F485053
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 897 | 394 | 1796 | 152 |
Family's Representative Sequence
| Representative Sequence | 3300046616|Ga0495668_0072851|Ga0495668_0072851_252_788 |
| Length | 178 |
| Sequence | MSASAPKVRARSRRFSNDLQGEAETMDLILWRHAEASELEGAGDDLERALTPKGERQAQRMGEWLNQRLAHSTRILVSPALRCQQTAKALGRKFKTLPELAPDGNGESLLKAARWPDANEPVLVIGHQPTLGLVAAYLLSDTPQPWTIKKGAVWWIRSRNREDQAQVVLQAVQSPDCL |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 2 | 3300002704 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB | Metagenome | Unclassified |
| 3 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 4 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 5 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 6 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 7 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 8 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 9 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 10 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 11 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 12 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 13 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 14 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 15 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 16 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 17 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 18 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 19 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 20 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 21 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 24 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 25 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 28 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 30 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 31 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 33 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 34 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 43 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 47 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 48 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 52 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 53 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 54 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 55 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 56 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 57 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 58 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 59 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 61 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 63 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 65 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 66 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 67 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 69 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 70 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 71 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 72 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 73 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 74 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 75 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 76 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 77 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 78 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 79 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 80 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 81 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 82 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 83 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 84 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 85 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 87 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 88 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 89 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 90 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 91 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 92 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 93 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 95 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 96 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 122 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 125 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 126 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 128 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 129 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 130 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 131 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 132 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 133 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 134 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 135 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 136 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 137 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 138 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 139 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 140 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 141 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 142 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 143 | 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 145 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 146 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 147 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 148 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 204 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 205 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 209 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 210 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 211 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 212 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 213 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 214 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 215 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 216 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 217 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 218 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 219 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 220 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 221 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 222 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 223 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 224 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 225 | 3300031838 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM | Metagenome | Unclassified |
| 226 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 227 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 228 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 229 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 230 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 231 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 232 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 233 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 234 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 235 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 236 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 237 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 238 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 239 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 240 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 241 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 242 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 243 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 244 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 245 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 246 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 247 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 248 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 249 | 3300042000 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 | Metagenome | Rhizosphere |
| 250 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 251 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 252 | 3300042144 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 | Metagenome | Rhizosphere |
| 253 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 254 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 255 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 256 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 257 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 258 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 259 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 260 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 261 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 262 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 263 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 264 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 265 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 266 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 303 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 304 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 305 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 306 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 307 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 308 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 309 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 310 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 311 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 312 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 313 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 314 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 315 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 316 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 317 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 318 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 319 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 320 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 321 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 322 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300049513 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control | Metagenome | Rhizosphere |
| 324 | 3300049523 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control | Metagenome | Rhizosphere |
| 325 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 326 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 327 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 328 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 329 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 330 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 331 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 332 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 333 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 334 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 335 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 336 | 3300049763 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control | Metagenome | Rhizosphere |
| 337 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 338 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 339 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 340 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 341 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 342 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 343 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 344 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 345 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 346 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 347 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 348 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 349 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 350 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 351 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 353 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 354 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 355 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 356 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 357 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 358 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 359 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 360 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 361 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 362 | 3300053739 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere | Metagenome | Endosphere |
| 363 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 364 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 365 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 366 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 367 | 2511231003 | Herbaspirillum sp. CF444 | Isolate | Rhizosphere |
| 368 | 2511231026 | Herbaspirillum sp. YR522 | Isolate | Rhizosphere |
| 369 | 2521172590 | Herbaspirillum sp. GW103 | Isolate | Rhizosphere |
| 370 | 2547132512 | Azospira oryzae 6a3 | Isolate | Unclassified |
| 371 | 2548876994 | Herbaspirillum lusitanum P6-12 | Isolate | Nodule |
| 372 | 2551306416 | Herbaspirillum seropedicae Os34 | Isolate | Unclassified |
| 373 | 2643221654 | Rhizobacter sp. Root404 | Isolate | Unclassified |
| 374 | 2643221660 | Methylibium sp. Root1272 | Isolate | Unclassified |
| 375 | 2765235838 | Herbaspirillum robiniae AA6 | Isolate | Unclassified |
| 376 | 2808606386 | Herbaspirillum sp. SJZ099 | Isolate | Rhizosphere |
| 377 | 2808606415 | Herbaspirillum sp. SJZ130 | Isolate | Rhizosphere |
| 378 | 2808606419 | Herbaspirillum sp. SJZ106 | Isolate | Rhizosphere |
| 379 | 2818991445 | Herbaspirillum hiltneri 3195 | Isolate | Unclassified |
| 380 | 2818991449 | Herbaspirillum huttiense 1147 | Isolate | Unclassified |
| 381 | 2839094727 | Herbaspirillum robiniae HZ10 | Isolate | Nodule |
| 382 | 2852618963 | Herbaspirillum sp. SJZ102 | Isolate | Rhizosphere |
| 383 | 2884836552 | Herbaspirillum sp. 3R-11 | Isolate | Unclassified |
| 384 | 2884852848 | Herbaspirillum sp. 3R11 | Isolate | Unclassified |
| 385 | 2896154374 | Herbaspirillum sp. 3R-3a1 | Isolate | Nodule |
| 386 | 2904439833 | Herbaspirillum sp. 1589 | Isolate | Rhizosphere |
| 387 | 2904530477 | Herbaspirillum huttiense 611 | Isolate | Unclassified |
| 388 | 2904584206 | Herbaspirillum sp. 1050 | Isolate | Unclassified |
| 389 | 2904589729 | Herbaspirillum sp. 1130 | Isolate | Unclassified |
| 390 | 2904601388 | Herbaspirillum sp. 1273 | Isolate | Rhizosphere |
| 391 | 2919046199 | Herbaspirillum frisingense 596 | Isolate | Unclassified |
| 392 | 2919079590 | Herbaspirillum sp. 1173 | Isolate | Unclassified |
| 393 | 2923510766 | Herbaspirillum rubrisubalbicans SLBN-127 | Isolate | Rhizosphere |
| 394 | 2928130867 | Herbaspirillum seropedicae 1977 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 96.88 |
| Metatranscriptomes | 0 |
| Isolates | 3.12 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 14.83 |
| Nodule | 0.56 |
| Rhizoplane | 2.45 |
| Rhizosphere | 71.01 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 3.23 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0495668_0072851 | 3300046616 | Bacteria | 1887 |
| 2 | JGI25155J39150_1000552 | 3300002704 | Bacteria | 8473 |
| 3 | JGI25156J39149_1000459 | 3300002705 | Bacteria | 24817 |
| 4 | JGI25156J39149_1001026 | 3300002705 | Bacteria | 13042 |
| 5 | JGI25156J39149_1002927 | 3300002705 | Bacteria | 5814 |
| 6 | JGI25156J39149_1020328 | 3300002705 | Bacteria | 1171 |
| 7 | JGI25162J39368_1010430 | 3300002737 | Bacteria | 1175 |
| 8 | JGI25154J39366_1000871 | 3300002738 | Bacteria | 13042 |
| 9 | JGI25154J39366_1000911 | 3300002738 | Bacteria | 12467 |
| 10 | JGI25154J39366_1001802 | 3300002738 | Bacteria | 6715 |
| 11 | JGI25157J39369_1000021 | 3300002741 | Bacteria | 163907 |
| 12 | JGI25157J39369_1001256 | 3300002741 | Bacteria | 10403 |
| 13 | JGI25164J39214_1005040 | 3300002772 | Bacteria | 1461 |
| 14 | rootH1_10015810 | 3300003316 | Bacteria | 1931 |
| 15 | rootH1_10015810 | 3300003323 | Bacteria | 19240 |
| 16 | rootH1_10028438 | 3300003316 | Bacteria | 4544 |
| 17 | rootH1_10028438 | 3300003323 | Bacteria | 1649 |
| 18 | rootH1_10033518 | 3300003316 | Bacteria | 1211 |
| 19 | rootH1_10042308 | 3300003316 | Bacteria | 1474 |
| 20 | rootH2_10019687 | 3300003320 | Bacteria | 1609 |
| 21 | rootH1_10021003 | 3300003323 | Bacteria | 1397 |
| 22 | rootH1_10072734 | 3300003323 | Bacteria | 1364 |
| 23 | rootH1_10085156 | 3300003323 | Bacteria | 1281 |
| 24 | Ga0055538_1000013 | 3300003751 | Bacteria | 348596 |
| 25 | Ga0055539_1000018 | 3300003752 | Bacteria | 348596 |
| 26 | Ga0055539_1000422 | 3300003752 | Bacteria | 15528 |
| 27 | Ga0055539_1006291 | 3300003752 | Bacteria | 1519 |
| 28 | Ga0055539_1007357 | 3300003752 | Bacteria | 1394 |
| 29 | Ga0055533_1000022 | 3300003756 | Bacteria | 348596 |
| 30 | Ga0055533_1000033 | 3300003756 | Bacteria | 265716 |
| 31 | Ga0055532_1000017 | 3300003758 | Bacteria | 306880 |
| 32 | Ga0055525_1000024 | 3300003759 | Bacteria | 348596 |
| 33 | Ga0055525_1001360 | 3300003759 | Bacteria | 4732 |
| 34 | Ga0055535_1001037 | 3300003761 | Bacteria | 17524 |
| 35 | Ga0055529_1000860 | 3300003763 | Bacteria | 17524 |
| 36 | Ga0055540_1098486 | 3300003792 | Bacteria | 547 |
| 37 | Ga0055531_10000303 | 3300003794 | Bacteria | 48725 |
| 38 | Ga0055541_1000013 | 3300003841 | Bacteria | 348596 |
| 39 | Ga0070658_10055065 | 3300005327 | Bacteria | 3231 |
| 40 | Ga0070658_10159526 | 3300005327 | Bacteria | 1892 |
| 41 | Ga0070658_10334405 | 3300005327 | Bacteria | 1295 |
| 42 | Ga0070658_10546180 | 3300005327 | Bacteria | 1003 |
| 43 | Ga0070658_10690884 | 3300005327 | Bacteria | 885 |
| 44 | Ga0070676_10006846 | 3300005328 | Bacteria | 6103 |
| 45 | Ga0070676_10031112 | 3300005328 | Bacteria | 3047 |
| 46 | Ga0070683_100052816 | 3300005329 | Bacteria | 3766 |
| 47 | Ga0070690_100258225 | 3300005330 | Bacteria | 1235 |
| 48 | Ga0070690_100884353 | 3300005330 | Bacteria | 698 |
| 49 | Ga0070670_100001932 | 3300005331 | Bacteria | 16972 |
| 50 | Ga0070670_100016141 | 3300005331 | Bacteria | 6410 |
| 51 | Ga0070670_100030522 | 3300005331 | Bacteria | 4641 |
| 52 | Ga0070670_100043467 | 3300005331 | Bacteria | 3862 |
| 53 | Ga0070670_100247824 | 3300005331 | Bacteria | 1551 |
| 54 | Ga0070670_100413575 | 3300005331 | Bacteria | 1191 |
| 55 | Ga0070670_100454897 | 3300005331 | Bacteria | 1135 |
| 56 | Ga0070670_100565065 | 3300005331 | Bacteria | 1016 |
| 57 | Ga0070677_10250943 | 3300005333 | Bacteria | 878 |
| 58 | Ga0068869_100002015 | 3300005334 | Bacteria | 12211 |
| 59 | Ga0068869_100009386 | 3300005334 | Bacteria | 6347 |
| 60 | Ga0068869_100270562 | 3300005334 | Bacteria | 1363 |
| 61 | Ga0068869_100280540 | 3300005334 | Bacteria | 1340 |
| 62 | Ga0068869_100866308 | 3300005334 | Bacteria | 780 |
| 63 | Ga0068869_100914381 | 3300005334 | Bacteria | 760 |
| 64 | Ga0070666_10118688 | 3300005335 | Bacteria | 1833 |
| 65 | Ga0070666_10578781 | 3300005335 | Bacteria | 818 |
| 66 | Ga0070666_10716842 | 3300005335 | Unclassified | 734 |
| 67 | Ga0070680_100951768 | 3300005336 | Unclassified | 741 |
| 68 | Ga0068868_100009443 | 3300005338 | Bacteria | 7021 |
| 69 | Ga0068868_100035076 | 3300005338 | Bacteria | 3876 |
| 70 | Ga0068868_100637045 | 3300005338 | Bacteria | 948 |
| 71 | Ga0068868_101715614 | 3300005338 | Bacteria | 592 |
| 72 | Ga0070660_100008023 | 3300005339 | Bacteria | 7379 |
| 73 | Ga0070660_100341540 | 3300005339 | Bacteria | 1232 |
| 74 | Ga0070689_100078740 | 3300005340 | Bacteria | 2584 |
| 75 | Ga0070687_100358331 | 3300005343 | Bacteria | 943 |
| 76 | Ga0070661_100001088 | 3300005344 | Bacteria | 19203 |
| 77 | Ga0070661_100248558 | 3300005344 | Bacteria | 1372 |
| 78 | Ga0070661_100394804 | 3300005344 | Bacteria | 1093 |
| 79 | Ga0070661_100552539 | 3300005344 | Unclassified | 926 |
| 80 | Ga0070661_100885046 | 3300005344 | Bacteria | 736 |
| 81 | Ga0070692_10004158 | 3300005345 | Bacteria | 5995 |
| 82 | Ga0070668_100020530 | 3300005347 | Bacteria | 4987 |
| 83 | Ga0070668_100329391 | 3300005347 | Bacteria | 1287 |
| 84 | Ga0070668_100743087 | 3300005347 | Bacteria | 868 |
| 85 | Ga0070669_100022076 | 3300005353 | Bacteria | 4553 |
| 86 | Ga0070669_100113789 | 3300005353 | Bacteria | 2056 |
| 87 | Ga0070675_100004356 | 3300005354 | Bacteria | 10791 |
| 88 | Ga0070675_100013239 | 3300005354 | Bacteria | 6483 |
| 89 | Ga0070675_100069593 | 3300005354 | Bacteria | 2916 |
| 90 | Ga0070671_100348620 | 3300005355 | Bacteria | 1263 |
| 91 | Ga0070674_100226733 | 3300005356 | Bacteria | 1456 |
| 92 | Ga0070673_100020834 | 3300005364 | Bacteria | 4738 |
| 93 | Ga0070673_100081701 | 3300005364 | Bacteria | 2621 |
| 94 | Ga0070673_100093732 | 3300005364 | Bacteria | 2460 |
| 95 | Ga0070673_100838826 | 3300005364 | Bacteria | 850 |
| 96 | Ga0070673_101116476 | 3300005364 | Bacteria | 737 |
| 97 | Ga0070688_100157273 | 3300005365 | Bacteria | 1559 |
| 98 | Ga0070688_100163550 | 3300005365 | Bacteria | 1531 |
| 99 | Ga0070688_100849343 | 3300005365 | Bacteria | 717 |
| 100 | Ga0070659_100005381 | 3300005366 | Bacteria | 9188 |
| 101 | Ga0070659_100189414 | 3300005366 | Bacteria | 1690 |
| 102 | Ga0070659_100311689 | 3300005366 | Bacteria | 1314 |
| 103 | Ga0070667_100003099 | 3300005367 | Bacteria | 14303 |
| 104 | Ga0070667_100012027 | 3300005367 | Bacteria | 7164 |
| 105 | Ga0070667_100025446 | 3300005367 | Bacteria | 4920 |
| 106 | Ga0070667_100176479 | 3300005367 | Bacteria | 1888 |
| 107 | Ga0070667_100783023 | 3300005367 | Unclassified | 885 |
| 108 | Ga0070714_100002739 | 3300005435 | Bacteria | 12979 |
| 109 | Ga0070700_100018494 | 3300005441 | Bacteria | 4006 |
| 110 | Ga0070700_100306428 | 3300005441 | Bacteria | 1161 |
| 111 | Ga0070694_100018628 | 3300005444 | Bacteria | 4408 |
| 112 | Ga0070663_100085402 | 3300005455 | Bacteria | 2329 |
| 113 | Ga0070663_100426950 | 3300005455 | Bacteria | 1088 |
| 114 | Ga0070678_100113175 | 3300005456 | Bacteria | 2127 |
| 115 | Ga0070678_100233511 | 3300005456 | Bacteria | 1534 |
| 116 | Ga0070678_100593398 | 3300005456 | Bacteria | 988 |
| 117 | Ga0070678_101830431 | 3300005456 | Bacteria | 573 |
| 118 | Ga0070662_100010527 | 3300005457 | Bacteria | 6074 |
| 119 | Ga0070662_100247329 | 3300005457 | Bacteria | 1432 |
| 120 | Ga0070662_101459081 | 3300005457 | Bacteria | 590 |
| 121 | Ga0070681_10034748 | 3300005458 | Bacteria | 5062 |
| 122 | Ga0068867_100001409 | 3300005459 | Bacteria | 16608 |
| 123 | Ga0068867_100013331 | 3300005459 | Bacteria | 5823 |
| 124 | Ga0068867_100059713 | 3300005459 | Bacteria | 2827 |
| 125 | Ga0068867_100109452 | 3300005459 | Bacteria | 2121 |
| 126 | Ga0068867_100144721 | 3300005459 | Bacteria | 1861 |
| 127 | Ga0068867_100236681 | 3300005459 | Bacteria | 1479 |
| 128 | Ga0068867_100840446 | 3300005459 | Bacteria | 822 |
| 129 | Ga0070685_10994582 | 3300005466 | Bacteria | 629 |
| 130 | Ga0070706_100014174 | 3300005467 | Bacteria | 7365 |
| 131 | Ga0070707_100032795 | 3300005468 | Bacteria | 4949 |
| 132 | Ga0070679_100029666 | 3300005530 | Bacteria | 5396 |
| 133 | Ga0070684_100006747 | 3300005535 | Bacteria | 8901 |
| 134 | Ga0070684_101032662 | 3300005535 | Unclassified | 772 |
| 135 | Ga0068853_100022449 | 3300005539 | Bacteria | 5270 |
| 136 | Ga0068853_101224347 | 3300005539 | Bacteria | 725 |
| 137 | Ga0070672_100001918 | 3300005543 | Bacteria | 13046 |
| 138 | Ga0070672_100007461 | 3300005543 | Bacteria | 7422 |
| 139 | Ga0070672_100037415 | 3300005543 | Bacteria | 3702 |
| 140 | Ga0070672_100296542 | 3300005543 | Bacteria | 1370 |
| 141 | Ga0070686_100000934 | 3300005544 | Bacteria | 16821 |
| 142 | Ga0070665_100125079 | 3300005548 | Bacteria | 2573 |
| 143 | Ga0070665_100176305 | 3300005548 | Bacteria | 2139 |
| 144 | Ga0070665_100651882 | 3300005548 | Bacteria | 1066 |
| 145 | Ga0070665_100797218 | 3300005548 | Bacteria | 958 |
| 146 | Ga0070665_100849149 | 3300005548 | Unclassified | 926 |
| 147 | Ga0068855_100000899 | 3300005563 | Bacteria | 36852 |
| 148 | Ga0068855_100009898 | 3300005563 | Bacteria | 11499 |
| 149 | Ga0068855_100026654 | 3300005563 | Bacteria | 6915 |
| 150 | Ga0068855_100041346 | 3300005563 | Bacteria | 5464 |
| 151 | Ga0068855_100129571 | 3300005563 | Bacteria | 2882 |
| 152 | Ga0068855_100290538 | 3300005563 | Bacteria | 1812 |
| 153 | Ga0068855_101784564 | 3300005563 | Bacteria | 625 |
| 154 | Ga0068855_102205600 | 3300005563 | Unclassified | 553 |
| 155 | Ga0068855_102490390 | 3300005563 | Unclassified | 515 |
| 156 | Ga0070664_100012427 | 3300005564 | Bacteria | 6919 |
| 157 | Ga0070664_100051593 | 3300005564 | Bacteria | 3482 |
| 158 | Ga0068857_100013188 | 3300005577 | Bacteria | 7203 |
| 159 | Ga0068857_100022930 | 3300005577 | Bacteria | 5492 |
| 160 | Ga0068857_100025706 | 3300005577 | Bacteria | 5184 |
| 161 | Ga0068857_100098504 | 3300005577 | Bacteria | 2622 |
| 162 | Ga0068857_100351971 | 3300005577 | Bacteria | 1364 |
| 163 | Ga0068857_100430714 | 3300005577 | Bacteria | 1231 |
| 164 | Ga0068857_100956919 | 3300005577 | Unclassified | 823 |
| 165 | Ga0068854_100003968 | 3300005578 | Bacteria | 9275 |
| 166 | Ga0068854_100028234 | 3300005578 | Bacteria | 3875 |
| 167 | Ga0068854_100090238 | 3300005578 | Bacteria | 2279 |
| 168 | Ga0068854_100102161 | 3300005578 | Bacteria | 2151 |
| 169 | Ga0068854_100116060 | 3300005578 | Bacteria | 2026 |
| 170 | Ga0068854_100615865 | 3300005578 | Unclassified | 928 |
| 171 | Ga0068856_100000887 | 3300005614 | Bacteria | 32039 |
| 172 | Ga0068856_100008336 | 3300005614 | Bacteria | 10097 |
| 173 | Ga0068856_100069023 | 3300005614 | Bacteria | 3495 |
| 174 | Ga0068856_100232885 | 3300005614 | Bacteria | 1857 |
| 175 | Ga0070702_100000571 | 3300005615 | Bacteria | 13448 |
| 176 | Ga0068852_100014656 | 3300005616 | Bacteria | 6045 |
| 177 | Ga0068852_100078291 | 3300005616 | Bacteria | 2925 |
| 178 | Ga0068852_100299390 | 3300005616 | Bacteria | 1556 |
| 179 | Ga0068852_101492726 | 3300005616 | Bacteria | 698 |
| 180 | Ga0068852_102178461 | 3300005616 | Bacteria | 576 |
| 181 | Ga0068859_100091161 | 3300005617 | Bacteria | 3098 |
| 182 | Ga0068859_100124734 | 3300005617 | Bacteria | 2643 |
| 183 | Ga0068859_100296945 | 3300005617 | Bacteria | 1709 |
| 184 | Ga0068864_100010671 | 3300005618 | Bacteria | 7592 |
| 185 | Ga0068864_100170920 | 3300005618 | Bacteria | 1982 |
| 186 | Ga0068864_100660326 | 3300005618 | Bacteria | 1019 |
| 187 | Ga0068864_100676311 | 3300005618 | Bacteria | 1007 |
| 188 | Ga0068861_100003204 | 3300005719 | Bacteria | 10828 |
| 189 | Ga0068861_100117369 | 3300005719 | Bacteria | 2141 |
| 190 | Ga0068851_10014082 | 3300005834 | Bacteria | 3792 |
| 191 | Ga0068851_10097987 | 3300005834 | Bacteria | 1552 |
| 192 | Ga0068851_10099999 | 3300005834 | Bacteria | 1538 |
| 193 | Ga0068870_10003323 | 3300005840 | Bacteria | 6801 |
| 194 | Ga0068870_10501577 | 3300005840 | Bacteria | 809 |
| 195 | Ga0068870_10870479 | 3300005840 | Bacteria | 634 |
| 196 | Ga0068863_100018071 | 3300005841 | Bacteria | 6752 |
| 197 | Ga0068863_100091707 | 3300005841 | Bacteria | 2881 |
| 198 | Ga0068863_100105308 | 3300005841 | Bacteria | 2683 |
| 199 | Ga0068858_100365766 | 3300005842 | Bacteria | 1383 |
| 200 | Ga0068860_100010532 | 3300005843 | Bacteria | 9135 |
| 201 | Ga0068862_100057571 | 3300005844 | Bacteria | 3334 |
| 202 | Ga0068862_100074688 | 3300005844 | Bacteria | 2931 |
| 203 | Ga0068862_100933363 | 3300005844 | Bacteria | 855 |
| 204 | Ga0075368_10045091 | 3300006042 | Bacteria | 1741 |
| 205 | Ga0075368_10097158 | 3300006042 | Bacteria | 1208 |
| 206 | Ga0075363_100002386 | 3300006048 | Bacteria | 7654 |
| 207 | Ga0075363_100048094 | 3300006048 | Bacteria | 2267 |
| 208 | Ga0075364_10028373 | 3300006051 | Bacteria | 3583 |
| 209 | Ga0075362_10001909 | 3300006177 | Bacteria | 6845 |
| 210 | Ga0075362_10003213 | 3300006177 | Bacteria | 5663 |
| 211 | Ga0075362_10044596 | 3300006177 | Bacteria | 1967 |
| 212 | Ga0075362_10104854 | 3300006177 | Bacteria | 1325 |
| 213 | Ga0075362_10177192 | 3300006177 | Bacteria | 1032 |
| 214 | Ga0075367_10099999 | 3300006178 | Bacteria | 1772 |
| 215 | Ga0075367_10126960 | 3300006178 | Bacteria | 1574 |
| 216 | Ga0075367_10281522 | 3300006178 | Bacteria | 1045 |
| 217 | Ga0075369_10028500 | 3300006186 | Bacteria | 2341 |
| 218 | Ga0075366_10005058 | 3300006195 | Bacteria | 7127 |
| 219 | Ga0075366_10023138 | 3300006195 | Bacteria | 3619 |
| 220 | Ga0075366_10057237 | 3300006195 | Bacteria | 2317 |
| 221 | Ga0075366_10060280 | 3300006195 | Bacteria | 2254 |
| 222 | Ga0075366_10081143 | 3300006195 | Bacteria | 1937 |
| 223 | Ga0075366_10092862 | 3300006195 | Bacteria | 1808 |
| 224 | Ga0075366_10120320 | 3300006195 | Bacteria | 1582 |
| 225 | Ga0075366_10159629 | 3300006195 | Bacteria | 1366 |
| 226 | Ga0075366_10174278 | 3300006195 | Bacteria | 1306 |
| 227 | Ga0075366_10208037 | 3300006195 | Bacteria | 1191 |
| 228 | Ga0075366_10454329 | 3300006195 | Bacteria | 790 |
| 229 | Ga0075366_10658274 | 3300006195 | Bacteria | 650 |
| 230 | Ga0097621_100000834 | 3300006237 | Bacteria | 21739 |
| 231 | Ga0075370_10000059 | 3300006353 | Bacteria | 32632 |
| 232 | Ga0075370_10000087 | 3300006353 | Bacteria | 28459 |
| 233 | Ga0075370_10000813 | 3300006353 | Bacteria | 12535 |
| 234 | Ga0075370_10002533 | 3300006353 | Bacteria | 8490 |
| 235 | Ga0075370_10071038 | 3300006353 | Bacteria | 1991 |
| 236 | Ga0075370_10165448 | 3300006353 | Bacteria | 1299 |
| 237 | Ga0075370_10274767 | 3300006353 | Bacteria | 1000 |
| 238 | Ga0075370_10313695 | 3300006353 | Bacteria | 933 |
| 239 | Ga0068871_100392947 | 3300006358 | Bacteria | 1234 |
| 240 | Ga0075428_100188651 | 3300006844 | Bacteria | 2230 |
| 241 | Ga0075430_100025785 | 3300006846 | Bacteria | 5002 |
| 242 | Ga0075434_101580907 | 3300006871 | Bacteria | 664 |
| 243 | Ga0075429_100001289 | 3300006880 | Bacteria | 20430 |
| 244 | Ga0068865_100023460 | 3300006881 | Bacteria | 4039 |
| 245 | Ga0068865_100064205 | 3300006881 | Bacteria | 2583 |
| 246 | Ga0068865_100276381 | 3300006881 | Bacteria | 1335 |
| 247 | Ga0097620_100091157 | 3300006931 | Bacteria | 3098 |
| 248 | Ga0097620_100124739 | 3300006931 | Bacteria | 2643 |
| 249 | Ga0097620_100296946 | 3300006931 | Bacteria | 1709 |
| 250 | Ga0079104_1004321 | 3300006946 | Bacteria | 6144 |
| 251 | Ga0099794_10143398 | 3300007265 | Bacteria | 1210 |
| 252 | Ga0105251_10026119 | 3300009011 | Bacteria | 2977 |
| 253 | Ga0105240_10001001 | 3300009093 | Bacteria | 50438 |
| 254 | Ga0105240_10004920 | 3300009093 | Bacteria | 20087 |
| 255 | Ga0105240_10035820 | 3300009093 | Bacteria | 6391 |
| 256 | Ga0105240_10064762 | 3300009093 | Bacteria | 4540 |
| 257 | Ga0105240_10110979 | 3300009093 | Bacteria | 3318 |
| 258 | Ga0105240_10151438 | 3300009093 | Bacteria | 2762 |
| 259 | Ga0105240_10580327 | 3300009093 | Bacteria | 1237 |
| 260 | Ga0105240_11387397 | 3300009093 | Bacteria | 739 |
| 261 | Ga0105240_11511099 | 3300009093 | Bacteria | 704 |
| 262 | Ga0111539_11726941 | 3300009094 | Bacteria | 726 |
| 263 | Ga0105245_10000241 | 3300009098 | Bacteria | 52084 |
| 264 | Ga0105245_10055064 | 3300009098 | Bacteria | 3572 |
| 265 | Ga0105245_10702000 | 3300009098 | Bacteria | 1045 |
| 266 | Ga0105245_10767526 | 3300009098 | Bacteria | 1001 |
| 267 | Ga0105245_10791525 | 3300009098 | Bacteria | 986 |
| 268 | Ga0105245_11483078 | 3300009098 | Unclassified | 729 |
| 269 | Ga0105247_10209395 | 3300009101 | Bacteria | 1314 |
| 270 | Ga0105247_10260653 | 3300009101 | Bacteria | 1189 |
| 271 | Ga0105247_11251157 | 3300009101 | Unclassified | 593 |
| 272 | Ga0114129_10496322 | 3300009147 | Bacteria | 1595 |
| 273 | Ga0105243_10000390 | 3300009148 | Bacteria | 46725 |
| 274 | Ga0105243_10020375 | 3300009148 | Bacteria | 5029 |
| 275 | Ga0105243_11877900 | 3300009148 | Bacteria | 631 |
| 276 | Ga0105241_10079604 | 3300009174 | Bacteria | 2563 |
| 277 | Ga0105241_10082320 | 3300009174 | Bacteria | 2522 |
| 278 | Ga0105241_10101868 | 3300009174 | Bacteria | 2284 |
| 279 | Ga0105241_11137689 | 3300009174 | Unclassified | 737 |
| 280 | Ga0105242_10185158 | 3300009176 | Bacteria | 1840 |
| 281 | Ga0105248_10331566 | 3300009177 | Bacteria | 1714 |
| 282 | Ga0105248_10827088 | 3300009177 | Bacteria | 1045 |
| 283 | Ga0105248_10979732 | 3300009177 | Bacteria | 955 |
| 284 | Ga0105248_11305591 | 3300009177 | Bacteria | 821 |
| 285 | Ga0105248_13176897 | 3300009177 | Unclassified | 523 |
| 286 | Ga0105237_10045864 | 3300009545 | Bacteria | 4398 |
| 287 | Ga0105237_10187694 | 3300009545 | Bacteria | 2067 |
| 288 | Ga0105237_10208760 | 3300009545 | Bacteria | 1953 |
| 289 | Ga0105237_10251517 | 3300009545 | Bacteria | 1769 |
| 290 | Ga0105237_10389651 | 3300009545 | Bacteria | 1398 |
| 291 | Ga0105237_10501577 | 3300009545 | Bacteria | 1220 |
| 292 | Ga0105238_10000738 | 3300009551 | Bacteria | 34144 |
| 293 | Ga0105238_10002979 | 3300009551 | Bacteria | 16912 |
| 294 | Ga0105238_10408954 | 3300009551 | Bacteria | 1351 |
| 295 | Ga0105238_10690928 | 3300009551 | Bacteria | 1032 |
| 296 | Ga0105238_10777075 | 3300009551 | Bacteria | 972 |
| 297 | Ga0105249_10008116 | 3300009553 | Bacteria | 9153 |
| 298 | Ga0105249_10173015 | 3300009553 | Bacteria | 2095 |
| 299 | Ga0105249_11428734 | 3300009553 | Bacteria | 764 |
| 300 | Ga0105239_10010208 | 3300010375 | Bacteria | 10520 |
| 301 | Ga0105239_10019338 | 3300010375 | Bacteria | 7522 |
| 302 | Ga0105239_10329892 | 3300010375 | Bacteria | 1721 |
| 303 | Ga0105239_10337678 | 3300010375 | Bacteria | 1700 |
| 304 | Ga0105239_12366395 | 3300010375 | Bacteria | 618 |
| 305 | Ga0105239_12503689 | 3300010375 | Bacteria | 601 |
| 306 | Ga0105246_10041666 | 3300011119 | Bacteria | 3105 |
| 307 | Ga0105246_12451221 | 3300011119 | Unclassified | 513 |
| 308 | Ga0157373_10030602 | 3300013100 | Bacteria | 3873 |
| 309 | Ga0157373_10350290 | 3300013100 | Bacteria | 1053 |
| 310 | Ga0157370_10005091 | 3300013104 | Bacteria | 14831 |
| 311 | Ga0157369_10005877 | 3300013105 | Bacteria | 14257 |
| 312 | Ga0157369_10112116 | 3300013105 | Bacteria | 2898 |
| 313 | Ga0157374_10099755 | 3300013296 | Bacteria | 2782 |
| 314 | Ga0157374_10181754 | 3300013296 | Bacteria | 2055 |
| 315 | Ga0157374_11080750 | 3300013296 | Unclassified | 822 |
| 316 | Ga0157378_10000691 | 3300013297 | Bacteria | 31706 |
| 317 | Ga0157378_10146556 | 3300013297 | Bacteria | 2196 |
| 318 | Ga0157378_10238755 | 3300013297 | Bacteria | 1735 |
| 319 | Ga0157378_11353466 | 3300013297 | Bacteria | 754 |
| 320 | Ga0163162_10109784 | 3300013306 | Bacteria | 2855 |
| 321 | Ga0163162_10128309 | 3300013306 | Bacteria | 2644 |
| 322 | Ga0163162_10247762 | 3300013306 | Bacteria | 1913 |
| 323 | Ga0163162_10322669 | 3300013306 | Bacteria | 1677 |
| 324 | Ga0163162_10343177 | 3300013306 | Bacteria | 1626 |
| 325 | Ga0163162_12085872 | 3300013306 | Bacteria | 650 |
| 326 | Ga0157372_10023891 | 3300013307 | Bacteria | 6632 |
| 327 | Ga0157372_10345474 | 3300013307 | Bacteria | 1734 |
| 328 | Ga0157375_10099480 | 3300013308 | Bacteria | 2987 |
| 329 | Ga0157375_10103460 | 3300013308 | Bacteria | 2934 |
| 330 | Ga0157375_10133410 | 3300013308 | Bacteria | 2605 |
| 331 | Ga0157375_10133527 | 3300013308 | Bacteria | 2603 |
| 332 | Ga0157375_10534409 | 3300013308 | Bacteria | 1335 |
| 333 | Ga0157375_10606622 | 3300013308 | Bacteria | 1253 |
| 334 | Ga0163163_10007845 | 3300014325 | Bacteria | 9441 |
| 335 | Ga0163163_10349218 | 3300014325 | Bacteria | 1535 |
| 336 | Ga0163163_10453346 | 3300014325 | Bacteria | 1343 |
| 337 | Ga0157380_10030112 | 3300014326 | Bacteria | 4155 |
| 338 | Ga0157380_10484356 | 3300014326 | Bacteria | 1197 |
| 339 | Ga0182008_10010381 | 3300014497 | Bacteria | 4985 |
| 340 | Ga0157379_10001790 | 3300014968 | Bacteria | 17741 |
| 341 | Ga0157379_10006875 | 3300014968 | Bacteria | 9835 |
| 342 | Ga0157379_10028002 | 3300014968 | Bacteria | 5016 |
| 343 | Ga0157379_10301397 | 3300014968 | Bacteria | 1461 |
| 344 | Ga0157379_10447386 | 3300014968 | Bacteria | 1192 |
| 345 | Ga0157379_10572138 | 3300014968 | Bacteria | 1053 |
| 346 | Ga0157379_11098943 | 3300014968 | Bacteria | 761 |
| 347 | Ga0157379_11763756 | 3300014968 | Unclassified | 607 |
| 348 | Ga0157379_12395590 | 3300014968 | Bacteria | 527 |
| 349 | Ga0157376_10088635 | 3300014969 | Bacteria | 2673 |
| 350 | Ga0157376_11381334 | 3300014969 | Bacteria | 735 |
| 351 | Ga0182006_1019521 | 3300015261 | Bacteria | 2853 |
| 352 | Ga0182006_1069162 | 3300015261 | Bacteria | 1314 |
| 353 | Ga0182007_10101261 | 3300015262 | Bacteria | 954 |
| 354 | Ga0182007_10234420 | 3300015262 | Bacteria | 653 |
| 355 | Ga0163161_10803624 | 3300017792 | Bacteria | 790 |
| 356 | Ga0163161_11531719 | 3300017792 | Bacteria | 586 |
| 357 | Ga0213872_10000058 | 3300021361 | Bacteria | 100531 |
| 358 | Ga0213872_10000102 | 3300021361 | Bacteria | 79440 |
| 359 | Ga0213872_10000150 | 3300021361 | Bacteria | 63730 |
| 360 | Ga0213872_10004383 | 3300021361 | Bacteria | 7513 |
| 361 | Ga0213872_10153162 | 3300021361 | Unclassified | 1006 |
| 362 | Ga0213872_10339958 | 3300021361 | Bacteria | 617 |
| 363 | Ga0213875_10077329 | 3300021388 | Bacteria | 1553 |
| 364 | Ga0209435_100015 | 3300025206 | Bacteria | 321177 |
| 365 | Ga0209435_100288 | 3300025206 | Bacteria | 12225 |
| 366 | Ga0209784_100005 | 3300025224 | Bacteria | 1040422 |
| 367 | Ga0209566_100005 | 3300025225 | Bacteria | 1040422 |
| 368 | Ga0209674_100009 | 3300025226 | Bacteria | 1040422 |
| 369 | Ga0209674_100064 | 3300025226 | Bacteria | 265769 |
| 370 | Ga0209147_100004 | 3300025229 | Bacteria | 1371850 |
| 371 | Ga0209563_100012 | 3300025230 | Bacteria | 1040422 |
| 372 | Ga0209563_100126 | 3300025230 | Bacteria | 113122 |
| 373 | Ga0207427_100197 | 3300025231 | Bacteria | 57629 |
| 374 | Ga0209437_100268 | 3300025233 | Bacteria | 79327 |
| 375 | Ga0209258_100298 | 3300025242 | Bacteria | 81047 |
| 376 | Ga0209258_100736 | 3300025242 | Bacteria | 21300 |
| 377 | Ga0209258_100787 | 3300025242 | Bacteria | 19150 |
| 378 | Ga0209646_1000040 | 3300025246 | Bacteria | 347867 |
| 379 | Ga0209646_1000060 | 3300025246 | Bacteria | 256386 |
| 380 | Ga0209646_1000105 | 3300025246 | Bacteria | 163453 |
| 381 | Ga0209026_1000034 | 3300025250 | Bacteria | 306953 |
| 382 | Ga0209026_1000049 | 3300025250 | Bacteria | 255273 |
| 383 | Ga0209677_100006 | 3300025253 | Bacteria | 1040422 |
| 384 | Ga0209677_100411 | 3300025253 | Bacteria | 25661 |
| 385 | Ga0209677_101394 | 3300025253 | Bacteria | 10483 |
| 386 | Ga0209677_109255 | 3300025253 | Bacteria | 1794 |
| 387 | Ga0209148_1012868 | 3300025254 | Bacteria | 1518 |
| 388 | Ga0209148_1022957 | 3300025254 | Bacteria | 997 |
| 389 | Ga0209759_1000069 | 3300025256 | Bacteria | 182437 |
| 390 | Ga0209759_1000234 | 3300025256 | Bacteria | 83099 |
| 391 | Ga0209759_1000569 | 3300025256 | Bacteria | 37040 |
| 392 | Ga0209759_1001582 | 3300025256 | Bacteria | 12362 |
| 393 | Ga0209759_1002582 | 3300025256 | Bacteria | 7830 |
| 394 | Ga0209759_1016603 | 3300025256 | Bacteria | 1850 |
| 395 | Ga0209759_1020690 | 3300025256 | Bacteria | 1518 |
| 396 | Ga0207666_1014266 | 3300025271 | Bacteria | 1122 |
| 397 | Ga0209455_1002003 | 3300025272 | Bacteria | 8360 |
| 398 | Ga0209455_1005524 | 3300025272 | Bacteria | 3887 |
| 399 | Ga0209455_1029989 | 3300025272 | Bacteria | 931 |
| 400 | Ga0209758_1000233 | 3300025297 | Bacteria | 116640 |
| 401 | Ga0209051_1000140 | 3300025303 | Bacteria | 135919 |
| 402 | Ga0209051_1001699 | 3300025303 | Bacteria | 17625 |
| 403 | Ga0209051_1008265 | 3300025303 | Bacteria | 5536 |
| 404 | Ga0209051_1029310 | 3300025303 | Bacteria | 2156 |
| 405 | Ga0209257_1000012 | 3300025304 | Bacteria | 1111138 |
| 406 | Ga0209257_1000045 | 3300025304 | Bacteria | 484429 |
| 407 | Ga0209257_1063458 | 3300025304 | Bacteria | 996 |
| 408 | Ga0207697_10185402 | 3300025315 | Bacteria | 913 |
| 409 | Ga0207656_10018424 | 3300025321 | Bacteria | 2749 |
| 410 | Ga0207656_10106539 | 3300025321 | Bacteria | 1291 |
| 411 | Ga0207656_10137890 | 3300025321 | Bacteria | 1148 |
| 412 | Ga0207656_10234031 | 3300025321 | Bacteria | 896 |
| 413 | Ga0207656_10407251 | 3300025321 | Unclassified | 684 |
| 414 | Ga0207710_10166332 | 3300025900 | Bacteria | 1076 |
| 415 | Ga0207680_10301289 | 3300025903 | Bacteria | 1117 |
| 416 | Ga0207645_10004810 | 3300025907 | Bacteria | 9928 |
| 417 | Ga0207645_10034993 | 3300025907 | Bacteria | 3226 |
| 418 | Ga0207643_10023140 | 3300025908 | Bacteria | 3425 |
| 419 | Ga0207643_10089604 | 3300025908 | Bacteria | 1792 |
| 420 | Ga0207643_10164665 | 3300025908 | Bacteria | 1335 |
| 421 | Ga0207705_10035791 | 3300025909 | Bacteria | 3552 |
| 422 | Ga0207705_10162995 | 3300025909 | Bacteria | 1676 |
| 423 | Ga0207705_10233564 | 3300025909 | Bacteria | 1399 |
| 424 | Ga0207684_10012635 | 3300025910 | Bacteria | 7333 |
| 425 | Ga0207654_10378130 | 3300025911 | Bacteria | 980 |
| 426 | Ga0207654_10834454 | 3300025911 | Bacteria | 667 |
| 427 | Ga0207707_10036063 | 3300025912 | Bacteria | 4325 |
| 428 | Ga0207695_10000573 | 3300025913 | Bacteria | 75332 |
| 429 | Ga0207695_10004109 | 3300025913 | Bacteria | 20007 |
| 430 | Ga0207695_10006006 | 3300025913 | Bacteria | 15874 |
| 431 | Ga0207695_10030732 | 3300025913 | Bacteria | 5910 |
| 432 | Ga0207695_10080469 | 3300025913 | Bacteria | 3299 |
| 433 | Ga0207695_10099795 | 3300025913 | Bacteria | 2900 |
| 434 | Ga0207695_10255540 | 3300025913 | Bacteria | 1651 |
| 435 | Ga0207671_10046969 | 3300025914 | Bacteria | 3195 |
| 436 | Ga0207671_10225306 | 3300025914 | Bacteria | 1470 |
| 437 | Ga0207671_10248091 | 3300025914 | Bacteria | 1399 |
| 438 | Ga0207671_10302330 | 3300025914 | Bacteria | 1264 |
| 439 | Ga0207671_10775753 | 3300025914 | Bacteria | 761 |
| 440 | Ga0207660_10906699 | 3300025917 | Unclassified | 719 |
| 441 | Ga0207660_10990277 | 3300025917 | Bacteria | 686 |
| 442 | Ga0207657_10024892 | 3300025919 | Bacteria | 5532 |
| 443 | Ga0207657_10286982 | 3300025919 | Bacteria | 1306 |
| 444 | Ga0207657_10727761 | 3300025919 | Unclassified | 769 |
| 445 | Ga0207657_10765968 | 3300025919 | Bacteria | 747 |
| 446 | Ga0207649_10002217 | 3300025920 | Bacteria | 10974 |
| 447 | Ga0207649_10563024 | 3300025920 | Unclassified | 873 |
| 448 | Ga0207652_10047116 | 3300025921 | Bacteria | 3681 |
| 449 | Ga0207652_10310463 | 3300025921 | Bacteria | 1423 |
| 450 | Ga0207646_10198051 | 3300025922 | Bacteria | 1814 |
| 451 | Ga0207681_10005071 | 3300025923 | Bacteria | 8095 |
| 452 | Ga0207681_10208885 | 3300025923 | Bacteria | 1503 |
| 453 | Ga0207694_10000505 | 3300025924 | Bacteria | 35291 |
| 454 | Ga0207694_10010773 | 3300025924 | Bacteria | 6903 |
| 455 | Ga0207694_10361493 | 3300025924 | Bacteria | 1203 |
| 456 | Ga0207694_10384437 | 3300025924 | Bacteria | 1165 |
| 457 | Ga0207694_10783681 | 3300025924 | Bacteria | 805 |
| 458 | Ga0207694_10819862 | 3300025924 | Bacteria | 786 |
| 459 | Ga0207650_10022889 | 3300025925 | Bacteria | 4427 |
| 460 | Ga0207650_10023873 | 3300025925 | Bacteria | 4341 |
| 461 | Ga0207650_10050850 | 3300025925 | Bacteria | 3066 |
| 462 | Ga0207650_10053437 | 3300025925 | Bacteria | 2994 |
| 463 | Ga0207650_10075425 | 3300025925 | Bacteria | 2545 |
| 464 | Ga0207650_10370508 | 3300025925 | Bacteria | 1181 |
| 465 | Ga0207650_10373791 | 3300025925 | Bacteria | 1176 |
| 466 | Ga0207659_10009257 | 3300025926 | Bacteria | 6152 |
| 467 | Ga0207659_10110207 | 3300025926 | Bacteria | 2091 |
| 468 | Ga0207659_10587076 | 3300025926 | Bacteria | 949 |
| 469 | Ga0207687_10000799 | 3300025927 | Bacteria | 21252 |
| 470 | Ga0207687_10060589 | 3300025927 | Bacteria | 2670 |
| 471 | Ga0207687_10241914 | 3300025927 | Bacteria | 1431 |
| 472 | Ga0207687_11504785 | 3300025927 | Bacteria | 578 |
| 473 | Ga0207664_10050874 | 3300025929 | Bacteria | 3269 |
| 474 | Ga0207644_10017024 | 3300025931 | Bacteria | 4901 |
| 475 | Ga0207644_10092568 | 3300025931 | Bacteria | 2256 |
| 476 | Ga0207644_10332254 | 3300025931 | Bacteria | 1231 |
| 477 | Ga0207644_10362591 | 3300025931 | Bacteria | 1179 |
| 478 | Ga0207644_11190387 | 3300025931 | Bacteria | 640 |
| 479 | Ga0207690_10013867 | 3300025932 | Bacteria | 4855 |
| 480 | Ga0207690_10189386 | 3300025932 | Bacteria | 1555 |
| 481 | Ga0207706_10074485 | 3300025933 | Bacteria | 2985 |
| 482 | Ga0207706_10132942 | 3300025933 | Bacteria | 2188 |
| 483 | Ga0207686_10004205 | 3300025934 | Bacteria | 7723 |
| 484 | Ga0207686_10276959 | 3300025934 | Bacteria | 1237 |
| 485 | Ga0207709_10060578 | 3300025935 | Bacteria | 2361 |
| 486 | Ga0207709_11177358 | 3300025935 | Bacteria | 631 |
| 487 | Ga0207670_10051735 | 3300025936 | Bacteria | 2760 |
| 488 | Ga0207669_10068061 | 3300025937 | Bacteria | 2222 |
| 489 | Ga0207669_10182940 | 3300025937 | Bacteria | 1504 |
| 490 | Ga0207669_10535201 | 3300025937 | Bacteria | 943 |
| 491 | Ga0207704_10058715 | 3300025938 | Bacteria | 2370 |
| 492 | Ga0207691_10004143 | 3300025940 | Bacteria | 14086 |
| 493 | Ga0207691_10006762 | 3300025940 | Bacteria | 11060 |
| 494 | Ga0207691_10024653 | 3300025940 | Bacteria | 5657 |
| 495 | Ga0207691_10061422 | 3300025940 | Bacteria | 3413 |
| 496 | Ga0207711_10011889 | 3300025941 | Bacteria | 7235 |
| 497 | Ga0207711_10549147 | 3300025941 | Bacteria | 1078 |
| 498 | Ga0207711_10620816 | 3300025941 | Bacteria | 1009 |
| 499 | Ga0207689_10000452 | 3300025942 | Bacteria | 38652 |
| 500 | Ga0207689_10147813 | 3300025942 | Bacteria | 1936 |
| 501 | Ga0207689_10584203 | 3300025942 | Bacteria | 939 |
| 502 | Ga0207689_10757036 | 3300025942 | Bacteria | 820 |
| 503 | Ga0207661_10028466 | 3300025944 | Bacteria | 4279 |
| 504 | Ga0207661_10866758 | 3300025944 | Bacteria | 832 |
| 505 | Ga0207679_10117544 | 3300025945 | Bacteria | 2110 |
| 506 | Ga0207679_10139525 | 3300025945 | Bacteria | 1957 |
| 507 | Ga0207679_10850953 | 3300025945 | Bacteria | 833 |
| 508 | Ga0207667_10000053 | 3300025949 | Bacteria | 226712 |
| 509 | Ga0207667_10026989 | 3300025949 | Bacteria | 6264 |
| 510 | Ga0207667_10028711 | 3300025949 | Bacteria | 6039 |
| 511 | Ga0207667_10052477 | 3300025949 | Bacteria | 4294 |
| 512 | Ga0207667_10248612 | 3300025949 | Bacteria | 1819 |
| 513 | Ga0207667_12123069 | 3300025949 | Unclassified | 520 |
| 514 | Ga0207651_10069538 | 3300025960 | Bacteria | 2486 |
| 515 | Ga0207651_10088444 | 3300025960 | Bacteria | 2258 |
| 516 | Ga0207651_10105872 | 3300025960 | Bacteria | 2099 |
| 517 | Ga0207651_10413338 | 3300025960 | Bacteria | 1150 |
| 518 | Ga0207651_11251062 | 3300025960 | Bacteria | 667 |
| 519 | Ga0207712_10123168 | 3300025961 | Bacteria | 1965 |
| 520 | Ga0207668_10012253 | 3300025972 | Bacteria | 5243 |
| 521 | Ga0207668_10247602 | 3300025972 | Bacteria | 1446 |
| 522 | Ga0207668_10407248 | 3300025972 | Bacteria | 1151 |
| 523 | Ga0207668_11296762 | 3300025972 | Bacteria | 655 |
| 524 | Ga0207640_10031492 | 3300025981 | Bacteria | 3277 |
| 525 | Ga0207640_10049985 | 3300025981 | Bacteria | 2710 |
| 526 | Ga0207640_10112897 | 3300025981 | Bacteria | 1930 |
| 527 | Ga0207640_10212227 | 3300025981 | Bacteria | 1476 |
| 528 | Ga0207640_10380006 | 3300025981 | Bacteria | 1144 |
| 529 | Ga0207658_10047106 | 3300025986 | Bacteria | 3153 |
| 530 | Ga0207658_10050043 | 3300025986 | Bacteria | 3073 |
| 531 | Ga0207658_10061349 | 3300025986 | Bacteria | 2809 |
| 532 | Ga0207658_10125710 | 3300025986 | Bacteria | 2052 |
| 533 | Ga0207658_10968704 | 3300025986 | Bacteria | 776 |
| 534 | Ga0207677_10031338 | 3300026023 | Bacteria | 3405 |
| 535 | Ga0207677_10051376 | 3300026023 | Bacteria | 2795 |
| 536 | Ga0207677_10774884 | 3300026023 | Bacteria | 857 |
| 537 | Ga0207677_11011251 | 3300026023 | Bacteria | 754 |
| 538 | Ga0207677_11999619 | 3300026023 | Bacteria | 539 |
| 539 | Ga0207703_10003194 | 3300026035 | Bacteria | 13797 |
| 540 | Ga0207703_10399632 | 3300026035 | Bacteria | 1275 |
| 541 | Ga0207639_10075141 | 3300026041 | Bacteria | 2656 |
| 542 | Ga0207639_10144245 | 3300026041 | Bacteria | 1987 |
| 543 | Ga0207639_11096435 | 3300026041 | Bacteria | 747 |
| 544 | Ga0207639_11415759 | 3300026041 | Bacteria | 652 |
| 545 | Ga0207678_10106297 | 3300026067 | Bacteria | 2394 |
| 546 | Ga0207678_10373059 | 3300026067 | Bacteria | 1233 |
| 547 | Ga0207708_10000701 | 3300026075 | Bacteria | 25411 |
| 548 | Ga0207702_10022449 | 3300026078 | Bacteria | 5231 |
| 549 | Ga0207702_10083504 | 3300026078 | Bacteria | 2779 |
| 550 | Ga0207702_10204748 | 3300026078 | Bacteria | 1831 |
| 551 | Ga0207641_10009598 | 3300026088 | Bacteria | 7974 |
| 552 | Ga0207641_10026935 | 3300026088 | Bacteria | 4747 |
| 553 | Ga0207641_10272468 | 3300026088 | Bacteria | 1589 |
| 554 | Ga0207648_10000159 | 3300026089 | Bacteria | 69221 |
| 555 | Ga0207648_10003372 | 3300026089 | Bacteria | 16778 |
| 556 | Ga0207648_10038891 | 3300026089 | Bacteria | 4185 |
| 557 | Ga0207648_10071567 | 3300026089 | Bacteria | 3022 |
| 558 | Ga0207648_10160108 | 3300026089 | Bacteria | 1988 |
| 559 | Ga0207648_10506563 | 3300026089 | Bacteria | 1105 |
| 560 | Ga0207648_10542851 | 3300026089 | Bacteria | 1067 |
| 561 | Ga0207648_10738928 | 3300026089 | Bacteria | 914 |
| 562 | Ga0207676_10003896 | 3300026095 | Bacteria | 10542 |
| 563 | Ga0207676_10037088 | 3300026095 | Bacteria | 3712 |
| 564 | Ga0207676_10620870 | 3300026095 | Bacteria | 1040 |
| 565 | Ga0207674_10000954 | 3300026116 | Bacteria | 37774 |
| 566 | Ga0207674_10006659 | 3300026116 | Bacteria | 13573 |
| 567 | Ga0207674_10022384 | 3300026116 | Bacteria | 6786 |
| 568 | Ga0207674_10121427 | 3300026116 | Bacteria | 2580 |
| 569 | Ga0207674_10435399 | 3300026116 | Bacteria | 1267 |
| 570 | Ga0207674_10437071 | 3300026116 | Bacteria | 1265 |
| 571 | Ga0207674_10636845 | 3300026116 | Bacteria | 1029 |
| 572 | Ga0207674_10975356 | 3300026116 | Bacteria | 816 |
| 573 | Ga0207674_11234974 | 3300026116 | Bacteria | 717 |
| 574 | Ga0207675_100000068 | 3300026118 | Bacteria | 78105 |
| 575 | Ga0207675_100037965 | 3300026118 | Bacteria | 4494 |
| 576 | Ga0207675_100213377 | 3300026118 | Bacteria | 1857 |
| 577 | Ga0207675_100454833 | 3300026118 | Bacteria | 1269 |
| 578 | Ga0207683_10013791 | 3300026121 | Bacteria | 6891 |
| 579 | Ga0207683_10093306 | 3300026121 | Bacteria | 2682 |
| 580 | Ga0207683_10598439 | 3300026121 | Bacteria | 1020 |
| 581 | Ga0207698_10007618 | 3300026142 | Bacteria | 6789 |
| 582 | Ga0207698_10025226 | 3300026142 | Bacteria | 4184 |
| 583 | Ga0207698_10698688 | 3300026142 | Bacteria | 1009 |
| 584 | Ga0207698_10767765 | 3300026142 | Bacteria | 964 |
| 585 | Ga0207698_11320615 | 3300026142 | Bacteria | 736 |
| 586 | Ga0209281_1007305 | 3300027111 | Bacteria | 2782 |
| 587 | Ga0209813_10008368 | 3300027866 | Bacteria | 2611 |
| 588 | Ga0209813_10140803 | 3300027866 | Bacteria | 856 |
| 589 | Ga0268266_10037951 | 3300028379 | Bacteria | 4102 |
| 590 | Ga0268266_10707477 | 3300028379 | Unclassified | 971 |
| 591 | Ga0268265_10016151 | 3300028380 | Bacteria | 5125 |
| 592 | Ga0268265_10031173 | 3300028380 | Bacteria | 3849 |
| 593 | Ga0268265_10050837 | 3300028380 | Bacteria | 3125 |
| 594 | Ga0268265_10223199 | 3300028380 | Bacteria | 1650 |
| 595 | Ga0268265_12588079 | 3300028380 | Bacteria | 513 |
| 596 | Ga0268264_10020364 | 3300028381 | Bacteria | 5421 |
| 597 | Ga0268264_10149599 | 3300028381 | Bacteria | 2092 |
| 598 | Ga0268264_10241375 | 3300028381 | Bacteria | 1674 |
| 599 | Ga0268264_10804770 | 3300028381 | Bacteria | 939 |
| 600 | Ga0265336_10000123 | 3300028666 | Bacteria | 57956 |
| 601 | Ga0307517_10002354 | 3300028786 | Bacteria | 30505 |
| 602 | Ga0307517_10077719 | 3300028786 | Bacteria | 2880 |
| 603 | Ga0307517_10318467 | 3300028786 | Bacteria | 862 |
| 604 | Ga0307515_10015864 | 3300028794 | Bacteria | 13844 |
| 605 | Ga0307515_10106461 | 3300028794 | Bacteria | 3327 |
| 606 | Ga0307515_10254589 | 3300028794 | Bacteria | 1502 |
| 607 | Ga0307515_10583058 | 3300028794 | Bacteria | 728 |
| 608 | Ga0265324_10000849 | 3300029957 | Bacteria | 19632 |
| 609 | Ga0307511_10253296 | 3300030521 | Bacteria | 843 |
| 610 | Ga0307512_10182106 | 3300030522 | Bacteria | 1178 |
| 611 | Ga0307512_10233028 | 3300030522 | Bacteria | 943 |
| 612 | Ga0307512_10252093 | 3300030522 | Bacteria | 878 |
| 613 | Ga0265332_10000278 | 3300031238 | Bacteria | 40354 |
| 614 | Ga0265331_10009024 | 3300031250 | Bacteria | 5634 |
| 615 | Ga0265331_10058535 | 3300031250 | Bacteria | 1824 |
| 616 | Ga0265327_10000328 | 3300031251 | Bacteria | 90489 |
| 617 | Ga0307513_10021976 | 3300031456 | Bacteria | 7515 |
| 618 | Ga0307513_10195711 | 3300031456 | Bacteria | 1868 |
| 619 | Ga0307513_10380145 | 3300031456 | Bacteria | 1152 |
| 620 | Ga0307509_10000234 | 3300031507 | Bacteria | 89398 |
| 621 | Ga0307509_10039607 | 3300031507 | Bacteria | 5132 |
| 622 | Ga0307509_10090207 | 3300031507 | Bacteria | 3141 |
| 623 | Ga0307509_10112558 | 3300031507 | Bacteria | 2721 |
| 624 | Ga0307509_10120503 | 3300031507 | Bacteria | 2602 |
| 625 | Ga0307509_10902039 | 3300031507 | Unclassified | 549 |
| 626 | Ga0307408_100211432 | 3300031548 | Bacteria | 1576 |
| 627 | Ga0307408_100603774 | 3300031548 | Bacteria | 975 |
| 628 | Ga0307508_10001066 | 3300031616 | Bacteria | 31732 |
| 629 | Ga0307508_10088896 | 3300031616 | Bacteria | 2673 |
| 630 | Ga0307514_10052858 | 3300031649 | Bacteria | 3137 |
| 631 | Ga0307514_10062249 | 3300031649 | Bacteria | 2839 |
| 632 | Ga0307514_10253912 | 3300031649 | Bacteria | 1037 |
| 633 | Ga0307514_10414020 | 3300031649 | Bacteria | 681 |
| 634 | Ga0307516_10037289 | 3300031730 | Bacteria | 4861 |
| 635 | Ga0307516_10090008 | 3300031730 | Bacteria | 2898 |
| 636 | Ga0307516_10124340 | 3300031730 | Bacteria | 2366 |
| 637 | Ga0307516_10143470 | 3300031730 | Bacteria | 2155 |
| 638 | Ga0307516_10613533 | 3300031730 | Bacteria | 742 |
| 639 | Ga0307516_10629741 | 3300031730 | Bacteria | 727 |
| 640 | Ga0307516_10769828 | 3300031730 | Bacteria | 623 |
| 641 | Ga0307405_10174205 | 3300031731 | Bacteria | 1538 |
| 642 | Ga0307413_10017248 | 3300031824 | Bacteria | 3756 |
| 643 | Ga0307413_11501109 | 3300031824 | Bacteria | 596 |
| 644 | Ga0307518_10357644 | 3300031838 | Bacteria | 845 |
| 645 | Ga0307410_10283779 | 3300031852 | Bacteria | 1300 |
| 646 | Ga0307412_10401022 | 3300031911 | Bacteria | 1116 |
| 647 | Ga0307412_11085580 | 3300031911 | Unclassified | 711 |
| 648 | Ga0307409_100372205 | 3300031995 | Bacteria | 1355 |
| 649 | Ga0307416_102294687 | 3300032002 | Bacteria | 640 |
| 650 | Ga0307414_10689805 | 3300032004 | Bacteria | 924 |
| 651 | Ga0307411_10044945 | 3300032005 | Bacteria | 2838 |
| 652 | Ga0307411_10321696 | 3300032005 | Bacteria | 1249 |
| 653 | Ga0307415_100740945 | 3300032126 | Bacteria | 891 |
| 654 | Ga0307415_101200948 | 3300032126 | Bacteria | 715 |
| 655 | Ga0316583_10227339 | 3300032133 | Bacteria | 647 |
| 656 | Ga0307510_10012165 | 3300033180 | Bacteria | 10203 |
| 657 | Ga0307510_10032961 | 3300033180 | Bacteria | 5829 |
| 658 | Ga0373952_0001139 | 3300035092 | Bacteria | 4848 |
| 659 | Ga0373946_0066198 | 3300035171 | Bacteria | 1549 |
| 660 | Ga0373931_0025723 | 3300035691 | Bacteria | 2989 |
| 661 | Ga0373937_0179223 | 3300036401 | Bacteria | 1989 |
| 662 | Ga0373937_0340219 | 3300036401 | Bacteria | 1421 |
| 663 | Ga0373937_0669136 | 3300036401 | Bacteria | 984 |
| 664 | Ga0395899_0195598 | 3300037312 | Bacteria | 1413 |
| 665 | Ga0395899_0204210 | 3300037312 | Bacteria | 1376 |
| 666 | Ga0395898_0038029 | 3300037466 | Bacteria | 4772 |
| 667 | Ga0436364_0570264 | 3300037853 | Bacteria | 3035 |
| 668 | Ga0395901_0029531 | 3300038443 | Bacteria | 5646 |
| 669 | Ga0436365_0680524 | 3300039437 | Bacteria | 1610 |
| 670 | Ga0436361_0018388 | 3300039447 | Bacteria | 44345 |
| 671 | Ga0436361_0068556 | 3300039447 | Bacteria | 100895 |
| 672 | Ga0436361_0162163 | 3300039447 | Bacteria | 1247 |
| 673 | Ga0436361_0614815 | 3300039447 | Bacteria | 45728 |
| 674 | Ga0436361_0651406 | 3300039447 | Bacteria | 3013 |
| 675 | Ga0436361_0658018 | 3300039447 | Bacteria | 686 |
| 676 | Ga0436361_0704442 | 3300039447 | Bacteria | 599 |
| 677 | Ga0436361_1050932 | 3300039447 | Bacteria | 935 |
| 678 | Ga0436361_1078434 | 3300039447 | Bacteria | 1024 |
| 679 | Ga0451791_0302276 | 3300041451 | Bacteria | 1038 |
| 680 | Ga0451795_1577239 | 3300041456 | Bacteria | 631 |
| 681 | Ga0451837_1131948 | 3300041494 | Bacteria | 583 |
| 682 | Ga0451853_1225302 | 3300041512 | Bacteria | 1310 |
| 683 | Ga0451853_1592565 | 3300041512 | Bacteria | 996 |
| 684 | Ga0451853_2413001 | 3300041512 | Bacteria | 822 |
| 685 | Ga0439437_064593 | 3300042000 | Unclassified | 500 |
| 686 | Ga0439448_0053162 | 3300042005 | Bacteria | 1329 |
| 687 | Ga0439448_0323230 | 3300042005 | Bacteria | 549 |
| 688 | Ga0439450_054731 | 3300042008 | Bacteria | 954 |
| 689 | Ga0450889_021654 | 3300042144 | Bacteria | 717 |
| 690 | Ga0439464_0008576 | 3300042439 | Bacteria | 2679 |
| 691 | Ga0451577_0180363 | 3300042876 | Bacteria | 1904 |
| 692 | Ga0466965_0030229 | 3300044683 | Bacteria | 2638 |
| 693 | Ga0466963_0645760 | 3300044694 | Bacteria | 747 |
| 694 | Ga0466964_0004400 | 3300044706 | Bacteria | 5198 |
| 695 | Ga0453684_0562581 | 3300044712 | Bacteria | 1254 |
| 696 | Ga0466968_0068366 | 3300044735 | Bacteria | 1542 |
| 697 | Ga0466970_0011861 | 3300044765 | Bacteria | 4445 |
| 698 | Ga0466957_0028524 | 3300044842 | Bacteria | 3324 |
| 699 | Ga0466957_0351328 | 3300044842 | Bacteria | 1000 |
| 700 | Ga0466957_0571936 | 3300044842 | Bacteria | 789 |
| 701 | Ga0466959_0022300 | 3300045049 | Bacteria | 4680 |
| 702 | Ga0451576_0001324 | 3300045051 | Bacteria | 42824 |
| 703 | Ga0451576_0978897 | 3300045051 | Bacteria | 887 |
| 704 | Ga0466958_0153786 | 3300045836 | Bacteria | 1451 |
| 705 | Ga0466967_0234772 | 3300045976 | Bacteria | 1747 |
| 706 | Ga0466967_0379341 | 3300045976 | Bacteria | 1372 |
| 707 | Ga0466967_0635782 | 3300045976 | Bacteria | 1055 |
| 708 | Ga0466967_0962078 | 3300045976 | Bacteria | 850 |
| 709 | Ga0466967_1447903 | 3300045976 | Unclassified | 684 |
| 710 | Ga0495592_0000291 | 3300046454 | Bacteria | 42990 |
| 711 | Ga0495638_0118661 | 3300046460 | Bacteria | 1565 |
| 712 | Ga0495638_0276953 | 3300046460 | Bacteria | 913 |
| 713 | Ga0495651_0387051 | 3300046462 | Bacteria | 916 |
| 714 | Ga0495650_0053966 | 3300046471 | Bacteria | 1642 |
| 715 | Ga0495650_0085334 | 3300046471 | Bacteria | 1210 |
| 716 | Ga0495582_0254919 | 3300046473 | Bacteria | 1006 |
| 717 | Ga0495605_0082544 | 3300046474 | Bacteria | 1501 |
| 718 | Ga0495664_0201984 | 3300046477 | Bacteria | 1204 |
| 719 | Ga0495607_0200564 | 3300046501 | Bacteria | 988 |
| 720 | Ga0495583_0000046 | 3300046506 | Bacteria | 218059 |
| 721 | Ga0495583_0312776 | 3300046506 | Bacteria | 623 |
| 722 | Ga0495610_0053848 | 3300046512 | Bacteria | 1947 |
| 723 | Ga0495628_0051863 | 3300046516 | Bacteria | 3242 |
| 724 | Ga0495631_0377690 | 3300046518 | Bacteria | 603 |
| 725 | Ga0495632_0006200 | 3300046519 | Bacteria | 7737 |
| 726 | Ga0495648_0303349 | 3300046524 | Bacteria | 747 |
| 727 | Ga0495666_0021091 | 3300046526 | Bacteria | 3226 |
| 728 | Ga0495598_0006095 | 3300046537 | Bacteria | 2708 |
| 729 | Ga0495621_0193356 | 3300046539 | Bacteria | 816 |
| 730 | Ga0495597_0003922 | 3300046542 | Bacteria | 8402 |
| 731 | Ga0495597_0024542 | 3300046542 | Bacteria | 2782 |
| 732 | Ga0495597_0134198 | 3300046542 | Bacteria | 1025 |
| 733 | Ga0495645_0071213 | 3300046543 | Bacteria | 2507 |
| 734 | Ga0495622_0025296 | 3300046557 | Bacteria | 2773 |
| 735 | Ga0495611_0221658 | 3300046648 | Bacteria | 880 |
| 736 | Ga0495625_0005740 | 3300046660 | Bacteria | 11219 |
| 737 | Ga0495625_0036997 | 3300046660 | Bacteria | 3583 |
| 738 | Ga0495625_0150118 | 3300046660 | Bacteria | 1567 |
| 739 | Ga0495625_0321463 | 3300046660 | Bacteria | 985 |
| 740 | Ga0495647_0334470 | 3300046681 | Bacteria | 687 |
| 741 | Ga0495658_0004796 | 3300046683 | Bacteria | 6631 |
| 742 | Ga0495658_0454283 | 3300046683 | Bacteria | 818 |
| 743 | Ga0495658_0693015 | 3300046683 | Bacteria | 653 |
| 744 | Ga0495613_0603713 | 3300046689 | Bacteria | 730 |
| 745 | Ga0495624_0056474 | 3300046690 | Bacteria | 2470 |
| 746 | Ga0495671_0111819 | 3300046692 | Bacteria | 1334 |
| 747 | Ga0495671_0154985 | 3300046692 | Bacteria | 1115 |
| 748 | Ga0495671_0363925 | 3300046692 | Bacteria | 693 |
| 749 | Ga0495671_0598998 | 3300046692 | Bacteria | 524 |
| 750 | Ga0495649_0000638 | 3300046694 | Bacteria | 28526 |
| 751 | Ga0495649_0037138 | 3300046694 | Bacteria | 2674 |
| 752 | Ga0495660_0024873 | 3300046810 | Bacteria | 3406 |
| 753 | Ga0495687_000367 | 3300047443 | Bacteria | 56387 |
| 754 | Ga0495687_011817 | 3300047443 | Bacteria | 4662 |
| 755 | Ga0495673_0156408 | 3300047469 | Bacteria | 878 |
| 756 | Ga0495686_0029542 | 3300047472 | Bacteria | 3565 |
| 757 | Ga0495686_0145468 | 3300047472 | Bacteria | 1395 |
| 758 | Ga0495593_0031997 | 3300047673 | Bacteria | 2870 |
| 759 | Ga0495614_0287908 | 3300048089 | Bacteria | 757 |
| 760 | Ga0495615_0024194 | 3300048090 | Bacteria | 1398 |
| 761 | Ga0495626_0074869 | 3300048091 | Bacteria | 1514 |
| 762 | Ga0496100_0095075 | 3300048903 | Bacteria | 2042 |
| 763 | Ga0496101_0242656 | 3300048904 | Bacteria | 1402 |
| 764 | Ga0496101_1162577 | 3300048904 | Bacteria | 605 |
| 765 | Ga0496104_0046378 | 3300048907 | Bacteria | 4093 |
| 766 | Ga0496105_0557045 | 3300048908 | Bacteria | 894 |
| 767 | Ga0496106_0056501 | 3300048909 | Bacteria | 2967 |
| 768 | Ga0496106_0361007 | 3300048909 | Unclassified | 1167 |
| 769 | Ga0496108_0054157 | 3300048911 | Bacteria | 3367 |
| 770 | Ga0496108_0458421 | 3300048911 | Bacteria | 1114 |
| 771 | Ga0496108_0475861 | 3300048911 | Bacteria | 1091 |
| 772 | Ga0496108_0716479 | 3300048911 | Bacteria | 867 |
| 773 | Ga0496109_0023407 | 3300048912 | Bacteria | 5484 |
| 774 | Ga0496111_0149444 | 3300048914 | Bacteria | 1732 |
| 775 | Ga0496112_0000429 | 3300048915 | Bacteria | 27778 |
| 776 | Ga0496112_0207877 | 3300048915 | Bacteria | 1915 |
| 777 | Ga0496112_1081738 | 3300048915 | Bacteria | 720 |
| 778 | Ga0496113_0400549 | 3300048916 | Bacteria | 1102 |
| 779 | Ga0496114_0006440 | 3300048917 | Bacteria | 9243 |
| 780 | Ga0496114_0322714 | 3300048917 | Bacteria | 1365 |
| 781 | Ga0496115_0416682 | 3300048918 | Bacteria | 1088 |
| 782 | Ga0496116_0018094 | 3300048919 | Bacteria | 5444 |
| 783 | Ga0496118_0185082 | 3300048921 | Bacteria | 1253 |
| 784 | Ga0496121_0020869 | 3300048924 | Bacteria | 6453 |
| 785 | Ga0496121_0054604 | 3300048924 | Bacteria | 3336 |
| 786 | Ga0496121_0316427 | 3300048924 | Bacteria | 1053 |
| 787 | Ga0496122_0008179 | 3300048925 | Bacteria | 11370 |
| 788 | Ga0496123_0008042 | 3300048926 | Bacteria | 9765 |
| 789 | Ga0496124_0469914 | 3300048927 | Bacteria | 852 |
| 790 | Ga0496125_0005346 | 3300048928 | Bacteria | 14333 |
| 791 | Ga0496126_0026066 | 3300048929 | Bacteria | 5612 |
| 792 | Ga0495682_0276103 | 3300049460 | Bacteria | 593 |
| 793 | Ga0501290_079332 | 3300049513 | Bacteria | 557 |
| 794 | Ga0501300_027973 | 3300049523 | Bacteria | 829 |
| 795 | Ga0501032_0010930 | 3300049569 | Bacteria | 6527 |
| 796 | Ga0501032_0140832 | 3300049569 | Bacteria | 1588 |
| 797 | Ga0501034_0024667 | 3300049571 | Bacteria | 6115 |
| 798 | Ga0501034_0257622 | 3300049571 | Bacteria | 1688 |
| 799 | Ga0501038_0058614 | 3300049574 | Bacteria | 3301 |
| 800 | Ga0501039_0013485 | 3300049575 | Bacteria | 6250 |
| 801 | Ga0501043_0000149 | 3300049579 | Bacteria | 65122 |
| 802 | Ga0501046_0000092 | 3300049580 | Bacteria | 97456 |
| 803 | Ga0501047_0000028 | 3300049581 | Bacteria | 220279 |
| 804 | Ga0501048_0006680 | 3300049582 | Bacteria | 8763 |
| 805 | Ga0501072_0586099 | 3300049588 | Bacteria | 880 |
| 806 | Ga0501079_0657938 | 3300049741 | Bacteria | 825 |
| 807 | Ga0501081_0688929 | 3300049743 | Bacteria | 767 |
| 808 | Ga0501266_000057 | 3300049763 | Bacteria | 17898 |
| 809 | Ga0501035_0046260 | 3300049822 | Bacteria | 3914 |
| 810 | Ga0501035_1209385 | 3300049822 | Bacteria | 586 |
| 811 | Ga0501044_0272835 | 3300049823 | Bacteria | 1627 |
| 812 | Ga0501045_0000170 | 3300049824 | Bacteria | 35617 |
| 813 | nmdc:mga03683_10952_c1 | 3300050489 | Bacteria | 3265 |
| 814 | nmdc:mga03683_120460_c1 | 3300050489 | Bacteria | 1166 |
| 815 | nmdc:mga03683_19823_c1 | 3300050489 | Bacteria | 2572 |
| 816 | nmdc:mga03n38_230957_c1 | 3300050490 | Bacteria | 970 |
| 817 | nmdc:mga03n38_48533_c1 | 3300050490 | Bacteria | 1884 |
| 818 | nmdc:mga00v17_10380_c1 | 3300050491 | Bacteria | 5082 |
| 819 | nmdc:mga0k408_11251_c1 | 3300050493 | Bacteria | 4865 |
| 820 | nmdc:mga0k408_198791_c1 | 3300050493 | Bacteria | 1196 |
| 821 | nmdc:mga0k408_22329_c1 | 3300050493 | Bacteria | 3563 |
| 822 | nmdc:mga0k408_2308_c1 | 3300050493 | Bacteria | 10151 |
| 823 | nmdc:mga0k408_27898_c1 | 3300050493 | Bacteria | 3209 |
| 824 | nmdc:mga0k408_355_c1 | 3300050493 | Bacteria | 25188 |
| 825 | nmdc:mga0k408_40234_c1 | 3300050493 | Bacteria | 2689 |
| 826 | nmdc:mga0k408_61790_c1 | 3300050493 | Bacteria | 2178 |
| 827 | nmdc:mga0k408_68274_c1 | 3300050493 | Bacteria | 2073 |
| 828 | nmdc:mga0k408_69103_c1 | 3300050493 | Bacteria | 2061 |
| 829 | nmdc:mga0k408_8262_c1 | 3300050493 | Bacteria | 5584 |
| 830 | nmdc:mga06z11_127044_c1 | 3300050494 | Bacteria | 1428 |
| 831 | nmdc:mga06z11_165950_c1 | 3300050494 | Bacteria | 1265 |
| 832 | nmdc:mga06z11_5785_c1 | 3300050494 | Bacteria | 4985 |
| 833 | nmdc:mga04h51_11203_c1 | 3300050495 | Bacteria | 2483 |
| 834 | nmdc:mga04h51_160506_c1 | 3300050495 | Bacteria | 865 |
| 835 | nmdc:mga07m45_10918_c1 | 3300050496 | Bacteria | 4758 |
| 836 | nmdc:mga07m45_1116_c1 | 3300050496 | Bacteria | 12021 |
| 837 | nmdc:mga07m45_175262_c1 | 3300050496 | Bacteria | 1247 |
| 838 | nmdc:mga07m45_216266_c1 | 3300050496 | Bacteria | 1115 |
| 839 | nmdc:mga07m45_2223_c1 | 3300050496 | Bacteria | 9067 |
| 840 | nmdc:mga07m45_27823_c1 | 3300050496 | Bacteria | 3118 |
| 841 | nmdc:mga07m45_398480_c1 | 3300050496 | Bacteria | 799 |
| 842 | nmdc:mga07m45_6961_c1 | 3300050496 | Bacteria | 5751 |
| 843 | nmdc:mga07m45_7118_c1 | 3300050496 | Bacteria | 5697 |
| 844 | nmdc:mga07m45_7357_c1 | 3300050496 | Bacteria | 5622 |
| 845 | nmdc:mga09592_4802_c1 | 3300050508 | Bacteria | 10952 |
| 846 | nmdc:mga0qj67_89016_c1 | 3300050509 | Bacteria | 2479 |
| 847 | nmdc:mga0n895_1200895_c1 | 3300050512 | Bacteria | 732 |
| 848 | nmdc:mga0n895_1778329_c1 | 3300050512 | Bacteria | 577 |
| 849 | nmdc:mga0sz30_176495_c1 | 3300050516 | Bacteria | 947 |
| 850 | Ga0495601_0498003 | 3300053077 | Bacteria | 786 |
| 851 | Ga0500635_0000005 | 3300053080 | Bacteria | 187821 |
| 852 | Ga0500644_0100473 | 3300053088 | Bacteria | 1098 |
| 853 | Ga0500651_0028942 | 3300053093 | Bacteria | 3482 |
| 854 | Ga0500651_0058855 | 3300053093 | Bacteria | 2403 |
| 855 | Ga0500651_0422206 | 3300053093 | Bacteria | 746 |
| 856 | Ga0500618_001127 | 3300053125 | Bacteria | 12996 |
| 857 | Ga0500618_003179 | 3300053125 | Bacteria | 5763 |
| 858 | Ga0500658_0002097 | 3300053134 | Bacteria | 7754 |
| 859 | Ga0500559_0000119 | 3300053136 | Bacteria | 62358 |
| 860 | Ga0500564_107433 | 3300053138 | Bacteria | 1228 |
| 861 | Ga0500564_113828 | 3300053138 | Bacteria | 1185 |
| 862 | Ga0500564_138173 | 3300053138 | Bacteria | 1049 |
| 863 | Ga0500568_0005734 | 3300053139 | Bacteria | 6362 |
| 864 | Ga0500622_0005643 | 3300053156 | Bacteria | 7455 |
| 865 | Ga0500636_0045101 | 3300053177 | Bacteria | 2600 |
| 866 | Ga0500636_0132989 | 3300053177 | Bacteria | 1384 |
| 867 | Ga0500587_004225 | 3300053739 | Bacteria | 1980 |
| 868 | Ga0501084_1049680 | 3300054114 | Bacteria | 684 |
| 869 | Ga0500661_014650 | 3300055283 | Bacteria | 1411 |
| 870 | Ga0501082_0504992 | 3300060353 | Bacteria | 1057 |
| 871 | Ga0466962_0057998 | 3300061719 | Bacteria | 1848 |
| 872 | 2511250706 | 2511231003 | Bacteria | 5606035 |
| 873 | 2511383165 | 2511231026 | Bacteria | 5225445 |
| 874 | 2521557186 | 2521172590 | Bacteria | 5047645 |
| 875 | 2548848656 | 2547132512 | Bacteria | 3416496 |
| 876 | 2550696542 | 2548876994 | Bacteria | 4904866 |
| 877 | 2553007707 | 2551306416 | Bacteria | 6152985 |
| 878 | 2644303978 | 2643221654 | Bacteria | 5273570 |
| 879 | 2644338794 | 2643221660 | Bacteria | 4208257 |
| 880 | 2765568317 | 2765235838 | Bacteria | 5445269 |
| 881 | 2808983393 | 2808606386 | Bacteria | 4471946 |
| 882 | 2809128621 | 2808606415 | Bacteria | 4576710 |
| 883 | 2809148242 | 2808606419 | Bacteria | 4576925 |
| 884 | 2819591914 | 2818991445 | Bacteria | 4955017 |
| 885 | 2819618660 | 2818991449 | Bacteria | 5518009 |
| 886 | 2839094821 | 2839094727 | Bacteria | 5534556 |
| 887 | 2852620336 | 2852618963 | Bacteria | 4577824 |
| 888 | 2884840674 | 2884836552 | Bacteria | 5219991 |
| 889 | 2884855931 | 2884852848 | Bacteria | 5221161 |
| 890 | 2896157144 | 2896154374 | Bacteria | 5221518 |
| 891 | 2904440108 | 2904439833 | Bacteria | 5931679 |
| 892 | 2904530956 | 2904530477 | Bacteria | 5876334 |
| 893 | 2904587411 | 2904584206 | Bacteria | 6028872 |
| 894 | 2904592554 | 2904589729 | Bacteria | 6113573 |
| 895 | 2904604654 | 2904601388 | Bacteria | 5884906 |
| 896 | 2919050465 | 2919046199 | Bacteria | 5567169 |
| 897 | 2919082485 | 2919079590 | Bacteria | 5946433 |
| 898 | 2923515812 | 2923510766 | Bacteria | 5926163 |
| 899 | 2928133396 | 2928130867 | Bacteria | 5467269 |
| 900 | Ga0495668_0072851 | |||
| 901 | JGI25155J39150_1000552 | |||
| 902 | JGI25156J39149_1000459 | |||
| 903 | JGI25156J39149_1001026 | |||
| 904 | JGI25156J39149_1002927 | |||
| 905 | JGI25156J39149_1020328 | |||
| 906 | JGI25162J39368_1010430 | |||
| 907 | JGI25154J39366_1000871 | |||
| 908 | JGI25154J39366_1000911 | |||
| 909 | JGI25154J39366_1001802 | |||
| 910 | JGI25157J39369_1000021 | |||
| 911 | JGI25157J39369_1001256 | |||
| 912 | JGI25164J39214_1005040 | |||
| 913 | rootH1_10015810 | |||
| 914 | rootH1_10028438 | |||
| 915 | rootH1_10033518 | |||
| 916 | rootH1_10042308 | |||
| 917 | rootH2_10019687 | |||
| 918 | rootH1_10021003 | |||
| 919 | rootH1_10072734 | |||
| 920 | rootH1_10085156 | |||
| 921 | Ga0055538_1000013 | |||
| 922 | Ga0055539_1000018 | |||
| 923 | Ga0055539_1000422 | |||
| 924 | Ga0055539_1006291 | |||
| 925 | Ga0055539_1007357 | |||
| 926 | Ga0055533_1000022 | |||
| 927 | Ga0055533_1000033 | |||
| 928 | Ga0055532_1000017 | |||
| 929 | Ga0055525_1000024 | |||
| 930 | Ga0055525_1001360 | |||
| 931 | Ga0055535_1001037 | |||
| 932 | Ga0055529_1000860 | |||
| 933 | Ga0055540_1098486 | |||
| 934 | Ga0055531_10000303 | |||
| 935 | Ga0055541_1000013 | |||
| 936 | Ga0070658_10055065 | |||
| 937 | Ga0070658_10159526 | |||
| 938 | Ga0070658_10334405 | |||
| 939 | Ga0070658_10546180 | |||
| 940 | Ga0070658_10690884 | |||
| 941 | Ga0070676_10006846 | |||
| 942 | Ga0070676_10031112 | |||
| 943 | Ga0070683_100052816 | |||
| 944 | Ga0070690_100258225 | |||
| 945 | Ga0070690_100884353 | |||
| 946 | Ga0070670_100001932 | |||
| 947 | Ga0070670_100016141 | |||
| 948 | Ga0070670_100030522 | |||
| 949 | Ga0070670_100043467 | |||
| 950 | Ga0070670_100247824 | |||
| 951 | Ga0070670_100413575 | |||
| 952 | Ga0070670_100454897 | |||
| 953 | Ga0070670_100565065 | |||
| 954 | Ga0070677_10250943 | |||
| 955 | Ga0068869_100002015 | |||
| 956 | Ga0068869_100009386 | |||
| 957 | Ga0068869_100270562 | |||
| 958 | Ga0068869_100280540 | |||
| 959 | Ga0068869_100866308 | |||
| 960 | Ga0068869_100914381 | |||
| 961 | Ga0070666_10118688 | |||
| 962 | Ga0070666_10578781 | |||
| 963 | Ga0070666_10716842 | |||
| 964 | Ga0070680_100951768 | |||
| 965 | Ga0068868_100009443 | |||
| 966 | Ga0068868_100035076 | |||
| 967 | Ga0068868_100637045 | |||
| 968 | Ga0068868_101715614 | |||
| 969 | Ga0070660_100008023 | |||
| 970 | Ga0070660_100341540 | |||
| 971 | Ga0070689_100078740 | |||
| 972 | Ga0070687_100358331 | |||
| 973 | Ga0070661_100001088 | |||
| 974 | Ga0070661_100248558 | |||
| 975 | Ga0070661_100394804 | |||
| 976 | Ga0070661_100552539 | |||
| 977 | Ga0070661_100885046 | |||
| 978 | Ga0070692_10004158 | |||
| 979 | Ga0070668_100020530 | |||
| 980 | Ga0070668_100329391 | |||
| 981 | Ga0070668_100743087 | |||
| 982 | Ga0070669_100022076 | |||
| 983 | Ga0070669_100113789 | |||
| 984 | Ga0070675_100004356 | |||
| 985 | Ga0070675_100013239 | |||
| 986 | Ga0070675_100069593 | |||
| 987 | Ga0070671_100348620 | |||
| 988 | Ga0070674_100226733 | |||
| 989 | Ga0070673_100020834 | |||
| 990 | Ga0070673_100081701 | |||
| 991 | Ga0070673_100093732 | |||
| 992 | Ga0070673_100838826 | |||
| 993 | Ga0070673_101116476 | |||
| 994 | Ga0070688_100157273 | |||
| 995 | Ga0070688_100163550 | |||
| 996 | Ga0070688_100849343 | |||
| 997 | Ga0070659_100005381 | |||
| 998 | Ga0070659_100189414 | |||
| 999 | Ga0070659_100311689 | |||
| 1000 | Ga0070667_100003099 | |||
| 1001 | Ga0070667_100012027 | |||
| 1002 | Ga0070667_100025446 | |||
| 1003 | Ga0070667_100176479 | |||
| 1004 | Ga0070667_100783023 | |||
| 1005 | Ga0070714_100002739 | |||
| 1006 | Ga0070700_100018494 | |||
| 1007 | Ga0070700_100306428 | |||
| 1008 | Ga0070694_100018628 | |||
| 1009 | Ga0070663_100085402 | |||
| 1010 | Ga0070663_100426950 | |||
| 1011 | Ga0070678_100113175 | |||
| 1012 | Ga0070678_100233511 | |||
| 1013 | Ga0070678_100593398 | |||
| 1014 | Ga0070678_101830431 | |||
| 1015 | Ga0070662_100010527 | |||
| 1016 | Ga0070662_100247329 | |||
| 1017 | Ga0070662_101459081 | |||
| 1018 | Ga0070681_10034748 | |||
| 1019 | Ga0068867_100001409 | |||
| 1020 | Ga0068867_100013331 | |||
| 1021 | Ga0068867_100059713 | |||
| 1022 | Ga0068867_100109452 | |||
| 1023 | Ga0068867_100144721 | |||
| 1024 | Ga0068867_100236681 | |||
| 1025 | Ga0068867_100840446 | |||
| 1026 | Ga0070685_10994582 | |||
| 1027 | Ga0070706_100014174 | |||
| 1028 | Ga0070707_100032795 | |||
| 1029 | Ga0070679_100029666 | |||
| 1030 | Ga0070684_100006747 | |||
| 1031 | Ga0070684_101032662 | |||
| 1032 | Ga0068853_100022449 | |||
| 1033 | Ga0068853_101224347 | |||
| 1034 | Ga0070672_100001918 | |||
| 1035 | Ga0070672_100007461 | |||
| 1036 | Ga0070672_100037415 | |||
| 1037 | Ga0070672_100296542 | |||
| 1038 | Ga0070686_100000934 | |||
| 1039 | Ga0070665_100125079 | |||
| 1040 | Ga0070665_100176305 | |||
| 1041 | Ga0070665_100651882 | |||
| 1042 | Ga0070665_100797218 | |||
| 1043 | Ga0070665_100849149 | |||
| 1044 | Ga0068855_100000899 | |||
| 1045 | Ga0068855_100009898 | |||
| 1046 | Ga0068855_100026654 | |||
| 1047 | Ga0068855_100041346 | |||
| 1048 | Ga0068855_100129571 | |||
| 1049 | Ga0068855_100290538 | |||
| 1050 | Ga0068855_101784564 | |||
| 1051 | Ga0068855_102205600 | |||
| 1052 | Ga0068855_102490390 | |||
| 1053 | Ga0070664_100012427 | |||
| 1054 | Ga0070664_100051593 | |||
| 1055 | Ga0068857_100013188 | |||
| 1056 | Ga0068857_100022930 | |||
| 1057 | Ga0068857_100025706 | |||
| 1058 | Ga0068857_100098504 | |||
| 1059 | Ga0068857_100351971 | |||
| 1060 | Ga0068857_100430714 | |||
| 1061 | Ga0068857_100956919 | |||
| 1062 | Ga0068854_100003968 | |||
| 1063 | Ga0068854_100028234 | |||
| 1064 | Ga0068854_100090238 | |||
| 1065 | Ga0068854_100102161 | |||
| 1066 | Ga0068854_100116060 | |||
| 1067 | Ga0068854_100615865 | |||
| 1068 | Ga0068856_100000887 | |||
| 1069 | Ga0068856_100008336 | |||
| 1070 | Ga0068856_100069023 | |||
| 1071 | Ga0068856_100232885 | |||
| 1072 | Ga0070702_100000571 | |||
| 1073 | Ga0068852_100014656 | |||
| 1074 | Ga0068852_100078291 | |||
| 1075 | Ga0068852_100299390 | |||
| 1076 | Ga0068852_101492726 | |||
| 1077 | Ga0068852_102178461 | |||
| 1078 | Ga0068859_100091161 | |||
| 1079 | Ga0068859_100124734 | |||
| 1080 | Ga0068859_100296945 | |||
| 1081 | Ga0068864_100010671 | |||
| 1082 | Ga0068864_100170920 | |||
| 1083 | Ga0068864_100660326 | |||
| 1084 | Ga0068864_100676311 | |||
| 1085 | Ga0068861_100003204 | |||
| 1086 | Ga0068861_100117369 | |||
| 1087 | Ga0068851_10014082 | |||
| 1088 | Ga0068851_10097987 | |||
| 1089 | Ga0068851_10099999 | |||
| 1090 | Ga0068870_10003323 | |||
| 1091 | Ga0068870_10501577 | |||
| 1092 | Ga0068870_10870479 | |||
| 1093 | Ga0068863_100018071 | |||
| 1094 | Ga0068863_100091707 | |||
| 1095 | Ga0068863_100105308 | |||
| 1096 | Ga0068858_100365766 | |||
| 1097 | Ga0068860_100010532 | |||
| 1098 | Ga0068862_100057571 | |||
| 1099 | Ga0068862_100074688 | |||
| 1100 | Ga0068862_100933363 | |||
| 1101 | Ga0075368_10045091 | |||
| 1102 | Ga0075368_10097158 | |||
| 1103 | Ga0075363_100002386 | |||
| 1104 | Ga0075363_100048094 | |||
| 1105 | Ga0075364_10028373 | |||
| 1106 | Ga0075362_10001909 | |||
| 1107 | Ga0075362_10003213 | |||
| 1108 | Ga0075362_10044596 | |||
| 1109 | Ga0075362_10104854 | |||
| 1110 | Ga0075362_10177192 | |||
| 1111 | Ga0075367_10099999 | |||
| 1112 | Ga0075367_10126960 | |||
| 1113 | Ga0075367_10281522 | |||
| 1114 | Ga0075369_10028500 | |||
| 1115 | Ga0075366_10005058 | |||
| 1116 | Ga0075366_10023138 | |||
| 1117 | Ga0075366_10057237 | |||
| 1118 | Ga0075366_10060280 | |||
| 1119 | Ga0075366_10081143 | |||
| 1120 | Ga0075366_10092862 | |||
| 1121 | Ga0075366_10120320 | |||
| 1122 | Ga0075366_10159629 | |||
| 1123 | Ga0075366_10174278 | |||
| 1124 | Ga0075366_10208037 | |||
| 1125 | Ga0075366_10454329 | |||
| 1126 | Ga0075366_10658274 | |||
| 1127 | Ga0097621_100000834 | |||
| 1128 | Ga0075370_10000059 | |||
| 1129 | Ga0075370_10000087 | |||
| 1130 | Ga0075370_10000813 | |||
| 1131 | Ga0075370_10002533 | |||
| 1132 | Ga0075370_10071038 | |||
| 1133 | Ga0075370_10165448 | |||
| 1134 | Ga0075370_10274767 | |||
| 1135 | Ga0075370_10313695 | |||
| 1136 | Ga0068871_100392947 | |||
| 1137 | Ga0075428_100188651 | |||
| 1138 | Ga0075430_100025785 | |||
| 1139 | Ga0075434_101580907 | |||
| 1140 | Ga0075429_100001289 | |||
| 1141 | Ga0068865_100023460 | |||
| 1142 | Ga0068865_100064205 | |||
| 1143 | Ga0068865_100276381 | |||
| 1144 | Ga0097620_100091157 | |||
| 1145 | Ga0097620_100124739 | |||
| 1146 | Ga0097620_100296946 | |||
| 1147 | Ga0079104_1004321 | |||
| 1148 | Ga0099794_10143398 | |||
| 1149 | Ga0105251_10026119 | |||
| 1150 | Ga0105240_10001001 | |||
| 1151 | Ga0105240_10004920 | |||
| 1152 | Ga0105240_10035820 | |||
| 1153 | Ga0105240_10064762 | |||
| 1154 | Ga0105240_10110979 | |||
| 1155 | Ga0105240_10151438 | |||
| 1156 | Ga0105240_10580327 | |||
| 1157 | Ga0105240_11387397 | |||
| 1158 | Ga0105240_11511099 | |||
| 1159 | Ga0111539_11726941 | |||
| 1160 | Ga0105245_10000241 | |||
| 1161 | Ga0105245_10055064 | |||
| 1162 | Ga0105245_10702000 | |||
| 1163 | Ga0105245_10767526 | |||
| 1164 | Ga0105245_10791525 | |||
| 1165 | Ga0105245_11483078 | |||
| 1166 | Ga0105247_10209395 | |||
| 1167 | Ga0105247_10260653 | |||
| 1168 | Ga0105247_11251157 | |||
| 1169 | Ga0114129_10496322 | |||
| 1170 | Ga0105243_10000390 | |||
| 1171 | Ga0105243_10020375 | |||
| 1172 | Ga0105243_11877900 | |||
| 1173 | Ga0105241_10079604 | |||
| 1174 | Ga0105241_10082320 | |||
| 1175 | Ga0105241_10101868 | |||
| 1176 | Ga0105241_11137689 | |||
| 1177 | Ga0105242_10185158 | |||
| 1178 | Ga0105248_10331566 | |||
| 1179 | Ga0105248_10827088 | |||
| 1180 | Ga0105248_10979732 | |||
| 1181 | Ga0105248_11305591 | |||
| 1182 | Ga0105248_13176897 | |||
| 1183 | Ga0105237_10045864 | |||
| 1184 | Ga0105237_10187694 | |||
| 1185 | Ga0105237_10208760 | |||
| 1186 | Ga0105237_10251517 | |||
| 1187 | Ga0105237_10389651 | |||
| 1188 | Ga0105237_10501577 | |||
| 1189 | Ga0105238_10000738 | |||
| 1190 | Ga0105238_10002979 | |||
| 1191 | Ga0105238_10408954 | |||
| 1192 | Ga0105238_10690928 | |||
| 1193 | Ga0105238_10777075 | |||
| 1194 | Ga0105249_10008116 | |||
| 1195 | Ga0105249_10173015 | |||
| 1196 | Ga0105249_11428734 | |||
| 1197 | Ga0105239_10010208 | |||
| 1198 | Ga0105239_10019338 | |||
| 1199 | Ga0105239_10329892 | |||
| 1200 | Ga0105239_10337678 | |||
| 1201 | Ga0105239_12366395 | |||
| 1202 | Ga0105239_12503689 | |||
| 1203 | Ga0105246_10041666 | |||
| 1204 | Ga0105246_12451221 | |||
| 1205 | Ga0157373_10030602 | |||
| 1206 | Ga0157373_10350290 | |||
| 1207 | Ga0157370_10005091 | |||
| 1208 | Ga0157369_10005877 | |||
| 1209 | Ga0157369_10112116 | |||
| 1210 | Ga0157374_10099755 | |||
| 1211 | Ga0157374_10181754 | |||
| 1212 | Ga0157374_11080750 | |||
| 1213 | Ga0157378_10000691 | |||
| 1214 | Ga0157378_10146556 | |||
| 1215 | Ga0157378_10238755 | |||
| 1216 | Ga0157378_11353466 | |||
| 1217 | Ga0163162_10109784 | |||
| 1218 | Ga0163162_10128309 | |||
| 1219 | Ga0163162_10247762 | |||
| 1220 | Ga0163162_10322669 | |||
| 1221 | Ga0163162_10343177 | |||
| 1222 | Ga0163162_12085872 | |||
| 1223 | Ga0157372_10023891 | |||
| 1224 | Ga0157372_10345474 | |||
| 1225 | Ga0157375_10099480 | |||
| 1226 | Ga0157375_10103460 | |||
| 1227 | Ga0157375_10133410 | |||
| 1228 | Ga0157375_10133527 | |||
| 1229 | Ga0157375_10534409 | |||
| 1230 | Ga0157375_10606622 | |||
| 1231 | Ga0163163_10007845 | |||
| 1232 | Ga0163163_10349218 | |||
| 1233 | Ga0163163_10453346 | |||
| 1234 | Ga0157380_10030112 | |||
| 1235 | Ga0157380_10484356 | |||
| 1236 | Ga0182008_10010381 | |||
| 1237 | Ga0157379_10001790 | |||
| 1238 | Ga0157379_10006875 | |||
| 1239 | Ga0157379_10028002 | |||
| 1240 | Ga0157379_10301397 | |||
| 1241 | Ga0157379_10447386 | |||
| 1242 | Ga0157379_10572138 | |||
| 1243 | Ga0157379_11098943 | |||
| 1244 | Ga0157379_11763756 | |||
| 1245 | Ga0157379_12395590 | |||
| 1246 | Ga0157376_10088635 | |||
| 1247 | Ga0157376_11381334 | |||
| 1248 | Ga0182006_1019521 | |||
| 1249 | Ga0182006_1069162 | |||
| 1250 | Ga0182007_10101261 | |||
| 1251 | Ga0182007_10234420 | |||
| 1252 | Ga0163161_10803624 | |||
| 1253 | Ga0163161_11531719 | |||
| 1254 | Ga0213872_10000058 | |||
| 1255 | Ga0213872_10000102 | |||
| 1256 | Ga0213872_10000150 | |||
| 1257 | Ga0213872_10004383 | |||
| 1258 | Ga0213872_10153162 | |||
| 1259 | Ga0213872_10339958 | |||
| 1260 | Ga0213875_10077329 | |||
| 1261 | Ga0209435_100015 | |||
| 1262 | Ga0209435_100288 | |||
| 1263 | Ga0209784_100005 | |||
| 1264 | Ga0209566_100005 | |||
| 1265 | Ga0209674_100009 | |||
| 1266 | Ga0209674_100064 | |||
| 1267 | Ga0209147_100004 | |||
| 1268 | Ga0209563_100012 | |||
| 1269 | Ga0209563_100126 | |||
| 1270 | Ga0207427_100197 | |||
| 1271 | Ga0209437_100268 | |||
| 1272 | Ga0209258_100298 | |||
| 1273 | Ga0209258_100736 | |||
| 1274 | Ga0209258_100787 | |||
| 1275 | Ga0209646_1000040 | |||
| 1276 | Ga0209646_1000060 | |||
| 1277 | Ga0209646_1000105 | |||
| 1278 | Ga0209026_1000034 | |||
| 1279 | Ga0209026_1000049 | |||
| 1280 | Ga0209677_100006 | |||
| 1281 | Ga0209677_100411 | |||
| 1282 | Ga0209677_101394 | |||
| 1283 | Ga0209677_109255 | |||
| 1284 | Ga0209148_1012868 | |||
| 1285 | Ga0209148_1022957 | |||
| 1286 | Ga0209759_1000069 | |||
| 1287 | Ga0209759_1000234 | |||
| 1288 | Ga0209759_1000569 | |||
| 1289 | Ga0209759_1001582 | |||
| 1290 | Ga0209759_1002582 | |||
| 1291 | Ga0209759_1016603 | |||
| 1292 | Ga0209759_1020690 | |||
| 1293 | Ga0207666_1014266 | |||
| 1294 | Ga0209455_1002003 | |||
| 1295 | Ga0209455_1005524 | |||
| 1296 | Ga0209455_1029989 | |||
| 1297 | Ga0209758_1000233 | |||
| 1298 | Ga0209051_1000140 | |||
| 1299 | Ga0209051_1001699 | |||
| 1300 | Ga0209051_1008265 | |||
| 1301 | Ga0209051_1029310 | |||
| 1302 | Ga0209257_1000012 | |||
| 1303 | Ga0209257_1000045 | |||
| 1304 | Ga0209257_1063458 | |||
| 1305 | Ga0207697_10185402 | |||
| 1306 | Ga0207656_10018424 | |||
| 1307 | Ga0207656_10106539 | |||
| 1308 | Ga0207656_10137890 | |||
| 1309 | Ga0207656_10234031 | |||
| 1310 | Ga0207656_10407251 | |||
| 1311 | Ga0207710_10166332 | |||
| 1312 | Ga0207680_10301289 | |||
| 1313 | Ga0207645_10004810 | |||
| 1314 | Ga0207645_10034993 | |||
| 1315 | Ga0207643_10023140 | |||
| 1316 | Ga0207643_10089604 | |||
| 1317 | Ga0207643_10164665 | |||
| 1318 | Ga0207705_10035791 | |||
| 1319 | Ga0207705_10162995 | |||
| 1320 | Ga0207705_10233564 | |||
| 1321 | Ga0207684_10012635 | |||
| 1322 | Ga0207654_10378130 | |||
| 1323 | Ga0207654_10834454 | |||
| 1324 | Ga0207707_10036063 | |||
| 1325 | Ga0207695_10000573 | |||
| 1326 | Ga0207695_10004109 | |||
| 1327 | Ga0207695_10006006 | |||
| 1328 | Ga0207695_10030732 | |||
| 1329 | Ga0207695_10080469 | |||
| 1330 | Ga0207695_10099795 | |||
| 1331 | Ga0207695_10255540 | |||
| 1332 | Ga0207671_10046969 | |||
| 1333 | Ga0207671_10225306 | |||
| 1334 | Ga0207671_10248091 | |||
| 1335 | Ga0207671_10302330 | |||
| 1336 | Ga0207671_10775753 | |||
| 1337 | Ga0207660_10906699 | |||
| 1338 | Ga0207660_10990277 | |||
| 1339 | Ga0207657_10024892 | |||
| 1340 | Ga0207657_10286982 | |||
| 1341 | Ga0207657_10727761 | |||
| 1342 | Ga0207657_10765968 | |||
| 1343 | Ga0207649_10002217 | |||
| 1344 | Ga0207649_10563024 | |||
| 1345 | Ga0207652_10047116 | |||
| 1346 | Ga0207652_10310463 | |||
| 1347 | Ga0207646_10198051 | |||
| 1348 | Ga0207681_10005071 | |||
| 1349 | Ga0207681_10208885 | |||
| 1350 | Ga0207694_10000505 | |||
| 1351 | Ga0207694_10010773 | |||
| 1352 | Ga0207694_10361493 | |||
| 1353 | Ga0207694_10384437 | |||
| 1354 | Ga0207694_10783681 | |||
| 1355 | Ga0207694_10819862 | |||
| 1356 | Ga0207650_10022889 | |||
| 1357 | Ga0207650_10023873 | |||
| 1358 | Ga0207650_10050850 | |||
| 1359 | Ga0207650_10053437 | |||
| 1360 | Ga0207650_10075425 | |||
| 1361 | Ga0207650_10370508 | |||
| 1362 | Ga0207650_10373791 | |||
| 1363 | Ga0207659_10009257 | |||
| 1364 | Ga0207659_10110207 | |||
| 1365 | Ga0207659_10587076 | |||
| 1366 | Ga0207687_10000799 | |||
| 1367 | Ga0207687_10060589 | |||
| 1368 | Ga0207687_10241914 | |||
| 1369 | Ga0207687_11504785 | |||
| 1370 | Ga0207664_10050874 | |||
| 1371 | Ga0207644_10017024 | |||
| 1372 | Ga0207644_10092568 | |||
| 1373 | Ga0207644_10332254 | |||
| 1374 | Ga0207644_10362591 | |||
| 1375 | Ga0207644_11190387 | |||
| 1376 | Ga0207690_10013867 | |||
| 1377 | Ga0207690_10189386 | |||
| 1378 | Ga0207706_10074485 | |||
| 1379 | Ga0207706_10132942 | |||
| 1380 | Ga0207686_10004205 | |||
| 1381 | Ga0207686_10276959 | |||
| 1382 | Ga0207709_10060578 | |||
| 1383 | Ga0207709_11177358 | |||
| 1384 | Ga0207670_10051735 | |||
| 1385 | Ga0207669_10068061 | |||
| 1386 | Ga0207669_10182940 | |||
| 1387 | Ga0207669_10535201 | |||
| 1388 | Ga0207704_10058715 | |||
| 1389 | Ga0207691_10004143 | |||
| 1390 | Ga0207691_10006762 | |||
| 1391 | Ga0207691_10024653 | |||
| 1392 | Ga0207691_10061422 | |||
| 1393 | Ga0207711_10011889 | |||
| 1394 | Ga0207711_10549147 | |||
| 1395 | Ga0207711_10620816 | |||
| 1396 | Ga0207689_10000452 | |||
| 1397 | Ga0207689_10147813 | |||
| 1398 | Ga0207689_10584203 | |||
| 1399 | Ga0207689_10757036 | |||
| 1400 | Ga0207661_10028466 | |||
| 1401 | Ga0207661_10866758 | |||
| 1402 | Ga0207679_10117544 | |||
| 1403 | Ga0207679_10139525 | |||
| 1404 | Ga0207679_10850953 | |||
| 1405 | Ga0207667_10000053 | |||
| 1406 | Ga0207667_10026989 | |||
| 1407 | Ga0207667_10028711 | |||
| 1408 | Ga0207667_10052477 | |||
| 1409 | Ga0207667_10248612 | |||
| 1410 | Ga0207667_12123069 | |||
| 1411 | Ga0207651_10069538 | |||
| 1412 | Ga0207651_10088444 | |||
| 1413 | Ga0207651_10105872 | |||
| 1414 | Ga0207651_10413338 | |||
| 1415 | Ga0207651_11251062 | |||
| 1416 | Ga0207712_10123168 | |||
| 1417 | Ga0207668_10012253 | |||
| 1418 | Ga0207668_10247602 | |||
| 1419 | Ga0207668_10407248 | |||
| 1420 | Ga0207668_11296762 | |||
| 1421 | Ga0207640_10031492 | |||
| 1422 | Ga0207640_10049985 | |||
| 1423 | Ga0207640_10112897 | |||
| 1424 | Ga0207640_10212227 | |||
| 1425 | Ga0207640_10380006 | |||
| 1426 | Ga0207658_10047106 | |||
| 1427 | Ga0207658_10050043 | |||
| 1428 | Ga0207658_10061349 | |||
| 1429 | Ga0207658_10125710 | |||
| 1430 | Ga0207658_10968704 | |||
| 1431 | Ga0207677_10031338 | |||
| 1432 | Ga0207677_10051376 | |||
| 1433 | Ga0207677_10774884 | |||
| 1434 | Ga0207677_11011251 | |||
| 1435 | Ga0207677_11999619 | |||
| 1436 | Ga0207703_10003194 | |||
| 1437 | Ga0207703_10399632 | |||
| 1438 | Ga0207639_10075141 | |||
| 1439 | Ga0207639_10144245 | |||
| 1440 | Ga0207639_11096435 | |||
| 1441 | Ga0207639_11415759 | |||
| 1442 | Ga0207678_10106297 | |||
| 1443 | Ga0207678_10373059 | |||
| 1444 | Ga0207708_10000701 | |||
| 1445 | Ga0207702_10022449 | |||
| 1446 | Ga0207702_10083504 | |||
| 1447 | Ga0207702_10204748 | |||
| 1448 | Ga0207641_10009598 | |||
| 1449 | Ga0207641_10026935 | |||
| 1450 | Ga0207641_10272468 | |||
| 1451 | Ga0207648_10000159 | |||
| 1452 | Ga0207648_10003372 | |||
| 1453 | Ga0207648_10038891 | |||
| 1454 | Ga0207648_10071567 | |||
| 1455 | Ga0207648_10160108 | |||
| 1456 | Ga0207648_10506563 | |||
| 1457 | Ga0207648_10542851 | |||
| 1458 | Ga0207648_10738928 | |||
| 1459 | Ga0207676_10003896 | |||
| 1460 | Ga0207676_10037088 | |||
| 1461 | Ga0207676_10620870 | |||
| 1462 | Ga0207674_10000954 | |||
| 1463 | Ga0207674_10006659 | |||
| 1464 | Ga0207674_10022384 | |||
| 1465 | Ga0207674_10121427 | |||
| 1466 | Ga0207674_10435399 | |||
| 1467 | Ga0207674_10437071 | |||
| 1468 | Ga0207674_10636845 | |||
| 1469 | Ga0207674_10975356 | |||
| 1470 | Ga0207674_11234974 | |||
| 1471 | Ga0207675_100000068 | |||
| 1472 | Ga0207675_100037965 | |||
| 1473 | Ga0207675_100213377 | |||
| 1474 | Ga0207675_100454833 | |||
| 1475 | Ga0207683_10013791 | |||
| 1476 | Ga0207683_10093306 | |||
| 1477 | Ga0207683_10598439 | |||
| 1478 | Ga0207698_10007618 | |||
| 1479 | Ga0207698_10025226 | |||
| 1480 | Ga0207698_10698688 | |||
| 1481 | Ga0207698_10767765 | |||
| 1482 | Ga0207698_11320615 | |||
| 1483 | Ga0209281_1007305 | |||
| 1484 | Ga0209813_10008368 | |||
| 1485 | Ga0209813_10140803 | |||
| 1486 | Ga0268266_10037951 | |||
| 1487 | Ga0268266_10707477 | |||
| 1488 | Ga0268265_10016151 | |||
| 1489 | Ga0268265_10031173 | |||
| 1490 | Ga0268265_10050837 | |||
| 1491 | Ga0268265_10223199 | |||
| 1492 | Ga0268265_12588079 | |||
| 1493 | Ga0268264_10020364 | |||
| 1494 | Ga0268264_10149599 | |||
| 1495 | Ga0268264_10241375 | |||
| 1496 | Ga0268264_10804770 | |||
| 1497 | Ga0265336_10000123 | |||
| 1498 | Ga0307517_10002354 | |||
| 1499 | Ga0307517_10077719 | |||
| 1500 | Ga0307517_10318467 | |||
| 1501 | Ga0307515_10015864 | |||
| 1502 | Ga0307515_10106461 | |||
| 1503 | Ga0307515_10254589 | |||
| 1504 | Ga0307515_10583058 | |||
| 1505 | Ga0265324_10000849 | |||
| 1506 | Ga0307511_10253296 | |||
| 1507 | Ga0307512_10182106 | |||
| 1508 | Ga0307512_10233028 | |||
| 1509 | Ga0307512_10252093 | |||
| 1510 | Ga0265332_10000278 | |||
| 1511 | Ga0265331_10009024 | |||
| 1512 | Ga0265331_10058535 | |||
| 1513 | Ga0265327_10000328 | |||
| 1514 | Ga0307513_10021976 | |||
| 1515 | Ga0307513_10195711 | |||
| 1516 | Ga0307513_10380145 | |||
| 1517 | Ga0307509_10000234 | |||
| 1518 | Ga0307509_10039607 | |||
| 1519 | Ga0307509_10090207 | |||
| 1520 | Ga0307509_10112558 | |||
| 1521 | Ga0307509_10120503 | |||
| 1522 | Ga0307509_10902039 | |||
| 1523 | Ga0307408_100211432 | |||
| 1524 | Ga0307408_100603774 | |||
| 1525 | Ga0307508_10001066 | |||
| 1526 | Ga0307508_10088896 | |||
| 1527 | Ga0307514_10052858 | |||
| 1528 | Ga0307514_10062249 | |||
| 1529 | Ga0307514_10253912 | |||
| 1530 | Ga0307514_10414020 | |||
| 1531 | Ga0307516_10037289 | |||
| 1532 | Ga0307516_10090008 | |||
| 1533 | Ga0307516_10124340 | |||
| 1534 | Ga0307516_10143470 | |||
| 1535 | Ga0307516_10613533 | |||
| 1536 | Ga0307516_10629741 | |||
| 1537 | Ga0307516_10769828 | |||
| 1538 | Ga0307405_10174205 | |||
| 1539 | Ga0307413_10017248 | |||
| 1540 | Ga0307413_11501109 | |||
| 1541 | Ga0307518_10357644 | |||
| 1542 | Ga0307410_10283779 | |||
| 1543 | Ga0307412_10401022 | |||
| 1544 | Ga0307412_11085580 | |||
| 1545 | Ga0307409_100372205 | |||
| 1546 | Ga0307416_102294687 | |||
| 1547 | Ga0307414_10689805 | |||
| 1548 | Ga0307411_10044945 | |||
| 1549 | Ga0307411_10321696 | |||
| 1550 | Ga0307415_100740945 | |||
| 1551 | Ga0307415_101200948 | |||
| 1552 | Ga0316583_10227339 | |||
| 1553 | Ga0307510_10012165 | |||
| 1554 | Ga0307510_10032961 | |||
| 1555 | Ga0373952_0001139 | |||
| 1556 | Ga0373946_0066198 | |||
| 1557 | Ga0373931_0025723 | |||
| 1558 | Ga0373937_0179223 | |||
| 1559 | Ga0373937_0340219 | |||
| 1560 | Ga0373937_0669136 | |||
| 1561 | Ga0395899_0195598 | |||
| 1562 | Ga0395899_0204210 | |||
| 1563 | Ga0395898_0038029 | |||
| 1564 | Ga0436364_0570264 | |||
| 1565 | Ga0395901_0029531 | |||
| 1566 | Ga0436365_0680524 | |||
| 1567 | Ga0436361_0018388 | |||
| 1568 | Ga0436361_0068556 | |||
| 1569 | Ga0436361_0162163 | |||
| 1570 | Ga0436361_0614815 | |||
| 1571 | Ga0436361_0651406 | |||
| 1572 | Ga0436361_0658018 | |||
| 1573 | Ga0436361_0704442 | |||
| 1574 | Ga0436361_1050932 | |||
| 1575 | Ga0436361_1078434 | |||
| 1576 | Ga0451791_0302276 | |||
| 1577 | Ga0451795_1577239 | |||
| 1578 | Ga0451837_1131948 | |||
| 1579 | Ga0451853_1225302 | |||
| 1580 | Ga0451853_1592565 | |||
| 1581 | Ga0451853_2413001 | |||
| 1582 | Ga0439437_064593 | |||
| 1583 | Ga0439448_0053162 | |||
| 1584 | Ga0439448_0323230 | |||
| 1585 | Ga0439450_054731 | |||
| 1586 | Ga0450889_021654 | |||
| 1587 | Ga0439464_0008576 | |||
| 1588 | Ga0451577_0180363 | |||
| 1589 | Ga0466965_0030229 | |||
| 1590 | Ga0466963_0645760 | |||
| 1591 | Ga0466964_0004400 | |||
| 1592 | Ga0453684_0562581 | |||
| 1593 | Ga0466968_0068366 | |||
| 1594 | Ga0466970_0011861 | |||
| 1595 | Ga0466957_0028524 | |||
| 1596 | Ga0466957_0351328 | |||
| 1597 | Ga0466957_0571936 | |||
| 1598 | Ga0466959_0022300 | |||
| 1599 | Ga0451576_0001324 | |||
| 1600 | Ga0451576_0978897 | |||
| 1601 | Ga0466958_0153786 | |||
| 1602 | Ga0466967_0234772 | |||
| 1603 | Ga0466967_0379341 | |||
| 1604 | Ga0466967_0635782 | |||
| 1605 | Ga0466967_0962078 | |||
| 1606 | Ga0466967_1447903 | |||
| 1607 | Ga0495592_0000291 | |||
| 1608 | Ga0495638_0118661 | |||
| 1609 | Ga0495638_0276953 | |||
| 1610 | Ga0495651_0387051 | |||
| 1611 | Ga0495650_0053966 | |||
| 1612 | Ga0495650_0085334 | |||
| 1613 | Ga0495582_0254919 | |||
| 1614 | Ga0495605_0082544 | |||
| 1615 | Ga0495664_0201984 | |||
| 1616 | Ga0495607_0200564 | |||
| 1617 | Ga0495583_0000046 | |||
| 1618 | Ga0495583_0312776 | |||
| 1619 | Ga0495610_0053848 | |||
| 1620 | Ga0495628_0051863 | |||
| 1621 | Ga0495631_0377690 | |||
| 1622 | Ga0495632_0006200 | |||
| 1623 | Ga0495648_0303349 | |||
| 1624 | Ga0495666_0021091 | |||
| 1625 | Ga0495598_0006095 | |||
| 1626 | Ga0495621_0193356 | |||
| 1627 | Ga0495597_0003922 | |||
| 1628 | Ga0495597_0024542 | |||
| 1629 | Ga0495597_0134198 | |||
| 1630 | Ga0495645_0071213 | |||
| 1631 | Ga0495622_0025296 | |||
| 1632 | Ga0495611_0221658 | |||
| 1633 | Ga0495625_0005740 | |||
| 1634 | Ga0495625_0036997 | |||
| 1635 | Ga0495625_0150118 | |||
| 1636 | Ga0495625_0321463 | |||
| 1637 | Ga0495647_0334470 | |||
| 1638 | Ga0495658_0004796 | |||
| 1639 | Ga0495658_0454283 | |||
| 1640 | Ga0495658_0693015 | |||
| 1641 | Ga0495613_0603713 | |||
| 1642 | Ga0495624_0056474 | |||
| 1643 | Ga0495671_0111819 | |||
| 1644 | Ga0495671_0154985 | |||
| 1645 | Ga0495671_0363925 | |||
| 1646 | Ga0495671_0598998 | |||
| 1647 | Ga0495649_0000638 | |||
| 1648 | Ga0495649_0037138 | |||
| 1649 | Ga0495660_0024873 | |||
| 1650 | Ga0495687_000367 | |||
| 1651 | Ga0495687_011817 | |||
| 1652 | Ga0495673_0156408 | |||
| 1653 | Ga0495686_0029542 | |||
| 1654 | Ga0495686_0145468 | |||
| 1655 | Ga0495593_0031997 | |||
| 1656 | Ga0495614_0287908 | |||
| 1657 | Ga0495615_0024194 | |||
| 1658 | Ga0495626_0074869 | |||
| 1659 | Ga0496100_0095075 | |||
| 1660 | Ga0496101_0242656 | |||
| 1661 | Ga0496101_1162577 | |||
| 1662 | Ga0496104_0046378 | |||
| 1663 | Ga0496105_0557045 | |||
| 1664 | Ga0496106_0056501 | |||
| 1665 | Ga0496106_0361007 | |||
| 1666 | Ga0496108_0054157 | |||
| 1667 | Ga0496108_0458421 | |||
| 1668 | Ga0496108_0475861 | |||
| 1669 | Ga0496108_0716479 | |||
| 1670 | Ga0496109_0023407 | |||
| 1671 | Ga0496111_0149444 | |||
| 1672 | Ga0496112_0000429 | |||
| 1673 | Ga0496112_0207877 | |||
| 1674 | Ga0496112_1081738 | |||
| 1675 | Ga0496113_0400549 | |||
| 1676 | Ga0496114_0006440 | |||
| 1677 | Ga0496114_0322714 | |||
| 1678 | Ga0496115_0416682 | |||
| 1679 | Ga0496116_0018094 | |||
| 1680 | Ga0496118_0185082 | |||
| 1681 | Ga0496121_0020869 | |||
| 1682 | Ga0496121_0054604 | |||
| 1683 | Ga0496121_0316427 | |||
| 1684 | Ga0496122_0008179 | |||
| 1685 | Ga0496123_0008042 | |||
| 1686 | Ga0496124_0469914 | |||
| 1687 | Ga0496125_0005346 | |||
| 1688 | Ga0496126_0026066 | |||
| 1689 | Ga0495682_0276103 | |||
| 1690 | Ga0501290_079332 | |||
| 1691 | Ga0501300_027973 | |||
| 1692 | Ga0501032_0010930 | |||
| 1693 | Ga0501032_0140832 | |||
| 1694 | Ga0501034_0024667 | |||
| 1695 | Ga0501034_0257622 | |||
| 1696 | Ga0501038_0058614 | |||
| 1697 | Ga0501039_0013485 | |||
| 1698 | Ga0501043_0000149 | |||
| 1699 | Ga0501046_0000092 | |||
| 1700 | Ga0501047_0000028 | |||
| 1701 | Ga0501048_0006680 | |||
| 1702 | Ga0501072_0586099 | |||
| 1703 | Ga0501079_0657938 | |||
| 1704 | Ga0501081_0688929 | |||
| 1705 | Ga0501266_000057 | |||
| 1706 | Ga0501035_0046260 | |||
| 1707 | Ga0501035_1209385 | |||
| 1708 | Ga0501044_0272835 | |||
| 1709 | Ga0501045_0000170 | |||
| 1710 | nmdc:mga03683_10952_c1 | |||
| 1711 | nmdc:mga03683_120460_c1 | |||
| 1712 | nmdc:mga03683_19823_c1 | |||
| 1713 | nmdc:mga03n38_230957_c1 | |||
| 1714 | nmdc:mga03n38_48533_c1 | |||
| 1715 | nmdc:mga00v17_10380_c1 | |||
| 1716 | nmdc:mga0k408_11251_c1 | |||
| 1717 | nmdc:mga0k408_198791_c1 | |||
| 1718 | nmdc:mga0k408_22329_c1 | |||
| 1719 | nmdc:mga0k408_2308_c1 | |||
| 1720 | nmdc:mga0k408_27898_c1 | |||
| 1721 | nmdc:mga0k408_355_c1 | |||
| 1722 | nmdc:mga0k408_40234_c1 | |||
| 1723 | nmdc:mga0k408_61790_c1 | |||
| 1724 | nmdc:mga0k408_68274_c1 | |||
| 1725 | nmdc:mga0k408_69103_c1 | |||
| 1726 | nmdc:mga0k408_8262_c1 | |||
| 1727 | nmdc:mga06z11_127044_c1 | |||
| 1728 | nmdc:mga06z11_165950_c1 | |||
| 1729 | nmdc:mga06z11_5785_c1 | |||
| 1730 | nmdc:mga04h51_11203_c1 | |||
| 1731 | nmdc:mga04h51_160506_c1 | |||
| 1732 | nmdc:mga07m45_10918_c1 | |||
| 1733 | nmdc:mga07m45_1116_c1 | |||
| 1734 | nmdc:mga07m45_175262_c1 | |||
| 1735 | nmdc:mga07m45_216266_c1 | |||
| 1736 | nmdc:mga07m45_2223_c1 | |||
| 1737 | nmdc:mga07m45_27823_c1 | |||
| 1738 | nmdc:mga07m45_398480_c1 | |||
| 1739 | nmdc:mga07m45_6961_c1 | |||
| 1740 | nmdc:mga07m45_7118_c1 | |||
| 1741 | nmdc:mga07m45_7357_c1 | |||
| 1742 | nmdc:mga09592_4802_c1 | |||
| 1743 | nmdc:mga0qj67_89016_c1 | |||
| 1744 | nmdc:mga0n895_1200895_c1 | |||
| 1745 | nmdc:mga0n895_1778329_c1 | |||
| 1746 | nmdc:mga0sz30_176495_c1 | |||
| 1747 | Ga0495601_0498003 | |||
| 1748 | Ga0500635_0000005 | |||
| 1749 | Ga0500644_0100473 | |||
| 1750 | Ga0500651_0028942 | |||
| 1751 | Ga0500651_0058855 | |||
| 1752 | Ga0500651_0422206 | |||
| 1753 | Ga0500618_001127 | |||
| 1754 | Ga0500618_003179 | |||
| 1755 | Ga0500658_0002097 | |||
| 1756 | Ga0500559_0000119 | |||
| 1757 | Ga0500564_107433 | |||
| 1758 | Ga0500564_113828 | |||
| 1759 | Ga0500564_138173 | |||
| 1760 | Ga0500568_0005734 | |||
| 1761 | Ga0500622_0005643 | |||
| 1762 | Ga0500636_0045101 | |||
| 1763 | Ga0500636_0132989 | |||
| 1764 | Ga0500587_004225 | |||
| 1765 | Ga0501084_1049680 | |||
| 1766 | Ga0500661_014650 | |||
| 1767 | Ga0501082_0504992 | |||
| 1768 | Ga0466962_0057998 | |||
| 1769 | 2511250706 | |||
| 1770 | 2511383165 | |||
| 1771 | 2521557186 | |||
| 1772 | 2548848656 | |||
| 1773 | 2550696542 | |||
| 1774 | 2553007707 | |||
| 1775 | 2644303978 | |||
| 1776 | 2644338794 | |||
| 1777 | 2765568317 | |||
| 1778 | 2808983393 | |||
| 1779 | 2809128621 | |||
| 1780 | 2809148242 | |||
| 1781 | 2819591914 | |||
| 1782 | 2819618660 | |||
| 1783 | 2839094821 | |||
| 1784 | 2852620336 | |||
| 1785 | 2884840674 | |||
| 1786 | 2884855931 | |||
| 1787 | 2896157144 | |||
| 1788 | 2904440108 | |||
| 1789 | 2904530956 | |||
| 1790 | 2904587411 | |||
| 1791 | 2904592554 | |||
| 1792 | 2904604654 | |||
| 1793 | 2919050465 | |||
| 1794 | 2919082485 | |||
| 1795 | 2923515812 | |||
| 1796 | 2928133396 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1ujc-assembly1.cif.gz_A | structure of the protein histidine phosphatase sixa complexed with tungstate | 0.8325 | 1 | 151 |
| 3f2i-assembly3.cif.gz_E | crystal structure of the alr0221 protein from nostoc, northeast structural genomics consortium target nsr422. | 0.8267 | 1 | 151 |
| 1ujc-assembly1.cif.gz_A | structure of the protein histidine phosphatase sixa complexed with tungstate | 0.8225 | 1 | 151 |
| 3f2i-assembly1.cif.gz_A | crystal structure of the alr0221 protein from nostoc, northeast structural genomics consortium target nsr422. | 0.8213 | 1 | 152 |
| 3f2i-assembly3.cif.gz_E | crystal structure of the alr0221 protein from nostoc, northeast structural genomics consortium target nsr422. | 0.8168 | 1 | 151 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P42522_761_951_2.30.29.30 | Mainly Beta;Roll;PH-domain like;Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) | 0.8556 | 124 | 146 | 2.30.29.30 |
| 1ujbA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Phosphoglycerate mutase-like | 0.8323 | 1 | 151 | 3.40.50.1240 |
| 1ujbA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Phosphoglycerate mutase-like | 0.8224 | 1 | 151 | 3.40.50.1240 |
| af_I1L079_52_229_3.40.50.1240 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Phosphoglycerate mutase-like | 0.7915 | 2 | 147 | 3.40.50.1240 |
| af_Q3UQ05_61_243_3.15.10.10 | Alpha Beta;Super Roll;Bactericidal permeability-increasing protein; domain 1;Bactericidal permeability-increasing protein; domain 1 | 0.7874 | 124 | 147 | 3.15.10.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A259DDT1-F1-model_v4 | Histidine phosphatase family protein | 0.9988 | 1 | 104 |
|
| AF-A0A0Q8H1B7-F1-model_v4 | Phosphohistidine phosphatase | 0.9896 | 1 | 149 |
|
| AF-A0A3N7EGH1-F1-model_v4 | Histidine phosphatase family protein | 0.9859 | 1 | 152 |
|
| AF-A0A5C1EC62-F1-model_v4 | Putative phosphohistidine phosphatase | 0.9852 | 1 | 152 |
|
| AF-A0A521KDL3-F1-model_v4 | Histidine phosphatase family protein | 0.9848 | 1 | 149 |
|