F485053

General Info

Members Datasets Scaffolds Average Seq Length
897 394 1796 152

Family's Representative Sequence

Representative Sequence 3300046616|Ga0495668_0072851|Ga0495668_0072851_252_788
Length 178
Sequence MSASAPKVRARSRRFSNDLQGEAETMDLILWRHAEASELEGAGDDLERALTPKGERQAQRMGEWLNQRLAHSTRILVSPALRCQQTAKALGRKFKTLPELAPDGNGESLLKAARWPDANEPVLVIGHQPTLGLVAAYLLSDTPQPWTIKKGAVWWIRSRNREDQAQVVLQAVQSPDCL

Samples

Sample ID Description Type Environment
1 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
2 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
3 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
4 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
5 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
6 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
7 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
8 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
9 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
10 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
11 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
12 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
13 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
14 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
15 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
16 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
17 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
18 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
19 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
20 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
21 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
22 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
23 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
24 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
25 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
26 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
27 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
28 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
29 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
30 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
31 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
32 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
33 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
34 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
35 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
36 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
37 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
38 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
39 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
40 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
41 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
42 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
43 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
44 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
45 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
46 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
47 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
48 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
49 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
50 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
51 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
52 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
53 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
54 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
55 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
56 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
57 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
58 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
59 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
60 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
61 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
62 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
63 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
64 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
65 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
66 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
67 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
68 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
69 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
70 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
71 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
72 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
73 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
74 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
75 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
76 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
77 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
78 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
79 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
80 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
81 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
82 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
83 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
84 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
85 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
86 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
87 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
88 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
89 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
90 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
91 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
92 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
93 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
94 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
95 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
96 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
97 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
98 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
99 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
100 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
101 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
102 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
103 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
104 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
105 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
106 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
107 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
108 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
109 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
110 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
111 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
112 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
113 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
114 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
115 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
116 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
117 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
118 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
119 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
120 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
121 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
122 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
123 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
124 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
125 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
126 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
127 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
128 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
129 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
130 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
131 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
132 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
133 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
134 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
135 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
136 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
137 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
138 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
139 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
140 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
141 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
142 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
143 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
145 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
146 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
147 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
148 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
204 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
205 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
209 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
210 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
211 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
212 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
213 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
214 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
215 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
216 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
217 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
218 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
219 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
220 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
221 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
222 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
223 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
224 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
225 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
226 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
227 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
228 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
229 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
230 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
231 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
232 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
233 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
234 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
235 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
236 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
237 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
238 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
239 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
240 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
241 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
242 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
243 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
244 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
245 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
246 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
247 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
248 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
249 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
250 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
251 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
252 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
253 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
254 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
255 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
256 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
257 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
258 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
259 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
260 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
261 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
262 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
263 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
264 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
265 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
266 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
267 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
268 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
269 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
270 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
271 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
272 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
273 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
274 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
275 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
276 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
277 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
278 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
279 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
280 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
281 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
282 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
283 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
284 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
285 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
286 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
287 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
288 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
289 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
290 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
291 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
292 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
293 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
294 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
295 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
296 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
297 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
298 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
299 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
300 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
301 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
302 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
303 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
304 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
305 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
306 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
307 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
308 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
309 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
310 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
311 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
312 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
313 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
314 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
315 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
316 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
317 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
318 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
319 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
320 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
321 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
322 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
323 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
324 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
325 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
326 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
327 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
328 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
329 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
330 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
331 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
332 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
333 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
334 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
335 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
336 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
337 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
338 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
339 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
340 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
341 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
342 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
343 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
344 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
345 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
346 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
347 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
348 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
349 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
350 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
351 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
352 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
353 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
354 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
355 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
356 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
357 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
358 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
359 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
360 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
361 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
362 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
363 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
364 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
365 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
366 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
367 2511231003 Herbaspirillum sp. CF444 Isolate Rhizosphere
368 2511231026 Herbaspirillum sp. YR522 Isolate Rhizosphere
369 2521172590 Herbaspirillum sp. GW103 Isolate Rhizosphere
370 2547132512 Azospira oryzae 6a3 Isolate Unclassified
371 2548876994 Herbaspirillum lusitanum P6-12 Isolate Nodule
372 2551306416 Herbaspirillum seropedicae Os34 Isolate Unclassified
373 2643221654 Rhizobacter sp. Root404 Isolate Unclassified
374 2643221660 Methylibium sp. Root1272 Isolate Unclassified
375 2765235838 Herbaspirillum robiniae AA6 Isolate Unclassified
376 2808606386 Herbaspirillum sp. SJZ099 Isolate Rhizosphere
377 2808606415 Herbaspirillum sp. SJZ130 Isolate Rhizosphere
378 2808606419 Herbaspirillum sp. SJZ106 Isolate Rhizosphere
379 2818991445 Herbaspirillum hiltneri 3195 Isolate Unclassified
380 2818991449 Herbaspirillum huttiense 1147 Isolate Unclassified
381 2839094727 Herbaspirillum robiniae HZ10 Isolate Nodule
382 2852618963 Herbaspirillum sp. SJZ102 Isolate Rhizosphere
383 2884836552 Herbaspirillum sp. 3R-11 Isolate Unclassified
384 2884852848 Herbaspirillum sp. 3R11 Isolate Unclassified
385 2896154374 Herbaspirillum sp. 3R-3a1 Isolate Nodule
386 2904439833 Herbaspirillum sp. 1589 Isolate Rhizosphere
387 2904530477 Herbaspirillum huttiense 611 Isolate Unclassified
388 2904584206 Herbaspirillum sp. 1050 Isolate Unclassified
389 2904589729 Herbaspirillum sp. 1130 Isolate Unclassified
390 2904601388 Herbaspirillum sp. 1273 Isolate Rhizosphere
391 2919046199 Herbaspirillum frisingense 596 Isolate Unclassified
392 2919079590 Herbaspirillum sp. 1173 Isolate Unclassified
393 2923510766 Herbaspirillum rubrisubalbicans SLBN-127 Isolate Rhizosphere
394 2928130867 Herbaspirillum seropedicae 1977 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 96.88
Metatranscriptomes 0
Isolates 3.12

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 14.83
Nodule 0.56
Rhizoplane 2.45
Rhizosphere 71.01
Stem 0
Stem Tuber 0
Unclassified 3.23

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495668_0072851 3300046616 Bacteria 1887
2 JGI25155J39150_1000552 3300002704 Bacteria 8473
3 JGI25156J39149_1000459 3300002705 Bacteria 24817
4 JGI25156J39149_1001026 3300002705 Bacteria 13042
5 JGI25156J39149_1002927 3300002705 Bacteria 5814
6 JGI25156J39149_1020328 3300002705 Bacteria 1171
7 JGI25162J39368_1010430 3300002737 Bacteria 1175
8 JGI25154J39366_1000871 3300002738 Bacteria 13042
9 JGI25154J39366_1000911 3300002738 Bacteria 12467
10 JGI25154J39366_1001802 3300002738 Bacteria 6715
11 JGI25157J39369_1000021 3300002741 Bacteria 163907
12 JGI25157J39369_1001256 3300002741 Bacteria 10403
13 JGI25164J39214_1005040 3300002772 Bacteria 1461
14 rootH1_10015810 3300003316 Bacteria 1931
15 rootH1_10015810 3300003323 Bacteria 19240
16 rootH1_10028438 3300003316 Bacteria 4544
17 rootH1_10028438 3300003323 Bacteria 1649
18 rootH1_10033518 3300003316 Bacteria 1211
19 rootH1_10042308 3300003316 Bacteria 1474
20 rootH2_10019687 3300003320 Bacteria 1609
21 rootH1_10021003 3300003323 Bacteria 1397
22 rootH1_10072734 3300003323 Bacteria 1364
23 rootH1_10085156 3300003323 Bacteria 1281
24 Ga0055538_1000013 3300003751 Bacteria 348596
25 Ga0055539_1000018 3300003752 Bacteria 348596
26 Ga0055539_1000422 3300003752 Bacteria 15528
27 Ga0055539_1006291 3300003752 Bacteria 1519
28 Ga0055539_1007357 3300003752 Bacteria 1394
29 Ga0055533_1000022 3300003756 Bacteria 348596
30 Ga0055533_1000033 3300003756 Bacteria 265716
31 Ga0055532_1000017 3300003758 Bacteria 306880
32 Ga0055525_1000024 3300003759 Bacteria 348596
33 Ga0055525_1001360 3300003759 Bacteria 4732
34 Ga0055535_1001037 3300003761 Bacteria 17524
35 Ga0055529_1000860 3300003763 Bacteria 17524
36 Ga0055540_1098486 3300003792 Bacteria 547
37 Ga0055531_10000303 3300003794 Bacteria 48725
38 Ga0055541_1000013 3300003841 Bacteria 348596
39 Ga0070658_10055065 3300005327 Bacteria 3231
40 Ga0070658_10159526 3300005327 Bacteria 1892
41 Ga0070658_10334405 3300005327 Bacteria 1295
42 Ga0070658_10546180 3300005327 Bacteria 1003
43 Ga0070658_10690884 3300005327 Bacteria 885
44 Ga0070676_10006846 3300005328 Bacteria 6103
45 Ga0070676_10031112 3300005328 Bacteria 3047
46 Ga0070683_100052816 3300005329 Bacteria 3766
47 Ga0070690_100258225 3300005330 Bacteria 1235
48 Ga0070690_100884353 3300005330 Bacteria 698
49 Ga0070670_100001932 3300005331 Bacteria 16972
50 Ga0070670_100016141 3300005331 Bacteria 6410
51 Ga0070670_100030522 3300005331 Bacteria 4641
52 Ga0070670_100043467 3300005331 Bacteria 3862
53 Ga0070670_100247824 3300005331 Bacteria 1551
54 Ga0070670_100413575 3300005331 Bacteria 1191
55 Ga0070670_100454897 3300005331 Bacteria 1135
56 Ga0070670_100565065 3300005331 Bacteria 1016
57 Ga0070677_10250943 3300005333 Bacteria 878
58 Ga0068869_100002015 3300005334 Bacteria 12211
59 Ga0068869_100009386 3300005334 Bacteria 6347
60 Ga0068869_100270562 3300005334 Bacteria 1363
61 Ga0068869_100280540 3300005334 Bacteria 1340
62 Ga0068869_100866308 3300005334 Bacteria 780
63 Ga0068869_100914381 3300005334 Bacteria 760
64 Ga0070666_10118688 3300005335 Bacteria 1833
65 Ga0070666_10578781 3300005335 Bacteria 818
66 Ga0070666_10716842 3300005335 Unclassified 734
67 Ga0070680_100951768 3300005336 Unclassified 741
68 Ga0068868_100009443 3300005338 Bacteria 7021
69 Ga0068868_100035076 3300005338 Bacteria 3876
70 Ga0068868_100637045 3300005338 Bacteria 948
71 Ga0068868_101715614 3300005338 Bacteria 592
72 Ga0070660_100008023 3300005339 Bacteria 7379
73 Ga0070660_100341540 3300005339 Bacteria 1232
74 Ga0070689_100078740 3300005340 Bacteria 2584
75 Ga0070687_100358331 3300005343 Bacteria 943
76 Ga0070661_100001088 3300005344 Bacteria 19203
77 Ga0070661_100248558 3300005344 Bacteria 1372
78 Ga0070661_100394804 3300005344 Bacteria 1093
79 Ga0070661_100552539 3300005344 Unclassified 926
80 Ga0070661_100885046 3300005344 Bacteria 736
81 Ga0070692_10004158 3300005345 Bacteria 5995
82 Ga0070668_100020530 3300005347 Bacteria 4987
83 Ga0070668_100329391 3300005347 Bacteria 1287
84 Ga0070668_100743087 3300005347 Bacteria 868
85 Ga0070669_100022076 3300005353 Bacteria 4553
86 Ga0070669_100113789 3300005353 Bacteria 2056
87 Ga0070675_100004356 3300005354 Bacteria 10791
88 Ga0070675_100013239 3300005354 Bacteria 6483
89 Ga0070675_100069593 3300005354 Bacteria 2916
90 Ga0070671_100348620 3300005355 Bacteria 1263
91 Ga0070674_100226733 3300005356 Bacteria 1456
92 Ga0070673_100020834 3300005364 Bacteria 4738
93 Ga0070673_100081701 3300005364 Bacteria 2621
94 Ga0070673_100093732 3300005364 Bacteria 2460
95 Ga0070673_100838826 3300005364 Bacteria 850
96 Ga0070673_101116476 3300005364 Bacteria 737
97 Ga0070688_100157273 3300005365 Bacteria 1559
98 Ga0070688_100163550 3300005365 Bacteria 1531
99 Ga0070688_100849343 3300005365 Bacteria 717
100 Ga0070659_100005381 3300005366 Bacteria 9188
101 Ga0070659_100189414 3300005366 Bacteria 1690
102 Ga0070659_100311689 3300005366 Bacteria 1314
103 Ga0070667_100003099 3300005367 Bacteria 14303
104 Ga0070667_100012027 3300005367 Bacteria 7164
105 Ga0070667_100025446 3300005367 Bacteria 4920
106 Ga0070667_100176479 3300005367 Bacteria 1888
107 Ga0070667_100783023 3300005367 Unclassified 885
108 Ga0070714_100002739 3300005435 Bacteria 12979
109 Ga0070700_100018494 3300005441 Bacteria 4006
110 Ga0070700_100306428 3300005441 Bacteria 1161
111 Ga0070694_100018628 3300005444 Bacteria 4408
112 Ga0070663_100085402 3300005455 Bacteria 2329
113 Ga0070663_100426950 3300005455 Bacteria 1088
114 Ga0070678_100113175 3300005456 Bacteria 2127
115 Ga0070678_100233511 3300005456 Bacteria 1534
116 Ga0070678_100593398 3300005456 Bacteria 988
117 Ga0070678_101830431 3300005456 Bacteria 573
118 Ga0070662_100010527 3300005457 Bacteria 6074
119 Ga0070662_100247329 3300005457 Bacteria 1432
120 Ga0070662_101459081 3300005457 Bacteria 590
121 Ga0070681_10034748 3300005458 Bacteria 5062
122 Ga0068867_100001409 3300005459 Bacteria 16608
123 Ga0068867_100013331 3300005459 Bacteria 5823
124 Ga0068867_100059713 3300005459 Bacteria 2827
125 Ga0068867_100109452 3300005459 Bacteria 2121
126 Ga0068867_100144721 3300005459 Bacteria 1861
127 Ga0068867_100236681 3300005459 Bacteria 1479
128 Ga0068867_100840446 3300005459 Bacteria 822
129 Ga0070685_10994582 3300005466 Bacteria 629
130 Ga0070706_100014174 3300005467 Bacteria 7365
131 Ga0070707_100032795 3300005468 Bacteria 4949
132 Ga0070679_100029666 3300005530 Bacteria 5396
133 Ga0070684_100006747 3300005535 Bacteria 8901
134 Ga0070684_101032662 3300005535 Unclassified 772
135 Ga0068853_100022449 3300005539 Bacteria 5270
136 Ga0068853_101224347 3300005539 Bacteria 725
137 Ga0070672_100001918 3300005543 Bacteria 13046
138 Ga0070672_100007461 3300005543 Bacteria 7422
139 Ga0070672_100037415 3300005543 Bacteria 3702
140 Ga0070672_100296542 3300005543 Bacteria 1370
141 Ga0070686_100000934 3300005544 Bacteria 16821
142 Ga0070665_100125079 3300005548 Bacteria 2573
143 Ga0070665_100176305 3300005548 Bacteria 2139
144 Ga0070665_100651882 3300005548 Bacteria 1066
145 Ga0070665_100797218 3300005548 Bacteria 958
146 Ga0070665_100849149 3300005548 Unclassified 926
147 Ga0068855_100000899 3300005563 Bacteria 36852
148 Ga0068855_100009898 3300005563 Bacteria 11499
149 Ga0068855_100026654 3300005563 Bacteria 6915
150 Ga0068855_100041346 3300005563 Bacteria 5464
151 Ga0068855_100129571 3300005563 Bacteria 2882
152 Ga0068855_100290538 3300005563 Bacteria 1812
153 Ga0068855_101784564 3300005563 Bacteria 625
154 Ga0068855_102205600 3300005563 Unclassified 553
155 Ga0068855_102490390 3300005563 Unclassified 515
156 Ga0070664_100012427 3300005564 Bacteria 6919
157 Ga0070664_100051593 3300005564 Bacteria 3482
158 Ga0068857_100013188 3300005577 Bacteria 7203
159 Ga0068857_100022930 3300005577 Bacteria 5492
160 Ga0068857_100025706 3300005577 Bacteria 5184
161 Ga0068857_100098504 3300005577 Bacteria 2622
162 Ga0068857_100351971 3300005577 Bacteria 1364
163 Ga0068857_100430714 3300005577 Bacteria 1231
164 Ga0068857_100956919 3300005577 Unclassified 823
165 Ga0068854_100003968 3300005578 Bacteria 9275
166 Ga0068854_100028234 3300005578 Bacteria 3875
167 Ga0068854_100090238 3300005578 Bacteria 2279
168 Ga0068854_100102161 3300005578 Bacteria 2151
169 Ga0068854_100116060 3300005578 Bacteria 2026
170 Ga0068854_100615865 3300005578 Unclassified 928
171 Ga0068856_100000887 3300005614 Bacteria 32039
172 Ga0068856_100008336 3300005614 Bacteria 10097
173 Ga0068856_100069023 3300005614 Bacteria 3495
174 Ga0068856_100232885 3300005614 Bacteria 1857
175 Ga0070702_100000571 3300005615 Bacteria 13448
176 Ga0068852_100014656 3300005616 Bacteria 6045
177 Ga0068852_100078291 3300005616 Bacteria 2925
178 Ga0068852_100299390 3300005616 Bacteria 1556
179 Ga0068852_101492726 3300005616 Bacteria 698
180 Ga0068852_102178461 3300005616 Bacteria 576
181 Ga0068859_100091161 3300005617 Bacteria 3098
182 Ga0068859_100124734 3300005617 Bacteria 2643
183 Ga0068859_100296945 3300005617 Bacteria 1709
184 Ga0068864_100010671 3300005618 Bacteria 7592
185 Ga0068864_100170920 3300005618 Bacteria 1982
186 Ga0068864_100660326 3300005618 Bacteria 1019
187 Ga0068864_100676311 3300005618 Bacteria 1007
188 Ga0068861_100003204 3300005719 Bacteria 10828
189 Ga0068861_100117369 3300005719 Bacteria 2141
190 Ga0068851_10014082 3300005834 Bacteria 3792
191 Ga0068851_10097987 3300005834 Bacteria 1552
192 Ga0068851_10099999 3300005834 Bacteria 1538
193 Ga0068870_10003323 3300005840 Bacteria 6801
194 Ga0068870_10501577 3300005840 Bacteria 809
195 Ga0068870_10870479 3300005840 Bacteria 634
196 Ga0068863_100018071 3300005841 Bacteria 6752
197 Ga0068863_100091707 3300005841 Bacteria 2881
198 Ga0068863_100105308 3300005841 Bacteria 2683
199 Ga0068858_100365766 3300005842 Bacteria 1383
200 Ga0068860_100010532 3300005843 Bacteria 9135
201 Ga0068862_100057571 3300005844 Bacteria 3334
202 Ga0068862_100074688 3300005844 Bacteria 2931
203 Ga0068862_100933363 3300005844 Bacteria 855
204 Ga0075368_10045091 3300006042 Bacteria 1741
205 Ga0075368_10097158 3300006042 Bacteria 1208
206 Ga0075363_100002386 3300006048 Bacteria 7654
207 Ga0075363_100048094 3300006048 Bacteria 2267
208 Ga0075364_10028373 3300006051 Bacteria 3583
209 Ga0075362_10001909 3300006177 Bacteria 6845
210 Ga0075362_10003213 3300006177 Bacteria 5663
211 Ga0075362_10044596 3300006177 Bacteria 1967
212 Ga0075362_10104854 3300006177 Bacteria 1325
213 Ga0075362_10177192 3300006177 Bacteria 1032
214 Ga0075367_10099999 3300006178 Bacteria 1772
215 Ga0075367_10126960 3300006178 Bacteria 1574
216 Ga0075367_10281522 3300006178 Bacteria 1045
217 Ga0075369_10028500 3300006186 Bacteria 2341
218 Ga0075366_10005058 3300006195 Bacteria 7127
219 Ga0075366_10023138 3300006195 Bacteria 3619
220 Ga0075366_10057237 3300006195 Bacteria 2317
221 Ga0075366_10060280 3300006195 Bacteria 2254
222 Ga0075366_10081143 3300006195 Bacteria 1937
223 Ga0075366_10092862 3300006195 Bacteria 1808
224 Ga0075366_10120320 3300006195 Bacteria 1582
225 Ga0075366_10159629 3300006195 Bacteria 1366
226 Ga0075366_10174278 3300006195 Bacteria 1306
227 Ga0075366_10208037 3300006195 Bacteria 1191
228 Ga0075366_10454329 3300006195 Bacteria 790
229 Ga0075366_10658274 3300006195 Bacteria 650
230 Ga0097621_100000834 3300006237 Bacteria 21739
231 Ga0075370_10000059 3300006353 Bacteria 32632
232 Ga0075370_10000087 3300006353 Bacteria 28459
233 Ga0075370_10000813 3300006353 Bacteria 12535
234 Ga0075370_10002533 3300006353 Bacteria 8490
235 Ga0075370_10071038 3300006353 Bacteria 1991
236 Ga0075370_10165448 3300006353 Bacteria 1299
237 Ga0075370_10274767 3300006353 Bacteria 1000
238 Ga0075370_10313695 3300006353 Bacteria 933
239 Ga0068871_100392947 3300006358 Bacteria 1234
240 Ga0075428_100188651 3300006844 Bacteria 2230
241 Ga0075430_100025785 3300006846 Bacteria 5002
242 Ga0075434_101580907 3300006871 Bacteria 664
243 Ga0075429_100001289 3300006880 Bacteria 20430
244 Ga0068865_100023460 3300006881 Bacteria 4039
245 Ga0068865_100064205 3300006881 Bacteria 2583
246 Ga0068865_100276381 3300006881 Bacteria 1335
247 Ga0097620_100091157 3300006931 Bacteria 3098
248 Ga0097620_100124739 3300006931 Bacteria 2643
249 Ga0097620_100296946 3300006931 Bacteria 1709
250 Ga0079104_1004321 3300006946 Bacteria 6144
251 Ga0099794_10143398 3300007265 Bacteria 1210
252 Ga0105251_10026119 3300009011 Bacteria 2977
253 Ga0105240_10001001 3300009093 Bacteria 50438
254 Ga0105240_10004920 3300009093 Bacteria 20087
255 Ga0105240_10035820 3300009093 Bacteria 6391
256 Ga0105240_10064762 3300009093 Bacteria 4540
257 Ga0105240_10110979 3300009093 Bacteria 3318
258 Ga0105240_10151438 3300009093 Bacteria 2762
259 Ga0105240_10580327 3300009093 Bacteria 1237
260 Ga0105240_11387397 3300009093 Bacteria 739
261 Ga0105240_11511099 3300009093 Bacteria 704
262 Ga0111539_11726941 3300009094 Bacteria 726
263 Ga0105245_10000241 3300009098 Bacteria 52084
264 Ga0105245_10055064 3300009098 Bacteria 3572
265 Ga0105245_10702000 3300009098 Bacteria 1045
266 Ga0105245_10767526 3300009098 Bacteria 1001
267 Ga0105245_10791525 3300009098 Bacteria 986
268 Ga0105245_11483078 3300009098 Unclassified 729
269 Ga0105247_10209395 3300009101 Bacteria 1314
270 Ga0105247_10260653 3300009101 Bacteria 1189
271 Ga0105247_11251157 3300009101 Unclassified 593
272 Ga0114129_10496322 3300009147 Bacteria 1595
273 Ga0105243_10000390 3300009148 Bacteria 46725
274 Ga0105243_10020375 3300009148 Bacteria 5029
275 Ga0105243_11877900 3300009148 Bacteria 631
276 Ga0105241_10079604 3300009174 Bacteria 2563
277 Ga0105241_10082320 3300009174 Bacteria 2522
278 Ga0105241_10101868 3300009174 Bacteria 2284
279 Ga0105241_11137689 3300009174 Unclassified 737
280 Ga0105242_10185158 3300009176 Bacteria 1840
281 Ga0105248_10331566 3300009177 Bacteria 1714
282 Ga0105248_10827088 3300009177 Bacteria 1045
283 Ga0105248_10979732 3300009177 Bacteria 955
284 Ga0105248_11305591 3300009177 Bacteria 821
285 Ga0105248_13176897 3300009177 Unclassified 523
286 Ga0105237_10045864 3300009545 Bacteria 4398
287 Ga0105237_10187694 3300009545 Bacteria 2067
288 Ga0105237_10208760 3300009545 Bacteria 1953
289 Ga0105237_10251517 3300009545 Bacteria 1769
290 Ga0105237_10389651 3300009545 Bacteria 1398
291 Ga0105237_10501577 3300009545 Bacteria 1220
292 Ga0105238_10000738 3300009551 Bacteria 34144
293 Ga0105238_10002979 3300009551 Bacteria 16912
294 Ga0105238_10408954 3300009551 Bacteria 1351
295 Ga0105238_10690928 3300009551 Bacteria 1032
296 Ga0105238_10777075 3300009551 Bacteria 972
297 Ga0105249_10008116 3300009553 Bacteria 9153
298 Ga0105249_10173015 3300009553 Bacteria 2095
299 Ga0105249_11428734 3300009553 Bacteria 764
300 Ga0105239_10010208 3300010375 Bacteria 10520
301 Ga0105239_10019338 3300010375 Bacteria 7522
302 Ga0105239_10329892 3300010375 Bacteria 1721
303 Ga0105239_10337678 3300010375 Bacteria 1700
304 Ga0105239_12366395 3300010375 Bacteria 618
305 Ga0105239_12503689 3300010375 Bacteria 601
306 Ga0105246_10041666 3300011119 Bacteria 3105
307 Ga0105246_12451221 3300011119 Unclassified 513
308 Ga0157373_10030602 3300013100 Bacteria 3873
309 Ga0157373_10350290 3300013100 Bacteria 1053
310 Ga0157370_10005091 3300013104 Bacteria 14831
311 Ga0157369_10005877 3300013105 Bacteria 14257
312 Ga0157369_10112116 3300013105 Bacteria 2898
313 Ga0157374_10099755 3300013296 Bacteria 2782
314 Ga0157374_10181754 3300013296 Bacteria 2055
315 Ga0157374_11080750 3300013296 Unclassified 822
316 Ga0157378_10000691 3300013297 Bacteria 31706
317 Ga0157378_10146556 3300013297 Bacteria 2196
318 Ga0157378_10238755 3300013297 Bacteria 1735
319 Ga0157378_11353466 3300013297 Bacteria 754
320 Ga0163162_10109784 3300013306 Bacteria 2855
321 Ga0163162_10128309 3300013306 Bacteria 2644
322 Ga0163162_10247762 3300013306 Bacteria 1913
323 Ga0163162_10322669 3300013306 Bacteria 1677
324 Ga0163162_10343177 3300013306 Bacteria 1626
325 Ga0163162_12085872 3300013306 Bacteria 650
326 Ga0157372_10023891 3300013307 Bacteria 6632
327 Ga0157372_10345474 3300013307 Bacteria 1734
328 Ga0157375_10099480 3300013308 Bacteria 2987
329 Ga0157375_10103460 3300013308 Bacteria 2934
330 Ga0157375_10133410 3300013308 Bacteria 2605
331 Ga0157375_10133527 3300013308 Bacteria 2603
332 Ga0157375_10534409 3300013308 Bacteria 1335
333 Ga0157375_10606622 3300013308 Bacteria 1253
334 Ga0163163_10007845 3300014325 Bacteria 9441
335 Ga0163163_10349218 3300014325 Bacteria 1535
336 Ga0163163_10453346 3300014325 Bacteria 1343
337 Ga0157380_10030112 3300014326 Bacteria 4155
338 Ga0157380_10484356 3300014326 Bacteria 1197
339 Ga0182008_10010381 3300014497 Bacteria 4985
340 Ga0157379_10001790 3300014968 Bacteria 17741
341 Ga0157379_10006875 3300014968 Bacteria 9835
342 Ga0157379_10028002 3300014968 Bacteria 5016
343 Ga0157379_10301397 3300014968 Bacteria 1461
344 Ga0157379_10447386 3300014968 Bacteria 1192
345 Ga0157379_10572138 3300014968 Bacteria 1053
346 Ga0157379_11098943 3300014968 Bacteria 761
347 Ga0157379_11763756 3300014968 Unclassified 607
348 Ga0157379_12395590 3300014968 Bacteria 527
349 Ga0157376_10088635 3300014969 Bacteria 2673
350 Ga0157376_11381334 3300014969 Bacteria 735
351 Ga0182006_1019521 3300015261 Bacteria 2853
352 Ga0182006_1069162 3300015261 Bacteria 1314
353 Ga0182007_10101261 3300015262 Bacteria 954
354 Ga0182007_10234420 3300015262 Bacteria 653
355 Ga0163161_10803624 3300017792 Bacteria 790
356 Ga0163161_11531719 3300017792 Bacteria 586
357 Ga0213872_10000058 3300021361 Bacteria 100531
358 Ga0213872_10000102 3300021361 Bacteria 79440
359 Ga0213872_10000150 3300021361 Bacteria 63730
360 Ga0213872_10004383 3300021361 Bacteria 7513
361 Ga0213872_10153162 3300021361 Unclassified 1006
362 Ga0213872_10339958 3300021361 Bacteria 617
363 Ga0213875_10077329 3300021388 Bacteria 1553
364 Ga0209435_100015 3300025206 Bacteria 321177
365 Ga0209435_100288 3300025206 Bacteria 12225
366 Ga0209784_100005 3300025224 Bacteria 1040422
367 Ga0209566_100005 3300025225 Bacteria 1040422
368 Ga0209674_100009 3300025226 Bacteria 1040422
369 Ga0209674_100064 3300025226 Bacteria 265769
370 Ga0209147_100004 3300025229 Bacteria 1371850
371 Ga0209563_100012 3300025230 Bacteria 1040422
372 Ga0209563_100126 3300025230 Bacteria 113122
373 Ga0207427_100197 3300025231 Bacteria 57629
374 Ga0209437_100268 3300025233 Bacteria 79327
375 Ga0209258_100298 3300025242 Bacteria 81047
376 Ga0209258_100736 3300025242 Bacteria 21300
377 Ga0209258_100787 3300025242 Bacteria 19150
378 Ga0209646_1000040 3300025246 Bacteria 347867
379 Ga0209646_1000060 3300025246 Bacteria 256386
380 Ga0209646_1000105 3300025246 Bacteria 163453
381 Ga0209026_1000034 3300025250 Bacteria 306953
382 Ga0209026_1000049 3300025250 Bacteria 255273
383 Ga0209677_100006 3300025253 Bacteria 1040422
384 Ga0209677_100411 3300025253 Bacteria 25661
385 Ga0209677_101394 3300025253 Bacteria 10483
386 Ga0209677_109255 3300025253 Bacteria 1794
387 Ga0209148_1012868 3300025254 Bacteria 1518
388 Ga0209148_1022957 3300025254 Bacteria 997
389 Ga0209759_1000069 3300025256 Bacteria 182437
390 Ga0209759_1000234 3300025256 Bacteria 83099
391 Ga0209759_1000569 3300025256 Bacteria 37040
392 Ga0209759_1001582 3300025256 Bacteria 12362
393 Ga0209759_1002582 3300025256 Bacteria 7830
394 Ga0209759_1016603 3300025256 Bacteria 1850
395 Ga0209759_1020690 3300025256 Bacteria 1518
396 Ga0207666_1014266 3300025271 Bacteria 1122
397 Ga0209455_1002003 3300025272 Bacteria 8360
398 Ga0209455_1005524 3300025272 Bacteria 3887
399 Ga0209455_1029989 3300025272 Bacteria 931
400 Ga0209758_1000233 3300025297 Bacteria 116640
401 Ga0209051_1000140 3300025303 Bacteria 135919
402 Ga0209051_1001699 3300025303 Bacteria 17625
403 Ga0209051_1008265 3300025303 Bacteria 5536
404 Ga0209051_1029310 3300025303 Bacteria 2156
405 Ga0209257_1000012 3300025304 Bacteria 1111138
406 Ga0209257_1000045 3300025304 Bacteria 484429
407 Ga0209257_1063458 3300025304 Bacteria 996
408 Ga0207697_10185402 3300025315 Bacteria 913
409 Ga0207656_10018424 3300025321 Bacteria 2749
410 Ga0207656_10106539 3300025321 Bacteria 1291
411 Ga0207656_10137890 3300025321 Bacteria 1148
412 Ga0207656_10234031 3300025321 Bacteria 896
413 Ga0207656_10407251 3300025321 Unclassified 684
414 Ga0207710_10166332 3300025900 Bacteria 1076
415 Ga0207680_10301289 3300025903 Bacteria 1117
416 Ga0207645_10004810 3300025907 Bacteria 9928
417 Ga0207645_10034993 3300025907 Bacteria 3226
418 Ga0207643_10023140 3300025908 Bacteria 3425
419 Ga0207643_10089604 3300025908 Bacteria 1792
420 Ga0207643_10164665 3300025908 Bacteria 1335
421 Ga0207705_10035791 3300025909 Bacteria 3552
422 Ga0207705_10162995 3300025909 Bacteria 1676
423 Ga0207705_10233564 3300025909 Bacteria 1399
424 Ga0207684_10012635 3300025910 Bacteria 7333
425 Ga0207654_10378130 3300025911 Bacteria 980
426 Ga0207654_10834454 3300025911 Bacteria 667
427 Ga0207707_10036063 3300025912 Bacteria 4325
428 Ga0207695_10000573 3300025913 Bacteria 75332
429 Ga0207695_10004109 3300025913 Bacteria 20007
430 Ga0207695_10006006 3300025913 Bacteria 15874
431 Ga0207695_10030732 3300025913 Bacteria 5910
432 Ga0207695_10080469 3300025913 Bacteria 3299
433 Ga0207695_10099795 3300025913 Bacteria 2900
434 Ga0207695_10255540 3300025913 Bacteria 1651
435 Ga0207671_10046969 3300025914 Bacteria 3195
436 Ga0207671_10225306 3300025914 Bacteria 1470
437 Ga0207671_10248091 3300025914 Bacteria 1399
438 Ga0207671_10302330 3300025914 Bacteria 1264
439 Ga0207671_10775753 3300025914 Bacteria 761
440 Ga0207660_10906699 3300025917 Unclassified 719
441 Ga0207660_10990277 3300025917 Bacteria 686
442 Ga0207657_10024892 3300025919 Bacteria 5532
443 Ga0207657_10286982 3300025919 Bacteria 1306
444 Ga0207657_10727761 3300025919 Unclassified 769
445 Ga0207657_10765968 3300025919 Bacteria 747
446 Ga0207649_10002217 3300025920 Bacteria 10974
447 Ga0207649_10563024 3300025920 Unclassified 873
448 Ga0207652_10047116 3300025921 Bacteria 3681
449 Ga0207652_10310463 3300025921 Bacteria 1423
450 Ga0207646_10198051 3300025922 Bacteria 1814
451 Ga0207681_10005071 3300025923 Bacteria 8095
452 Ga0207681_10208885 3300025923 Bacteria 1503
453 Ga0207694_10000505 3300025924 Bacteria 35291
454 Ga0207694_10010773 3300025924 Bacteria 6903
455 Ga0207694_10361493 3300025924 Bacteria 1203
456 Ga0207694_10384437 3300025924 Bacteria 1165
457 Ga0207694_10783681 3300025924 Bacteria 805
458 Ga0207694_10819862 3300025924 Bacteria 786
459 Ga0207650_10022889 3300025925 Bacteria 4427
460 Ga0207650_10023873 3300025925 Bacteria 4341
461 Ga0207650_10050850 3300025925 Bacteria 3066
462 Ga0207650_10053437 3300025925 Bacteria 2994
463 Ga0207650_10075425 3300025925 Bacteria 2545
464 Ga0207650_10370508 3300025925 Bacteria 1181
465 Ga0207650_10373791 3300025925 Bacteria 1176
466 Ga0207659_10009257 3300025926 Bacteria 6152
467 Ga0207659_10110207 3300025926 Bacteria 2091
468 Ga0207659_10587076 3300025926 Bacteria 949
469 Ga0207687_10000799 3300025927 Bacteria 21252
470 Ga0207687_10060589 3300025927 Bacteria 2670
471 Ga0207687_10241914 3300025927 Bacteria 1431
472 Ga0207687_11504785 3300025927 Bacteria 578
473 Ga0207664_10050874 3300025929 Bacteria 3269
474 Ga0207644_10017024 3300025931 Bacteria 4901
475 Ga0207644_10092568 3300025931 Bacteria 2256
476 Ga0207644_10332254 3300025931 Bacteria 1231
477 Ga0207644_10362591 3300025931 Bacteria 1179
478 Ga0207644_11190387 3300025931 Bacteria 640
479 Ga0207690_10013867 3300025932 Bacteria 4855
480 Ga0207690_10189386 3300025932 Bacteria 1555
481 Ga0207706_10074485 3300025933 Bacteria 2985
482 Ga0207706_10132942 3300025933 Bacteria 2188
483 Ga0207686_10004205 3300025934 Bacteria 7723
484 Ga0207686_10276959 3300025934 Bacteria 1237
485 Ga0207709_10060578 3300025935 Bacteria 2361
486 Ga0207709_11177358 3300025935 Bacteria 631
487 Ga0207670_10051735 3300025936 Bacteria 2760
488 Ga0207669_10068061 3300025937 Bacteria 2222
489 Ga0207669_10182940 3300025937 Bacteria 1504
490 Ga0207669_10535201 3300025937 Bacteria 943
491 Ga0207704_10058715 3300025938 Bacteria 2370
492 Ga0207691_10004143 3300025940 Bacteria 14086
493 Ga0207691_10006762 3300025940 Bacteria 11060
494 Ga0207691_10024653 3300025940 Bacteria 5657
495 Ga0207691_10061422 3300025940 Bacteria 3413
496 Ga0207711_10011889 3300025941 Bacteria 7235
497 Ga0207711_10549147 3300025941 Bacteria 1078
498 Ga0207711_10620816 3300025941 Bacteria 1009
499 Ga0207689_10000452 3300025942 Bacteria 38652
500 Ga0207689_10147813 3300025942 Bacteria 1936
501 Ga0207689_10584203 3300025942 Bacteria 939
502 Ga0207689_10757036 3300025942 Bacteria 820
503 Ga0207661_10028466 3300025944 Bacteria 4279
504 Ga0207661_10866758 3300025944 Bacteria 832
505 Ga0207679_10117544 3300025945 Bacteria 2110
506 Ga0207679_10139525 3300025945 Bacteria 1957
507 Ga0207679_10850953 3300025945 Bacteria 833
508 Ga0207667_10000053 3300025949 Bacteria 226712
509 Ga0207667_10026989 3300025949 Bacteria 6264
510 Ga0207667_10028711 3300025949 Bacteria 6039
511 Ga0207667_10052477 3300025949 Bacteria 4294
512 Ga0207667_10248612 3300025949 Bacteria 1819
513 Ga0207667_12123069 3300025949 Unclassified 520
514 Ga0207651_10069538 3300025960 Bacteria 2486
515 Ga0207651_10088444 3300025960 Bacteria 2258
516 Ga0207651_10105872 3300025960 Bacteria 2099
517 Ga0207651_10413338 3300025960 Bacteria 1150
518 Ga0207651_11251062 3300025960 Bacteria 667
519 Ga0207712_10123168 3300025961 Bacteria 1965
520 Ga0207668_10012253 3300025972 Bacteria 5243
521 Ga0207668_10247602 3300025972 Bacteria 1446
522 Ga0207668_10407248 3300025972 Bacteria 1151
523 Ga0207668_11296762 3300025972 Bacteria 655
524 Ga0207640_10031492 3300025981 Bacteria 3277
525 Ga0207640_10049985 3300025981 Bacteria 2710
526 Ga0207640_10112897 3300025981 Bacteria 1930
527 Ga0207640_10212227 3300025981 Bacteria 1476
528 Ga0207640_10380006 3300025981 Bacteria 1144
529 Ga0207658_10047106 3300025986 Bacteria 3153
530 Ga0207658_10050043 3300025986 Bacteria 3073
531 Ga0207658_10061349 3300025986 Bacteria 2809
532 Ga0207658_10125710 3300025986 Bacteria 2052
533 Ga0207658_10968704 3300025986 Bacteria 776
534 Ga0207677_10031338 3300026023 Bacteria 3405
535 Ga0207677_10051376 3300026023 Bacteria 2795
536 Ga0207677_10774884 3300026023 Bacteria 857
537 Ga0207677_11011251 3300026023 Bacteria 754
538 Ga0207677_11999619 3300026023 Bacteria 539
539 Ga0207703_10003194 3300026035 Bacteria 13797
540 Ga0207703_10399632 3300026035 Bacteria 1275
541 Ga0207639_10075141 3300026041 Bacteria 2656
542 Ga0207639_10144245 3300026041 Bacteria 1987
543 Ga0207639_11096435 3300026041 Bacteria 747
544 Ga0207639_11415759 3300026041 Bacteria 652
545 Ga0207678_10106297 3300026067 Bacteria 2394
546 Ga0207678_10373059 3300026067 Bacteria 1233
547 Ga0207708_10000701 3300026075 Bacteria 25411
548 Ga0207702_10022449 3300026078 Bacteria 5231
549 Ga0207702_10083504 3300026078 Bacteria 2779
550 Ga0207702_10204748 3300026078 Bacteria 1831
551 Ga0207641_10009598 3300026088 Bacteria 7974
552 Ga0207641_10026935 3300026088 Bacteria 4747
553 Ga0207641_10272468 3300026088 Bacteria 1589
554 Ga0207648_10000159 3300026089 Bacteria 69221
555 Ga0207648_10003372 3300026089 Bacteria 16778
556 Ga0207648_10038891 3300026089 Bacteria 4185
557 Ga0207648_10071567 3300026089 Bacteria 3022
558 Ga0207648_10160108 3300026089 Bacteria 1988
559 Ga0207648_10506563 3300026089 Bacteria 1105
560 Ga0207648_10542851 3300026089 Bacteria 1067
561 Ga0207648_10738928 3300026089 Bacteria 914
562 Ga0207676_10003896 3300026095 Bacteria 10542
563 Ga0207676_10037088 3300026095 Bacteria 3712
564 Ga0207676_10620870 3300026095 Bacteria 1040
565 Ga0207674_10000954 3300026116 Bacteria 37774
566 Ga0207674_10006659 3300026116 Bacteria 13573
567 Ga0207674_10022384 3300026116 Bacteria 6786
568 Ga0207674_10121427 3300026116 Bacteria 2580
569 Ga0207674_10435399 3300026116 Bacteria 1267
570 Ga0207674_10437071 3300026116 Bacteria 1265
571 Ga0207674_10636845 3300026116 Bacteria 1029
572 Ga0207674_10975356 3300026116 Bacteria 816
573 Ga0207674_11234974 3300026116 Bacteria 717
574 Ga0207675_100000068 3300026118 Bacteria 78105
575 Ga0207675_100037965 3300026118 Bacteria 4494
576 Ga0207675_100213377 3300026118 Bacteria 1857
577 Ga0207675_100454833 3300026118 Bacteria 1269
578 Ga0207683_10013791 3300026121 Bacteria 6891
579 Ga0207683_10093306 3300026121 Bacteria 2682
580 Ga0207683_10598439 3300026121 Bacteria 1020
581 Ga0207698_10007618 3300026142 Bacteria 6789
582 Ga0207698_10025226 3300026142 Bacteria 4184
583 Ga0207698_10698688 3300026142 Bacteria 1009
584 Ga0207698_10767765 3300026142 Bacteria 964
585 Ga0207698_11320615 3300026142 Bacteria 736
586 Ga0209281_1007305 3300027111 Bacteria 2782
587 Ga0209813_10008368 3300027866 Bacteria 2611
588 Ga0209813_10140803 3300027866 Bacteria 856
589 Ga0268266_10037951 3300028379 Bacteria 4102
590 Ga0268266_10707477 3300028379 Unclassified 971
591 Ga0268265_10016151 3300028380 Bacteria 5125
592 Ga0268265_10031173 3300028380 Bacteria 3849
593 Ga0268265_10050837 3300028380 Bacteria 3125
594 Ga0268265_10223199 3300028380 Bacteria 1650
595 Ga0268265_12588079 3300028380 Bacteria 513
596 Ga0268264_10020364 3300028381 Bacteria 5421
597 Ga0268264_10149599 3300028381 Bacteria 2092
598 Ga0268264_10241375 3300028381 Bacteria 1674
599 Ga0268264_10804770 3300028381 Bacteria 939
600 Ga0265336_10000123 3300028666 Bacteria 57956
601 Ga0307517_10002354 3300028786 Bacteria 30505
602 Ga0307517_10077719 3300028786 Bacteria 2880
603 Ga0307517_10318467 3300028786 Bacteria 862
604 Ga0307515_10015864 3300028794 Bacteria 13844
605 Ga0307515_10106461 3300028794 Bacteria 3327
606 Ga0307515_10254589 3300028794 Bacteria 1502
607 Ga0307515_10583058 3300028794 Bacteria 728
608 Ga0265324_10000849 3300029957 Bacteria 19632
609 Ga0307511_10253296 3300030521 Bacteria 843
610 Ga0307512_10182106 3300030522 Bacteria 1178
611 Ga0307512_10233028 3300030522 Bacteria 943
612 Ga0307512_10252093 3300030522 Bacteria 878
613 Ga0265332_10000278 3300031238 Bacteria 40354
614 Ga0265331_10009024 3300031250 Bacteria 5634
615 Ga0265331_10058535 3300031250 Bacteria 1824
616 Ga0265327_10000328 3300031251 Bacteria 90489
617 Ga0307513_10021976 3300031456 Bacteria 7515
618 Ga0307513_10195711 3300031456 Bacteria 1868
619 Ga0307513_10380145 3300031456 Bacteria 1152
620 Ga0307509_10000234 3300031507 Bacteria 89398
621 Ga0307509_10039607 3300031507 Bacteria 5132
622 Ga0307509_10090207 3300031507 Bacteria 3141
623 Ga0307509_10112558 3300031507 Bacteria 2721
624 Ga0307509_10120503 3300031507 Bacteria 2602
625 Ga0307509_10902039 3300031507 Unclassified 549
626 Ga0307408_100211432 3300031548 Bacteria 1576
627 Ga0307408_100603774 3300031548 Bacteria 975
628 Ga0307508_10001066 3300031616 Bacteria 31732
629 Ga0307508_10088896 3300031616 Bacteria 2673
630 Ga0307514_10052858 3300031649 Bacteria 3137
631 Ga0307514_10062249 3300031649 Bacteria 2839
632 Ga0307514_10253912 3300031649 Bacteria 1037
633 Ga0307514_10414020 3300031649 Bacteria 681
634 Ga0307516_10037289 3300031730 Bacteria 4861
635 Ga0307516_10090008 3300031730 Bacteria 2898
636 Ga0307516_10124340 3300031730 Bacteria 2366
637 Ga0307516_10143470 3300031730 Bacteria 2155
638 Ga0307516_10613533 3300031730 Bacteria 742
639 Ga0307516_10629741 3300031730 Bacteria 727
640 Ga0307516_10769828 3300031730 Bacteria 623
641 Ga0307405_10174205 3300031731 Bacteria 1538
642 Ga0307413_10017248 3300031824 Bacteria 3756
643 Ga0307413_11501109 3300031824 Bacteria 596
644 Ga0307518_10357644 3300031838 Bacteria 845
645 Ga0307410_10283779 3300031852 Bacteria 1300
646 Ga0307412_10401022 3300031911 Bacteria 1116
647 Ga0307412_11085580 3300031911 Unclassified 711
648 Ga0307409_100372205 3300031995 Bacteria 1355
649 Ga0307416_102294687 3300032002 Bacteria 640
650 Ga0307414_10689805 3300032004 Bacteria 924
651 Ga0307411_10044945 3300032005 Bacteria 2838
652 Ga0307411_10321696 3300032005 Bacteria 1249
653 Ga0307415_100740945 3300032126 Bacteria 891
654 Ga0307415_101200948 3300032126 Bacteria 715
655 Ga0316583_10227339 3300032133 Bacteria 647
656 Ga0307510_10012165 3300033180 Bacteria 10203
657 Ga0307510_10032961 3300033180 Bacteria 5829
658 Ga0373952_0001139 3300035092 Bacteria 4848
659 Ga0373946_0066198 3300035171 Bacteria 1549
660 Ga0373931_0025723 3300035691 Bacteria 2989
661 Ga0373937_0179223 3300036401 Bacteria 1989
662 Ga0373937_0340219 3300036401 Bacteria 1421
663 Ga0373937_0669136 3300036401 Bacteria 984
664 Ga0395899_0195598 3300037312 Bacteria 1413
665 Ga0395899_0204210 3300037312 Bacteria 1376
666 Ga0395898_0038029 3300037466 Bacteria 4772
667 Ga0436364_0570264 3300037853 Bacteria 3035
668 Ga0395901_0029531 3300038443 Bacteria 5646
669 Ga0436365_0680524 3300039437 Bacteria 1610
670 Ga0436361_0018388 3300039447 Bacteria 44345
671 Ga0436361_0068556 3300039447 Bacteria 100895
672 Ga0436361_0162163 3300039447 Bacteria 1247
673 Ga0436361_0614815 3300039447 Bacteria 45728
674 Ga0436361_0651406 3300039447 Bacteria 3013
675 Ga0436361_0658018 3300039447 Bacteria 686
676 Ga0436361_0704442 3300039447 Bacteria 599
677 Ga0436361_1050932 3300039447 Bacteria 935
678 Ga0436361_1078434 3300039447 Bacteria 1024
679 Ga0451791_0302276 3300041451 Bacteria 1038
680 Ga0451795_1577239 3300041456 Bacteria 631
681 Ga0451837_1131948 3300041494 Bacteria 583
682 Ga0451853_1225302 3300041512 Bacteria 1310
683 Ga0451853_1592565 3300041512 Bacteria 996
684 Ga0451853_2413001 3300041512 Bacteria 822
685 Ga0439437_064593 3300042000 Unclassified 500
686 Ga0439448_0053162 3300042005 Bacteria 1329
687 Ga0439448_0323230 3300042005 Bacteria 549
688 Ga0439450_054731 3300042008 Bacteria 954
689 Ga0450889_021654 3300042144 Bacteria 717
690 Ga0439464_0008576 3300042439 Bacteria 2679
691 Ga0451577_0180363 3300042876 Bacteria 1904
692 Ga0466965_0030229 3300044683 Bacteria 2638
693 Ga0466963_0645760 3300044694 Bacteria 747
694 Ga0466964_0004400 3300044706 Bacteria 5198
695 Ga0453684_0562581 3300044712 Bacteria 1254
696 Ga0466968_0068366 3300044735 Bacteria 1542
697 Ga0466970_0011861 3300044765 Bacteria 4445
698 Ga0466957_0028524 3300044842 Bacteria 3324
699 Ga0466957_0351328 3300044842 Bacteria 1000
700 Ga0466957_0571936 3300044842 Bacteria 789
701 Ga0466959_0022300 3300045049 Bacteria 4680
702 Ga0451576_0001324 3300045051 Bacteria 42824
703 Ga0451576_0978897 3300045051 Bacteria 887
704 Ga0466958_0153786 3300045836 Bacteria 1451
705 Ga0466967_0234772 3300045976 Bacteria 1747
706 Ga0466967_0379341 3300045976 Bacteria 1372
707 Ga0466967_0635782 3300045976 Bacteria 1055
708 Ga0466967_0962078 3300045976 Bacteria 850
709 Ga0466967_1447903 3300045976 Unclassified 684
710 Ga0495592_0000291 3300046454 Bacteria 42990
711 Ga0495638_0118661 3300046460 Bacteria 1565
712 Ga0495638_0276953 3300046460 Bacteria 913
713 Ga0495651_0387051 3300046462 Bacteria 916
714 Ga0495650_0053966 3300046471 Bacteria 1642
715 Ga0495650_0085334 3300046471 Bacteria 1210
716 Ga0495582_0254919 3300046473 Bacteria 1006
717 Ga0495605_0082544 3300046474 Bacteria 1501
718 Ga0495664_0201984 3300046477 Bacteria 1204
719 Ga0495607_0200564 3300046501 Bacteria 988
720 Ga0495583_0000046 3300046506 Bacteria 218059
721 Ga0495583_0312776 3300046506 Bacteria 623
722 Ga0495610_0053848 3300046512 Bacteria 1947
723 Ga0495628_0051863 3300046516 Bacteria 3242
724 Ga0495631_0377690 3300046518 Bacteria 603
725 Ga0495632_0006200 3300046519 Bacteria 7737
726 Ga0495648_0303349 3300046524 Bacteria 747
727 Ga0495666_0021091 3300046526 Bacteria 3226
728 Ga0495598_0006095 3300046537 Bacteria 2708
729 Ga0495621_0193356 3300046539 Bacteria 816
730 Ga0495597_0003922 3300046542 Bacteria 8402
731 Ga0495597_0024542 3300046542 Bacteria 2782
732 Ga0495597_0134198 3300046542 Bacteria 1025
733 Ga0495645_0071213 3300046543 Bacteria 2507
734 Ga0495622_0025296 3300046557 Bacteria 2773
735 Ga0495611_0221658 3300046648 Bacteria 880
736 Ga0495625_0005740 3300046660 Bacteria 11219
737 Ga0495625_0036997 3300046660 Bacteria 3583
738 Ga0495625_0150118 3300046660 Bacteria 1567
739 Ga0495625_0321463 3300046660 Bacteria 985
740 Ga0495647_0334470 3300046681 Bacteria 687
741 Ga0495658_0004796 3300046683 Bacteria 6631
742 Ga0495658_0454283 3300046683 Bacteria 818
743 Ga0495658_0693015 3300046683 Bacteria 653
744 Ga0495613_0603713 3300046689 Bacteria 730
745 Ga0495624_0056474 3300046690 Bacteria 2470
746 Ga0495671_0111819 3300046692 Bacteria 1334
747 Ga0495671_0154985 3300046692 Bacteria 1115
748 Ga0495671_0363925 3300046692 Bacteria 693
749 Ga0495671_0598998 3300046692 Bacteria 524
750 Ga0495649_0000638 3300046694 Bacteria 28526
751 Ga0495649_0037138 3300046694 Bacteria 2674
752 Ga0495660_0024873 3300046810 Bacteria 3406
753 Ga0495687_000367 3300047443 Bacteria 56387
754 Ga0495687_011817 3300047443 Bacteria 4662
755 Ga0495673_0156408 3300047469 Bacteria 878
756 Ga0495686_0029542 3300047472 Bacteria 3565
757 Ga0495686_0145468 3300047472 Bacteria 1395
758 Ga0495593_0031997 3300047673 Bacteria 2870
759 Ga0495614_0287908 3300048089 Bacteria 757
760 Ga0495615_0024194 3300048090 Bacteria 1398
761 Ga0495626_0074869 3300048091 Bacteria 1514
762 Ga0496100_0095075 3300048903 Bacteria 2042
763 Ga0496101_0242656 3300048904 Bacteria 1402
764 Ga0496101_1162577 3300048904 Bacteria 605
765 Ga0496104_0046378 3300048907 Bacteria 4093
766 Ga0496105_0557045 3300048908 Bacteria 894
767 Ga0496106_0056501 3300048909 Bacteria 2967
768 Ga0496106_0361007 3300048909 Unclassified 1167
769 Ga0496108_0054157 3300048911 Bacteria 3367
770 Ga0496108_0458421 3300048911 Bacteria 1114
771 Ga0496108_0475861 3300048911 Bacteria 1091
772 Ga0496108_0716479 3300048911 Bacteria 867
773 Ga0496109_0023407 3300048912 Bacteria 5484
774 Ga0496111_0149444 3300048914 Bacteria 1732
775 Ga0496112_0000429 3300048915 Bacteria 27778
776 Ga0496112_0207877 3300048915 Bacteria 1915
777 Ga0496112_1081738 3300048915 Bacteria 720
778 Ga0496113_0400549 3300048916 Bacteria 1102
779 Ga0496114_0006440 3300048917 Bacteria 9243
780 Ga0496114_0322714 3300048917 Bacteria 1365
781 Ga0496115_0416682 3300048918 Bacteria 1088
782 Ga0496116_0018094 3300048919 Bacteria 5444
783 Ga0496118_0185082 3300048921 Bacteria 1253
784 Ga0496121_0020869 3300048924 Bacteria 6453
785 Ga0496121_0054604 3300048924 Bacteria 3336
786 Ga0496121_0316427 3300048924 Bacteria 1053
787 Ga0496122_0008179 3300048925 Bacteria 11370
788 Ga0496123_0008042 3300048926 Bacteria 9765
789 Ga0496124_0469914 3300048927 Bacteria 852
790 Ga0496125_0005346 3300048928 Bacteria 14333
791 Ga0496126_0026066 3300048929 Bacteria 5612
792 Ga0495682_0276103 3300049460 Bacteria 593
793 Ga0501290_079332 3300049513 Bacteria 557
794 Ga0501300_027973 3300049523 Bacteria 829
795 Ga0501032_0010930 3300049569 Bacteria 6527
796 Ga0501032_0140832 3300049569 Bacteria 1588
797 Ga0501034_0024667 3300049571 Bacteria 6115
798 Ga0501034_0257622 3300049571 Bacteria 1688
799 Ga0501038_0058614 3300049574 Bacteria 3301
800 Ga0501039_0013485 3300049575 Bacteria 6250
801 Ga0501043_0000149 3300049579 Bacteria 65122
802 Ga0501046_0000092 3300049580 Bacteria 97456
803 Ga0501047_0000028 3300049581 Bacteria 220279
804 Ga0501048_0006680 3300049582 Bacteria 8763
805 Ga0501072_0586099 3300049588 Bacteria 880
806 Ga0501079_0657938 3300049741 Bacteria 825
807 Ga0501081_0688929 3300049743 Bacteria 767
808 Ga0501266_000057 3300049763 Bacteria 17898
809 Ga0501035_0046260 3300049822 Bacteria 3914
810 Ga0501035_1209385 3300049822 Bacteria 586
811 Ga0501044_0272835 3300049823 Bacteria 1627
812 Ga0501045_0000170 3300049824 Bacteria 35617
813 nmdc:mga03683_10952_c1 3300050489 Bacteria 3265
814 nmdc:mga03683_120460_c1 3300050489 Bacteria 1166
815 nmdc:mga03683_19823_c1 3300050489 Bacteria 2572
816 nmdc:mga03n38_230957_c1 3300050490 Bacteria 970
817 nmdc:mga03n38_48533_c1 3300050490 Bacteria 1884
818 nmdc:mga00v17_10380_c1 3300050491 Bacteria 5082
819 nmdc:mga0k408_11251_c1 3300050493 Bacteria 4865
820 nmdc:mga0k408_198791_c1 3300050493 Bacteria 1196
821 nmdc:mga0k408_22329_c1 3300050493 Bacteria 3563
822 nmdc:mga0k408_2308_c1 3300050493 Bacteria 10151
823 nmdc:mga0k408_27898_c1 3300050493 Bacteria 3209
824 nmdc:mga0k408_355_c1 3300050493 Bacteria 25188
825 nmdc:mga0k408_40234_c1 3300050493 Bacteria 2689
826 nmdc:mga0k408_61790_c1 3300050493 Bacteria 2178
827 nmdc:mga0k408_68274_c1 3300050493 Bacteria 2073
828 nmdc:mga0k408_69103_c1 3300050493 Bacteria 2061
829 nmdc:mga0k408_8262_c1 3300050493 Bacteria 5584
830 nmdc:mga06z11_127044_c1 3300050494 Bacteria 1428
831 nmdc:mga06z11_165950_c1 3300050494 Bacteria 1265
832 nmdc:mga06z11_5785_c1 3300050494 Bacteria 4985
833 nmdc:mga04h51_11203_c1 3300050495 Bacteria 2483
834 nmdc:mga04h51_160506_c1 3300050495 Bacteria 865
835 nmdc:mga07m45_10918_c1 3300050496 Bacteria 4758
836 nmdc:mga07m45_1116_c1 3300050496 Bacteria 12021
837 nmdc:mga07m45_175262_c1 3300050496 Bacteria 1247
838 nmdc:mga07m45_216266_c1 3300050496 Bacteria 1115
839 nmdc:mga07m45_2223_c1 3300050496 Bacteria 9067
840 nmdc:mga07m45_27823_c1 3300050496 Bacteria 3118
841 nmdc:mga07m45_398480_c1 3300050496 Bacteria 799
842 nmdc:mga07m45_6961_c1 3300050496 Bacteria 5751
843 nmdc:mga07m45_7118_c1 3300050496 Bacteria 5697
844 nmdc:mga07m45_7357_c1 3300050496 Bacteria 5622
845 nmdc:mga09592_4802_c1 3300050508 Bacteria 10952
846 nmdc:mga0qj67_89016_c1 3300050509 Bacteria 2479
847 nmdc:mga0n895_1200895_c1 3300050512 Bacteria 732
848 nmdc:mga0n895_1778329_c1 3300050512 Bacteria 577
849 nmdc:mga0sz30_176495_c1 3300050516 Bacteria 947
850 Ga0495601_0498003 3300053077 Bacteria 786
851 Ga0500635_0000005 3300053080 Bacteria 187821
852 Ga0500644_0100473 3300053088 Bacteria 1098
853 Ga0500651_0028942 3300053093 Bacteria 3482
854 Ga0500651_0058855 3300053093 Bacteria 2403
855 Ga0500651_0422206 3300053093 Bacteria 746
856 Ga0500618_001127 3300053125 Bacteria 12996
857 Ga0500618_003179 3300053125 Bacteria 5763
858 Ga0500658_0002097 3300053134 Bacteria 7754
859 Ga0500559_0000119 3300053136 Bacteria 62358
860 Ga0500564_107433 3300053138 Bacteria 1228
861 Ga0500564_113828 3300053138 Bacteria 1185
862 Ga0500564_138173 3300053138 Bacteria 1049
863 Ga0500568_0005734 3300053139 Bacteria 6362
864 Ga0500622_0005643 3300053156 Bacteria 7455
865 Ga0500636_0045101 3300053177 Bacteria 2600
866 Ga0500636_0132989 3300053177 Bacteria 1384
867 Ga0500587_004225 3300053739 Bacteria 1980
868 Ga0501084_1049680 3300054114 Bacteria 684
869 Ga0500661_014650 3300055283 Bacteria 1411
870 Ga0501082_0504992 3300060353 Bacteria 1057
871 Ga0466962_0057998 3300061719 Bacteria 1848
872 2511250706 2511231003 Bacteria 5606035
873 2511383165 2511231026 Bacteria 5225445
874 2521557186 2521172590 Bacteria 5047645
875 2548848656 2547132512 Bacteria 3416496
876 2550696542 2548876994 Bacteria 4904866
877 2553007707 2551306416 Bacteria 6152985
878 2644303978 2643221654 Bacteria 5273570
879 2644338794 2643221660 Bacteria 4208257
880 2765568317 2765235838 Bacteria 5445269
881 2808983393 2808606386 Bacteria 4471946
882 2809128621 2808606415 Bacteria 4576710
883 2809148242 2808606419 Bacteria 4576925
884 2819591914 2818991445 Bacteria 4955017
885 2819618660 2818991449 Bacteria 5518009
886 2839094821 2839094727 Bacteria 5534556
887 2852620336 2852618963 Bacteria 4577824
888 2884840674 2884836552 Bacteria 5219991
889 2884855931 2884852848 Bacteria 5221161
890 2896157144 2896154374 Bacteria 5221518
891 2904440108 2904439833 Bacteria 5931679
892 2904530956 2904530477 Bacteria 5876334
893 2904587411 2904584206 Bacteria 6028872
894 2904592554 2904589729 Bacteria 6113573
895 2904604654 2904601388 Bacteria 5884906
896 2919050465 2919046199 Bacteria 5567169
897 2919082485 2919079590 Bacteria 5946433
898 2923515812 2923510766 Bacteria 5926163
899 2928133396 2928130867 Bacteria 5467269
900 Ga0495668_0072851
901 JGI25155J39150_1000552
902 JGI25156J39149_1000459
903 JGI25156J39149_1001026
904 JGI25156J39149_1002927
905 JGI25156J39149_1020328
906 JGI25162J39368_1010430
907 JGI25154J39366_1000871
908 JGI25154J39366_1000911
909 JGI25154J39366_1001802
910 JGI25157J39369_1000021
911 JGI25157J39369_1001256
912 JGI25164J39214_1005040
913 rootH1_10015810
914 rootH1_10028438
915 rootH1_10033518
916 rootH1_10042308
917 rootH2_10019687
918 rootH1_10021003
919 rootH1_10072734
920 rootH1_10085156
921 Ga0055538_1000013
922 Ga0055539_1000018
923 Ga0055539_1000422
924 Ga0055539_1006291
925 Ga0055539_1007357
926 Ga0055533_1000022
927 Ga0055533_1000033
928 Ga0055532_1000017
929 Ga0055525_1000024
930 Ga0055525_1001360
931 Ga0055535_1001037
932 Ga0055529_1000860
933 Ga0055540_1098486
934 Ga0055531_10000303
935 Ga0055541_1000013
936 Ga0070658_10055065
937 Ga0070658_10159526
938 Ga0070658_10334405
939 Ga0070658_10546180
940 Ga0070658_10690884
941 Ga0070676_10006846
942 Ga0070676_10031112
943 Ga0070683_100052816
944 Ga0070690_100258225
945 Ga0070690_100884353
946 Ga0070670_100001932
947 Ga0070670_100016141
948 Ga0070670_100030522
949 Ga0070670_100043467
950 Ga0070670_100247824
951 Ga0070670_100413575
952 Ga0070670_100454897
953 Ga0070670_100565065
954 Ga0070677_10250943
955 Ga0068869_100002015
956 Ga0068869_100009386
957 Ga0068869_100270562
958 Ga0068869_100280540
959 Ga0068869_100866308
960 Ga0068869_100914381
961 Ga0070666_10118688
962 Ga0070666_10578781
963 Ga0070666_10716842
964 Ga0070680_100951768
965 Ga0068868_100009443
966 Ga0068868_100035076
967 Ga0068868_100637045
968 Ga0068868_101715614
969 Ga0070660_100008023
970 Ga0070660_100341540
971 Ga0070689_100078740
972 Ga0070687_100358331
973 Ga0070661_100001088
974 Ga0070661_100248558
975 Ga0070661_100394804
976 Ga0070661_100552539
977 Ga0070661_100885046
978 Ga0070692_10004158
979 Ga0070668_100020530
980 Ga0070668_100329391
981 Ga0070668_100743087
982 Ga0070669_100022076
983 Ga0070669_100113789
984 Ga0070675_100004356
985 Ga0070675_100013239
986 Ga0070675_100069593
987 Ga0070671_100348620
988 Ga0070674_100226733
989 Ga0070673_100020834
990 Ga0070673_100081701
991 Ga0070673_100093732
992 Ga0070673_100838826
993 Ga0070673_101116476
994 Ga0070688_100157273
995 Ga0070688_100163550
996 Ga0070688_100849343
997 Ga0070659_100005381
998 Ga0070659_100189414
999 Ga0070659_100311689
1000 Ga0070667_100003099
1001 Ga0070667_100012027
1002 Ga0070667_100025446
1003 Ga0070667_100176479
1004 Ga0070667_100783023
1005 Ga0070714_100002739
1006 Ga0070700_100018494
1007 Ga0070700_100306428
1008 Ga0070694_100018628
1009 Ga0070663_100085402
1010 Ga0070663_100426950
1011 Ga0070678_100113175
1012 Ga0070678_100233511
1013 Ga0070678_100593398
1014 Ga0070678_101830431
1015 Ga0070662_100010527
1016 Ga0070662_100247329
1017 Ga0070662_101459081
1018 Ga0070681_10034748
1019 Ga0068867_100001409
1020 Ga0068867_100013331
1021 Ga0068867_100059713
1022 Ga0068867_100109452
1023 Ga0068867_100144721
1024 Ga0068867_100236681
1025 Ga0068867_100840446
1026 Ga0070685_10994582
1027 Ga0070706_100014174
1028 Ga0070707_100032795
1029 Ga0070679_100029666
1030 Ga0070684_100006747
1031 Ga0070684_101032662
1032 Ga0068853_100022449
1033 Ga0068853_101224347
1034 Ga0070672_100001918
1035 Ga0070672_100007461
1036 Ga0070672_100037415
1037 Ga0070672_100296542
1038 Ga0070686_100000934
1039 Ga0070665_100125079
1040 Ga0070665_100176305
1041 Ga0070665_100651882
1042 Ga0070665_100797218
1043 Ga0070665_100849149
1044 Ga0068855_100000899
1045 Ga0068855_100009898
1046 Ga0068855_100026654
1047 Ga0068855_100041346
1048 Ga0068855_100129571
1049 Ga0068855_100290538
1050 Ga0068855_101784564
1051 Ga0068855_102205600
1052 Ga0068855_102490390
1053 Ga0070664_100012427
1054 Ga0070664_100051593
1055 Ga0068857_100013188
1056 Ga0068857_100022930
1057 Ga0068857_100025706
1058 Ga0068857_100098504
1059 Ga0068857_100351971
1060 Ga0068857_100430714
1061 Ga0068857_100956919
1062 Ga0068854_100003968
1063 Ga0068854_100028234
1064 Ga0068854_100090238
1065 Ga0068854_100102161
1066 Ga0068854_100116060
1067 Ga0068854_100615865
1068 Ga0068856_100000887
1069 Ga0068856_100008336
1070 Ga0068856_100069023
1071 Ga0068856_100232885
1072 Ga0070702_100000571
1073 Ga0068852_100014656
1074 Ga0068852_100078291
1075 Ga0068852_100299390
1076 Ga0068852_101492726
1077 Ga0068852_102178461
1078 Ga0068859_100091161
1079 Ga0068859_100124734
1080 Ga0068859_100296945
1081 Ga0068864_100010671
1082 Ga0068864_100170920
1083 Ga0068864_100660326
1084 Ga0068864_100676311
1085 Ga0068861_100003204
1086 Ga0068861_100117369
1087 Ga0068851_10014082
1088 Ga0068851_10097987
1089 Ga0068851_10099999
1090 Ga0068870_10003323
1091 Ga0068870_10501577
1092 Ga0068870_10870479
1093 Ga0068863_100018071
1094 Ga0068863_100091707
1095 Ga0068863_100105308
1096 Ga0068858_100365766
1097 Ga0068860_100010532
1098 Ga0068862_100057571
1099 Ga0068862_100074688
1100 Ga0068862_100933363
1101 Ga0075368_10045091
1102 Ga0075368_10097158
1103 Ga0075363_100002386
1104 Ga0075363_100048094
1105 Ga0075364_10028373
1106 Ga0075362_10001909
1107 Ga0075362_10003213
1108 Ga0075362_10044596
1109 Ga0075362_10104854
1110 Ga0075362_10177192
1111 Ga0075367_10099999
1112 Ga0075367_10126960
1113 Ga0075367_10281522
1114 Ga0075369_10028500
1115 Ga0075366_10005058
1116 Ga0075366_10023138
1117 Ga0075366_10057237
1118 Ga0075366_10060280
1119 Ga0075366_10081143
1120 Ga0075366_10092862
1121 Ga0075366_10120320
1122 Ga0075366_10159629
1123 Ga0075366_10174278
1124 Ga0075366_10208037
1125 Ga0075366_10454329
1126 Ga0075366_10658274
1127 Ga0097621_100000834
1128 Ga0075370_10000059
1129 Ga0075370_10000087
1130 Ga0075370_10000813
1131 Ga0075370_10002533
1132 Ga0075370_10071038
1133 Ga0075370_10165448
1134 Ga0075370_10274767
1135 Ga0075370_10313695
1136 Ga0068871_100392947
1137 Ga0075428_100188651
1138 Ga0075430_100025785
1139 Ga0075434_101580907
1140 Ga0075429_100001289
1141 Ga0068865_100023460
1142 Ga0068865_100064205
1143 Ga0068865_100276381
1144 Ga0097620_100091157
1145 Ga0097620_100124739
1146 Ga0097620_100296946
1147 Ga0079104_1004321
1148 Ga0099794_10143398
1149 Ga0105251_10026119
1150 Ga0105240_10001001
1151 Ga0105240_10004920
1152 Ga0105240_10035820
1153 Ga0105240_10064762
1154 Ga0105240_10110979
1155 Ga0105240_10151438
1156 Ga0105240_10580327
1157 Ga0105240_11387397
1158 Ga0105240_11511099
1159 Ga0111539_11726941
1160 Ga0105245_10000241
1161 Ga0105245_10055064
1162 Ga0105245_10702000
1163 Ga0105245_10767526
1164 Ga0105245_10791525
1165 Ga0105245_11483078
1166 Ga0105247_10209395
1167 Ga0105247_10260653
1168 Ga0105247_11251157
1169 Ga0114129_10496322
1170 Ga0105243_10000390
1171 Ga0105243_10020375
1172 Ga0105243_11877900
1173 Ga0105241_10079604
1174 Ga0105241_10082320
1175 Ga0105241_10101868
1176 Ga0105241_11137689
1177 Ga0105242_10185158
1178 Ga0105248_10331566
1179 Ga0105248_10827088
1180 Ga0105248_10979732
1181 Ga0105248_11305591
1182 Ga0105248_13176897
1183 Ga0105237_10045864
1184 Ga0105237_10187694
1185 Ga0105237_10208760
1186 Ga0105237_10251517
1187 Ga0105237_10389651
1188 Ga0105237_10501577
1189 Ga0105238_10000738
1190 Ga0105238_10002979
1191 Ga0105238_10408954
1192 Ga0105238_10690928
1193 Ga0105238_10777075
1194 Ga0105249_10008116
1195 Ga0105249_10173015
1196 Ga0105249_11428734
1197 Ga0105239_10010208
1198 Ga0105239_10019338
1199 Ga0105239_10329892
1200 Ga0105239_10337678
1201 Ga0105239_12366395
1202 Ga0105239_12503689
1203 Ga0105246_10041666
1204 Ga0105246_12451221
1205 Ga0157373_10030602
1206 Ga0157373_10350290
1207 Ga0157370_10005091
1208 Ga0157369_10005877
1209 Ga0157369_10112116
1210 Ga0157374_10099755
1211 Ga0157374_10181754
1212 Ga0157374_11080750
1213 Ga0157378_10000691
1214 Ga0157378_10146556
1215 Ga0157378_10238755
1216 Ga0157378_11353466
1217 Ga0163162_10109784
1218 Ga0163162_10128309
1219 Ga0163162_10247762
1220 Ga0163162_10322669
1221 Ga0163162_10343177
1222 Ga0163162_12085872
1223 Ga0157372_10023891
1224 Ga0157372_10345474
1225 Ga0157375_10099480
1226 Ga0157375_10103460
1227 Ga0157375_10133410
1228 Ga0157375_10133527
1229 Ga0157375_10534409
1230 Ga0157375_10606622
1231 Ga0163163_10007845
1232 Ga0163163_10349218
1233 Ga0163163_10453346
1234 Ga0157380_10030112
1235 Ga0157380_10484356
1236 Ga0182008_10010381
1237 Ga0157379_10001790
1238 Ga0157379_10006875
1239 Ga0157379_10028002
1240 Ga0157379_10301397
1241 Ga0157379_10447386
1242 Ga0157379_10572138
1243 Ga0157379_11098943
1244 Ga0157379_11763756
1245 Ga0157379_12395590
1246 Ga0157376_10088635
1247 Ga0157376_11381334
1248 Ga0182006_1019521
1249 Ga0182006_1069162
1250 Ga0182007_10101261
1251 Ga0182007_10234420
1252 Ga0163161_10803624
1253 Ga0163161_11531719
1254 Ga0213872_10000058
1255 Ga0213872_10000102
1256 Ga0213872_10000150
1257 Ga0213872_10004383
1258 Ga0213872_10153162
1259 Ga0213872_10339958
1260 Ga0213875_10077329
1261 Ga0209435_100015
1262 Ga0209435_100288
1263 Ga0209784_100005
1264 Ga0209566_100005
1265 Ga0209674_100009
1266 Ga0209674_100064
1267 Ga0209147_100004
1268 Ga0209563_100012
1269 Ga0209563_100126
1270 Ga0207427_100197
1271 Ga0209437_100268
1272 Ga0209258_100298
1273 Ga0209258_100736
1274 Ga0209258_100787
1275 Ga0209646_1000040
1276 Ga0209646_1000060
1277 Ga0209646_1000105
1278 Ga0209026_1000034
1279 Ga0209026_1000049
1280 Ga0209677_100006
1281 Ga0209677_100411
1282 Ga0209677_101394
1283 Ga0209677_109255
1284 Ga0209148_1012868
1285 Ga0209148_1022957
1286 Ga0209759_1000069
1287 Ga0209759_1000234
1288 Ga0209759_1000569
1289 Ga0209759_1001582
1290 Ga0209759_1002582
1291 Ga0209759_1016603
1292 Ga0209759_1020690
1293 Ga0207666_1014266
1294 Ga0209455_1002003
1295 Ga0209455_1005524
1296 Ga0209455_1029989
1297 Ga0209758_1000233
1298 Ga0209051_1000140
1299 Ga0209051_1001699
1300 Ga0209051_1008265
1301 Ga0209051_1029310
1302 Ga0209257_1000012
1303 Ga0209257_1000045
1304 Ga0209257_1063458
1305 Ga0207697_10185402
1306 Ga0207656_10018424
1307 Ga0207656_10106539
1308 Ga0207656_10137890
1309 Ga0207656_10234031
1310 Ga0207656_10407251
1311 Ga0207710_10166332
1312 Ga0207680_10301289
1313 Ga0207645_10004810
1314 Ga0207645_10034993
1315 Ga0207643_10023140
1316 Ga0207643_10089604
1317 Ga0207643_10164665
1318 Ga0207705_10035791
1319 Ga0207705_10162995
1320 Ga0207705_10233564
1321 Ga0207684_10012635
1322 Ga0207654_10378130
1323 Ga0207654_10834454
1324 Ga0207707_10036063
1325 Ga0207695_10000573
1326 Ga0207695_10004109
1327 Ga0207695_10006006
1328 Ga0207695_10030732
1329 Ga0207695_10080469
1330 Ga0207695_10099795
1331 Ga0207695_10255540
1332 Ga0207671_10046969
1333 Ga0207671_10225306
1334 Ga0207671_10248091
1335 Ga0207671_10302330
1336 Ga0207671_10775753
1337 Ga0207660_10906699
1338 Ga0207660_10990277
1339 Ga0207657_10024892
1340 Ga0207657_10286982
1341 Ga0207657_10727761
1342 Ga0207657_10765968
1343 Ga0207649_10002217
1344 Ga0207649_10563024
1345 Ga0207652_10047116
1346 Ga0207652_10310463
1347 Ga0207646_10198051
1348 Ga0207681_10005071
1349 Ga0207681_10208885
1350 Ga0207694_10000505
1351 Ga0207694_10010773
1352 Ga0207694_10361493
1353 Ga0207694_10384437
1354 Ga0207694_10783681
1355 Ga0207694_10819862
1356 Ga0207650_10022889
1357 Ga0207650_10023873
1358 Ga0207650_10050850
1359 Ga0207650_10053437
1360 Ga0207650_10075425
1361 Ga0207650_10370508
1362 Ga0207650_10373791
1363 Ga0207659_10009257
1364 Ga0207659_10110207
1365 Ga0207659_10587076
1366 Ga0207687_10000799
1367 Ga0207687_10060589
1368 Ga0207687_10241914
1369 Ga0207687_11504785
1370 Ga0207664_10050874
1371 Ga0207644_10017024
1372 Ga0207644_10092568
1373 Ga0207644_10332254
1374 Ga0207644_10362591
1375 Ga0207644_11190387
1376 Ga0207690_10013867
1377 Ga0207690_10189386
1378 Ga0207706_10074485
1379 Ga0207706_10132942
1380 Ga0207686_10004205
1381 Ga0207686_10276959
1382 Ga0207709_10060578
1383 Ga0207709_11177358
1384 Ga0207670_10051735
1385 Ga0207669_10068061
1386 Ga0207669_10182940
1387 Ga0207669_10535201
1388 Ga0207704_10058715
1389 Ga0207691_10004143
1390 Ga0207691_10006762
1391 Ga0207691_10024653
1392 Ga0207691_10061422
1393 Ga0207711_10011889
1394 Ga0207711_10549147
1395 Ga0207711_10620816
1396 Ga0207689_10000452
1397 Ga0207689_10147813
1398 Ga0207689_10584203
1399 Ga0207689_10757036
1400 Ga0207661_10028466
1401 Ga0207661_10866758
1402 Ga0207679_10117544
1403 Ga0207679_10139525
1404 Ga0207679_10850953
1405 Ga0207667_10000053
1406 Ga0207667_10026989
1407 Ga0207667_10028711
1408 Ga0207667_10052477
1409 Ga0207667_10248612
1410 Ga0207667_12123069
1411 Ga0207651_10069538
1412 Ga0207651_10088444
1413 Ga0207651_10105872
1414 Ga0207651_10413338
1415 Ga0207651_11251062
1416 Ga0207712_10123168
1417 Ga0207668_10012253
1418 Ga0207668_10247602
1419 Ga0207668_10407248
1420 Ga0207668_11296762
1421 Ga0207640_10031492
1422 Ga0207640_10049985
1423 Ga0207640_10112897
1424 Ga0207640_10212227
1425 Ga0207640_10380006
1426 Ga0207658_10047106
1427 Ga0207658_10050043
1428 Ga0207658_10061349
1429 Ga0207658_10125710
1430 Ga0207658_10968704
1431 Ga0207677_10031338
1432 Ga0207677_10051376
1433 Ga0207677_10774884
1434 Ga0207677_11011251
1435 Ga0207677_11999619
1436 Ga0207703_10003194
1437 Ga0207703_10399632
1438 Ga0207639_10075141
1439 Ga0207639_10144245
1440 Ga0207639_11096435
1441 Ga0207639_11415759
1442 Ga0207678_10106297
1443 Ga0207678_10373059
1444 Ga0207708_10000701
1445 Ga0207702_10022449
1446 Ga0207702_10083504
1447 Ga0207702_10204748
1448 Ga0207641_10009598
1449 Ga0207641_10026935
1450 Ga0207641_10272468
1451 Ga0207648_10000159
1452 Ga0207648_10003372
1453 Ga0207648_10038891
1454 Ga0207648_10071567
1455 Ga0207648_10160108
1456 Ga0207648_10506563
1457 Ga0207648_10542851
1458 Ga0207648_10738928
1459 Ga0207676_10003896
1460 Ga0207676_10037088
1461 Ga0207676_10620870
1462 Ga0207674_10000954
1463 Ga0207674_10006659
1464 Ga0207674_10022384
1465 Ga0207674_10121427
1466 Ga0207674_10435399
1467 Ga0207674_10437071
1468 Ga0207674_10636845
1469 Ga0207674_10975356
1470 Ga0207674_11234974
1471 Ga0207675_100000068
1472 Ga0207675_100037965
1473 Ga0207675_100213377
1474 Ga0207675_100454833
1475 Ga0207683_10013791
1476 Ga0207683_10093306
1477 Ga0207683_10598439
1478 Ga0207698_10007618
1479 Ga0207698_10025226
1480 Ga0207698_10698688
1481 Ga0207698_10767765
1482 Ga0207698_11320615
1483 Ga0209281_1007305
1484 Ga0209813_10008368
1485 Ga0209813_10140803
1486 Ga0268266_10037951
1487 Ga0268266_10707477
1488 Ga0268265_10016151
1489 Ga0268265_10031173
1490 Ga0268265_10050837
1491 Ga0268265_10223199
1492 Ga0268265_12588079
1493 Ga0268264_10020364
1494 Ga0268264_10149599
1495 Ga0268264_10241375
1496 Ga0268264_10804770
1497 Ga0265336_10000123
1498 Ga0307517_10002354
1499 Ga0307517_10077719
1500 Ga0307517_10318467
1501 Ga0307515_10015864
1502 Ga0307515_10106461
1503 Ga0307515_10254589
1504 Ga0307515_10583058
1505 Ga0265324_10000849
1506 Ga0307511_10253296
1507 Ga0307512_10182106
1508 Ga0307512_10233028
1509 Ga0307512_10252093
1510 Ga0265332_10000278
1511 Ga0265331_10009024
1512 Ga0265331_10058535
1513 Ga0265327_10000328
1514 Ga0307513_10021976
1515 Ga0307513_10195711
1516 Ga0307513_10380145
1517 Ga0307509_10000234
1518 Ga0307509_10039607
1519 Ga0307509_10090207
1520 Ga0307509_10112558
1521 Ga0307509_10120503
1522 Ga0307509_10902039
1523 Ga0307408_100211432
1524 Ga0307408_100603774
1525 Ga0307508_10001066
1526 Ga0307508_10088896
1527 Ga0307514_10052858
1528 Ga0307514_10062249
1529 Ga0307514_10253912
1530 Ga0307514_10414020
1531 Ga0307516_10037289
1532 Ga0307516_10090008
1533 Ga0307516_10124340
1534 Ga0307516_10143470
1535 Ga0307516_10613533
1536 Ga0307516_10629741
1537 Ga0307516_10769828
1538 Ga0307405_10174205
1539 Ga0307413_10017248
1540 Ga0307413_11501109
1541 Ga0307518_10357644
1542 Ga0307410_10283779
1543 Ga0307412_10401022
1544 Ga0307412_11085580
1545 Ga0307409_100372205
1546 Ga0307416_102294687
1547 Ga0307414_10689805
1548 Ga0307411_10044945
1549 Ga0307411_10321696
1550 Ga0307415_100740945
1551 Ga0307415_101200948
1552 Ga0316583_10227339
1553 Ga0307510_10012165
1554 Ga0307510_10032961
1555 Ga0373952_0001139
1556 Ga0373946_0066198
1557 Ga0373931_0025723
1558 Ga0373937_0179223
1559 Ga0373937_0340219
1560 Ga0373937_0669136
1561 Ga0395899_0195598
1562 Ga0395899_0204210
1563 Ga0395898_0038029
1564 Ga0436364_0570264
1565 Ga0395901_0029531
1566 Ga0436365_0680524
1567 Ga0436361_0018388
1568 Ga0436361_0068556
1569 Ga0436361_0162163
1570 Ga0436361_0614815
1571 Ga0436361_0651406
1572 Ga0436361_0658018
1573 Ga0436361_0704442
1574 Ga0436361_1050932
1575 Ga0436361_1078434
1576 Ga0451791_0302276
1577 Ga0451795_1577239
1578 Ga0451837_1131948
1579 Ga0451853_1225302
1580 Ga0451853_1592565
1581 Ga0451853_2413001
1582 Ga0439437_064593
1583 Ga0439448_0053162
1584 Ga0439448_0323230
1585 Ga0439450_054731
1586 Ga0450889_021654
1587 Ga0439464_0008576
1588 Ga0451577_0180363
1589 Ga0466965_0030229
1590 Ga0466963_0645760
1591 Ga0466964_0004400
1592 Ga0453684_0562581
1593 Ga0466968_0068366
1594 Ga0466970_0011861
1595 Ga0466957_0028524
1596 Ga0466957_0351328
1597 Ga0466957_0571936
1598 Ga0466959_0022300
1599 Ga0451576_0001324
1600 Ga0451576_0978897
1601 Ga0466958_0153786
1602 Ga0466967_0234772
1603 Ga0466967_0379341
1604 Ga0466967_0635782
1605 Ga0466967_0962078
1606 Ga0466967_1447903
1607 Ga0495592_0000291
1608 Ga0495638_0118661
1609 Ga0495638_0276953
1610 Ga0495651_0387051
1611 Ga0495650_0053966
1612 Ga0495650_0085334
1613 Ga0495582_0254919
1614 Ga0495605_0082544
1615 Ga0495664_0201984
1616 Ga0495607_0200564
1617 Ga0495583_0000046
1618 Ga0495583_0312776
1619 Ga0495610_0053848
1620 Ga0495628_0051863
1621 Ga0495631_0377690
1622 Ga0495632_0006200
1623 Ga0495648_0303349
1624 Ga0495666_0021091
1625 Ga0495598_0006095
1626 Ga0495621_0193356
1627 Ga0495597_0003922
1628 Ga0495597_0024542
1629 Ga0495597_0134198
1630 Ga0495645_0071213
1631 Ga0495622_0025296
1632 Ga0495611_0221658
1633 Ga0495625_0005740
1634 Ga0495625_0036997
1635 Ga0495625_0150118
1636 Ga0495625_0321463
1637 Ga0495647_0334470
1638 Ga0495658_0004796
1639 Ga0495658_0454283
1640 Ga0495658_0693015
1641 Ga0495613_0603713
1642 Ga0495624_0056474
1643 Ga0495671_0111819
1644 Ga0495671_0154985
1645 Ga0495671_0363925
1646 Ga0495671_0598998
1647 Ga0495649_0000638
1648 Ga0495649_0037138
1649 Ga0495660_0024873
1650 Ga0495687_000367
1651 Ga0495687_011817
1652 Ga0495673_0156408
1653 Ga0495686_0029542
1654 Ga0495686_0145468
1655 Ga0495593_0031997
1656 Ga0495614_0287908
1657 Ga0495615_0024194
1658 Ga0495626_0074869
1659 Ga0496100_0095075
1660 Ga0496101_0242656
1661 Ga0496101_1162577
1662 Ga0496104_0046378
1663 Ga0496105_0557045
1664 Ga0496106_0056501
1665 Ga0496106_0361007
1666 Ga0496108_0054157
1667 Ga0496108_0458421
1668 Ga0496108_0475861
1669 Ga0496108_0716479
1670 Ga0496109_0023407
1671 Ga0496111_0149444
1672 Ga0496112_0000429
1673 Ga0496112_0207877
1674 Ga0496112_1081738
1675 Ga0496113_0400549
1676 Ga0496114_0006440
1677 Ga0496114_0322714
1678 Ga0496115_0416682
1679 Ga0496116_0018094
1680 Ga0496118_0185082
1681 Ga0496121_0020869
1682 Ga0496121_0054604
1683 Ga0496121_0316427
1684 Ga0496122_0008179
1685 Ga0496123_0008042
1686 Ga0496124_0469914
1687 Ga0496125_0005346
1688 Ga0496126_0026066
1689 Ga0495682_0276103
1690 Ga0501290_079332
1691 Ga0501300_027973
1692 Ga0501032_0010930
1693 Ga0501032_0140832
1694 Ga0501034_0024667
1695 Ga0501034_0257622
1696 Ga0501038_0058614
1697 Ga0501039_0013485
1698 Ga0501043_0000149
1699 Ga0501046_0000092
1700 Ga0501047_0000028
1701 Ga0501048_0006680
1702 Ga0501072_0586099
1703 Ga0501079_0657938
1704 Ga0501081_0688929
1705 Ga0501266_000057
1706 Ga0501035_0046260
1707 Ga0501035_1209385
1708 Ga0501044_0272835
1709 Ga0501045_0000170
1710 nmdc:mga03683_10952_c1
1711 nmdc:mga03683_120460_c1
1712 nmdc:mga03683_19823_c1
1713 nmdc:mga03n38_230957_c1
1714 nmdc:mga03n38_48533_c1
1715 nmdc:mga00v17_10380_c1
1716 nmdc:mga0k408_11251_c1
1717 nmdc:mga0k408_198791_c1
1718 nmdc:mga0k408_22329_c1
1719 nmdc:mga0k408_2308_c1
1720 nmdc:mga0k408_27898_c1
1721 nmdc:mga0k408_355_c1
1722 nmdc:mga0k408_40234_c1
1723 nmdc:mga0k408_61790_c1
1724 nmdc:mga0k408_68274_c1
1725 nmdc:mga0k408_69103_c1
1726 nmdc:mga0k408_8262_c1
1727 nmdc:mga06z11_127044_c1
1728 nmdc:mga06z11_165950_c1
1729 nmdc:mga06z11_5785_c1
1730 nmdc:mga04h51_11203_c1
1731 nmdc:mga04h51_160506_c1
1732 nmdc:mga07m45_10918_c1
1733 nmdc:mga07m45_1116_c1
1734 nmdc:mga07m45_175262_c1
1735 nmdc:mga07m45_216266_c1
1736 nmdc:mga07m45_2223_c1
1737 nmdc:mga07m45_27823_c1
1738 nmdc:mga07m45_398480_c1
1739 nmdc:mga07m45_6961_c1
1740 nmdc:mga07m45_7118_c1
1741 nmdc:mga07m45_7357_c1
1742 nmdc:mga09592_4802_c1
1743 nmdc:mga0qj67_89016_c1
1744 nmdc:mga0n895_1200895_c1
1745 nmdc:mga0n895_1778329_c1
1746 nmdc:mga0sz30_176495_c1
1747 Ga0495601_0498003
1748 Ga0500635_0000005
1749 Ga0500644_0100473
1750 Ga0500651_0028942
1751 Ga0500651_0058855
1752 Ga0500651_0422206
1753 Ga0500618_001127
1754 Ga0500618_003179
1755 Ga0500658_0002097
1756 Ga0500559_0000119
1757 Ga0500564_107433
1758 Ga0500564_113828
1759 Ga0500564_138173
1760 Ga0500568_0005734
1761 Ga0500622_0005643
1762 Ga0500636_0045101
1763 Ga0500636_0132989
1764 Ga0500587_004225
1765 Ga0501084_1049680
1766 Ga0500661_014650
1767 Ga0501082_0504992
1768 Ga0466962_0057998
1769 2511250706
1770 2511383165
1771 2521557186
1772 2548848656
1773 2550696542
1774 2553007707
1775 2644303978
1776 2644338794
1777 2765568317
1778 2808983393
1779 2809128621
1780 2809148242
1781 2819591914
1782 2819618660
1783 2839094821
1784 2852620336
1785 2884840674
1786 2884855931
1787 2896157144
1788 2904440108
1789 2904530956
1790 2904587411
1791 2904592554
1792 2904604654
1793 2919050465
1794 2919082485
1795 2923515812
1796 2928133396

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00300

His_Phos_1

Histidine phosphatase superfamily (branch 1)

28

103

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
1ujc-assembly1.cif.gz_A structure of the protein histidine phosphatase sixa complexed with tungstate 0.8325 1 151
3f2i-assembly3.cif.gz_E crystal structure of the alr0221 protein from nostoc, northeast structural genomics consortium target nsr422. 0.8267 1 151
1ujc-assembly1.cif.gz_A structure of the protein histidine phosphatase sixa complexed with tungstate 0.8225 1 151
3f2i-assembly1.cif.gz_A crystal structure of the alr0221 protein from nostoc, northeast structural genomics consortium target nsr422. 0.8213 1 152
3f2i-assembly3.cif.gz_E crystal structure of the alr0221 protein from nostoc, northeast structural genomics consortium target nsr422. 0.8168 1 151
ID Description Score Start End Superfamily
af_P42522_761_951_2.30.29.30 Mainly Beta;Roll;PH-domain like;Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 0.8556 124 146 2.30.29.30
1ujbA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Phosphoglycerate mutase-like 0.8323 1 151 3.40.50.1240
1ujbA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Phosphoglycerate mutase-like 0.8224 1 151 3.40.50.1240
af_I1L079_52_229_3.40.50.1240 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Phosphoglycerate mutase-like 0.7915 2 147 3.40.50.1240
af_Q3UQ05_61_243_3.15.10.10 Alpha Beta;Super Roll;Bactericidal permeability-increasing protein; domain 1;Bactericidal permeability-increasing protein; domain 1 0.7874 124 147 3.15.10.10
ID Description Score Start End GO Terms
AF-A0A259DDT1-F1-model_v4 Histidine phosphatase family protein 0.9988 1 104
AF-A0A0Q8H1B7-F1-model_v4 Phosphohistidine phosphatase 0.9896 1 149
AF-A0A3N7EGH1-F1-model_v4 Histidine phosphatase family protein 0.9859 1 152
AF-A0A5C1EC62-F1-model_v4 Putative phosphohistidine phosphatase 0.9852 1 152
AF-A0A521KDL3-F1-model_v4 Histidine phosphatase family protein 0.9848 1 149

Map