFIVGPYVIRRLAQHQVGQRVRSDGPQSHLSKAGTPTMGGALILVAIIAATLLWGDLGNRFVWIVLAVTAAFGLIGFWDDYLKLVVGDSRGLIARYKYLWQSVAGLGAAVALYITAQSDAETTLYVPFFKDVLVPLGAAFVVLAYFVIVGTSNAVNLTDGLDGLAIMPAVLVAAALGVFAYASGNVVFANYLAIPYIAGTGEVLVICAAIFGAGLGFLWFNTYPAQVFMGDIGALALGAALGVIAVVVRQEIVLFIMGGVFVMETVSVILQVASFKLTGKRIFKMAPIHHHYELKGWAEPKVIVRFWIITVVLVLFGRGKLSETMGDFGKGLREFKKGMNEPDREQPRLPQPEITPEQAVRAEAKTTREG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 2 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 3 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 4 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 5 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 8 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 9 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 11 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 13 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 14 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 15 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 16 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 17 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 19 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 26 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 29 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 31 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 32 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 36 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 39 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 40 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 41 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 42 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 43 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 45 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 46 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 47 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 49 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 50 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 54 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 55 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 57 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 58 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 59 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 60 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 61 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 62 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 63 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 64 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 65 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 66 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 67 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 69 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 70 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 71 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 72 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 74 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 75 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 76 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 77 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 78 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 79 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 80 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 81 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 82 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 84 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 85 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 86 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009987 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_213 metaG | Metagenome | Rhizosphere |
| 99 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 100 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 111 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300027364 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300027552 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300027614 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300027617 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 170 | 3300028016 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 | Metagenome | Rhizosphere |
| 171 | 3300028036 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE2 | Metagenome | Rhizosphere |
| 172 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 176 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 177 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 178 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 179 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 180 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 181 | 3300030878 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 182 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 183 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 184 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 185 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 186 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 187 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 188 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 189 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 190 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 191 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 192 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 193 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 194 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 195 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 196 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 197 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 198 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 199 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 200 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 201 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 202 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 203 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 204 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 205 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 206 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 207 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 208 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 209 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 210 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 211 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 212 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 213 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 214 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 215 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 216 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 217 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 218 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 219 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 220 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 221 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 222 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 223 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 224 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 225 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 226 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 227 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 228 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 229 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 230 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 231 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 232 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 233 | 3300037588 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA | Metagenome | Rhizosphere |
| 234 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 235 | 3300038726 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 | Metagenome | Unclassified |
| 236 | 3300038741 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 | Metagenome | Unclassified |
| 237 | 3300038742 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 | Metagenome | Unclassified |
| 238 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 239 | 3300039093 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 | Metagenome | Unclassified |
| 240 | 3300039110 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 | Metagenome | Unclassified |
| 241 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 242 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 243 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 244 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 245 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 246 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 247 | 3300042132 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_070716_133 | Metagenome | Rhizosphere |
| 248 | 3300042133 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 | Metagenome | Rhizosphere |
| 249 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 250 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 251 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 252 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 253 | 3300042437 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 | Metagenome | Rhizosphere |
| 254 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 255 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 256 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 257 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 258 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 259 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 260 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 261 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 262 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 296 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 297 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 298 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 299 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 300 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 301 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 302 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 303 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 304 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 305 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 306 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 307 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 308 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 309 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 310 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 311 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 312 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 313 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 314 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 315 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 316 | 3300049522 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control | Metagenome | Rhizosphere |
| 317 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 318 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 319 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 320 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 321 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 322 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 323 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 324 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 325 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 326 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 327 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 328 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 329 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 330 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 331 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 332 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 333 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 334 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 335 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 336 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 337 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 338 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 339 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 340 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 341 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 342 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 343 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 344 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 345 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 346 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 347 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 348 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 349 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 350 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 351 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 352 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 353 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 354 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 355 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 356 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 357 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 358 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 359 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 360 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 361 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 362 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 363 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 364 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 365 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 366 | 2952252522 | Salinicola sp. DM10 | Isolate | Unclassified |
| 367 | 8002745576 | Marinomonas spartinae USM8 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.55 |
| Metatranscriptomes | 0.22 |
| Isolates | 0.22 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.78 |
| Nodule | 0 |
| Rhizoplane | 5.35 |
| Rhizosphere | 90.08 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.45 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0209983_1003504 | 3300027665 | Bacteria | 3343 |
| 2 | SwRhRL2b_contig_2759267 | 2162886007 | Bacteria | 2449 |
| 3 | Ga0065704_10076288 | 3300005289 | Bacteria | 5183 |
| 4 | Ga0065707_10015964 | 3300005295 | Bacteria | 2349 |
| 5 | Ga0065707_10083843 | 3300005295 | Bacteria | 8121 |
| 6 | Ga0065707_10095867 | 3300005295 | Bacteria | 3328 |
| 7 | Ga0065707_10176552 | 3300005295 | Bacteria | 1447 |
| 8 | Ga0070658_10006615 | 3300005327 | Bacteria | 9394 |
| 9 | Ga0070658_10075762 | 3300005327 | Bacteria | 2760 |
| 10 | Ga0070676_10003423 | 3300005328 | Bacteria | 8266 |
| 11 | Ga0070676_10117600 | 3300005328 | Bacteria | 1664 |
| 12 | Ga0070683_100143004 | 3300005329 | Bacteria | 2266 |
| 13 | Ga0070690_100010979 | 3300005330 | Bacteria | 5288 |
| 14 | Ga0070690_100024229 | 3300005330 | Bacteria | 3730 |
| 15 | Ga0070670_100006897 | 3300005331 | Bacteria | 9627 |
| 16 | Ga0070670_100068129 | 3300005331 | Bacteria | 3054 |
| 17 | Ga0070670_100266576 | 3300005331 | Bacteria | 1494 |
| 18 | Ga0068869_100066984 | 3300005334 | Bacteria | 2648 |
| 19 | Ga0068869_100143151 | 3300005334 | Bacteria | 1848 |
| 20 | Ga0070666_10000022 | 3300005335 | Bacteria | 166910 |
| 21 | Ga0070666_10004216 | 3300005335 | Bacteria | 8728 |
| 22 | Ga0070666_10004495 | 3300005335 | Bacteria | 8500 |
| 23 | Ga0070666_10030981 | 3300005335 | Bacteria | 3528 |
| 24 | Ga0070680_100018973 | 3300005336 | Bacteria | 5443 |
| 25 | Ga0070682_100031123 | 3300005337 | Bacteria | 3226 |
| 26 | Ga0068868_100000335 | 3300005338 | Bacteria | 31712 |
| 27 | Ga0068868_100071254 | 3300005338 | Bacteria | 2772 |
| 28 | Ga0070689_100004899 | 3300005340 | Bacteria | 9080 |
| 29 | Ga0070689_100158597 | 3300005340 | Bacteria | 1828 |
| 30 | Ga0070689_100273157 | 3300005340 | Bacteria | 1400 |
| 31 | Ga0070687_100056482 | 3300005343 | Bacteria | 2054 |
| 32 | Ga0070661_100011484 | 3300005344 | Bacteria | 6169 |
| 33 | Ga0070661_100073164 | 3300005344 | Bacteria | 2523 |
| 34 | Ga0070692_10182023 | 3300005345 | Bacteria | 1218 |
| 35 | Ga0070668_100003462 | 3300005347 | Bacteria | 11651 |
| 36 | Ga0070669_100000063 | 3300005353 | Bacteria | 107421 |
| 37 | Ga0070669_100214548 | 3300005353 | Bacteria | 1520 |
| 38 | Ga0070675_100173620 | 3300005354 | Bacteria | 1860 |
| 39 | Ga0070671_100020407 | 3300005355 | Bacteria | 5404 |
| 40 | Ga0070671_100089062 | 3300005355 | Bacteria | 2583 |
| 41 | Ga0070671_100090939 | 3300005355 | Bacteria | 2555 |
| 42 | Ga0070671_100272909 | 3300005355 | Bacteria | 1437 |
| 43 | Ga0070674_100180841 | 3300005356 | Bacteria | 1615 |
| 44 | Ga0070673_100024963 | 3300005364 | Bacteria | 4391 |
| 45 | Ga0070688_100011955 | 3300005365 | Bacteria | 4848 |
| 46 | Ga0070688_100122183 | 3300005365 | Bacteria | 1746 |
| 47 | Ga0070659_100008033 | 3300005366 | Bacteria | 7693 |
| 48 | Ga0070659_100033710 | 3300005366 | Bacteria | 3980 |
| 49 | Ga0070667_100051440 | 3300005367 | Bacteria | 3473 |
| 50 | Ga0070667_100062662 | 3300005367 | Bacteria | 3150 |
| 51 | Ga0070667_100068877 | 3300005367 | Bacteria | 3011 |
| 52 | Ga0070709_10000015 | 3300005434 | Bacteria | 145128 |
| 53 | Ga0070709_10003270 | 3300005434 | Bacteria | 8710 |
| 54 | Ga0070709_10010003 | 3300005434 | Bacteria | 5242 |
| 55 | Ga0070709_10024673 | 3300005434 | Bacteria | 3542 |
| 56 | Ga0070709_10031262 | 3300005434 | Bacteria | 3202 |
| 57 | Ga0070709_10212313 | 3300005434 | Bacteria | 1376 |
| 58 | Ga0070714_100011662 | 3300005435 | Bacteria | 6978 |
| 59 | Ga0070714_100083547 | 3300005435 | Bacteria | 2785 |
| 60 | Ga0070714_100207713 | 3300005435 | Bacteria | 1794 |
| 61 | Ga0070713_100003974 | 3300005436 | Bacteria | 9835 |
| 62 | Ga0070713_100013627 | 3300005436 | Bacteria | 6012 |
| 63 | Ga0070713_100014591 | 3300005436 | Bacteria | 5843 |
| 64 | Ga0070713_100267719 | 3300005436 | Bacteria | 1564 |
| 65 | Ga0070710_10005226 | 3300005437 | Bacteria | 6154 |
| 66 | Ga0070710_10134441 | 3300005437 | Bacteria | 1511 |
| 67 | Ga0070701_10076302 | 3300005438 | Bacteria | 1804 |
| 68 | Ga0070711_100007093 | 3300005439 | Bacteria | 6796 |
| 69 | Ga0070711_100037985 | 3300005439 | Bacteria | 3233 |
| 70 | Ga0070705_100002609 | 3300005440 | Bacteria | 9035 |
| 71 | Ga0070705_100041258 | 3300005440 | Bacteria | 2630 |
| 72 | Ga0070694_100075066 | 3300005444 | Bacteria | 2338 |
| 73 | Ga0070694_100085740 | 3300005444 | Bacteria | 2200 |
| 74 | Ga0070708_100011568 | 3300005445 | Bacteria | 7185 |
| 75 | Ga0070708_100018282 | 3300005445 | Bacteria | 5865 |
| 76 | Ga0070708_100117542 | 3300005445 | Bacteria | 2449 |
| 77 | Ga0070662_100157134 | 3300005457 | Bacteria | 1776 |
| 78 | Ga0070681_10009911 | 3300005458 | Bacteria | 9389 |
| 79 | Ga0070681_10288130 | 3300005458 | Bacteria | 1552 |
| 80 | Ga0070685_10025653 | 3300005466 | Bacteria | 3245 |
| 81 | Ga0070685_10025909 | 3300005466 | Bacteria | 3230 |
| 82 | Ga0070706_100027150 | 3300005467 | Bacteria | 5268 |
| 83 | Ga0070706_100060215 | 3300005467 | Bacteria | 3504 |
| 84 | Ga0070707_100105979 | 3300005468 | Bacteria | 2726 |
| 85 | Ga0070707_100162186 | 3300005468 | Bacteria | 2178 |
| 86 | Ga0070698_100012524 | 3300005471 | Bacteria | 8981 |
| 87 | Ga0070698_100051691 | 3300005471 | Bacteria | 4184 |
| 88 | Ga0070698_100120432 | 3300005471 | Bacteria | 2585 |
| 89 | Ga0070699_100001328 | 3300005518 | Bacteria | 22789 |
| 90 | Ga0070699_100004474 | 3300005518 | Bacteria | 12360 |
| 91 | Ga0070699_100030505 | 3300005518 | Bacteria | 4655 |
| 92 | Ga0070699_100035202 | 3300005518 | Bacteria | 4328 |
| 93 | Ga0070699_100062476 | 3300005518 | Bacteria | 3228 |
| 94 | Ga0070679_100007861 | 3300005530 | Bacteria | 10000 |
| 95 | Ga0070679_100157154 | 3300005530 | Bacteria | 2248 |
| 96 | Ga0070684_100427742 | 3300005535 | Bacteria | 1222 |
| 97 | Ga0070697_100012849 | 3300005536 | Bacteria | 6560 |
| 98 | Ga0070697_100020243 | 3300005536 | Bacteria | 5262 |
| 99 | Ga0070697_100073823 | 3300005536 | Bacteria | 2801 |
| 100 | Ga0070697_100140744 | 3300005536 | Bacteria | 2029 |
| 101 | Ga0070672_100028443 | 3300005543 | Bacteria | 4182 |
| 102 | Ga0070686_100045056 | 3300005544 | Bacteria | 2777 |
| 103 | Ga0070695_100009232 | 3300005545 | Bacteria | 5864 |
| 104 | Ga0070695_100016777 | 3300005545 | Bacteria | 4437 |
| 105 | Ga0070695_100093510 | 3300005545 | Bacteria | 2012 |
| 106 | Ga0070695_100279046 | 3300005545 | Bacteria | 1227 |
| 107 | Ga0070696_100000697 | 3300005546 | Bacteria | 21497 |
| 108 | Ga0070696_100005456 | 3300005546 | Bacteria | 8482 |
| 109 | Ga0070696_100010314 | 3300005546 | Bacteria | 6258 |
| 110 | Ga0070696_100301398 | 3300005546 | Bacteria | 1227 |
| 111 | Ga0070693_100033408 | 3300005547 | Bacteria | 2839 |
| 112 | Ga0070665_100002111 | 3300005548 | Bacteria | 22209 |
| 113 | Ga0070665_100026421 | 3300005548 | Bacteria | 5846 |
| 114 | Ga0070665_100029916 | 3300005548 | Bacteria | 5482 |
| 115 | Ga0070665_100048673 | 3300005548 | Bacteria | 4255 |
| 116 | Ga0070665_100096729 | 3300005548 | Bacteria | 2957 |
| 117 | Ga0070665_100200883 | 3300005548 | Bacteria | 1994 |
| 118 | Ga0070704_100010806 | 3300005549 | Bacteria | 5567 |
| 119 | Ga0070704_100011465 | 3300005549 | Bacteria | 5433 |
| 120 | Ga0068855_100001414 | 3300005563 | Bacteria | 29795 |
| 121 | Ga0068855_100280852 | 3300005563 | Bacteria | 1849 |
| 122 | Ga0070664_100002644 | 3300005564 | Bacteria | 14449 |
| 123 | Ga0070664_100062046 | 3300005564 | Bacteria | 3186 |
| 124 | Ga0068857_100141756 | 3300005577 | Bacteria | 2173 |
| 125 | Ga0068856_100015431 | 3300005614 | Bacteria | 7383 |
| 126 | Ga0068856_100199521 | 3300005614 | Bacteria | 2015 |
| 127 | Ga0068856_100247823 | 3300005614 | Bacteria | 1796 |
| 128 | Ga0068856_100284360 | 3300005614 | Bacteria | 1671 |
| 129 | Ga0068859_100000517 | 3300005617 | Bacteria | 38279 |
| 130 | Ga0068859_100001180 | 3300005617 | Bacteria | 26684 |
| 131 | Ga0068859_100089188 | 3300005617 | Bacteria | 3134 |
| 132 | Ga0068859_100369918 | 3300005617 | Bacteria | 1529 |
| 133 | Ga0068864_100006506 | 3300005618 | Bacteria | 9574 |
| 134 | Ga0068864_100233220 | 3300005618 | Bacteria | 1703 |
| 135 | Ga0068866_10094860 | 3300005718 | Bacteria | 1633 |
| 136 | Ga0068861_100013358 | 3300005719 | Bacteria | 5747 |
| 137 | Ga0068861_100214914 | 3300005719 | Bacteria | 1622 |
| 138 | Ga0068851_10095732 | 3300005834 | Bacteria | 1569 |
| 139 | Ga0068863_100003133 | 3300005841 | Bacteria | 16328 |
| 140 | Ga0068863_100006503 | 3300005841 | Bacteria | 11464 |
| 141 | Ga0068858_100002263 | 3300005842 | Bacteria | 19465 |
| 142 | Ga0068858_100003221 | 3300005842 | Bacteria | 16292 |
| 143 | Ga0068858_100024505 | 3300005842 | Bacteria | 5621 |
| 144 | Ga0068858_100223733 | 3300005842 | Bacteria | 1783 |
| 145 | Ga0068858_100232624 | 3300005842 | Bacteria | 1747 |
| 146 | Ga0068860_100002206 | 3300005843 | Bacteria | 20490 |
| 147 | Ga0068860_100004354 | 3300005843 | Bacteria | 14469 |
| 148 | Ga0068860_100105422 | 3300005843 | Bacteria | 2692 |
| 149 | Ga0068860_100120611 | 3300005843 | Bacteria | 2511 |
| 150 | Ga0068860_100134392 | 3300005843 | Bacteria | 2375 |
| 151 | Ga0068862_100001650 | 3300005844 | Bacteria | 20295 |
| 152 | Ga0068862_100011119 | 3300005844 | Bacteria | 7433 |
| 153 | Ga0068862_100011686 | 3300005844 | Bacteria | 7245 |
| 154 | Ga0068862_100027639 | 3300005844 | Bacteria | 4776 |
| 155 | Ga0070717_10003728 | 3300006028 | Bacteria | 10945 |
| 156 | Ga0075364_10183859 | 3300006051 | Bacteria | 1415 |
| 157 | Ga0070715_10002837 | 3300006163 | Bacteria | 5398 |
| 158 | Ga0070715_10009053 | 3300006163 | Bacteria | 3495 |
| 159 | Ga0070716_100009434 | 3300006173 | Bacteria | 4864 |
| 160 | Ga0070716_100009456 | 3300006173 | Bacteria | 4860 |
| 161 | Ga0070716_100013212 | 3300006173 | Bacteria | 4204 |
| 162 | Ga0070716_100059008 | 3300006173 | Bacteria | 2210 |
| 163 | Ga0070716_100194583 | 3300006173 | Bacteria | 1343 |
| 164 | Ga0070712_100007789 | 3300006175 | Bacteria | 6704 |
| 165 | Ga0070712_100017652 | 3300006175 | Bacteria | 4621 |
| 166 | Ga0070712_100020177 | 3300006175 | Bacteria | 4359 |
| 167 | Ga0097621_100031912 | 3300006237 | Bacteria | 4182 |
| 168 | Ga0097621_100040376 | 3300006237 | Bacteria | 3752 |
| 169 | Ga0097621_100156963 | 3300006237 | Bacteria | 1953 |
| 170 | Ga0068871_100024519 | 3300006358 | Bacteria | 4680 |
| 171 | Ga0068871_100032869 | 3300006358 | Bacteria | 4102 |
| 172 | Ga0068871_100059994 | 3300006358 | Bacteria | 3101 |
| 173 | Ga0068871_100175812 | 3300006358 | Bacteria | 1838 |
| 174 | Ga0075428_100012989 | 3300006844 | Bacteria | 9260 |
| 175 | Ga0075428_100017441 | 3300006844 | Bacteria | 7936 |
| 176 | Ga0075428_100055753 | 3300006844 | Bacteria | 4331 |
| 177 | Ga0075428_100127043 | 3300006844 | Bacteria | 2774 |
| 178 | Ga0075430_100050431 | 3300006846 | Bacteria | 3510 |
| 179 | Ga0075430_100073742 | 3300006846 | Bacteria | 2861 |
| 180 | Ga0075430_100214288 | 3300006846 | Bacteria | 1598 |
| 181 | Ga0075431_100006814 | 3300006847 | Bacteria | 11347 |
| 182 | Ga0075431_100053189 | 3300006847 | Bacteria | 4175 |
| 183 | Ga0075431_100114036 | 3300006847 | Bacteria | 2790 |
| 184 | Ga0075433_10002210 | 3300006852 | Bacteria | 14753 |
| 185 | Ga0075433_10004587 | 3300006852 | Bacteria | 10778 |
| 186 | Ga0075433_10015686 | 3300006852 | Bacteria | 6223 |
| 187 | Ga0075433_10016652 | 3300006852 | Bacteria | 6066 |
| 188 | Ga0075433_10017234 | 3300006852 | Bacteria | 5978 |
| 189 | Ga0075433_10036290 | 3300006852 | Bacteria | 4245 |
| 190 | Ga0075433_10354455 | 3300006852 | Bacteria | 1296 |
| 191 | Ga0075434_100001437 | 3300006871 | Bacteria | 20000 |
| 192 | Ga0075434_100029611 | 3300006871 | Bacteria | 5388 |
| 193 | Ga0075434_100032679 | 3300006871 | Bacteria | 5132 |
| 194 | Ga0075434_100087605 | 3300006871 | Bacteria | 3114 |
| 195 | Ga0075434_100157955 | 3300006871 | Bacteria | 2287 |
| 196 | Ga0075434_100210126 | 3300006871 | Bacteria | 1966 |
| 197 | Ga0075434_100269799 | 3300006871 | Bacteria | 1721 |
| 198 | Ga0075429_100040887 | 3300006880 | Bacteria | 4037 |
| 199 | Ga0068865_100005883 | 3300006881 | Bacteria | 7463 |
| 200 | Ga0075436_100000310 | 3300006914 | Bacteria | 31184 |
| 201 | Ga0075436_100005105 | 3300006914 | Bacteria | 9033 |
| 202 | Ga0075436_100011982 | 3300006914 | Bacteria | 5947 |
| 203 | Ga0075436_100174032 | 3300006914 | Bacteria | 1520 |
| 204 | Ga0075436_100243998 | 3300006914 | Bacteria | 1278 |
| 205 | Ga0097620_100000517 | 3300006931 | Bacteria | 38279 |
| 206 | Ga0097620_100001180 | 3300006931 | Bacteria | 26684 |
| 207 | Ga0097620_100089192 | 3300006931 | Bacteria | 3134 |
| 208 | Ga0097620_100369954 | 3300006931 | Bacteria | 1529 |
| 209 | Ga0075435_100000015 | 3300007076 | Bacteria | 100708 |
| 210 | Ga0075435_100033715 | 3300007076 | Bacteria | 4051 |
| 211 | Ga0075435_100034863 | 3300007076 | Bacteria | 3991 |
| 212 | Ga0099794_10000005 | 3300007265 | Bacteria | 131875 |
| 213 | Ga0099794_10006626 | 3300007265 | Bacteria | 4704 |
| 214 | Ga0099794_10015450 | 3300007265 | Bacteria | 3371 |
| 215 | Ga0099794_10023668 | 3300007265 | Bacteria | 2812 |
| 216 | Ga0099794_10048175 | 3300007265 | Bacteria | 2045 |
| 217 | Ga0099794_10048471 | 3300007265 | Bacteria | 2039 |
| 218 | Ga0099795_10000021 | 3300007788 | Bacteria | 58184 |
| 219 | Ga0099795_10000327 | 3300007788 | Bacteria | 8586 |
| 220 | Ga0099795_10009814 | 3300007788 | Bacteria | 2793 |
| 221 | Ga0105250_10000008 | 3300009092 | Bacteria | 343965 |
| 222 | Ga0105240_10000096 | 3300009093 | Bacteria | 179543 |
| 223 | Ga0105240_10032169 | 3300009093 | Bacteria | 6793 |
| 224 | Ga0105240_10037859 | 3300009093 | Bacteria | 6195 |
| 225 | Ga0105240_10095884 | 3300009093 | Bacteria | 3616 |
| 226 | Ga0105240_10127205 | 3300009093 | Bacteria | 3060 |
| 227 | Ga0105240_10339773 | 3300009093 | Bacteria | 1706 |
| 228 | Ga0111539_10004041 | 3300009094 | Bacteria | 19256 |
| 229 | Ga0111539_10010716 | 3300009094 | Bacteria | 11538 |
| 230 | Ga0111539_10166979 | 3300009094 | Bacteria | 2572 |
| 231 | Ga0105245_10014445 | 3300009098 | Bacteria | 6879 |
| 232 | Ga0105245_10014836 | 3300009098 | Bacteria | 6786 |
| 233 | Ga0105245_10020382 | 3300009098 | Bacteria | 5815 |
| 234 | Ga0105245_10405890 | 3300009098 | Bacteria | 1363 |
| 235 | Ga0105247_10034236 | 3300009101 | Bacteria | 3094 |
| 236 | Ga0114129_10007905 | 3300009147 | Bacteria | 15138 |
| 237 | Ga0114129_10041629 | 3300009147 | Bacteria | 6471 |
| 238 | Ga0114129_10145266 | 3300009147 | Bacteria | 3250 |
| 239 | Ga0114129_10159665 | 3300009147 | Bacteria | 3081 |
| 240 | Ga0105243_10280449 | 3300009148 | Bacteria | 1501 |
| 241 | Ga0105241_10104934 | 3300009174 | Bacteria | 2253 |
| 242 | Ga0105242_10012523 | 3300009176 | Bacteria | 6530 |
| 243 | Ga0105242_10040823 | 3300009176 | Bacteria | 3739 |
| 244 | Ga0105242_10113336 | 3300009176 | Bacteria | 2315 |
| 245 | Ga0105242_10117595 | 3300009176 | Bacteria | 2276 |
| 246 | Ga0105242_10246417 | 3300009176 | Bacteria | 1608 |
| 247 | Ga0105248_10004174 | 3300009177 | Bacteria | 15957 |
| 248 | Ga0105248_10006487 | 3300009177 | Bacteria | 12830 |
| 249 | Ga0105248_10244360 | 3300009177 | Bacteria | 2020 |
| 250 | Ga0105237_10026197 | 3300009545 | Bacteria | 5959 |
| 251 | Ga0105238_10025529 | 3300009551 | Bacteria | 6024 |
| 252 | Ga0105238_10065545 | 3300009551 | Bacteria | 3633 |
| 253 | Ga0105238_10110020 | 3300009551 | Bacteria | 2736 |
| 254 | Ga0105030_100378 | 3300009987 | Bacteria | 3911 |
| 255 | Ga0099796_10000037 | 3300010159 | Bacteria | 27751 |
| 256 | Ga0099796_10000544 | 3300010159 | Bacteria | 6440 |
| 257 | Ga0099796_10001887 | 3300010159 | Bacteria | 4430 |
| 258 | Ga0099796_10009673 | 3300010159 | Bacteria | 2618 |
| 259 | Ga0105239_10065240 | 3300010375 | Bacteria | 3998 |
| 260 | Ga0105239_10087150 | 3300010375 | Bacteria | 3441 |
| 261 | Ga0105246_10002978 | 3300011119 | Bacteria | 10265 |
| 262 | Ga0157374_10002345 | 3300013296 | Bacteria | 15995 |
| 263 | Ga0157374_10061827 | 3300013296 | Bacteria | 3508 |
| 264 | Ga0157374_10146878 | 3300013296 | Bacteria | 2290 |
| 265 | Ga0157378_10000053 | 3300013297 | Bacteria | 99982 |
| 266 | Ga0157378_10016842 | 3300013297 | Bacteria | 6407 |
| 267 | Ga0157378_10018148 | 3300013297 | Bacteria | 6178 |
| 268 | Ga0157378_10034424 | 3300013297 | Bacteria | 4480 |
| 269 | Ga0157378_10061658 | 3300013297 | Bacteria | 3348 |
| 270 | Ga0163162_10000132 | 3300013306 | Bacteria | 67582 |
| 271 | Ga0163162_10004643 | 3300013306 | Bacteria | 13243 |
| 272 | Ga0163162_10024479 | 3300013306 | Bacteria | 5959 |
| 273 | Ga0163162_10115331 | 3300013306 | Bacteria | 2786 |
| 274 | Ga0163162_10150941 | 3300013306 | Bacteria | 2441 |
| 275 | Ga0157375_10079627 | 3300013308 | Bacteria | 3312 |
| 276 | Ga0157375_10082715 | 3300013308 | Bacteria | 3253 |
| 277 | Ga0157375_10125414 | 3300013308 | Bacteria | 2682 |
| 278 | Ga0157375_10322092 | 3300013308 | Bacteria | 1710 |
| 279 | Ga0163163_10001120 | 3300014325 | Bacteria | 22784 |
| 280 | Ga0163163_10044763 | 3300014325 | Bacteria | 4343 |
| 281 | Ga0163163_10107073 | 3300014325 | Bacteria | 2822 |
| 282 | Ga0163163_10550097 | 3300014325 | Bacteria | 1217 |
| 283 | Ga0157380_10004148 | 3300014326 | Bacteria | 10015 |
| 284 | Ga0157380_10248435 | 3300014326 | Bacteria | 1609 |
| 285 | Ga0157380_10327845 | 3300014326 | Bacteria | 1422 |
| 286 | Ga0157379_10000026 | 3300014968 | Bacteria | 88552 |
| 287 | Ga0157379_10000295 | 3300014968 | Bacteria | 39515 |
| 288 | Ga0157379_10012640 | 3300014968 | Bacteria | 7376 |
| 289 | Ga0157379_10067368 | 3300014968 | Bacteria | 3200 |
| 290 | Ga0157379_10093250 | 3300014968 | Bacteria | 2701 |
| 291 | Ga0157379_10144182 | 3300014968 | Bacteria | 2147 |
| 292 | Ga0157379_10233123 | 3300014968 | Bacteria | 1669 |
| 293 | Ga0157376_10000036 | 3300014969 | Bacteria | 145496 |
| 294 | Ga0157376_10015665 | 3300014969 | Bacteria | 5734 |
| 295 | Ga0157376_10025804 | 3300014969 | Bacteria | 4633 |
| 296 | Ga0157376_10211166 | 3300014969 | Bacteria | 1792 |
| 297 | Ga0182007_10034995 | 3300015262 | Bacteria | 1694 |
| 298 | Ga0207696_1000119 | 3300025711 | Bacteria | 147213 |
| 299 | Ga0207653_10033169 | 3300025885 | Bacteria | 1674 |
| 300 | Ga0207692_10107137 | 3300025898 | Bacteria | 1544 |
| 301 | Ga0207642_10014267 | 3300025899 | Bacteria | 2927 |
| 302 | Ga0207710_10020281 | 3300025900 | Bacteria | 2841 |
| 303 | Ga0207680_10000001 | 3300025903 | Bacteria | 1091453 |
| 304 | Ga0207680_10111459 | 3300025903 | Bacteria | 1775 |
| 305 | Ga0207680_10173645 | 3300025903 | Bacteria | 1453 |
| 306 | Ga0207685_10004892 | 3300025905 | Bacteria | 3467 |
| 307 | Ga0207685_10008743 | 3300025905 | Bacteria | 2903 |
| 308 | Ga0207699_10000011 | 3300025906 | Bacteria | 282783 |
| 309 | Ga0207699_10001312 | 3300025906 | Bacteria | 11824 |
| 310 | Ga0207699_10002296 | 3300025906 | Bacteria | 9033 |
| 311 | Ga0207699_10031431 | 3300025906 | Bacteria | 2981 |
| 312 | Ga0207699_10094906 | 3300025906 | Bacteria | 1880 |
| 313 | Ga0207699_10111106 | 3300025906 | Bacteria | 1756 |
| 314 | Ga0207699_10120377 | 3300025906 | Bacteria | 1697 |
| 315 | Ga0207705_10001121 | 3300025909 | Bacteria | 21795 |
| 316 | Ga0207705_10046253 | 3300025909 | Bacteria | 3127 |
| 317 | Ga0207705_10063995 | 3300025909 | Bacteria | 2658 |
| 318 | Ga0207684_10061602 | 3300025910 | Unclassified | 3186 |
| 319 | Ga0207684_10073495 | 3300025910 | Bacteria | 2904 |
| 320 | Ga0207684_10083902 | 3300025910 | Bacteria | 2713 |
| 321 | Ga0207707_10003235 | 3300025912 | Bacteria | 14463 |
| 322 | Ga0207707_10212599 | 3300025912 | Bacteria | 1684 |
| 323 | Ga0207695_10001779 | 3300025913 | Bacteria | 34026 |
| 324 | Ga0207695_10085381 | 3300025913 | Bacteria | 3185 |
| 325 | Ga0207671_10296383 | 3300025914 | Bacteria | 1277 |
| 326 | Ga0207693_10000711 | 3300025915 | Bacteria | 29948 |
| 327 | Ga0207693_10007605 | 3300025915 | Bacteria | 8901 |
| 328 | Ga0207693_10012146 | 3300025915 | Bacteria | 6959 |
| 329 | Ga0207693_10033837 | 3300025915 | Bacteria | 4032 |
| 330 | Ga0207663_10235859 | 3300025916 | Bacteria | 1339 |
| 331 | Ga0207660_10065319 | 3300025917 | Bacteria | 2629 |
| 332 | Ga0207660_10306321 | 3300025917 | Bacteria | 1266 |
| 333 | Ga0207662_10046348 | 3300025918 | Bacteria | 2572 |
| 334 | Ga0207649_10094912 | 3300025920 | Bacteria | 1961 |
| 335 | Ga0207652_10171961 | 3300025921 | Bacteria | 1944 |
| 336 | Ga0207652_10335833 | 3300025921 | Bacteria | 1364 |
| 337 | Ga0207646_10001298 | 3300025922 | Bacteria | 31112 |
| 338 | Ga0207646_10040030 | 3300025922 | Bacteria | 4217 |
| 339 | Ga0207646_10042859 | 3300025922 | Unclassified | 4066 |
| 340 | Ga0207646_10103535 | 3300025922 | Bacteria | 2553 |
| 341 | Ga0207681_10000015 | 3300025923 | Bacteria | 352892 |
| 342 | Ga0207694_10000200 | 3300025924 | Bacteria | 59994 |
| 343 | Ga0207694_10052693 | 3300025924 | Bacteria | 3154 |
| 344 | Ga0207694_10054303 | 3300025924 | Bacteria | 3107 |
| 345 | Ga0207650_10191940 | 3300025925 | Bacteria | 1632 |
| 346 | Ga0207650_10232159 | 3300025925 | Bacteria | 1488 |
| 347 | Ga0207659_10020972 | 3300025926 | Bacteria | 4329 |
| 348 | Ga0207659_10098612 | 3300025926 | Bacteria | 2197 |
| 349 | Ga0207659_10165535 | 3300025926 | Bacteria | 1740 |
| 350 | Ga0207700_10009179 | 3300025928 | Bacteria | 6164 |
| 351 | Ga0207700_10032030 | 3300025928 | Bacteria | 3744 |
| 352 | Ga0207700_10127066 | 3300025928 | Bacteria | 2076 |
| 353 | Ga0207700_10218671 | 3300025928 | Bacteria | 1614 |
| 354 | Ga0207700_10322837 | 3300025928 | Bacteria | 1338 |
| 355 | Ga0207664_10012252 | 3300025929 | Bacteria | 6129 |
| 356 | Ga0207644_10145183 | 3300025931 | Bacteria | 1831 |
| 357 | Ga0207706_10000427 | 3300025933 | Bacteria | 45237 |
| 358 | Ga0207706_10116225 | 3300025933 | Bacteria | 2353 |
| 359 | Ga0207686_10170237 | 3300025934 | Bacteria | 1535 |
| 360 | Ga0207670_10015364 | 3300025936 | Bacteria | 4574 |
| 361 | Ga0207704_10008728 | 3300025938 | Bacteria | 4862 |
| 362 | Ga0207704_10160665 | 3300025938 | Bacteria | 1598 |
| 363 | Ga0207665_10004089 | 3300025939 | Bacteria | 9737 |
| 364 | Ga0207665_10020650 | 3300025939 | Bacteria | 4329 |
| 365 | Ga0207665_10067295 | 3300025939 | Unclassified | 2439 |
| 366 | Ga0207665_10107291 | 3300025939 | Bacteria | 1958 |
| 367 | Ga0207691_10000868 | 3300025940 | Bacteria | 30058 |
| 368 | Ga0207711_10011715 | 3300025941 | Bacteria | 7283 |
| 369 | Ga0207711_10031197 | 3300025941 | Bacteria | 4498 |
| 370 | Ga0207711_10141326 | 3300025941 | Bacteria | 2166 |
| 371 | Ga0207711_10168711 | 3300025941 | Bacteria | 1985 |
| 372 | Ga0207689_10169460 | 3300025942 | Bacteria | 1799 |
| 373 | Ga0207661_10036948 | 3300025944 | Bacteria | 3816 |
| 374 | Ga0207667_10019818 | 3300025949 | Bacteria | 7497 |
| 375 | Ga0207667_10316386 | 3300025949 | Bacteria | 1594 |
| 376 | Ga0207651_10007744 | 3300025960 | Bacteria | 5740 |
| 377 | Ga0207668_10029380 | 3300025972 | Bacteria | 3603 |
| 378 | Ga0207668_10146772 | 3300025972 | Bacteria | 1821 |
| 379 | Ga0207640_10035463 | 3300025981 | Bacteria | 3123 |
| 380 | Ga0207658_10043963 | 3300025986 | Bacteria | 3250 |
| 381 | Ga0207658_10050777 | 3300025986 | Bacteria | 3053 |
| 382 | Ga0207658_10118882 | 3300025986 | Bacteria | 2103 |
| 383 | Ga0207658_10129613 | 3300025986 | Bacteria | 2024 |
| 384 | Ga0207677_10073977 | 3300026023 | Bacteria | 2415 |
| 385 | Ga0207677_10110702 | 3300026023 | Bacteria | 2044 |
| 386 | Ga0207677_10142845 | 3300026023 | Bacteria | 1835 |
| 387 | Ga0207677_10319129 | 3300026023 | Bacteria | 1290 |
| 388 | Ga0207703_10000674 | 3300026035 | Bacteria | 34083 |
| 389 | Ga0207703_10033403 | 3300026035 | Bacteria | 4078 |
| 390 | Ga0207703_10114272 | 3300026035 | Bacteria | 2308 |
| 391 | Ga0207703_10168155 | 3300026035 | Bacteria | 1926 |
| 392 | Ga0207703_10196503 | 3300026035 | Bacteria | 1790 |
| 393 | Ga0207708_10053465 | 3300026075 | Bacteria | 3077 |
| 394 | Ga0207702_10022483 | 3300026078 | Bacteria | 5228 |
| 395 | Ga0207702_10076235 | 3300026078 | Bacteria | 2898 |
| 396 | Ga0207702_10082106 | 3300026078 | Bacteria | 2802 |
| 397 | Ga0207702_10189288 | 3300026078 | Bacteria | 1900 |
| 398 | Ga0207641_10003776 | 3300026088 | Bacteria | 13301 |
| 399 | Ga0207641_10044664 | 3300026088 | Bacteria | 3727 |
| 400 | Ga0207648_10000165 | 3300026089 | Bacteria | 68239 |
| 401 | Ga0207648_10055950 | 3300026089 | Bacteria | 3443 |
| 402 | Ga0207648_10103722 | 3300026089 | Bacteria | 2494 |
| 403 | Ga0207676_10015072 | 3300026095 | Bacteria | 5573 |
| 404 | Ga0207676_10063288 | 3300026095 | Bacteria | 2938 |
| 405 | Ga0207675_100001139 | 3300026118 | Bacteria | 26331 |
| 406 | Ga0207675_100004948 | 3300026118 | Bacteria | 12840 |
| 407 | Ga0207675_100020910 | 3300026118 | Bacteria | 6101 |
| 408 | Ga0207675_100267279 | 3300026118 | Bacteria | 1659 |
| 409 | Ga0209967_1007762 | 3300027364 | Bacteria | 1471 |
| 410 | Ga0209179_1000034 | 3300027512 | Bacteria | 31538 |
| 411 | Ga0209179_1002995 | 3300027512 | Bacteria | 2370 |
| 412 | Ga0209982_1005940 | 3300027552 | Bacteria | 1768 |
| 413 | Ga0209970_1005333 | 3300027614 | Bacteria | 2124 |
| 414 | Ga0210002_1004305 | 3300027617 | Bacteria | 2115 |
| 415 | Ga0209588_1000006 | 3300027671 | Bacteria | 184445 |
| 416 | Ga0209588_1001342 | 3300027671 | Bacteria | 6396 |
| 417 | Ga0209588_1005287 | 3300027671 | Bacteria | 3690 |
| 418 | Ga0209588_1031255 | 3300027671 | Bacteria | 1703 |
| 419 | Ga0209971_1000284 | 3300027682 | Bacteria | 14126 |
| 420 | Ga0209966_1005548 | 3300027695 | Bacteria | 2166 |
| 421 | Ga0209974_10009351 | 3300027876 | Bacteria | 3325 |
| 422 | Ga0209974_10064616 | 3300027876 | Bacteria | 1242 |
| 423 | Ga0207428_10006585 | 3300027907 | Bacteria | 10699 |
| 424 | Ga0207428_10016493 | 3300027907 | Bacteria | 6352 |
| 425 | Ga0207428_10047954 | 3300027907 | Bacteria | 3429 |
| 426 | Ga0207428_10160734 | 3300027907 | Bacteria | 1706 |
| 427 | Ga0265354_1003477 | 3300028016 | Bacteria | 1759 |
| 428 | Ga0265355_1003124 | 3300028036 | Bacteria | 1205 |
| 429 | Ga0268266_10000075 | 3300028379 | Bacteria | 218045 |
| 430 | Ga0268266_10001848 | 3300028379 | Bacteria | 23892 |
| 431 | Ga0268266_10002891 | 3300028379 | Bacteria | 17806 |
| 432 | Ga0268266_10010789 | 3300028379 | Bacteria | 7959 |
| 433 | Ga0268266_10077262 | 3300028379 | Bacteria | 2894 |
| 434 | Ga0268266_10216033 | 3300028379 | Bacteria | 1760 |
| 435 | Ga0268265_10000522 | 3300028380 | Bacteria | 39151 |
| 436 | Ga0268265_10016779 | 3300028380 | Bacteria | 5040 |
| 437 | Ga0268265_10033964 | 3300028380 | Bacteria | 3714 |
| 438 | Ga0268265_10122905 | 3300028380 | Bacteria | 2142 |
| 439 | Ga0268265_10162375 | 3300028380 | Bacteria | 1900 |
| 440 | Ga0268264_10008995 | 3300028381 | Bacteria | 8287 |
| 441 | Ga0268264_10042241 | 3300028381 | Bacteria | 3774 |
| 442 | Ga0268264_10180576 | 3300028381 | Bacteria | 1916 |
| 443 | Ga0265326_10003887 | 3300028558 | Bacteria | 4851 |
| 444 | Ga0265319_1018293 | 3300028563 | Bacteria | 2641 |
| 445 | Ga0265334_10000110 | 3300028573 | Bacteria | 54049 |
| 446 | Ga0265318_10000295 | 3300028577 | Bacteria | 40766 |
| 447 | Ga0307515_10003416 | 3300028794 | Bacteria | 33442 |
| 448 | Ga0307515_10312504 | 3300028794 | Bacteria | 1245 |
| 449 | Ga0265338_10016148 | 3300028800 | Bacteria | 8145 |
| 450 | Ga0265338_10032779 | 3300028800 | Bacteria | 5056 |
| 451 | Ga0265338_10177319 | 3300028800 | Bacteria | 1628 |
| 452 | Ga0265770_1000035 | 3300030878 | Bacteria | 13434 |
| 453 | Ga0265760_10008613 | 3300031090 | Bacteria | 2913 |
| 454 | Ga0265330_10013978 | 3300031235 | Bacteria | 3730 |
| 455 | Ga0265332_10001472 | 3300031238 | Bacteria | 13160 |
| 456 | Ga0265328_10000038 | 3300031239 | Bacteria | 91571 |
| 457 | Ga0265328_10000462 | 3300031239 | Bacteria | 18873 |
| 458 | Ga0265328_10003378 | 3300031239 | Bacteria | 7055 |
| 459 | Ga0265328_10011778 | 3300031239 | Bacteria | 3489 |
| 460 | Ga0265325_10009477 | 3300031241 | Bacteria | 5680 |
| 461 | Ga0265329_10006707 | 3300031242 | Bacteria | 4543 |
| 462 | Ga0265340_10037623 | 3300031247 | Bacteria | 2397 |
| 463 | Ga0265339_10033981 | 3300031249 | Bacteria | 2868 |
| 464 | Ga0265331_10000024 | 3300031250 | Bacteria | 235118 |
| 465 | Ga0265331_10001740 | 3300031250 | Bacteria | 15656 |
| 466 | Ga0265331_10004168 | 3300031250 | Bacteria | 9063 |
| 467 | Ga0265327_10000079 | 3300031251 | Bacteria | 206892 |
| 468 | Ga0265327_10000136 | 3300031251 | Bacteria | 160868 |
| 469 | Ga0265327_10016591 | 3300031251 | Bacteria | 4666 |
| 470 | Ga0265316_10032269 | 3300031344 | Bacteria | 4274 |
| 471 | Ga0265316_10152095 | 3300031344 | Bacteria | 1733 |
| 472 | Ga0307513_10112360 | 3300031456 | Bacteria | 2715 |
| 473 | Ga0307509_10104733 | 3300031507 | Bacteria | 2853 |
| 474 | Ga0265313_10011846 | 3300031595 | Bacteria | 5388 |
| 475 | Ga0307508_10026008 | 3300031616 | Bacteria | 5306 |
| 476 | Ga0316575_10000633 | 3300031665 | Bacteria | 10355 |
| 477 | Ga0316579_10003266 | 3300031691 | Bacteria | 6292 |
| 478 | Ga0265314_10027054 | 3300031711 | Bacteria | 4299 |
| 479 | Ga0265342_10002639 | 3300031712 | Bacteria | 15324 |
| 480 | Ga0316576_10055004 | 3300031727 | Bacteria | 2903 |
| 481 | Ga0316576_10083410 | 3300031727 | Bacteria | 2374 |
| 482 | Ga0316576_10112901 | 3300031727 | Bacteria | 2037 |
| 483 | Ga0316578_10017501 | 3300031728 | Bacteria | 3901 |
| 484 | Ga0316578_10047163 | 3300031728 | Bacteria | 2514 |
| 485 | Ga0307516_10061762 | 3300031730 | Bacteria | 3634 |
| 486 | Ga0316577_10015653 | 3300031733 | Bacteria | 4172 |
| 487 | Ga0307413_10023699 | 3300031824 | Bacteria | 3330 |
| 488 | Ga0307413_10037714 | 3300031824 | Bacteria | 2794 |
| 489 | Ga0307410_10178489 | 3300031852 | Bacteria | 1606 |
| 490 | Ga0307407_10063726 | 3300031903 | Bacteria | 2164 |
| 491 | Ga0307412_10018737 | 3300031911 | Bacteria | 4174 |
| 492 | Ga0307409_100015633 | 3300031995 | Bacteria | 4988 |
| 493 | Ga0307409_100376669 | 3300031995 | Bacteria | 1348 |
| 494 | Ga0307416_100003639 | 3300032002 | Bacteria | 9106 |
| 495 | Ga0307415_100004865 | 3300032126 | Bacteria | 7048 |
| 496 | Ga0316583_10001521 | 3300032133 | Bacteria | 7788 |
| 497 | Ga0316583_10014851 | 3300032133 | Bacteria | 2804 |
| 498 | Ga0307510_10016108 | 3300033180 | Bacteria | 8828 |
| 499 | Ga0373929_0000009 | 3300035085 | Bacteria | 202242 |
| 500 | Ga0373952_0002113 | 3300035092 | Bacteria | 3575 |
| 501 | Ga0373954_0003004 | 3300035118 | Bacteria | 7115 |
| 502 | Ga0373956_0042314 | 3300035119 | Bacteria | 2025 |
| 503 | Ga0373956_0046070 | 3300035119 | Bacteria | 1947 |
| 504 | Ga0373956_0058929 | 3300035119 | Bacteria | 1736 |
| 505 | Ga0373956_0064618 | 3300035119 | Bacteria | 1662 |
| 506 | Ga0373943_0110192 | 3300035170 | Bacteria | 1451 |
| 507 | Ga0373946_0041439 | 3300035171 | Bacteria | 1889 |
| 508 | Ga0373955_0001581 | 3300035172 | Bacteria | 9732 |
| 509 | Ga0373955_0014508 | 3300035172 | Bacteria | 3835 |
| 510 | Ga0373955_0041382 | 3300035172 | Bacteria | 2470 |
| 511 | Ga0373961_0001487 | 3300035241 | Bacteria | 6858 |
| 512 | Ga0316574_0004662 | 3300035398 | Bacteria | 7220 |
| 513 | Ga0316574_0004807 | 3300035398 | Bacteria | 7146 |
| 514 | Ga0316574_0179882 | 3300035398 | Bacteria | 1361 |
| 515 | Ga0373924_0020978 | 3300035410 | Bacteria | 2545 |
| 516 | Ga0373931_0015940 | 3300035691 | Bacteria | 3693 |
| 517 | Ga0373931_0145446 | 3300035691 | Bacteria | 1377 |
| 518 | Ga0373933_0000092 | 3300035724 | Bacteria | 56195 |
| 519 | Ga0373937_0002321 | 3300036401 | Bacteria | 15898 |
| 520 | Ga0373937_0101293 | 3300036401 | Bacteria | 2673 |
| 521 | Ga0373937_0344076 | 3300036401 | Bacteria | 1412 |
| 522 | Ga0373937_0362707 | 3300036401 | Bacteria | 1373 |
| 523 | Ga0316582_0003446 | 3300036647 | Bacteria | 7763 |
| 524 | Ga0316582_0007241 | 3300036647 | Bacteria | 5899 |
| 525 | Ga0316582_0030585 | 3300036647 | Bacteria | 3281 |
| 526 | Ga0316582_0037425 | 3300036647 | Bacteria | 3008 |
| 527 | Ga0316584_0011477 | 3300036712 | Bacteria | 6226 |
| 528 | Ga0316584_0014413 | 3300036712 | Bacteria | 5625 |
| 529 | Ga0316584_0015665 | 3300036712 | Bacteria | 5425 |
| 530 | Ga0316584_0021930 | 3300036712 | Bacteria | 4651 |
| 531 | Ga0316584_0024602 | 3300036712 | Bacteria | 4408 |
| 532 | Ga0316584_0052181 | 3300036712 | Bacteria | 3059 |
| 533 | Ga0316584_0103189 | 3300036712 | Bacteria | 2135 |
| 534 | Ga0373925_0075516 | 3300037068 | Bacteria | 2554 |
| 535 | Ga0395900_0002653 | 3300037418 | Bacteria | 19542 |
| 536 | Ga0395900_0156793 | 3300037418 | Bacteria | 2325 |
| 537 | Ga0395900_0164995 | 3300037418 | Unclassified | 2258 |
| 538 | Ga0395900_0261273 | 3300037418 | Bacteria | 1729 |
| 539 | Ga0395898_0017594 | 3300037466 | Bacteria | 7295 |
| 540 | Ga0395905_0003856 | 3300037471 | Bacteria | 15813 |
| 541 | Ga0395905_0038631 | 3300037471 | Bacteria | 4479 |
| 542 | Ga0395905_0054389 | 3300037471 | Bacteria | 3746 |
| 543 | Ga0395905_0081840 | 3300037471 | Bacteria | 3026 |
| 544 | Ga0395905_0187339 | 3300037471 | Bacteria | 1942 |
| 545 | Ga0316581_0004257 | 3300037588 | Bacteria | 3638 |
| 546 | Ga0316581_0020866 | 3300037588 | Bacteria | 1920 |
| 547 | Ga0395901_0071050 | 3300038443 | Bacteria | 3627 |
| 548 | Ga0400490_24818 | 3300038726 | Bacteria | 21658 |
| 549 | Ga0400490_33485 | 3300038726 | Bacteria | 5044 |
| 550 | Ga0400490_43208 | 3300038726 | Bacteria | 40847 |
| 551 | Ga0400488_08624 | 3300038741 | Bacteria | 2237 |
| 552 | Ga0400488_48288 | 3300038741 | Bacteria | 12907 |
| 553 | Ga0400486_01259 | 3300038742 | Bacteria | 2531 |
| 554 | Ga0400486_02595 | 3300038742 | Bacteria | 12059 |
| 555 | Ga0400486_14746 | 3300038742 | Bacteria | 4261 |
| 556 | Ga0400483_160384 | 3300039062 | Bacteria | 7215 |
| 557 | Ga0400483_231710 | 3300039062 | Bacteria | 1844 |
| 558 | Ga0400483_234508 | 3300039062 | Bacteria | 9530 |
| 559 | Ga0400483_265969 | 3300039062 | Bacteria | 4344 |
| 560 | Ga0400483_275498 | 3300039062 | Bacteria | 4322 |
| 561 | Ga0400483_276356 | 3300039062 | Bacteria | 6970 |
| 562 | Ga0400489_07775 | 3300039093 | Bacteria | 14176 |
| 563 | Ga0400489_28828 | 3300039093 | Bacteria | 1705 |
| 564 | Ga0400487_21516 | 3300039110 | Bacteria | 3346 |
| 565 | Ga0436365_0389691 | 3300039437 | Bacteria | 2988 |
| 566 | Ga0436361_0355668 | 3300039447 | Bacteria | 2519 |
| 567 | Ga0436363_1471966 | 3300039450 | Bacteria | 13576 |
| 568 | Ga0451800_0970504 | 3300041459 | Bacteria | 1354 |
| 569 | Ga0450920_000110 | 3300042122 | Bacteria | 10927 |
| 570 | Ga0450920_005305 | 3300042122 | Bacteria | 2286 |
| 571 | Ga0450923_001003 | 3300042125 | Bacteria | 3518 |
| 572 | Ga0450895_001307 | 3300042132 | Bacteria | 1707 |
| 573 | Ga0450896_000066 | 3300042133 | Bacteria | 6782 |
| 574 | Ga0450906_011326 | 3300042145 | Bacteria | 1669 |
| 575 | Ga0439446_0001168 | 3300042156 | Bacteria | 5844 |
| 576 | Ga0450908_000865 | 3300042184 | Bacteria | 5847 |
| 577 | Ga0439435_0000053 | 3300042436 | Bacteria | 13174 |
| 578 | Ga0439444_0001584 | 3300042437 | Bacteria | 2995 |
| 579 | Ga0451577_0000074 | 3300042876 | Bacteria | 232698 |
| 580 | Ga0451577_0000088 | 3300042876 | Bacteria | 206788 |
| 581 | Ga0451577_0000193 | 3300042876 | Bacteria | 128594 |
| 582 | Ga0451577_0000516 | 3300042876 | Bacteria | 64529 |
| 583 | Ga0451577_0002021 | 3300042876 | Bacteria | 25151 |
| 584 | Ga0451577_0003277 | 3300042876 | Bacteria | 18215 |
| 585 | Ga0451577_0006444 | 3300042876 | Bacteria | 11709 |
| 586 | Ga0451577_0009601 | 3300042876 | Bacteria | 9291 |
| 587 | Ga0451577_0010031 | 3300042876 | Bacteria | 9073 |
| 588 | Ga0451577_0010506 | 3300042876 | Bacteria | 8841 |
| 589 | Ga0451577_0019877 | 3300042876 | Bacteria | 6169 |
| 590 | Ga0451577_0032905 | 3300042876 | Bacteria | 4673 |
| 591 | Ga0451577_0033295 | 3300042876 | Bacteria | 4645 |
| 592 | Ga0451577_0067352 | 3300042876 | Bacteria | 3193 |
| 593 | Ga0451577_0075149 | 3300042876 | Bacteria | 3013 |
| 594 | Ga0451577_0096361 | 3300042876 | Bacteria | 2641 |
| 595 | Ga0451577_0237681 | 3300042876 | Bacteria | 1648 |
| 596 | Ga0453683_0000231 | 3300044673 | Bacteria | 74424 |
| 597 | Ga0453683_0000513 | 3300044673 | Bacteria | 43919 |
| 598 | Ga0453683_0002349 | 3300044673 | Bacteria | 14833 |
| 599 | Ga0453683_0008408 | 3300044673 | Bacteria | 6928 |
| 600 | Ga0453683_0009298 | 3300044673 | Bacteria | 6570 |
| 601 | Ga0453683_0118656 | 3300044673 | Bacteria | 1665 |
| 602 | Ga0466965_0009714 | 3300044683 | Bacteria | 4474 |
| 603 | Ga0466966_0018497 | 3300044684 | Bacteria | 4595 |
| 604 | Ga0466966_0093629 | 3300044684 | Bacteria | 1863 |
| 605 | Ga0453684_0000309 | 3300044712 | Bacteria | 207063 |
| 606 | Ga0453684_0000482 | 3300044712 | Bacteria | 158296 |
| 607 | Ga0453684_0001270 | 3300044712 | Bacteria | 75637 |
| 608 | Ga0453684_0001333 | 3300044712 | Bacteria | 72470 |
| 609 | Ga0453684_0001824 | 3300044712 | Bacteria | 55944 |
| 610 | Ga0453684_0002715 | 3300044712 | Bacteria | 41943 |
| 611 | Ga0453684_0003190 | 3300044712 | Bacteria | 37571 |
| 612 | Ga0453684_0005943 | 3300044712 | Bacteria | 23673 |
| 613 | Ga0453684_0006807 | 3300044712 | Bacteria | 21495 |
| 614 | Ga0453684_0014763 | 3300044712 | Bacteria | 12448 |
| 615 | Ga0453684_0018374 | 3300044712 | Bacteria | 10733 |
| 616 | Ga0453684_0027257 | 3300044712 | Bacteria | 8201 |
| 617 | Ga0453684_0035614 | 3300044712 | Bacteria | 6876 |
| 618 | Ga0453684_0046109 | 3300044712 | Bacteria | 5803 |
| 619 | Ga0453684_0123234 | 3300044712 | Bacteria | 3125 |
| 620 | Ga0453684_0155809 | 3300044712 | Bacteria | 2709 |
| 621 | Ga0453684_0169857 | 3300044712 | Bacteria | 2572 |
| 622 | Ga0453684_0253669 | 3300044712 | Bacteria | 2019 |
| 623 | Ga0453684_0373282 | 3300044712 | Bacteria | 1603 |
| 624 | Ga0453684_0424007 | 3300044712 | Bacteria | 1485 |
| 625 | Ga0453684_0514618 | 3300044712 | Bacteria | 1323 |
| 626 | Ga0453684_0584330 | 3300044712 | Bacteria | 1226 |
| 627 | Ga0466959_0020277 | 3300045049 | Bacteria | 4896 |
| 628 | Ga0466959_0139036 | 3300045049 | Bacteria | 1718 |
| 629 | Ga0451576_0000469 | 3300045051 | Bacteria | 91565 |
| 630 | Ga0451576_0000620 | 3300045051 | Bacteria | 74314 |
| 631 | Ga0451576_0006546 | 3300045051 | Bacteria | 14258 |
| 632 | Ga0451576_0011753 | 3300045051 | Bacteria | 9914 |
| 633 | Ga0451576_0014196 | 3300045051 | Bacteria | 8877 |
| 634 | Ga0451576_0108275 | 3300045051 | Bacteria | 2892 |
| 635 | Ga0451576_0143835 | 3300045051 | Bacteria | 2486 |
| 636 | Ga0451576_0228176 | 3300045051 | Bacteria | 1944 |
| 637 | Ga0451576_0255411 | 3300045051 | Bacteria | 1832 |
| 638 | Ga0466967_0182380 | 3300045976 | Bacteria | 1981 |
| 639 | Ga0495603_0060758 | 3300046455 | Bacteria | 2232 |
| 640 | Ga0495629_0064534 | 3300046459 | Bacteria | 2557 |
| 641 | Ga0495651_0151232 | 3300046462 | Bacteria | 1673 |
| 642 | Ga0495653_0064117 | 3300046463 | Bacteria | 2769 |
| 643 | Ga0495650_0000338 | 3300046471 | Bacteria | 83352 |
| 644 | Ga0495580_0009190 | 3300046472 | Bacteria | 7790 |
| 645 | Ga0495580_0017932 | 3300046472 | Bacteria | 5280 |
| 646 | Ga0495580_0042555 | 3300046472 | Bacteria | 3236 |
| 647 | Ga0495580_0138108 | 3300046472 | Bacteria | 1690 |
| 648 | Ga0495582_0000161 | 3300046473 | Bacteria | 36312 |
| 649 | Ga0495664_0056199 | 3300046477 | Bacteria | 2341 |
| 650 | Ga0495664_0057387 | 3300046477 | Bacteria | 2316 |
| 651 | Ga0495594_0057509 | 3300046499 | Bacteria | 2147 |
| 652 | Ga0495608_0019119 | 3300046511 | Bacteria | 4721 |
| 653 | Ga0495618_0074668 | 3300046514 | Bacteria | 2159 |
| 654 | Ga0495628_0071998 | 3300046516 | Bacteria | 2694 |
| 655 | Ga0495628_0277021 | 3300046516 | Bacteria | 1247 |
| 656 | Ga0495630_0294640 | 3300046517 | Bacteria | 1240 |
| 657 | Ga0495644_0016363 | 3300046523 | Bacteria | 2838 |
| 658 | Ga0495666_0033463 | 3300046526 | Bacteria | 2511 |
| 659 | Ga0495665_0039971 | 3300046531 | Bacteria | 2498 |
| 660 | Ga0495665_0063345 | 3300046531 | Bacteria | 1952 |
| 661 | Ga0495665_0109156 | 3300046531 | Bacteria | 1452 |
| 662 | Ga0495586_0025836 | 3300046535 | Bacteria | 3142 |
| 663 | Ga0495587_0007281 | 3300046536 | Bacteria | 7174 |
| 664 | Ga0495621_0005295 | 3300046539 | Bacteria | 3696 |
| 665 | Ga0495667_0111924 | 3300046559 | Bacteria | 1764 |
| 666 | Ga0495625_0057686 | 3300046660 | Bacteria | 2760 |
| 667 | Ga0495635_0256187 | 3300046663 | Bacteria | 1179 |
| 668 | Ga0495659_0000273 | 3300046664 | Bacteria | 21064 |
| 669 | Ga0495588_0015942 | 3300046674 | Bacteria | 3625 |
| 670 | Ga0495658_0002115 | 3300046683 | Bacteria | 10064 |
| 671 | Ga0495658_0009606 | 3300046683 | Bacteria | 4823 |
| 672 | Ga0495658_0012305 | 3300046683 | Bacteria | 4328 |
| 673 | Ga0495613_0014054 | 3300046689 | Bacteria | 5940 |
| 674 | Ga0495624_0050184 | 3300046690 | Bacteria | 2644 |
| 675 | Ga0495670_0065380 | 3300046691 | Bacteria | 1833 |
| 676 | Ga0495581_0014552 | 3300047315 | Bacteria | 4562 |
| 677 | Ga0495581_0059115 | 3300047315 | Bacteria | 2215 |
| 678 | Ga0495604_0000536 | 3300047317 | Bacteria | 33451 |
| 679 | Ga0495674_0034504 | 3300047319 | Bacteria | 4575 |
| 680 | Ga0495674_0048265 | 3300047319 | Bacteria | 3768 |
| 681 | Ga0495674_0078309 | 3300047319 | Bacteria | 2840 |
| 682 | Ga0495676_0016069 | 3300047321 | Bacteria | 6649 |
| 683 | Ga0495680_0108332 | 3300047322 | Bacteria | 2062 |
| 684 | Ga0496100_0052912 | 3300048903 | Bacteria | 2642 |
| 685 | Ga0496100_0149182 | 3300048903 | Bacteria | 1665 |
| 686 | Ga0496100_0168084 | 3300048903 | Bacteria | 1577 |
| 687 | Ga0496101_0046317 | 3300048904 | Bacteria | 3118 |
| 688 | Ga0496101_0243125 | 3300048904 | Bacteria | 1401 |
| 689 | Ga0496102_0003185 | 3300048905 | Bacteria | 13912 |
| 690 | Ga0496102_0032263 | 3300048905 | Bacteria | 4705 |
| 691 | Ga0496102_0080326 | 3300048905 | Bacteria | 3004 |
| 692 | Ga0496102_0251058 | 3300048905 | Bacteria | 1668 |
| 693 | Ga0496103_0079556 | 3300048906 | Bacteria | 2060 |
| 694 | Ga0496104_0020825 | 3300048907 | Bacteria | 6013 |
| 695 | Ga0496104_0038861 | 3300048907 | Bacteria | 4454 |
| 696 | Ga0496104_0046684 | 3300048907 | Bacteria | 4080 |
| 697 | Ga0496104_0077839 | 3300048907 | Bacteria | 3160 |
| 698 | Ga0496105_0015164 | 3300048908 | Bacteria | 6134 |
| 699 | Ga0496105_0021234 | 3300048908 | Bacteria | 5253 |
| 700 | Ga0496105_0045780 | 3300048908 | Bacteria | 3610 |
| 701 | Ga0496105_0097234 | 3300048908 | Bacteria | 2432 |
| 702 | Ga0496106_0002250 | 3300048909 | Bacteria | 14387 |
| 703 | Ga0496106_0197863 | 3300048909 | Bacteria | 1599 |
| 704 | Ga0496107_0043611 | 3300048910 | Bacteria | 3223 |
| 705 | Ga0496107_0164940 | 3300048910 | Bacteria | 1642 |
| 706 | Ga0496108_0047168 | 3300048911 | Bacteria | 3601 |
| 707 | Ga0496108_0053892 | 3300048911 | Bacteria | 3374 |
| 708 | Ga0496108_0111775 | 3300048911 | Bacteria | 2337 |
| 709 | Ga0496108_0117005 | 3300048911 | Bacteria | 2284 |
| 710 | Ga0496109_0018403 | 3300048912 | Bacteria | 6138 |
| 711 | Ga0496109_0059938 | 3300048912 | Bacteria | 3477 |
| 712 | Ga0496110_0041724 | 3300048913 | Bacteria | 4004 |
| 713 | Ga0496111_0032056 | 3300048914 | Bacteria | 3746 |
| 714 | Ga0496111_0045861 | 3300048914 | Bacteria | 3146 |
| 715 | Ga0496112_0041978 | 3300048915 | Bacteria | 4475 |
| 716 | Ga0496112_0191492 | 3300048915 | Bacteria | 2007 |
| 717 | Ga0496113_0114544 | 3300048916 | Bacteria | 2102 |
| 718 | Ga0496114_0000031 | 3300048917 | Bacteria | 168230 |
| 719 | Ga0496114_0000525 | 3300048917 | Bacteria | 28205 |
| 720 | Ga0496114_0006736 | 3300048917 | Bacteria | 9050 |
| 721 | Ga0496114_0016484 | 3300048917 | Bacteria | 5955 |
| 722 | Ga0496114_0028330 | 3300048917 | Bacteria | 4595 |
| 723 | Ga0496114_0036753 | 3300048917 | Bacteria | 4049 |
| 724 | Ga0496114_0103393 | 3300048917 | Bacteria | 2435 |
| 725 | Ga0496114_0474424 | 3300048917 | Bacteria | 1107 |
| 726 | Ga0496115_0001445 | 3300048918 | Bacteria | 17029 |
| 727 | Ga0496115_0006113 | 3300048918 | Bacteria | 8799 |
| 728 | Ga0496115_0044199 | 3300048918 | Bacteria | 3553 |
| 729 | Ga0496115_0085986 | 3300048918 | Bacteria | 2565 |
| 730 | Ga0496115_0300426 | 3300048918 | Bacteria | 1315 |
| 731 | Ga0496116_0000005 | 3300048919 | Bacteria | 827804 |
| 732 | Ga0496116_0048313 | 3300048919 | Bacteria | 2857 |
| 733 | Ga0496118_0037737 | 3300048921 | Bacteria | 3884 |
| 734 | Ga0496120_0000543 | 3300048923 | Bacteria | 57596 |
| 735 | Ga0496121_0000029 | 3300048924 | Bacteria | 430303 |
| 736 | Ga0496126_0046366 | 3300048929 | Bacteria | 3987 |
| 737 | Ga0496126_0128815 | 3300048929 | Bacteria | 2189 |
| 738 | Ga0501299_002008 | 3300049522 | Bacteria | 2759 |
| 739 | Ga0501031_0024709 | 3300049568 | Bacteria | 3917 |
| 740 | Ga0501031_0054975 | 3300049568 | Bacteria | 2594 |
| 741 | Ga0501032_0001200 | 3300049569 | Bacteria | 20717 |
| 742 | Ga0501032_0019635 | 3300049569 | Bacteria | 4724 |
| 743 | Ga0501033_0000188 | 3300049570 | Bacteria | 59295 |
| 744 | Ga0501033_0039594 | 3300049570 | Bacteria | 3521 |
| 745 | Ga0501033_0115240 | 3300049570 | Bacteria | 1953 |
| 746 | Ga0501033_0216832 | 3300049570 | Bacteria | 1363 |
| 747 | Ga0501034_0097857 | 3300049571 | Bacteria | 2930 |
| 748 | Ga0501034_0302030 | 3300049571 | Bacteria | 1537 |
| 749 | Ga0501034_0391472 | 3300049571 | Bacteria | 1314 |
| 750 | Ga0501036_0000718 | 3300049572 | Bacteria | 24523 |
| 751 | Ga0501036_0000902 | 3300049572 | Bacteria | 22239 |
| 752 | Ga0501036_0010990 | 3300049572 | Bacteria | 7485 |
| 753 | Ga0501036_0023156 | 3300049572 | Bacteria | 5229 |
| 754 | Ga0501036_0042245 | 3300049572 | Bacteria | 3861 |
| 755 | Ga0501036_0066366 | 3300049572 | Bacteria | 3053 |
| 756 | Ga0501037_0042101 | 3300049573 | Bacteria | 3357 |
| 757 | Ga0501038_0001200 | 3300049574 | Bacteria | 23496 |
| 758 | Ga0501038_0003652 | 3300049574 | Bacteria | 14338 |
| 759 | Ga0501038_0003791 | 3300049574 | Bacteria | 14066 |
| 760 | Ga0501038_0010501 | 3300049574 | Bacteria | 8469 |
| 761 | Ga0501038_0135922 | 3300049574 | Bacteria | 2014 |
| 762 | Ga0501038_0182637 | 3300049574 | Bacteria | 1692 |
| 763 | Ga0501038_0276645 | 3300049574 | Bacteria | 1322 |
| 764 | Ga0501039_0000129 | 3300049575 | Bacteria | 52452 |
| 765 | Ga0501039_0005104 | 3300049575 | Bacteria | 9947 |
| 766 | Ga0501039_0112887 | 3300049575 | Bacteria | 2125 |
| 767 | Ga0501040_0003393 | 3300049576 | Bacteria | 10276 |
| 768 | Ga0501040_0006313 | 3300049576 | Bacteria | 7694 |
| 769 | Ga0501040_0061933 | 3300049576 | Bacteria | 2574 |
| 770 | Ga0501040_0064519 | 3300049576 | Bacteria | 2521 |
| 771 | Ga0501041_0002162 | 3300049577 | Bacteria | 11097 |
| 772 | Ga0501041_0003644 | 3300049577 | Bacteria | 8861 |
| 773 | Ga0501041_0073865 | 3300049577 | Bacteria | 2095 |
| 774 | Ga0501041_0115207 | 3300049577 | Bacteria | 1669 |
| 775 | Ga0501041_0143508 | 3300049577 | Bacteria | 1489 |
| 776 | Ga0501042_0000149 | 3300049578 | Bacteria | 31256 |
| 777 | Ga0501042_0005175 | 3300049578 | Bacteria | 8383 |
| 778 | Ga0501042_0018209 | 3300049578 | Bacteria | 4860 |
| 779 | Ga0501043_0002354 | 3300049579 | Bacteria | 16022 |
| 780 | Ga0501043_0095087 | 3300049579 | Bacteria | 2342 |
| 781 | Ga0501046_0009656 | 3300049580 | Bacteria | 8320 |
| 782 | Ga0501046_0046060 | 3300049580 | Bacteria | 3462 |
| 783 | Ga0501048_0024354 | 3300049582 | Bacteria | 4419 |
| 784 | Ga0501048_0037853 | 3300049582 | Bacteria | 3464 |
| 785 | Ga0501048_0052813 | 3300049582 | Bacteria | 2892 |
| 786 | Ga0501067_0006534 | 3300049583 | Bacteria | 6463 |
| 787 | Ga0501068_0017871 | 3300049584 | Bacteria | 4105 |
| 788 | Ga0501068_0021037 | 3300049584 | Bacteria | 3807 |
| 789 | Ga0501068_0098364 | 3300049584 | Bacteria | 1811 |
| 790 | Ga0501068_0153522 | 3300049584 | Bacteria | 1448 |
| 791 | Ga0501070_0144892 | 3300049586 | Bacteria | 1961 |
| 792 | Ga0501071_0000172 | 3300049587 | Bacteria | 28277 |
| 793 | Ga0501071_0003494 | 3300049587 | Bacteria | 9822 |
| 794 | Ga0501071_0004103 | 3300049587 | Bacteria | 9209 |
| 795 | Ga0501071_0101271 | 3300049587 | Bacteria | 2124 |
| 796 | Ga0501071_0306798 | 3300049587 | Bacteria | 1204 |
| 797 | Ga0501072_0006100 | 3300049588 | Bacteria | 9193 |
| 798 | Ga0501072_0031664 | 3300049588 | Bacteria | 4142 |
| 799 | Ga0501072_0036857 | 3300049588 | Bacteria | 3835 |
| 800 | Ga0501073_0002463 | 3300049589 | Bacteria | 13830 |
| 801 | Ga0501073_0023010 | 3300049589 | Bacteria | 4481 |
| 802 | Ga0501074_0018601 | 3300049590 | Bacteria | 5047 |
| 803 | Ga0501074_0111518 | 3300049590 | Bacteria | 1957 |
| 804 | Ga0501075_0001132 | 3300049591 | Bacteria | 17193 |
| 805 | Ga0501075_0003540 | 3300049591 | Bacteria | 10449 |
| 806 | Ga0501075_0188170 | 3300049591 | Bacteria | 1574 |
| 807 | Ga0501076_0007381 | 3300049592 | Bacteria | 8000 |
| 808 | Ga0501076_0012915 | 3300049592 | Bacteria | 6251 |
| 809 | Ga0501076_0027242 | 3300049592 | Bacteria | 4432 |
| 810 | Ga0501076_0265233 | 3300049592 | Bacteria | 1406 |
| 811 | Ga0501077_0002116 | 3300049593 | Bacteria | 11982 |
| 812 | Ga0501077_0028830 | 3300049593 | Bacteria | 3528 |
| 813 | Ga0501079_0001630 | 3300049741 | Bacteria | 15977 |
| 814 | Ga0501079_0008901 | 3300049741 | Bacteria | 7601 |
| 815 | Ga0501079_0020939 | 3300049741 | Bacteria | 4998 |
| 816 | Ga0501079_0083687 | 3300049741 | Bacteria | 2468 |
| 817 | Ga0501079_0105499 | 3300049741 | Bacteria | 2187 |
| 818 | Ga0501079_0145180 | 3300049741 | Bacteria | 1849 |
| 819 | Ga0501080_0004833 | 3300049742 | Bacteria | 12017 |
| 820 | Ga0501080_0056162 | 3300049742 | Bacteria | 3667 |
| 821 | Ga0501080_0063425 | 3300049742 | Bacteria | 3439 |
| 822 | Ga0501080_0248776 | 3300049742 | Bacteria | 1621 |
| 823 | Ga0501080_0303596 | 3300049742 | Bacteria | 1447 |
| 824 | Ga0501081_0000276 | 3300049743 | Bacteria | 27057 |
| 825 | Ga0501081_0011019 | 3300049743 | Bacteria | 5911 |
| 826 | Ga0501081_0066545 | 3300049743 | Bacteria | 2506 |
| 827 | Ga0501081_0079929 | 3300049743 | Bacteria | 2287 |
| 828 | Ga0501081_0098678 | 3300049743 | Bacteria | 2063 |
| 829 | Ga0501083_0035435 | 3300049744 | Bacteria | 3409 |
| 830 | Ga0501035_0001470 | 3300049822 | Bacteria | 24148 |
| 831 | Ga0501035_0006995 | 3300049822 | Bacteria | 10536 |
| 832 | Ga0501035_0022885 | 3300049822 | Bacteria | 5739 |
| 833 | Ga0501035_0066164 | 3300049822 | Bacteria | 3208 |
| 834 | Ga0501035_0117281 | 3300049822 | Bacteria | 2329 |
| 835 | Ga0501035_0160800 | 3300049822 | Bacteria | 1944 |
| 836 | Ga0501044_0000700 | 3300049823 | Bacteria | 40445 |
| 837 | Ga0501044_0028450 | 3300049823 | Bacteria | 5899 |
| 838 | Ga0501044_0033347 | 3300049823 | Bacteria | 5413 |
| 839 | Ga0501044_0466788 | 3300049823 | Bacteria | 1167 |
| 840 | Ga0501045_0006043 | 3300049824 | Bacteria | 8385 |
| 841 | Ga0501045_0030711 | 3300049824 | Bacteria | 3889 |
| 842 | Ga0501045_0078367 | 3300049824 | Bacteria | 2436 |
| 843 | Ga0501045_0108875 | 3300049824 | Bacteria | 2054 |
| 844 | nmdc:mga05p37_256285_c1 | 3300050507 | Bacteria | 2096 |
| 845 | nmdc:mga05p37_41777_c1 | 3300050507 | Bacteria | 5631 |
| 846 | nmdc:mga09592_16932_c1 | 3300050508 | Bacteria | 5965 |
| 847 | nmdc:mga09592_244208_c1 | 3300050508 | Bacteria | 1556 |
| 848 | nmdc:mga09592_459294_c1 | 3300050508 | Bacteria | 1098 |
| 849 | nmdc:mga0qj67_122349_c1 | 3300050509 | Bacteria | 2105 |
| 850 | nmdc:mga0qj67_193141_c1 | 3300050509 | Bacteria | 1654 |
| 851 | nmdc:mga06r32_14214_c1 | 3300050510 | Bacteria | 7219 |
| 852 | nmdc:mga06r32_202114_c1 | 3300050510 | Bacteria | 1975 |
| 853 | nmdc:mga06r32_46244_c1 | 3300050510 | Bacteria | 4153 |
| 854 | nmdc:mga08y16_131428_c1 | 3300050511 | Bacteria | 2603 |
| 855 | nmdc:mga08y16_3416_c1 | 3300050511 | Bacteria | 16476 |
| 856 | nmdc:mga08y16_73378_c1 | 3300050511 | Bacteria | 3566 |
| 857 | nmdc:mga0n895_107268_c1 | 3300050512 | Bacteria | 2807 |
| 858 | nmdc:mga0n895_172046_c1 | 3300050512 | Bacteria | 2198 |
| 859 | nmdc:mga0n895_219299_c1 | 3300050512 | Bacteria | 1931 |
| 860 | nmdc:mga0n895_23293_c1 | 3300050512 | Bacteria | 5817 |
| 861 | nmdc:mga0n895_285284_c1 | 3300050512 | Bacteria | 1674 |
| 862 | nmdc:mga0n895_301_c1 | 3300050512 | Bacteria | 32672 |
| 863 | nmdc:mga0n895_8070_c1 | 3300050512 | Bacteria | 9089 |
| 864 | nmdc:mga0n895_9406_c1 | 3300050512 | Bacteria | 8549 |
| 865 | nmdc:mga0rr50_25639_c1 | 3300050513 | Bacteria | 4101 |
| 866 | nmdc:mga0rr50_28804_c1 | 3300050513 | Bacteria | 3908 |
| 867 | nmdc:mga0rr50_5827_c1 | 3300050513 | Bacteria | 7404 |
| 868 | nmdc:mga0rr50_6410_c1 | 3300050513 | Bacteria | 4966 |
| 869 | nmdc:mga08x19_1345_c1 | 3300050514 | Bacteria | 15261 |
| 870 | nmdc:mga08x19_1890_c1 | 3300050514 | Bacteria | 12822 |
| 871 | nmdc:mga08x19_3396_c1 | 3300050514 | Bacteria | 9497 |
| 872 | nmdc:mga08x19_38204_c1 | 3300050514 | Bacteria | 3049 |
| 873 | nmdc:mga08x19_43084_c1 | 3300050514 | Bacteria | 2879 |
| 874 | nmdc:mga08x19_67576_c1 | 3300050514 | Bacteria | 2325 |
| 875 | nmdc:mga08x19_87373_c1 | 3300050514 | Bacteria | 2054 |
| 876 | nmdc:mga0a205_128182_c1 | 3300050515 | Bacteria | 2437 |
| 877 | nmdc:mga0a205_180_c1 | 3300050515 | Bacteria | 42950 |
| 878 | nmdc:mga0a205_4503_c2 | 3300050515 | Bacteria | 12073 |
| 879 | nmdc:mga0a205_56634_c1 | 3300050515 | Bacteria | 3785 |
| 880 | Ga0500643_001494 | 3300053087 | Bacteria | 13401 |
| 881 | Ga0500555_038946 | 3300053103 | Bacteria | 1328 |
| 882 | Ga0500568_0012728 | 3300053139 | Bacteria | 3858 |
| 883 | Ga0500622_0000011 | 3300053156 | Bacteria | 386096 |
| 884 | Ga0500637_0001349 | 3300053178 | Bacteria | 10389 |
| 885 | Ga0500611_003137 | 3300053727 | Bacteria | 2080 |
| 886 | Ga0501084_0043016 | 3300054114 | Bacteria | 3778 |
| 887 | Ga0501082_0002842 | 3300060353 | Bacteria | 15084 |
| 888 | Ga0501082_0013727 | 3300060353 | Bacteria | 6963 |
| 889 | Ga0501082_0239331 | 3300060353 | Bacteria | 1579 |
| 890 | Ga0501082_0386152 | 3300060353 | Bacteria | 1222 |
| 891 | Ga0530510_0004375 | 3300061734 | Bacteria | 9774 |
| 892 | Ga0530510_0007524 | 3300061734 | Bacteria | 7586 |
| 893 | Ga0530510_0010667 | 3300061734 | Bacteria | 6445 |
| 894 | Ga0530510_0118386 | 3300061734 | Bacteria | 1943 |
| 895 | Ga0530510_0261697 | 3300061734 | Bacteria | 1290 |
| 896 | 2952254800 | 2952252522 | Bacteria | 4171745 |
| 897 | 8002747459 | 8002745576 | Bacteria | 4840272 |
| 898 | Ga0209983_1003504 | |||
| 899 | SwRhRL2b_contig_2759267 | |||
| 900 | Ga0065704_10076288 | |||
| 901 | Ga0065707_10015964 | |||
| 902 | Ga0065707_10083843 | |||
| 903 | Ga0065707_10095867 | |||
| 904 | Ga0065707_10176552 | |||
| 905 | Ga0070658_10006615 | |||
| 906 | Ga0070658_10075762 | |||
| 907 | Ga0070676_10003423 | |||
| 908 | Ga0070676_10117600 | |||
| 909 | Ga0070683_100143004 | |||
| 910 | Ga0070690_100010979 | |||
| 911 | Ga0070690_100024229 | |||
| 912 | Ga0070670_100006897 | |||
| 913 | Ga0070670_100068129 | |||
| 914 | Ga0070670_100266576 | |||
| 915 | Ga0068869_100066984 | |||
| 916 | Ga0068869_100143151 | |||
| 917 | Ga0070666_10000022 | |||
| 918 | Ga0070666_10004216 | |||
| 919 | Ga0070666_10004495 | |||
| 920 | Ga0070666_10030981 | |||
| 921 | Ga0070680_100018973 | |||
| 922 | Ga0070682_100031123 | |||
| 923 | Ga0068868_100000335 | |||
| 924 | Ga0068868_100071254 | |||
| 925 | Ga0070689_100004899 | |||
| 926 | Ga0070689_100158597 | |||
| 927 | Ga0070689_100273157 | |||
| 928 | Ga0070687_100056482 | |||
| 929 | Ga0070661_100011484 | |||
| 930 | Ga0070661_100073164 | |||
| 931 | Ga0070692_10182023 | |||
| 932 | Ga0070668_100003462 | |||
| 933 | Ga0070669_100000063 | |||
| 934 | Ga0070669_100214548 | |||
| 935 | Ga0070675_100173620 | |||
| 936 | Ga0070671_100020407 | |||
| 937 | Ga0070671_100089062 | |||
| 938 | Ga0070671_100090939 | |||
| 939 | Ga0070671_100272909 | |||
| 940 | Ga0070674_100180841 | |||
| 941 | Ga0070673_100024963 | |||
| 942 | Ga0070688_100011955 | |||
| 943 | Ga0070688_100122183 | |||
| 944 | Ga0070659_100008033 | |||
| 945 | Ga0070659_100033710 | |||
| 946 | Ga0070667_100051440 | |||
| 947 | Ga0070667_100062662 | |||
| 948 | Ga0070667_100068877 | |||
| 949 | Ga0070709_10000015 | |||
| 950 | Ga0070709_10003270 | |||
| 951 | Ga0070709_10010003 | |||
| 952 | Ga0070709_10024673 | |||
| 953 | Ga0070709_10031262 | |||
| 954 | Ga0070709_10212313 | |||
| 955 | Ga0070714_100011662 | |||
| 956 | Ga0070714_100083547 | |||
| 957 | Ga0070714_100207713 | |||
| 958 | Ga0070713_100003974 | |||
| 959 | Ga0070713_100013627 | |||
| 960 | Ga0070713_100014591 | |||
| 961 | Ga0070713_100267719 | |||
| 962 | Ga0070710_10005226 | |||
| 963 | Ga0070710_10134441 | |||
| 964 | Ga0070701_10076302 | |||
| 965 | Ga0070711_100007093 | |||
| 966 | Ga0070711_100037985 | |||
| 967 | Ga0070705_100002609 | |||
| 968 | Ga0070705_100041258 | |||
| 969 | Ga0070694_100075066 | |||
| 970 | Ga0070694_100085740 | |||
| 971 | Ga0070708_100011568 | |||
| 972 | Ga0070708_100018282 | |||
| 973 | Ga0070708_100117542 | |||
| 974 | Ga0070662_100157134 | |||
| 975 | Ga0070681_10009911 | |||
| 976 | Ga0070681_10288130 | |||
| 977 | Ga0070685_10025653 | |||
| 978 | Ga0070685_10025909 | |||
| 979 | Ga0070706_100027150 | |||
| 980 | Ga0070706_100060215 | |||
| 981 | Ga0070707_100105979 | |||
| 982 | Ga0070707_100162186 | |||
| 983 | Ga0070698_100012524 | |||
| 984 | Ga0070698_100051691 | |||
| 985 | Ga0070698_100120432 | |||
| 986 | Ga0070699_100001328 | |||
| 987 | Ga0070699_100004474 | |||
| 988 | Ga0070699_100030505 | |||
| 989 | Ga0070699_100035202 | |||
| 990 | Ga0070699_100062476 | |||
| 991 | Ga0070679_100007861 | |||
| 992 | Ga0070679_100157154 | |||
| 993 | Ga0070684_100427742 | |||
| 994 | Ga0070697_100012849 | |||
| 995 | Ga0070697_100020243 | |||
| 996 | Ga0070697_100073823 | |||
| 997 | Ga0070697_100140744 | |||
| 998 | Ga0070672_100028443 | |||
| 999 | Ga0070686_100045056 | |||
| 1000 | Ga0070695_100009232 | |||
| 1001 | Ga0070695_100016777 | |||
| 1002 | Ga0070695_100093510 | |||
| 1003 | Ga0070695_100279046 | |||
| 1004 | Ga0070696_100000697 | |||
| 1005 | Ga0070696_100005456 | |||
| 1006 | Ga0070696_100010314 | |||
| 1007 | Ga0070696_100301398 | |||
| 1008 | Ga0070693_100033408 | |||
| 1009 | Ga0070665_100002111 | |||
| 1010 | Ga0070665_100026421 | |||
| 1011 | Ga0070665_100029916 | |||
| 1012 | Ga0070665_100048673 | |||
| 1013 | Ga0070665_100096729 | |||
| 1014 | Ga0070665_100200883 | |||
| 1015 | Ga0070704_100010806 | |||
| 1016 | Ga0070704_100011465 | |||
| 1017 | Ga0068855_100001414 | |||
| 1018 | Ga0068855_100280852 | |||
| 1019 | Ga0070664_100002644 | |||
| 1020 | Ga0070664_100062046 | |||
| 1021 | Ga0068857_100141756 | |||
| 1022 | Ga0068856_100015431 | |||
| 1023 | Ga0068856_100199521 | |||
| 1024 | Ga0068856_100247823 | |||
| 1025 | Ga0068856_100284360 | |||
| 1026 | Ga0068859_100000517 | |||
| 1027 | Ga0068859_100001180 | |||
| 1028 | Ga0068859_100089188 | |||
| 1029 | Ga0068859_100369918 | |||
| 1030 | Ga0068864_100006506 | |||
| 1031 | Ga0068864_100233220 | |||
| 1032 | Ga0068866_10094860 | |||
| 1033 | Ga0068861_100013358 | |||
| 1034 | Ga0068861_100214914 | |||
| 1035 | Ga0068851_10095732 | |||
| 1036 | Ga0068863_100003133 | |||
| 1037 | Ga0068863_100006503 | |||
| 1038 | Ga0068858_100002263 | |||
| 1039 | Ga0068858_100003221 | |||
| 1040 | Ga0068858_100024505 | |||
| 1041 | Ga0068858_100223733 | |||
| 1042 | Ga0068858_100232624 | |||
| 1043 | Ga0068860_100002206 | |||
| 1044 | Ga0068860_100004354 | |||
| 1045 | Ga0068860_100105422 | |||
| 1046 | Ga0068860_100120611 | |||
| 1047 | Ga0068860_100134392 | |||
| 1048 | Ga0068862_100001650 | |||
| 1049 | Ga0068862_100011119 | |||
| 1050 | Ga0068862_100011686 | |||
| 1051 | Ga0068862_100027639 | |||
| 1052 | Ga0070717_10003728 | |||
| 1053 | Ga0075364_10183859 | |||
| 1054 | Ga0070715_10002837 | |||
| 1055 | Ga0070715_10009053 | |||
| 1056 | Ga0070716_100009434 | |||
| 1057 | Ga0070716_100009456 | |||
| 1058 | Ga0070716_100013212 | |||
| 1059 | Ga0070716_100059008 | |||
| 1060 | Ga0070716_100194583 | |||
| 1061 | Ga0070712_100007789 | |||
| 1062 | Ga0070712_100017652 | |||
| 1063 | Ga0070712_100020177 | |||
| 1064 | Ga0097621_100031912 | |||
| 1065 | Ga0097621_100040376 | |||
| 1066 | Ga0097621_100156963 | |||
| 1067 | Ga0068871_100024519 | |||
| 1068 | Ga0068871_100032869 | |||
| 1069 | Ga0068871_100059994 | |||
| 1070 | Ga0068871_100175812 | |||
| 1071 | Ga0075428_100012989 | |||
| 1072 | Ga0075428_100017441 | |||
| 1073 | Ga0075428_100055753 | |||
| 1074 | Ga0075428_100127043 | |||
| 1075 | Ga0075430_100050431 | |||
| 1076 | Ga0075430_100073742 | |||
| 1077 | Ga0075430_100214288 | |||
| 1078 | Ga0075431_100006814 | |||
| 1079 | Ga0075431_100053189 | |||
| 1080 | Ga0075431_100114036 | |||
| 1081 | Ga0075433_10002210 | |||
| 1082 | Ga0075433_10004587 | |||
| 1083 | Ga0075433_10015686 | |||
| 1084 | Ga0075433_10016652 | |||
| 1085 | Ga0075433_10017234 | |||
| 1086 | Ga0075433_10036290 | |||
| 1087 | Ga0075433_10354455 | |||
| 1088 | Ga0075434_100001437 | |||
| 1089 | Ga0075434_100029611 | |||
| 1090 | Ga0075434_100032679 | |||
| 1091 | Ga0075434_100087605 | |||
| 1092 | Ga0075434_100157955 | |||
| 1093 | Ga0075434_100210126 | |||
| 1094 | Ga0075434_100269799 | |||
| 1095 | Ga0075429_100040887 | |||
| 1096 | Ga0068865_100005883 | |||
| 1097 | Ga0075436_100000310 | |||
| 1098 | Ga0075436_100005105 | |||
| 1099 | Ga0075436_100011982 | |||
| 1100 | Ga0075436_100174032 | |||
| 1101 | Ga0075436_100243998 | |||
| 1102 | Ga0097620_100000517 | |||
| 1103 | Ga0097620_100001180 | |||
| 1104 | Ga0097620_100089192 | |||
| 1105 | Ga0097620_100369954 | |||
| 1106 | Ga0075435_100000015 | |||
| 1107 | Ga0075435_100033715 | |||
| 1108 | Ga0075435_100034863 | |||
| 1109 | Ga0099794_10000005 | |||
| 1110 | Ga0099794_10006626 | |||
| 1111 | Ga0099794_10015450 | |||
| 1112 | Ga0099794_10023668 | |||
| 1113 | Ga0099794_10048175 | |||
| 1114 | Ga0099794_10048471 | |||
| 1115 | Ga0099795_10000021 | |||
| 1116 | Ga0099795_10000327 | |||
| 1117 | Ga0099795_10009814 | |||
| 1118 | Ga0105250_10000008 | |||
| 1119 | Ga0105240_10000096 | |||
| 1120 | Ga0105240_10032169 | |||
| 1121 | Ga0105240_10037859 | |||
| 1122 | Ga0105240_10095884 | |||
| 1123 | Ga0105240_10127205 | |||
| 1124 | Ga0105240_10339773 | |||
| 1125 | Ga0111539_10004041 | |||
| 1126 | Ga0111539_10010716 | |||
| 1127 | Ga0111539_10166979 | |||
| 1128 | Ga0105245_10014445 | |||
| 1129 | Ga0105245_10014836 | |||
| 1130 | Ga0105245_10020382 | |||
| 1131 | Ga0105245_10405890 | |||
| 1132 | Ga0105247_10034236 | |||
| 1133 | Ga0114129_10007905 | |||
| 1134 | Ga0114129_10041629 | |||
| 1135 | Ga0114129_10145266 | |||
| 1136 | Ga0114129_10159665 | |||
| 1137 | Ga0105243_10280449 | |||
| 1138 | Ga0105241_10104934 | |||
| 1139 | Ga0105242_10012523 | |||
| 1140 | Ga0105242_10040823 | |||
| 1141 | Ga0105242_10113336 | |||
| 1142 | Ga0105242_10117595 | |||
| 1143 | Ga0105242_10246417 | |||
| 1144 | Ga0105248_10004174 | |||
| 1145 | Ga0105248_10006487 | |||
| 1146 | Ga0105248_10244360 | |||
| 1147 | Ga0105237_10026197 | |||
| 1148 | Ga0105238_10025529 | |||
| 1149 | Ga0105238_10065545 | |||
| 1150 | Ga0105238_10110020 | |||
| 1151 | Ga0105030_100378 | |||
| 1152 | Ga0099796_10000037 | |||
| 1153 | Ga0099796_10000544 | |||
| 1154 | Ga0099796_10001887 | |||
| 1155 | Ga0099796_10009673 | |||
| 1156 | Ga0105239_10065240 | |||
| 1157 | Ga0105239_10087150 | |||
| 1158 | Ga0105246_10002978 | |||
| 1159 | Ga0157374_10002345 | |||
| 1160 | Ga0157374_10061827 | |||
| 1161 | Ga0157374_10146878 | |||
| 1162 | Ga0157378_10000053 | |||
| 1163 | Ga0157378_10016842 | |||
| 1164 | Ga0157378_10018148 | |||
| 1165 | Ga0157378_10034424 | |||
| 1166 | Ga0157378_10061658 | |||
| 1167 | Ga0163162_10000132 | |||
| 1168 | Ga0163162_10004643 | |||
| 1169 | Ga0163162_10024479 | |||
| 1170 | Ga0163162_10115331 | |||
| 1171 | Ga0163162_10150941 | |||
| 1172 | Ga0157375_10079627 | |||
| 1173 | Ga0157375_10082715 | |||
| 1174 | Ga0157375_10125414 | |||
| 1175 | Ga0157375_10322092 | |||
| 1176 | Ga0163163_10001120 | |||
| 1177 | Ga0163163_10044763 | |||
| 1178 | Ga0163163_10107073 | |||
| 1179 | Ga0163163_10550097 | |||
| 1180 | Ga0157380_10004148 | |||
| 1181 | Ga0157380_10248435 | |||
| 1182 | Ga0157380_10327845 | |||
| 1183 | Ga0157379_10000026 | |||
| 1184 | Ga0157379_10000295 | |||
| 1185 | Ga0157379_10012640 | |||
| 1186 | Ga0157379_10067368 | |||
| 1187 | Ga0157379_10093250 | |||
| 1188 | Ga0157379_10144182 | |||
| 1189 | Ga0157379_10233123 | |||
| 1190 | Ga0157376_10000036 | |||
| 1191 | Ga0157376_10015665 | |||
| 1192 | Ga0157376_10025804 | |||
| 1193 | Ga0157376_10211166 | |||
| 1194 | Ga0182007_10034995 | |||
| 1195 | Ga0207696_1000119 | |||
| 1196 | Ga0207653_10033169 | |||
| 1197 | Ga0207692_10107137 | |||
| 1198 | Ga0207642_10014267 | |||
| 1199 | Ga0207710_10020281 | |||
| 1200 | Ga0207680_10000001 | |||
| 1201 | Ga0207680_10111459 | |||
| 1202 | Ga0207680_10173645 | |||
| 1203 | Ga0207685_10004892 | |||
| 1204 | Ga0207685_10008743 | |||
| 1205 | Ga0207699_10000011 | |||
| 1206 | Ga0207699_10001312 | |||
| 1207 | Ga0207699_10002296 | |||
| 1208 | Ga0207699_10031431 | |||
| 1209 | Ga0207699_10094906 | |||
| 1210 | Ga0207699_10111106 | |||
| 1211 | Ga0207699_10120377 | |||
| 1212 | Ga0207705_10001121 | |||
| 1213 | Ga0207705_10046253 | |||
| 1214 | Ga0207705_10063995 | |||
| 1215 | Ga0207684_10061602 | |||
| 1216 | Ga0207684_10073495 | |||
| 1217 | Ga0207684_10083902 | |||
| 1218 | Ga0207707_10003235 | |||
| 1219 | Ga0207707_10212599 | |||
| 1220 | Ga0207695_10001779 | |||
| 1221 | Ga0207695_10085381 | |||
| 1222 | Ga0207671_10296383 | |||
| 1223 | Ga0207693_10000711 | |||
| 1224 | Ga0207693_10007605 | |||
| 1225 | Ga0207693_10012146 | |||
| 1226 | Ga0207693_10033837 | |||
| 1227 | Ga0207663_10235859 | |||
| 1228 | Ga0207660_10065319 | |||
| 1229 | Ga0207660_10306321 | |||
| 1230 | Ga0207662_10046348 | |||
| 1231 | Ga0207649_10094912 | |||
| 1232 | Ga0207652_10171961 | |||
| 1233 | Ga0207652_10335833 | |||
| 1234 | Ga0207646_10001298 | |||
| 1235 | Ga0207646_10040030 | |||
| 1236 | Ga0207646_10042859 | |||
| 1237 | Ga0207646_10103535 | |||
| 1238 | Ga0207681_10000015 | |||
| 1239 | Ga0207694_10000200 | |||
| 1240 | Ga0207694_10052693 | |||
| 1241 | Ga0207694_10054303 | |||
| 1242 | Ga0207650_10191940 | |||
| 1243 | Ga0207650_10232159 | |||
| 1244 | Ga0207659_10020972 | |||
| 1245 | Ga0207659_10098612 | |||
| 1246 | Ga0207659_10165535 | |||
| 1247 | Ga0207700_10009179 | |||
| 1248 | Ga0207700_10032030 | |||
| 1249 | Ga0207700_10127066 | |||
| 1250 | Ga0207700_10218671 | |||
| 1251 | Ga0207700_10322837 | |||
| 1252 | Ga0207664_10012252 | |||
| 1253 | Ga0207644_10145183 | |||
| 1254 | Ga0207706_10000427 | |||
| 1255 | Ga0207706_10116225 | |||
| 1256 | Ga0207686_10170237 | |||
| 1257 | Ga0207670_10015364 | |||
| 1258 | Ga0207704_10008728 | |||
| 1259 | Ga0207704_10160665 | |||
| 1260 | Ga0207665_10004089 | |||
| 1261 | Ga0207665_10020650 | |||
| 1262 | Ga0207665_10067295 | |||
| 1263 | Ga0207665_10107291 | |||
| 1264 | Ga0207691_10000868 | |||
| 1265 | Ga0207711_10011715 | |||
| 1266 | Ga0207711_10031197 | |||
| 1267 | Ga0207711_10141326 | |||
| 1268 | Ga0207711_10168711 | |||
| 1269 | Ga0207689_10169460 | |||
| 1270 | Ga0207661_10036948 | |||
| 1271 | Ga0207667_10019818 | |||
| 1272 | Ga0207667_10316386 | |||
| 1273 | Ga0207651_10007744 | |||
| 1274 | Ga0207668_10029380 | |||
| 1275 | Ga0207668_10146772 | |||
| 1276 | Ga0207640_10035463 | |||
| 1277 | Ga0207658_10043963 | |||
| 1278 | Ga0207658_10050777 | |||
| 1279 | Ga0207658_10118882 | |||
| 1280 | Ga0207658_10129613 | |||
| 1281 | Ga0207677_10073977 | |||
| 1282 | Ga0207677_10110702 | |||
| 1283 | Ga0207677_10142845 | |||
| 1284 | Ga0207677_10319129 | |||
| 1285 | Ga0207703_10000674 | |||
| 1286 | Ga0207703_10033403 | |||
| 1287 | Ga0207703_10114272 | |||
| 1288 | Ga0207703_10168155 | |||
| 1289 | Ga0207703_10196503 | |||
| 1290 | Ga0207708_10053465 | |||
| 1291 | Ga0207702_10022483 | |||
| 1292 | Ga0207702_10076235 | |||
| 1293 | Ga0207702_10082106 | |||
| 1294 | Ga0207702_10189288 | |||
| 1295 | Ga0207641_10003776 | |||
| 1296 | Ga0207641_10044664 | |||
| 1297 | Ga0207648_10000165 | |||
| 1298 | Ga0207648_10055950 | |||
| 1299 | Ga0207648_10103722 | |||
| 1300 | Ga0207676_10015072 | |||
| 1301 | Ga0207676_10063288 | |||
| 1302 | Ga0207675_100001139 | |||
| 1303 | Ga0207675_100004948 | |||
| 1304 | Ga0207675_100020910 | |||
| 1305 | Ga0207675_100267279 | |||
| 1306 | Ga0209967_1007762 | |||
| 1307 | Ga0209179_1000034 | |||
| 1308 | Ga0209179_1002995 | |||
| 1309 | Ga0209982_1005940 | |||
| 1310 | Ga0209970_1005333 | |||
| 1311 | Ga0210002_1004305 | |||
| 1312 | Ga0209588_1000006 | |||
| 1313 | Ga0209588_1001342 | |||
| 1314 | Ga0209588_1005287 | |||
| 1315 | Ga0209588_1031255 | |||
| 1316 | Ga0209971_1000284 | |||
| 1317 | Ga0209966_1005548 | |||
| 1318 | Ga0209974_10009351 | |||
| 1319 | Ga0209974_10064616 | |||
| 1320 | Ga0207428_10006585 | |||
| 1321 | Ga0207428_10016493 | |||
| 1322 | Ga0207428_10047954 | |||
| 1323 | Ga0207428_10160734 | |||
| 1324 | Ga0265354_1003477 | |||
| 1325 | Ga0265355_1003124 | |||
| 1326 | Ga0268266_10000075 | |||
| 1327 | Ga0268266_10001848 | |||
| 1328 | Ga0268266_10002891 | |||
| 1329 | Ga0268266_10010789 | |||
| 1330 | Ga0268266_10077262 | |||
| 1331 | Ga0268266_10216033 | |||
| 1332 | Ga0268265_10000522 | |||
| 1333 | Ga0268265_10016779 | |||
| 1334 | Ga0268265_10033964 | |||
| 1335 | Ga0268265_10122905 | |||
| 1336 | Ga0268265_10162375 | |||
| 1337 | Ga0268264_10008995 | |||
| 1338 | Ga0268264_10042241 | |||
| 1339 | Ga0268264_10180576 | |||
| 1340 | Ga0265326_10003887 | |||
| 1341 | Ga0265319_1018293 | |||
| 1342 | Ga0265334_10000110 | |||
| 1343 | Ga0265318_10000295 | |||
| 1344 | Ga0307515_10003416 | |||
| 1345 | Ga0307515_10312504 | |||
| 1346 | Ga0265338_10016148 | |||
| 1347 | Ga0265338_10032779 | |||
| 1348 | Ga0265338_10177319 | |||
| 1349 | Ga0265770_1000035 | |||
| 1350 | Ga0265760_10008613 | |||
| 1351 | Ga0265330_10013978 | |||
| 1352 | Ga0265332_10001472 | |||
| 1353 | Ga0265328_10000038 | |||
| 1354 | Ga0265328_10000462 | |||
| 1355 | Ga0265328_10003378 | |||
| 1356 | Ga0265328_10011778 | |||
| 1357 | Ga0265325_10009477 | |||
| 1358 | Ga0265329_10006707 | |||
| 1359 | Ga0265340_10037623 | |||
| 1360 | Ga0265339_10033981 | |||
| 1361 | Ga0265331_10000024 | |||
| 1362 | Ga0265331_10001740 | |||
| 1363 | Ga0265331_10004168 | |||
| 1364 | Ga0265327_10000079 | |||
| 1365 | Ga0265327_10000136 | |||
| 1366 | Ga0265327_10016591 | |||
| 1367 | Ga0265316_10032269 | |||
| 1368 | Ga0265316_10152095 | |||
| 1369 | Ga0307513_10112360 | |||
| 1370 | Ga0307509_10104733 | |||
| 1371 | Ga0265313_10011846 | |||
| 1372 | Ga0307508_10026008 | |||
| 1373 | Ga0316575_10000633 | |||
| 1374 | Ga0316579_10003266 | |||
| 1375 | Ga0265314_10027054 | |||
| 1376 | Ga0265342_10002639 | |||
| 1377 | Ga0316576_10055004 | |||
| 1378 | Ga0316576_10083410 | |||
| 1379 | Ga0316576_10112901 | |||
| 1380 | Ga0316578_10017501 | |||
| 1381 | Ga0316578_10047163 | |||
| 1382 | Ga0307516_10061762 | |||
| 1383 | Ga0316577_10015653 | |||
| 1384 | Ga0307413_10023699 | |||
| 1385 | Ga0307413_10037714 | |||
| 1386 | Ga0307410_10178489 | |||
| 1387 | Ga0307407_10063726 | |||
| 1388 | Ga0307412_10018737 | |||
| 1389 | Ga0307409_100015633 | |||
| 1390 | Ga0307409_100376669 | |||
| 1391 | Ga0307416_100003639 | |||
| 1392 | Ga0307415_100004865 | |||
| 1393 | Ga0316583_10001521 | |||
| 1394 | Ga0316583_10014851 | |||
| 1395 | Ga0307510_10016108 | |||
| 1396 | Ga0373929_0000009 | |||
| 1397 | Ga0373952_0002113 | |||
| 1398 | Ga0373954_0003004 | |||
| 1399 | Ga0373956_0042314 | |||
| 1400 | Ga0373956_0046070 | |||
| 1401 | Ga0373956_0058929 | |||
| 1402 | Ga0373956_0064618 | |||
| 1403 | Ga0373943_0110192 | |||
| 1404 | Ga0373946_0041439 | |||
| 1405 | Ga0373955_0001581 | |||
| 1406 | Ga0373955_0014508 | |||
| 1407 | Ga0373955_0041382 | |||
| 1408 | Ga0373961_0001487 | |||
| 1409 | Ga0316574_0004662 | |||
| 1410 | Ga0316574_0004807 | |||
| 1411 | Ga0316574_0179882 | |||
| 1412 | Ga0373924_0020978 | |||
| 1413 | Ga0373931_0015940 | |||
| 1414 | Ga0373931_0145446 | |||
| 1415 | Ga0373933_0000092 | |||
| 1416 | Ga0373937_0002321 | |||
| 1417 | Ga0373937_0101293 | |||
| 1418 | Ga0373937_0344076 | |||
| 1419 | Ga0373937_0362707 | |||
| 1420 | Ga0316582_0003446 | |||
| 1421 | Ga0316582_0007241 | |||
| 1422 | Ga0316582_0030585 | |||
| 1423 | Ga0316582_0037425 | |||
| 1424 | Ga0316584_0011477 | |||
| 1425 | Ga0316584_0014413 | |||
| 1426 | Ga0316584_0015665 | |||
| 1427 | Ga0316584_0021930 | |||
| 1428 | Ga0316584_0024602 | |||
| 1429 | Ga0316584_0052181 | |||
| 1430 | Ga0316584_0103189 | |||
| 1431 | Ga0373925_0075516 | |||
| 1432 | Ga0395900_0002653 | |||
| 1433 | Ga0395900_0156793 | |||
| 1434 | Ga0395900_0164995 | |||
| 1435 | Ga0395900_0261273 | |||
| 1436 | Ga0395898_0017594 | |||
| 1437 | Ga0395905_0003856 | |||
| 1438 | Ga0395905_0038631 | |||
| 1439 | Ga0395905_0054389 | |||
| 1440 | Ga0395905_0081840 | |||
| 1441 | Ga0395905_0187339 | |||
| 1442 | Ga0316581_0004257 | |||
| 1443 | Ga0316581_0020866 | |||
| 1444 | Ga0395901_0071050 | |||
| 1445 | Ga0400490_24818 | |||
| 1446 | Ga0400490_33485 | |||
| 1447 | Ga0400490_43208 | |||
| 1448 | Ga0400488_08624 | |||
| 1449 | Ga0400488_48288 | |||
| 1450 | Ga0400486_01259 | |||
| 1451 | Ga0400486_02595 | |||
| 1452 | Ga0400486_14746 | |||
| 1453 | Ga0400483_160384 | |||
| 1454 | Ga0400483_231710 | |||
| 1455 | Ga0400483_234508 | |||
| 1456 | Ga0400483_265969 | |||
| 1457 | Ga0400483_275498 | |||
| 1458 | Ga0400483_276356 | |||
| 1459 | Ga0400489_07775 | |||
| 1460 | Ga0400489_28828 | |||
| 1461 | Ga0400487_21516 | |||
| 1462 | Ga0436365_0389691 | |||
| 1463 | Ga0436361_0355668 | |||
| 1464 | Ga0436363_1471966 | |||
| 1465 | Ga0451800_0970504 | |||
| 1466 | Ga0450920_000110 | |||
| 1467 | Ga0450920_005305 | |||
| 1468 | Ga0450923_001003 | |||
| 1469 | Ga0450895_001307 | |||
| 1470 | Ga0450896_000066 | |||
| 1471 | Ga0450906_011326 | |||
| 1472 | Ga0439446_0001168 | |||
| 1473 | Ga0450908_000865 | |||
| 1474 | Ga0439435_0000053 | |||
| 1475 | Ga0439444_0001584 | |||
| 1476 | Ga0451577_0000074 | |||
| 1477 | Ga0451577_0000088 | |||
| 1478 | Ga0451577_0000193 | |||
| 1479 | Ga0451577_0000516 | |||
| 1480 | Ga0451577_0002021 | |||
| 1481 | Ga0451577_0003277 | |||
| 1482 | Ga0451577_0006444 | |||
| 1483 | Ga0451577_0009601 | |||
| 1484 | Ga0451577_0010031 | |||
| 1485 | Ga0451577_0010506 | |||
| 1486 | Ga0451577_0019877 | |||
| 1487 | Ga0451577_0032905 | |||
| 1488 | Ga0451577_0033295 | |||
| 1489 | Ga0451577_0067352 | |||
| 1490 | Ga0451577_0075149 | |||
| 1491 | Ga0451577_0096361 | |||
| 1492 | Ga0451577_0237681 | |||
| 1493 | Ga0453683_0000231 | |||
| 1494 | Ga0453683_0000513 | |||
| 1495 | Ga0453683_0002349 | |||
| 1496 | Ga0453683_0008408 | |||
| 1497 | Ga0453683_0009298 | |||
| 1498 | Ga0453683_0118656 | |||
| 1499 | Ga0466965_0009714 | |||
| 1500 | Ga0466966_0018497 | |||
| 1501 | Ga0466966_0093629 | |||
| 1502 | Ga0453684_0000309 | |||
| 1503 | Ga0453684_0000482 | |||
| 1504 | Ga0453684_0001270 | |||
| 1505 | Ga0453684_0001333 | |||
| 1506 | Ga0453684_0001824 | |||
| 1507 | Ga0453684_0002715 | |||
| 1508 | Ga0453684_0003190 | |||
| 1509 | Ga0453684_0005943 | |||
| 1510 | Ga0453684_0006807 | |||
| 1511 | Ga0453684_0014763 | |||
| 1512 | Ga0453684_0018374 | |||
| 1513 | Ga0453684_0027257 | |||
| 1514 | Ga0453684_0035614 | |||
| 1515 | Ga0453684_0046109 | |||
| 1516 | Ga0453684_0123234 | |||
| 1517 | Ga0453684_0155809 | |||
| 1518 | Ga0453684_0169857 | |||
| 1519 | Ga0453684_0253669 | |||
| 1520 | Ga0453684_0373282 | |||
| 1521 | Ga0453684_0424007 | |||
| 1522 | Ga0453684_0514618 | |||
| 1523 | Ga0453684_0584330 | |||
| 1524 | Ga0466959_0020277 | |||
| 1525 | Ga0466959_0139036 | |||
| 1526 | Ga0451576_0000469 | |||
| 1527 | Ga0451576_0000620 | |||
| 1528 | Ga0451576_0006546 | |||
| 1529 | Ga0451576_0011753 | |||
| 1530 | Ga0451576_0014196 | |||
| 1531 | Ga0451576_0108275 | |||
| 1532 | Ga0451576_0143835 | |||
| 1533 | Ga0451576_0228176 | |||
| 1534 | Ga0451576_0255411 | |||
| 1535 | Ga0466967_0182380 | |||
| 1536 | Ga0495603_0060758 | |||
| 1537 | Ga0495629_0064534 | |||
| 1538 | Ga0495651_0151232 | |||
| 1539 | Ga0495653_0064117 | |||
| 1540 | Ga0495650_0000338 | |||
| 1541 | Ga0495580_0009190 | |||
| 1542 | Ga0495580_0017932 | |||
| 1543 | Ga0495580_0042555 | |||
| 1544 | Ga0495580_0138108 | |||
| 1545 | Ga0495582_0000161 | |||
| 1546 | Ga0495664_0056199 | |||
| 1547 | Ga0495664_0057387 | |||
| 1548 | Ga0495594_0057509 | |||
| 1549 | Ga0495608_0019119 | |||
| 1550 | Ga0495618_0074668 | |||
| 1551 | Ga0495628_0071998 | |||
| 1552 | Ga0495628_0277021 | |||
| 1553 | Ga0495630_0294640 | |||
| 1554 | Ga0495644_0016363 | |||
| 1555 | Ga0495666_0033463 | |||
| 1556 | Ga0495665_0039971 | |||
| 1557 | Ga0495665_0063345 | |||
| 1558 | Ga0495665_0109156 | |||
| 1559 | Ga0495586_0025836 | |||
| 1560 | Ga0495587_0007281 | |||
| 1561 | Ga0495621_0005295 | |||
| 1562 | Ga0495667_0111924 | |||
| 1563 | Ga0495625_0057686 | |||
| 1564 | Ga0495635_0256187 | |||
| 1565 | Ga0495659_0000273 | |||
| 1566 | Ga0495588_0015942 | |||
| 1567 | Ga0495658_0002115 | |||
| 1568 | Ga0495658_0009606 | |||
| 1569 | Ga0495658_0012305 | |||
| 1570 | Ga0495613_0014054 | |||
| 1571 | Ga0495624_0050184 | |||
| 1572 | Ga0495670_0065380 | |||
| 1573 | Ga0495581_0014552 | |||
| 1574 | Ga0495581_0059115 | |||
| 1575 | Ga0495604_0000536 | |||
| 1576 | Ga0495674_0034504 | |||
| 1577 | Ga0495674_0048265 | |||
| 1578 | Ga0495674_0078309 | |||
| 1579 | Ga0495676_0016069 | |||
| 1580 | Ga0495680_0108332 | |||
| 1581 | Ga0496100_0052912 | |||
| 1582 | Ga0496100_0149182 | |||
| 1583 | Ga0496100_0168084 | |||
| 1584 | Ga0496101_0046317 | |||
| 1585 | Ga0496101_0243125 | |||
| 1586 | Ga0496102_0003185 | |||
| 1587 | Ga0496102_0032263 | |||
| 1588 | Ga0496102_0080326 | |||
| 1589 | Ga0496102_0251058 | |||
| 1590 | Ga0496103_0079556 | |||
| 1591 | Ga0496104_0020825 | |||
| 1592 | Ga0496104_0038861 | |||
| 1593 | Ga0496104_0046684 | |||
| 1594 | Ga0496104_0077839 | |||
| 1595 | Ga0496105_0015164 | |||
| 1596 | Ga0496105_0021234 | |||
| 1597 | Ga0496105_0045780 | |||
| 1598 | Ga0496105_0097234 | |||
| 1599 | Ga0496106_0002250 | |||
| 1600 | Ga0496106_0197863 | |||
| 1601 | Ga0496107_0043611 | |||
| 1602 | Ga0496107_0164940 | |||
| 1603 | Ga0496108_0047168 | |||
| 1604 | Ga0496108_0053892 | |||
| 1605 | Ga0496108_0111775 | |||
| 1606 | Ga0496108_0117005 | |||
| 1607 | Ga0496109_0018403 | |||
| 1608 | Ga0496109_0059938 | |||
| 1609 | Ga0496110_0041724 | |||
| 1610 | Ga0496111_0032056 | |||
| 1611 | Ga0496111_0045861 | |||
| 1612 | Ga0496112_0041978 | |||
| 1613 | Ga0496112_0191492 | |||
| 1614 | Ga0496113_0114544 | |||
| 1615 | Ga0496114_0000031 | |||
| 1616 | Ga0496114_0000525 | |||
| 1617 | Ga0496114_0006736 | |||
| 1618 | Ga0496114_0016484 | |||
| 1619 | Ga0496114_0028330 | |||
| 1620 | Ga0496114_0036753 | |||
| 1621 | Ga0496114_0103393 | |||
| 1622 | Ga0496114_0474424 | |||
| 1623 | Ga0496115_0001445 | |||
| 1624 | Ga0496115_0006113 | |||
| 1625 | Ga0496115_0044199 | |||
| 1626 | Ga0496115_0085986 | |||
| 1627 | Ga0496115_0300426 | |||
| 1628 | Ga0496116_0000005 | |||
| 1629 | Ga0496116_0048313 | |||
| 1630 | Ga0496118_0037737 | |||
| 1631 | Ga0496120_0000543 | |||
| 1632 | Ga0496121_0000029 | |||
| 1633 | Ga0496126_0046366 | |||
| 1634 | Ga0496126_0128815 | |||
| 1635 | Ga0501299_002008 | |||
| 1636 | Ga0501031_0024709 | |||
| 1637 | Ga0501031_0054975 | |||
| 1638 | Ga0501032_0001200 | |||
| 1639 | Ga0501032_0019635 | |||
| 1640 | Ga0501033_0000188 | |||
| 1641 | Ga0501033_0039594 | |||
| 1642 | Ga0501033_0115240 | |||
| 1643 | Ga0501033_0216832 | |||
| 1644 | Ga0501034_0097857 | |||
| 1645 | Ga0501034_0302030 | |||
| 1646 | Ga0501034_0391472 | |||
| 1647 | Ga0501036_0000718 | |||
| 1648 | Ga0501036_0000902 | |||
| 1649 | Ga0501036_0010990 | |||
| 1650 | Ga0501036_0023156 | |||
| 1651 | Ga0501036_0042245 | |||
| 1652 | Ga0501036_0066366 | |||
| 1653 | Ga0501037_0042101 | |||
| 1654 | Ga0501038_0001200 | |||
| 1655 | Ga0501038_0003652 | |||
| 1656 | Ga0501038_0003791 | |||
| 1657 | Ga0501038_0010501 | |||
| 1658 | Ga0501038_0135922 | |||
| 1659 | Ga0501038_0182637 | |||
| 1660 | Ga0501038_0276645 | |||
| 1661 | Ga0501039_0000129 | |||
| 1662 | Ga0501039_0005104 | |||
| 1663 | Ga0501039_0112887 | |||
| 1664 | Ga0501040_0003393 | |||
| 1665 | Ga0501040_0006313 | |||
| 1666 | Ga0501040_0061933 | |||
| 1667 | Ga0501040_0064519 | |||
| 1668 | Ga0501041_0002162 | |||
| 1669 | Ga0501041_0003644 | |||
| 1670 | Ga0501041_0073865 | |||
| 1671 | Ga0501041_0115207 | |||
| 1672 | Ga0501041_0143508 | |||
| 1673 | Ga0501042_0000149 | |||
| 1674 | Ga0501042_0005175 | |||
| 1675 | Ga0501042_0018209 | |||
| 1676 | Ga0501043_0002354 | |||
| 1677 | Ga0501043_0095087 | |||
| 1678 | Ga0501046_0009656 | |||
| 1679 | Ga0501046_0046060 | |||
| 1680 | Ga0501048_0024354 | |||
| 1681 | Ga0501048_0037853 | |||
| 1682 | Ga0501048_0052813 | |||
| 1683 | Ga0501067_0006534 | |||
| 1684 | Ga0501068_0017871 | |||
| 1685 | Ga0501068_0021037 | |||
| 1686 | Ga0501068_0098364 | |||
| 1687 | Ga0501068_0153522 | |||
| 1688 | Ga0501070_0144892 | |||
| 1689 | Ga0501071_0000172 | |||
| 1690 | Ga0501071_0003494 | |||
| 1691 | Ga0501071_0004103 | |||
| 1692 | Ga0501071_0101271 | |||
| 1693 | Ga0501071_0306798 | |||
| 1694 | Ga0501072_0006100 | |||
| 1695 | Ga0501072_0031664 | |||
| 1696 | Ga0501072_0036857 | |||
| 1697 | Ga0501073_0002463 | |||
| 1698 | Ga0501073_0023010 | |||
| 1699 | Ga0501074_0018601 | |||
| 1700 | Ga0501074_0111518 | |||
| 1701 | Ga0501075_0001132 | |||
| 1702 | Ga0501075_0003540 | |||
| 1703 | Ga0501075_0188170 | |||
| 1704 | Ga0501076_0007381 | |||
| 1705 | Ga0501076_0012915 | |||
| 1706 | Ga0501076_0027242 | |||
| 1707 | Ga0501076_0265233 | |||
| 1708 | Ga0501077_0002116 | |||
| 1709 | Ga0501077_0028830 | |||
| 1710 | Ga0501079_0001630 | |||
| 1711 | Ga0501079_0008901 | |||
| 1712 | Ga0501079_0020939 | |||
| 1713 | Ga0501079_0083687 | |||
| 1714 | Ga0501079_0105499 | |||
| 1715 | Ga0501079_0145180 | |||
| 1716 | Ga0501080_0004833 | |||
| 1717 | Ga0501080_0056162 | |||
| 1718 | Ga0501080_0063425 | |||
| 1719 | Ga0501080_0248776 | |||
| 1720 | Ga0501080_0303596 | |||
| 1721 | Ga0501081_0000276 | |||
| 1722 | Ga0501081_0011019 | |||
| 1723 | Ga0501081_0066545 | |||
| 1724 | Ga0501081_0079929 | |||
| 1725 | Ga0501081_0098678 | |||
| 1726 | Ga0501083_0035435 | |||
| 1727 | Ga0501035_0001470 | |||
| 1728 | Ga0501035_0006995 | |||
| 1729 | Ga0501035_0022885 | |||
| 1730 | Ga0501035_0066164 | |||
| 1731 | Ga0501035_0117281 | |||
| 1732 | Ga0501035_0160800 | |||
| 1733 | Ga0501044_0000700 | |||
| 1734 | Ga0501044_0028450 | |||
| 1735 | Ga0501044_0033347 | |||
| 1736 | Ga0501044_0466788 | |||
| 1737 | Ga0501045_0006043 | |||
| 1738 | Ga0501045_0030711 | |||
| 1739 | Ga0501045_0078367 | |||
| 1740 | Ga0501045_0108875 | |||
| 1741 | nmdc:mga05p37_256285_c1 | |||
| 1742 | nmdc:mga05p37_41777_c1 | |||
| 1743 | nmdc:mga09592_16932_c1 | |||
| 1744 | nmdc:mga09592_244208_c1 | |||
| 1745 | nmdc:mga09592_459294_c1 | |||
| 1746 | nmdc:mga0qj67_122349_c1 | |||
| 1747 | nmdc:mga0qj67_193141_c1 | |||
| 1748 | nmdc:mga06r32_14214_c1 | |||
| 1749 | nmdc:mga06r32_202114_c1 | |||
| 1750 | nmdc:mga06r32_46244_c1 | |||
| 1751 | nmdc:mga08y16_131428_c1 | |||
| 1752 | nmdc:mga08y16_3416_c1 | |||
| 1753 | nmdc:mga08y16_73378_c1 | |||
| 1754 | nmdc:mga0n895_107268_c1 | |||
| 1755 | nmdc:mga0n895_172046_c1 | |||
| 1756 | nmdc:mga0n895_219299_c1 | |||
| 1757 | nmdc:mga0n895_23293_c1 | |||
| 1758 | nmdc:mga0n895_285284_c1 | |||
| 1759 | nmdc:mga0n895_301_c1 | |||
| 1760 | nmdc:mga0n895_8070_c1 | |||
| 1761 | nmdc:mga0n895_9406_c1 | |||
| 1762 | nmdc:mga0rr50_25639_c1 | |||
| 1763 | nmdc:mga0rr50_28804_c1 | |||
| 1764 | nmdc:mga0rr50_5827_c1 | |||
| 1765 | nmdc:mga0rr50_6410_c1 | |||
| 1766 | nmdc:mga08x19_1345_c1 | |||
| 1767 | nmdc:mga08x19_1890_c1 | |||
| 1768 | nmdc:mga08x19_3396_c1 | |||
| 1769 | nmdc:mga08x19_38204_c1 | |||
| 1770 | nmdc:mga08x19_43084_c1 | |||
| 1771 | nmdc:mga08x19_67576_c1 | |||
| 1772 | nmdc:mga08x19_87373_c1 | |||
| 1773 | nmdc:mga0a205_128182_c1 | |||
| 1774 | nmdc:mga0a205_180_c1 | |||
| 1775 | nmdc:mga0a205_4503_c2 | |||
| 1776 | nmdc:mga0a205_56634_c1 | |||
| 1777 | Ga0500643_001494 | |||
| 1778 | Ga0500555_038946 | |||
| 1779 | Ga0500568_0012728 | |||
| 1780 | Ga0500622_0000011 | |||
| 1781 | Ga0500637_0001349 | |||
| 1782 | Ga0500611_003137 | |||
| 1783 | Ga0501084_0043016 | |||
| 1784 | Ga0501082_0002842 | |||
| 1785 | Ga0501082_0013727 | |||
| 1786 | Ga0501082_0239331 | |||
| 1787 | Ga0501082_0386152 | |||
| 1788 | Ga0530510_0004375 | |||
| 1789 | Ga0530510_0007524 | |||
| 1790 | Ga0530510_0010667 | |||
| 1791 | Ga0530510_0118386 | |||
| 1792 | Ga0530510_0261697 | |||
| 1793 | 2952254800 | |||
| 1794 | 8002747459 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 8cxr-assembly4.cif.gz_D | crystal structure of mray bound to a sphaerimicin analogue | 0.9842 | 24 | 358 |
| 8cxr-assembly1.cif.gz_A | crystal structure of mray bound to a sphaerimicin analogue | 0.9806 | 25 | 358 |
| 6oz6-assembly3.cif.gz_C | error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) | 0.9792 | 25 | 358 |
| 6oyz-assembly2.cif.gz_C | crystal structure of mray bound to capuramycin | 0.9774 | 25 | 358 |
| 8cxr-assembly4.cif.gz_D | crystal structure of mray bound to a sphaerimicin analogue | 0.9745 | 24 | 358 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q8WSV6_55_300_1.20.1260.140 | Mainly Alpha;Up-down Bundle;Ferritin;Alternative oxidase | 0.3369 | 178 | 358 | 1.20.1260.140 |
| af_Q8BMA6_254_625_1.25.40.280 | Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;alix/aip1 like domains | 0.334 | 22 | 147 | 1.25.40.280 |
| af_P0ADJ8_1_145_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.3008 | 178 | 287 | 1.20.1250.20 |
| af_A2CF25_588_744_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.2995 | 178 | 360 | 1.20.1250.20 |
| af_A0A0G2L3Z8_323_518_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.294 | 175 | 356 | 1.20.1250.20 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1X0N8X3-F1-model_v4 | Phospho-N-acetylmuramoyl-pentapeptide-transferase (EC 2.7.8.13) | 1.001 | 209 | 360 |
GO:0005886
GO:0008360 GO:0008963 GO:0009252 GO:0046872 GO:0051301 GO:0071555 |
| AF-A0A3S1VV32-F1-model_v4 | deleted | 1 | 191 | 343 |
|
| AF-A0A7Y8RU87-F1-model_v4 | Phospho-N-acetylmuramoyl-pentapeptide-transferase (EC 2.7.8.13) | 0.9988 | 74 | 249 |
GO:0005886
GO:0008360 GO:0008963 GO:0009252 GO:0046872 GO:0051301 GO:0051992 GO:0071555 |
| AF-A0A661FIK3-F1-model_v4 | Phospho-N-acetylmuramoyl-pentapeptide-transferase (EC 2.7.8.13) | 0.9985 | 68 | 360 |
GO:0005886
GO:0008360 GO:0008963 GO:0009252 GO:0046872 GO:0051301 GO:0051992 GO:0071555 |
| AF-A0A1F6SX96-F1-model_v4 | Phospho-N-acetylmuramoyl-pentapeptide-transferase (EC 2.7.8.13) | 0.998 | 74 | 360 |
GO:0005886
GO:0008360 GO:0008963 GO:0009252 GO:0046872 GO:0051301 GO:0071555 |