F485058

General Info

Members Datasets Scaffolds Average Seq Length
897 343 1794 324

Family's Representative Sequence

Representative Sequence 3300050509|nmdc:mga0qj67_37429_c1|nmdc:mga0qj67_37429_c1_2382_3512
Length 376
Sequence LASIADLPTPQRLTAIRDQLTPLIESADPGALAEQAGALELEMGAPGFWDDQERAQQVSSEHARVTRRLEQMRSLEADVDDLEGLAELAAEDASIAEXXXXQLAAVEARLSDLELERLFSGRYDRGDALVAVNAGAGGTDAQDWAEMVLRMEMRWAERRGFKVELLEVSEGEEAGIKSATFRVSGENAYGLYSAEKGVHRLVRLSPFDSANRRQTSFAGVEVSPVIEDAGEVEIDADDLQVDTYRASGAGGQHVNKTDSAVRITHRPSGIVVQCQNERSQTQNRETAMKMLRSKLVELRERERAEELARERGDAQDVNFGSQIRSYVLHPYTMVKDHRTNFEVGNAQGVLEGDLDGFIRAELLRAAGRSAGAGGVK

Samples

Sample ID Description Type Environment
1 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
2 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
3 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
4 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
5 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
24 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
25 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
26 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
27 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
28 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
29 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
30 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
31 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
32 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
33 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
34 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
35 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
36 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
37 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
38 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
39 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
40 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
41 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
42 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
43 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
44 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
45 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
46 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
47 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
48 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
49 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
50 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
51 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
52 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
53 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
54 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
55 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
56 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
57 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
58 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
59 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
60 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
61 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
62 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
63 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
64 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
65 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
67 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
68 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
69 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
70 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
71 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
72 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
73 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
74 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
75 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
76 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
77 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
78 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
79 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
80 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
81 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
82 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
83 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
84 3300012507 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 Metagenome Rhizosphere
85 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
86 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
87 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
88 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
89 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
90 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
91 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
92 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
93 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
94 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
95 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
96 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
97 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
98 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
99 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
100 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
101 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
102 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
103 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
104 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
105 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
106 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
158 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
159 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
163 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
164 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
165 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
166 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
167 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
168 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
169 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
170 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
171 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
172 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
173 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
174 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
175 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
176 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
177 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
178 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
179 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
180 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
181 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
182 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
183 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
184 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
185 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
186 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
187 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
188 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
189 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
190 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
191 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
192 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
193 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
194 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
195 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
196 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
197 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
198 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
199 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
200 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
201 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
202 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
203 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
204 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
205 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
206 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
207 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
208 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
209 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
210 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
211 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
212 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
213 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
214 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
215 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
216 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
217 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
218 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
219 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
220 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
221 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
222 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
223 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
224 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
225 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
226 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
227 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
228 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
229 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
230 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
231 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
232 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
233 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
234 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
235 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
236 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
237 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
238 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
239 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
240 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
241 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
242 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
243 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
244 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
245 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
246 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
247 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
248 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
249 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
250 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
251 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
252 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
253 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
254 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
255 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
256 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
257 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
258 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
259 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
260 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
261 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
262 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
263 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
264 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
265 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
266 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
267 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
268 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
269 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
270 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
271 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
272 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
273 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
274 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
275 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
276 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
277 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
278 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
279 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
280 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
281 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
282 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
283 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
284 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
285 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
286 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
287 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
288 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
289 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
290 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
291 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
292 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
293 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
294 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
295 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
296 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
297 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
298 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
299 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
300 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
301 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
302 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
303 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
304 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
305 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
306 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
307 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
308 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
309 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
310 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
311 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
312 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
313 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
314 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
315 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
316 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
317 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
318 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
319 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
320 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
321 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
322 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
323 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
324 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
325 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
326 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
327 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
328 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
329 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
330 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
331 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
332 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
333 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
334 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
335 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
336 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
337 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
338 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
339 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
340 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
341 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
342 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
343 8007375930 Clostridium sp. YIM B02565 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99
Metatranscriptomes 0.89
Isolates 0.11

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.56
Nodule 0.78
Rhizoplane 9.03
Rhizosphere 86.62
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 nmdc:mga0qj67_37429_c1 3300050509 Bacteria 3801
2 LJQas_1008039 3300000549 Bacteria 1291
3 JGI24738J21930_10008605 3300002075 Bacteria 2318
4 JGI25406J46586_10014128 3300003203 Bacteria 3403
5 JGI25406J46586_10016276 3300003203 Bacteria 3104
6 JGI25407J50210_10005129 3300003373 Bacteria 3211
7 JGI25407J50210_10013832 3300003373 Bacteria 2076
8 JGI25407J50210_10014324 3300003373 Bacteria 2044
9 Ga0070658_10064661 3300005327 Bacteria 2984
10 Ga0070658_10245389 3300005327 Bacteria 1519
11 Ga0070683_100001429 3300005329 Bacteria 18327
12 Ga0070683_100006385 3300005329 Bacteria 9886
13 Ga0070683_100008554 3300005329 Bacteria 8698
14 Ga0070683_100030210 3300005329 Bacteria 4914
15 Ga0070670_100090285 3300005331 Bacteria 2633
16 Ga0068869_100066940 3300005334 Bacteria 2648
17 Ga0070666_10029341 3300005335 Bacteria 3615
18 Ga0070680_100081060 3300005336 Bacteria 2677
19 Ga0070680_100101413 3300005336 Bacteria 2389
20 Ga0070680_100143896 3300005336 Bacteria 2000
21 Ga0070680_100301560 3300005336 Bacteria 1359
22 Ga0070682_100000045 3300005337 Bacteria 131960
23 Ga0070682_100002116 3300005337 Bacteria 11030
24 Ga0070682_100014100 3300005337 Bacteria 4614
25 Ga0070682_100063203 3300005337 Bacteria 2346
26 Ga0070682_100080129 3300005337 Bacteria 2110
27 Ga0070682_100080676 3300005337 Bacteria 2104
28 Ga0070682_100212589 3300005337 Bacteria 1371
29 Ga0068868_100005956 3300005338 Bacteria 8599
30 Ga0068868_100025245 3300005338 Bacteria 4517
31 Ga0070660_100001878 3300005339 Bacteria 14467
32 Ga0070660_100002874 3300005339 Bacteria 11862
33 Ga0070660_100044156 3300005339 Bacteria 3407
34 Ga0070661_100000023 3300005344 Bacteria 123104
35 Ga0070661_100029830 3300005344 Bacteria 3938
36 Ga0070661_100036846 3300005344 Bacteria 3555
37 Ga0070692_10016243 3300005345 Bacteria 3540
38 Ga0070668_100015307 3300005347 Bacteria 5731
39 Ga0070668_100116183 3300005347 Bacteria 2133
40 Ga0070675_100000053 3300005354 Bacteria 70601
41 Ga0070675_100195855 3300005354 Bacteria 1752
42 Ga0070674_100000082 3300005356 Bacteria 44418
43 Ga0070674_100070535 3300005356 Bacteria 2469
44 Ga0070674_100158725 3300005356 Bacteria 1714
45 Ga0070688_100000300 3300005365 Bacteria 25290
46 Ga0070688_100000630 3300005365 Bacteria 17586
47 Ga0070688_100060783 3300005365 Bacteria 2387
48 Ga0070659_100006539 3300005366 Bacteria 8417
49 Ga0070659_100024338 3300005366 Bacteria 4641
50 Ga0070659_100037986 3300005366 Bacteria 3754
51 Ga0070667_100000695 3300005367 Bacteria 32405
52 Ga0070713_100000009 3300005436 Bacteria 153056
53 Ga0070713_100160693 3300005436 Bacteria 2005
54 Ga0070711_100092307 3300005439 Bacteria 2184
55 Ga0070711_100247965 3300005439 Bacteria 1395
56 Ga0070705_100054509 3300005440 Bacteria 2346
57 Ga0070700_100080988 3300005441 Bacteria 2096
58 Ga0070700_100272372 3300005441 Bacteria 1224
59 Ga0070663_100023142 3300005455 Bacteria 4161
60 Ga0070678_100007927 3300005456 Bacteria 6325
61 Ga0070662_100000016 3300005457 Bacteria 105820
62 Ga0070662_100068086 3300005457 Bacteria 2616
63 Ga0070662_100093451 3300005457 Bacteria 2263
64 Ga0070681_10010625 3300005458 Bacteria 9099
65 Ga0070681_10013721 3300005458 Bacteria 8066
66 Ga0070681_10019078 3300005458 Bacteria 6863
67 Ga0070681_10028864 3300005458 Bacteria 5574
68 Ga0070681_10056580 3300005458 Bacteria 3903
69 Ga0070681_10105644 3300005458 Bacteria 2758
70 Ga0068867_100006031 3300005459 Bacteria 8588
71 Ga0068867_100054845 3300005459 Bacteria 2945
72 Ga0070685_10000282 3300005466 Bacteria 32605
73 Ga0070685_10000320 3300005466 Bacteria 29816
74 Ga0070707_100229613 3300005468 Bacteria 1807
75 Ga0070679_100000312 3300005530 Bacteria 41159
76 Ga0070679_100014166 3300005530 Bacteria 7650
77 Ga0070679_100031669 3300005530 Bacteria 5227
78 Ga0070679_100033291 3300005530 Bacteria 5103
79 Ga0070679_100068574 3300005530 Bacteria 3538
80 Ga0070684_100011922 3300005535 Bacteria 6942
81 Ga0070684_100023464 3300005535 Bacteria 5161
82 Ga0070684_100024068 3300005535 Bacteria 5104
83 Ga0070684_100024149 3300005535 Bacteria 5096
84 Ga0070684_100025949 3300005535 Bacteria 4930
85 Ga0070684_100038133 3300005535 Bacteria 4126
86 Ga0070684_100091076 3300005535 Bacteria 2712
87 Ga0070684_100138659 3300005535 Bacteria 2198
88 Ga0070697_100097586 3300005536 Bacteria 2438
89 Ga0068853_100002766 3300005539 Bacteria 13247
90 Ga0070686_100242430 3300005544 Bacteria 1313
91 Ga0070693_100006705 3300005547 Bacteria 5592
92 Ga0070693_100169542 3300005547 Bacteria 1397
93 Ga0070665_100000244 3300005548 Bacteria 90284
94 Ga0070665_100005026 3300005548 Bacteria 13720
95 Ga0070665_100017879 3300005548 Bacteria 7118
96 Ga0070665_100223482 3300005548 Bacteria 1884
97 Ga0070665_100279050 3300005548 Bacteria 1672
98 Ga0070704_100028529 3300005549 Bacteria 3715
99 Ga0070704_100148947 3300005549 Bacteria 1837
100 Ga0068855_100046966 3300005563 Bacteria 5103
101 Ga0068855_100204032 3300005563 Bacteria 2225
102 Ga0070664_100128239 3300005564 Bacteria 2227
103 Ga0070664_100272162 3300005564 Bacteria 1526
104 Ga0068857_100058998 3300005577 Bacteria 3408
105 Ga0068854_100000031 3300005578 Bacteria 107298
106 Ga0068856_100001194 3300005614 Bacteria 27371
107 Ga0068856_100026366 3300005614 Bacteria 5667
108 Ga0068856_100043149 3300005614 Bacteria 4437
109 Ga0068856_100173482 3300005614 Bacteria 2168
110 Ga0068856_100184340 3300005614 Bacteria 2101
111 Ga0070702_100010129 3300005615 Bacteria 4633
112 Ga0068852_100000296 3300005616 Bacteria 33429
113 Ga0068852_100006184 3300005616 Bacteria 8632
114 Ga0068852_100044814 3300005616 Bacteria 3760
115 Ga0068852_100239073 3300005616 Bacteria 1734
116 Ga0068864_100000045 3300005618 Bacteria 154739
117 Ga0068864_100058920 3300005618 Bacteria 3321
118 Ga0068866_10000001 3300005718 Bacteria 519680
119 Ga0068866_10005928 3300005718 Bacteria 5080
120 Ga0068861_100002566 3300005719 Bacteria 11872
121 Ga0068851_10000656 3300005834 Bacteria 14770
122 Ga0068851_10019515 3300005834 Bacteria 3275
123 Ga0068863_100000021 3300005841 Bacteria 198088
124 Ga0068863_100024278 3300005841 Bacteria 5782
125 Ga0068863_100339780 3300005841 Bacteria 1461
126 Ga0068858_100000267 3300005842 Bacteria 55818
127 Ga0068858_100001207 3300005842 Bacteria 26780
128 Ga0068860_100130464 3300005843 Bacteria 2411
129 Ga0068862_100008832 3300005844 Bacteria 8345
130 Ga0081455_10003252 3300005937 Bacteria 18813
131 Ga0081455_10027049 3300005937 Bacteria 5261
132 Ga0081455_10028011 3300005937 Bacteria 5152
133 Ga0081455_10055109 3300005937 Bacteria 3383
134 Ga0081455_10057361 3300005937 Bacteria 3301
135 Ga0081455_10149621 3300005937 Bacteria 1801
136 Ga0081538_10000219 3300005981 Bacteria 64491
137 Ga0081538_10000241 3300005981 Bacteria 61996
138 Ga0081538_10002025 3300005981 Bacteria 20274
139 Ga0081538_10003073 3300005981 Bacteria 15877
140 Ga0081538_10003315 3300005981 Bacteria 15262
141 Ga0081538_10004594 3300005981 Bacteria 12692
142 Ga0081538_10011818 3300005981 Bacteria 7047
143 Ga0081538_10016142 3300005981 Bacteria 5740
144 Ga0081538_10021887 3300005981 Bacteria 4649
145 Ga0081538_10046933 3300005981 Bacteria 2656
146 Ga0081538_10047697 3300005981 Bacteria 2624
147 Ga0081538_10077193 3300005981 Bacteria 1795
148 Ga0081540_1002225 3300005983 Bacteria 15996
149 Ga0081539_10001668 3300005985 Bacteria 35937
150 Ga0081539_10001929 3300005985 Bacteria 31957
151 Ga0081539_10002491 3300005985 Bacteria 25867
152 Ga0081539_10009624 3300005985 Bacteria 8021
153 Ga0081539_10017082 3300005985 Bacteria 5122
154 Ga0075364_10188149 3300006051 Bacteria 1398
155 Ga0070715_10000001 3300006163 Bacteria 693690
156 Ga0070716_100135735 3300006173 Bacteria 1562
157 Ga0070716_100217633 3300006173 Bacteria 1281
158 Ga0070716_100224153 3300006173 Bacteria 1265
159 Ga0070716_100263271 3300006173 Bacteria 1181
160 Ga0070712_100001071 3300006175 Bacteria 16531
161 Ga0070712_100003981 3300006175 Bacteria 9083
162 Ga0070712_100056677 3300006175 Bacteria 2749
163 Ga0070712_100186842 3300006175 Bacteria 1618
164 Ga0070712_100343399 3300006175 Bacteria 1220
165 Ga0097621_100365845 3300006237 Bacteria 1286
166 Ga0075428_100023575 3300006844 Bacteria 6813
167 Ga0075428_100047387 3300006844 Bacteria 4721
168 Ga0075430_100000824 3300006846 Bacteria 24215
169 Ga0075431_100000747 3300006847 Bacteria 28086
170 Ga0075431_100002897 3300006847 Bacteria 16590
171 Ga0075431_100230163 3300006847 Bacteria 1889
172 Ga0075431_100257275 3300006847 Bacteria 1772
173 Ga0075433_10001485 3300006852 Bacteria 17324
174 Ga0075433_10015865 3300006852 Bacteria 6193
175 Ga0075433_10018515 3300006852 Bacteria 5792
176 Ga0075434_100034518 3300006871 Bacteria 4995
177 Ga0075434_100137545 3300006871 Bacteria 2462
178 Ga0068865_100000104 3300006881 Bacteria 43423
179 Ga0068865_100034775 3300006881 Bacteria 3383
180 Ga0075436_100228362 3300006914 Bacteria 1322
181 Ga0079104_1000337 3300006946 Bacteria 57374
182 Ga0079104_1005865 3300006946 Bacteria 4790
183 Ga0079104_1028242 3300006946 Bacteria 1427
184 Ga0105240_10031253 3300009093 Bacteria 6907
185 Ga0105240_10324663 3300009093 Bacteria 1753
186 Ga0111539_10044466 3300009094 Bacteria 5320
187 Ga0111539_10065301 3300009094 Bacteria 4301
188 Ga0111539_10078234 3300009094 Bacteria 3891
189 Ga0111539_10102572 3300009094 Bacteria 3358
190 Ga0105245_10000236 3300009098 Bacteria 52639
191 Ga0105245_10000545 3300009098 Bacteria 34359
192 Ga0105245_10002692 3300009098 Bacteria 15989
193 Ga0105245_10006569 3300009098 Bacteria 10206
194 Ga0105245_10042529 3300009098 Bacteria 4054
195 Ga0105245_10108988 3300009098 Bacteria 2573
196 Ga0105245_10240515 3300009098 Bacteria 1754
197 Ga0105245_10247711 3300009098 Bacteria 1730
198 Ga0105245_10282589 3300009098 Bacteria 1623
199 Ga0105247_10054722 3300009101 Bacteria 2462
200 Ga0105247_10067293 3300009101 Bacteria 2231
201 Ga0114129_10014103 3300009147 Bacteria 11384
202 Ga0114129_10124004 3300009147 Bacteria 3553
203 Ga0114129_10215708 3300009147 Bacteria 2592
204 Ga0114129_10411207 3300009147 Bacteria 1781
205 Ga0114129_10765283 3300009147 Bacteria 1235
206 Ga0105243_10014354 3300009148 Bacteria 5995
207 Ga0105243_10046579 3300009148 Bacteria 3412
208 Ga0105243_10086529 3300009148 Bacteria 2571
209 Ga0105243_10297599 3300009148 Bacteria 1461
210 Ga0105242_10000194 3300009176 Bacteria 47231
211 Ga0105242_10000819 3300009176 Bacteria 24165
212 Ga0105242_10132675 3300009176 Bacteria 2152
213 Ga0105242_10193474 3300009176 Bacteria 1802
214 Ga0105238_10000011 3300009551 Bacteria 261080
215 Ga0105238_10040063 3300009551 Bacteria 4749
216 Ga0105238_10081390 3300009551 Bacteria 3228
217 Ga0105249_10148229 3300009553 Bacteria 2256
218 Ga0105249_10183328 3300009553 Bacteria 2038
219 Ga0105239_10130675 3300010375 Bacteria 2793
220 Ga0105239_10351710 3300010375 Bacteria 1664
221 Ga0105239_10374451 3300010375 Bacteria 1609
222 Ga0105239_10392819 3300010375 Bacteria 1569
223 Ga0157342_1005311 3300012507 Bacteria 1180
224 Ga0157373_10093096 3300013100 Bacteria 2123
225 Ga0157371_10005434 3300013102 Bacteria 10742
226 Ga0157371_10049109 3300013102 Bacteria 2998
227 Ga0157371_10050500 3300013102 Bacteria 2956
228 Ga0157370_10014865 3300013104 Bacteria 7942
229 Ga0157370_10069784 3300013104 Bacteria 3318
230 Ga0157370_10140814 3300013104 Bacteria 2247
231 Ga0157370_10146104 3300013104 Bacteria 2202
232 Ga0157370_10160855 3300013104 Bacteria 2089
233 Ga0157370_10286935 3300013104 Bacteria 1520
234 Ga0157369_10001239 3300013105 Bacteria 31838
235 Ga0157369_10003551 3300013105 Bacteria 18519
236 Ga0157369_10033166 3300013105 Bacteria 5677
237 Ga0157369_10193773 3300013105 Bacteria 2135
238 Ga0157369_10195655 3300013105 Bacteria 2123
239 Ga0157369_10342026 3300013105 Bacteria 1554
240 Ga0157374_10001108 3300013296 Bacteria 23187
241 Ga0157374_10451073 3300013296 Bacteria 1287
242 Ga0157378_10289166 3300013297 Bacteria 1582
243 Ga0163162_10044877 3300013306 Bacteria 4428
244 Ga0157372_10000409 3300013307 Bacteria 47021
245 Ga0157372_10031427 3300013307 Bacteria 5813
246 Ga0157372_10035008 3300013307 Bacteria 5525
247 Ga0157372_10068938 3300013307 Bacteria 3977
248 Ga0157372_10080269 3300013307 Bacteria 3690
249 Ga0157372_10100239 3300013307 Bacteria 3305
250 Ga0157372_10176247 3300013307 Bacteria 2474
251 Ga0157372_10478890 3300013307 Bacteria 1451
252 Ga0157375_10106522 3300013308 Bacteria 2895
253 Ga0157380_10000059 3300014326 Bacteria 62280
254 Ga0157380_10002264 3300014326 Bacteria 12942
255 Ga0182008_10083110 3300014497 Bacteria 1576
256 Ga0157379_10023085 3300014968 Bacteria 5516
257 Ga0157376_10176393 3300014969 Bacteria 1950
258 Ga0157376_10212168 3300014969 Bacteria 1788
259 Ga0206356_10112548 3300020070 Bacteria 1605
260 Ga0206356_10303627 3300020070 Bacteria 2994
261 Ga0206356_10601656 3300020070 Bacteria 5581
262 Ga0206351_10463088 3300020077 Bacteria 1645
263 Ga0206350_10365630 3300020080 Bacteria 1364
264 Ga0206353_11406144 3300020082 Bacteria 1778
265 Ga0206353_11805222 3300020082 Bacteria 1480
266 Ga0213874_10000607 3300021377 Bacteria 7219
267 Ga0213876_10004540 3300021384 Bacteria 7752
268 Ga0213876_10005317 3300021384 Bacteria 7087
269 Ga0213876_10007254 3300021384 Bacteria 6040
270 Ga0213875_10000199 3300021388 Bacteria 61479
271 Ga0213875_10015454 3300021388 Bacteria 3714
272 Ga0224712_10009509 3300022467 Bacteria 2933
273 Ga0207656_10002957 3300025321 Bacteria 5800
274 Ga0207656_10102513 3300025321 Bacteria 1313
275 Ga0207642_10000007 3300025899 Bacteria 226017
276 Ga0207642_10024114 3300025899 Bacteria 2442
277 Ga0207642_10040399 3300025899 Bacteria 2035
278 Ga0207642_10041359 3300025899 Bacteria 2017
279 Ga0207680_10010826 3300025903 Bacteria 4580
280 Ga0207685_10000011 3300025905 Bacteria 213430
281 Ga0207643_10147964 3300025908 Bacteria 1406
282 Ga0207705_10112357 3300025909 Bacteria 2014
283 Ga0207707_10018013 3300025912 Bacteria 6153
284 Ga0207707_10023261 3300025912 Bacteria 5421
285 Ga0207707_10068277 3300025912 Bacteria 3097
286 Ga0207707_10333648 3300025912 Bacteria 1308
287 Ga0207695_10268436 3300025913 Bacteria 1602
288 Ga0207693_10000677 3300025915 Bacteria 30611
289 Ga0207693_10001903 3300025915 Bacteria 18266
290 Ga0207693_10002622 3300025915 Bacteria 15629
291 Ga0207693_10258315 3300025915 Bacteria 1366
292 Ga0207663_10229404 3300025916 Bacteria 1356
293 Ga0207660_10027356 3300025917 Bacteria 3890
294 Ga0207660_10064247 3300025917 Bacteria 2649
295 Ga0207660_10065864 3300025917 Bacteria 2619
296 Ga0207662_10055643 3300025918 Bacteria 2361
297 Ga0207662_10124173 3300025918 Bacteria 1621
298 Ga0207657_10004630 3300025919 Bacteria 14532
299 Ga0207657_10006016 3300025919 Bacteria 12624
300 Ga0207657_10011291 3300025919 Bacteria 8871
301 Ga0207657_10036543 3300025919 Bacteria 4395
302 Ga0207657_10043544 3300025919 Bacteria 3953
303 Ga0207657_10058586 3300025919 Bacteria 3313
304 Ga0207649_10000063 3300025920 Bacteria 96360
305 Ga0207649_10077206 3300025920 Bacteria 2145
306 Ga0207652_10000483 3300025921 Bacteria 40881
307 Ga0207652_10040831 3300025921 Bacteria 3941
308 Ga0207652_10110598 3300025921 Bacteria 2436
309 Ga0207652_10125620 3300025921 Bacteria 2285
310 Ga0207652_10131242 3300025921 Bacteria 2235
311 Ga0207652_10169370 3300025921 Bacteria 1959
312 Ga0207652_10368781 3300025921 Bacteria 1296
313 Ga0207681_10279254 3300025923 Bacteria 1314
314 Ga0207694_10000004 3300025924 Bacteria 967075
315 Ga0207694_10051979 3300025924 Bacteria 3176
316 Ga0207650_10024224 3300025925 Bacteria 4312
317 Ga0207659_10000010 3300025926 Bacteria 286639
318 Ga0207659_10227067 3300025926 Bacteria 1504
319 Ga0207687_10000007 3300025927 Bacteria 604185
320 Ga0207687_10000247 3300025927 Bacteria 36785
321 Ga0207687_10004769 3300025927 Bacteria 9019
322 Ga0207687_10034822 3300025927 Bacteria 3422
323 Ga0207700_10000025 3300025928 Bacteria 147429
324 Ga0207700_10003610 3300025928 Bacteria 9015
325 Ga0207700_10021302 3300025928 Bacteria 4423
326 Ga0207664_10000060 3300025929 Bacteria 116764
327 Ga0207664_10020656 3300025929 Bacteria 4886
328 Ga0207664_10100265 3300025929 Bacteria 2391
329 Ga0207664_10123464 3300025929 Bacteria 2171
330 Ga0207644_10175626 3300025931 Bacteria 1676
331 Ga0207644_10238498 3300025931 Bacteria 1447
332 Ga0207690_10000117 3300025932 Bacteria 65570
333 Ga0207690_10001648 3300025932 Bacteria 13799
334 Ga0207690_10048283 3300025932 Bacteria 2829
335 Ga0207690_10050488 3300025932 Bacteria 2777
336 Ga0207690_10379369 3300025932 Bacteria 1123
337 Ga0207706_10000068 3300025933 Bacteria 105795
338 Ga0207706_10040857 3300025933 Bacteria 4111
339 Ga0207686_10000033 3300025934 Bacteria 143602
340 Ga0207686_10000428 3300025934 Bacteria 28669
341 Ga0207686_10254242 3300025934 Bacteria 1285
342 Ga0207709_10233345 3300025935 Bacteria 1334
343 Ga0207669_10000012 3300025937 Bacteria 138242
344 Ga0207704_10000146 3300025938 Bacteria 37894
345 Ga0207665_10047824 3300025939 Bacteria 2869
346 Ga0207665_10182238 3300025939 Bacteria 1521
347 Ga0207665_10209651 3300025939 Bacteria 1423
348 Ga0207691_10001039 3300025940 Bacteria 27535
349 Ga0207711_10000020 3300025941 Bacteria 363325
350 Ga0207661_10000492 3300025944 Bacteria 25390
351 Ga0207661_10008086 3300025944 Bacteria 7501
352 Ga0207661_10009162 3300025944 Bacteria 7097
353 Ga0207661_10009503 3300025944 Bacteria 6977
354 Ga0207661_10027150 3300025944 Bacteria 4370
355 Ga0207661_10029153 3300025944 Bacteria 4235
356 Ga0207661_10037197 3300025944 Bacteria 3805
357 Ga0207661_10188469 3300025944 Bacteria 1807
358 Ga0207679_10115103 3300025945 Bacteria 2130
359 Ga0207667_10150188 3300025949 Bacteria 2398
360 Ga0207712_10020852 3300025961 Bacteria 4298
361 Ga0207712_10070266 3300025961 Bacteria 2515
362 Ga0207712_10160173 3300025961 Bacteria 1748
363 Ga0207640_10000015 3300025981 Bacteria 215411
364 Ga0207640_10188590 3300025981 Bacteria 1552
365 Ga0207658_10025449 3300025986 Bacteria 4144
366 Ga0207677_10019123 3300026023 Bacteria 4129
367 Ga0207703_10000040 3300026035 Bacteria 168191
368 Ga0207703_10001815 3300026035 Bacteria 19030
369 Ga0207639_10005404 3300026041 Bacteria 8640
370 Ga0207639_10047900 3300026041 Bacteria 3233
371 Ga0207678_10012342 3300026067 Bacteria 7500
372 Ga0207678_10170749 3300026067 Bacteria 1857
373 Ga0207708_10109055 3300026075 Bacteria 2148
374 Ga0207702_10000607 3300026078 Bacteria 39638
375 Ga0207702_10017650 3300026078 Bacteria 5905
376 Ga0207702_10088937 3300026078 Bacteria 2700
377 Ga0207702_10185986 3300026078 Bacteria 1916
378 Ga0207702_10214928 3300026078 Bacteria 1789
379 Ga0207702_10389868 3300026078 Bacteria 1341
380 Ga0207641_10007104 3300026088 Bacteria 9351
381 Ga0207641_10275188 3300026088 Bacteria 1581
382 Ga0207648_10007855 3300026089 Bacteria 10409
383 Ga0207676_10000016 3300026095 Bacteria 311561
384 Ga0207674_10014502 3300026116 Bacteria 8702
385 Ga0207674_10116495 3300026116 Bacteria 2643
386 Ga0207675_100002174 3300026118 Bacteria 19495
387 Ga0207675_100096249 3300026118 Bacteria 2786
388 Ga0207675_100466808 3300026118 Bacteria 1253
389 Ga0207683_10022220 3300026121 Bacteria 5444
390 Ga0207683_10055774 3300026121 Bacteria 3465
391 Ga0207698_10000012 3300026142 Bacteria 260061
392 Ga0207698_10018265 3300026142 Bacteria 4774
393 Ga0209281_1000131 3300027111 Bacteria 190072
394 Ga0209281_1000502 3300027111 Bacteria 51906
395 Ga0209281_1004136 3300027111 Bacteria 4445
396 Ga0209281_1013085 3300027111 Bacteria 1801
397 Ga0207428_10020123 3300027907 Bacteria 5676
398 Ga0207428_10041096 3300027907 Bacteria 3745
399 Ga0207428_10055546 3300027907 Bacteria 3148
400 Ga0207428_10214585 3300027907 Bacteria 1445
401 Ga0268266_10000020 3300028379 Bacteria 527065
402 Ga0268266_10055957 3300028379 Bacteria 3392
403 Ga0268265_10000555 3300028380 Bacteria 38092
404 Ga0268264_10006502 3300028381 Bacteria 9842
405 Ga0265337_1000002 3300028556 Bacteria 139247
406 Ga0265326_10000007 3300028558 Bacteria 223057
407 Ga0265326_10000024 3300028558 Bacteria 112928
408 Ga0265319_1000116 3300028563 Bacteria 60553
409 Ga0265334_10000078 3300028573 Bacteria 70145
410 Ga0265318_10017106 3300028577 Bacteria 2982
411 Ga0265322_10000001 3300028654 Bacteria 543854
412 Ga0265336_10003815 3300028666 Bacteria 5812
413 Ga0265338_10016842 3300028800 Bacteria 7918
414 Ga0265338_10098748 3300028800 Bacteria 2387
415 Ga0265324_10000309 3300029957 Bacteria 35875
416 Ga0265324_10003299 3300029957 Bacteria 7754
417 Ga0265328_10001155 3300031239 Bacteria 12164
418 Ga0265320_10000002 3300031240 Bacteria 542875
419 Ga0265329_10014821 3300031242 Bacteria 2742
420 Ga0265331_10005257 3300031250 Bacteria 7837
421 Ga0265327_10000011 3300031251 Bacteria 543807
422 Ga0265314_10000058 3300031711 Bacteria 167476
423 Ga0307405_10119453 3300031731 Bacteria 1801
424 Ga0307413_10045649 3300031824 Bacteria 2599
425 Ga0307410_10054203 3300031852 Bacteria 2717
426 Ga0307407_10015214 3300031903 Bacteria 3794
427 Ga0307407_10119466 3300031903 Bacteria 1668
428 Ga0307409_100015871 3300031995 Bacteria 4962
429 Ga0307409_100033327 3300031995 Bacteria 3747
430 Ga0307409_100090481 3300031995 Bacteria 2505
431 Ga0307409_100172243 3300031995 Bacteria 1906
432 Ga0307409_100188824 3300031995 Bacteria 1832
433 Ga0307416_100010497 3300032002 Bacteria 6120
434 Ga0307411_10231509 3300032005 Bacteria 1440
435 Ga0307415_100000109 3300032126 Bacteria 35202
436 Ga0307415_100020877 3300032126 Bacteria 4010
437 Ga0307415_100121081 3300032126 Bacteria 1962
438 Ga0307415_100177466 3300032126 Bacteria 1668
439 Ga0307415_100357145 3300032126 Bacteria 1232
440 Ga0373956_0111322 3300035119 Bacteria 1275
441 Ga0373943_0000450 3300035170 Bacteria 17418
442 Ga0373946_0004358 3300035171 Bacteria 5066
443 Ga0373927_0022758 3300035695 Bacteria 4104
444 Ga0373933_0023238 3300035724 Bacteria 3540
445 Ga0373947_0002176 3300035725 Bacteria 11907
446 Ga0373937_0011597 3300036401 Bacteria 7740
447 Ga0373937_0168677 3300036401 Bacteria 2053
448 Ga0373937_0334799 3300036401 Bacteria 1433
449 Ga0373925_0003354 3300037068 Bacteria 12426
450 Ga0395899_0019528 3300037312 Bacteria 5147
451 Ga0395899_0040871 3300037312 Bacteria 3467
452 Ga0395899_0075426 3300037312 Bacteria 2463
453 Ga0395900_0017631 3300037418 Bacteria 7286
454 Ga0395900_0022240 3300037418 Bacteria 6487
455 Ga0395900_0068406 3300037418 Bacteria 3649
456 Ga0395900_0257804 3300037418 Bacteria 1743
457 Ga0395900_0452587 3300037418 Bacteria 1240
458 Ga0395900_0462972 3300037418 Bacteria 1222
459 Ga0395898_0002496 3300037466 Bacteria 21639
460 Ga0395898_0018707 3300037466 Bacteria 7062
461 Ga0395898_0031362 3300037466 Bacteria 5311
462 Ga0395898_0042172 3300037466 Bacteria 4504
463 Ga0395898_0053265 3300037466 Bacteria 3952
464 Ga0395898_0053394 3300037466 Bacteria 3947
465 Ga0395898_0075926 3300037466 Bacteria 3245
466 Ga0395898_0105247 3300037466 Bacteria 2705
467 Ga0395898_0535496 3300037466 Bacteria 1113
468 Ga0395905_0010080 3300037471 Bacteria 9210
469 Ga0395905_0071433 3300037471 Bacteria 3254
470 Ga0395905_0168995 3300037471 Bacteria 2054
471 Ga0395905_0172870 3300037471 Bacteria 2029
472 Ga0436364_0457216 3300037853 Bacteria 5287
473 Ga0436364_0527107 3300037853 Bacteria 72365
474 Ga0436364_1168514 3300037853 Bacteria 10945
475 Ga0395901_0014107 3300038443 Bacteria 8134
476 Ga0395901_0018370 3300038443 Bacteria 7139
477 Ga0395901_0026219 3300038443 Bacteria 5983
478 Ga0395901_0077464 3300038443 Bacteria 3470
479 Ga0395901_0095660 3300038443 Bacteria 3112
480 Ga0395901_0129283 3300038443 Bacteria 2654
481 Ga0395901_0148255 3300038443 Bacteria 2465
482 Ga0395901_0232358 3300038443 Bacteria 1925
483 Ga0395901_0254951 3300038443 Bacteria 1827
484 Ga0395901_0472338 3300038443 Bacteria 1280
485 Ga0395901_0577279 3300038443 Bacteria 1136
486 Ga0436365_0344023 3300039437 Bacteria 9173
487 Ga0436365_0494891 3300039437 Bacteria 2465
488 Ga0436365_0823300 3300039437 Bacteria 7865
489 Ga0436365_1182882 3300039437 Bacteria 1153
490 Ga0436365_1248745 3300039437 Bacteria 2014
491 Ga0436365_1574649 3300039437 Bacteria 17677
492 Ga0436363_0675171 3300039450 Bacteria 25439
493 Ga0451798_0735618 3300041458 Bacteria 1408
494 Ga0451833_0016179 3300041491 Bacteria 1621
495 Ga0451853_0128655 3300041512 Bacteria 2159
496 Ga0466965_0098246 3300044683 Bacteria 1495
497 Ga0466966_0087254 3300044684 Bacteria 1939
498 Ga0466961_0009994 3300044693 Bacteria 6047
499 Ga0466961_0019451 3300044693 Bacteria 4367
500 Ga0466961_0122770 3300044693 Bacteria 1630
501 Ga0466963_0000023 3300044694 Bacteria 52546
502 Ga0466963_0005370 3300044694 Bacteria 7500
503 Ga0466963_0025380 3300044694 Bacteria 3779
504 Ga0466963_0061539 3300044694 Bacteria 2510
505 Ga0466963_0073596 3300044694 Bacteria 2303
506 Ga0466963_0118600 3300044694 Bacteria 1820
507 Ga0466964_0018912 3300044706 Bacteria 2646
508 Ga0466964_0057309 3300044706 Bacteria 1612
509 Ga0466971_0001268 3300044719 Bacteria 10525
510 Ga0466971_0013005 3300044719 Bacteria 3651
511 Ga0466971_0124073 3300044719 Bacteria 1196
512 Ga0466968_0009508 3300044735 Bacteria 3740
513 Ga0466957_0000566 3300044842 Bacteria 18671
514 Ga0466957_0088050 3300044842 Bacteria 1942
515 Ga0466960_0024390 3300044901 Bacteria 2728
516 Ga0466960_0064375 3300044901 Bacteria 1808
517 Ga0466960_0095012 3300044901 Bacteria 1526
518 Ga0466959_0001055 3300045049 Bacteria 16508
519 Ga0466959_0052484 3300045049 Bacteria 2985
520 Ga0466959_0137177 3300045049 Bacteria 1731
521 Ga0466959_0156171 3300045049 Bacteria 1606
522 Ga0466958_0002895 3300045836 Bacteria 8759
523 Ga0466958_0006736 3300045836 Bacteria 6273
524 Ga0466958_0027368 3300045836 Bacteria 3375
525 Ga0466958_0080234 3300045836 Bacteria 2007
526 Ga0466967_0000027 3300045976 Bacteria 64265
527 Ga0466967_0004155 3300045976 Bacteria 9685
528 Ga0466967_0007145 3300045976 Bacteria 8015
529 Ga0466967_0010564 3300045976 Bacteria 6934
530 Ga0466967_0010911 3300045976 Bacteria 6847
531 Ga0466967_0013454 3300045976 Bacteria 6324
532 Ga0466967_0016955 3300045976 Bacteria 5762
533 Ga0466967_0027982 3300045976 Bacteria 4698
534 Ga0466967_0061995 3300045976 Bacteria 3318
535 Ga0466967_0064480 3300045976 Bacteria 3258
536 Ga0466967_0066201 3300045976 Bacteria 3218
537 Ga0466967_0180119 3300045976 Bacteria 1993
538 Ga0466967_0210347 3300045976 Bacteria 1844
539 Ga0466967_0211313 3300045976 Bacteria 1840
540 Ga0466967_0226742 3300045976 Bacteria 1778
541 Ga0466967_0506817 3300045976 Bacteria 1185
542 Ga0466967_0624440 3300045976 Bacteria 1064
543 Ga0495592_0000036 3300046454 Bacteria 125461
544 Ga0495603_0000097 3300046455 Bacteria 40321
545 Ga0495603_0007864 3300046455 Bacteria 6429
546 Ga0495603_0012162 3300046455 Bacteria 5212
547 Ga0495629_0009397 3300046459 Bacteria 7153
548 Ga0495629_0024338 3300046459 Bacteria 4310
549 Ga0495629_0081278 3300046459 Bacteria 2262
550 Ga0495638_0065726 3300046460 Bacteria 2231
551 Ga0495641_0000003 3300046461 Bacteria 242879
552 Ga0495651_0003583 3300046462 Bacteria 11916
553 Ga0495651_0117342 3300046462 Bacteria 1959
554 Ga0495653_0038949 3300046463 Bacteria 3727
555 Ga0495653_0073344 3300046463 Bacteria 2554
556 Ga0495653_0107237 3300046463 Bacteria 2013
557 Ga0495653_0135719 3300046463 Bacteria 1736
558 Ga0495580_0200013 3300046472 Bacteria 1377
559 Ga0495582_0000029 3300046473 Bacteria 77919
560 Ga0495582_0000066 3300046473 Bacteria 53920
561 Ga0495582_0201094 3300046473 Bacteria 1138
562 Ga0495639_0001185 3300046475 Bacteria 11777
563 Ga0495662_0000650 3300046476 Bacteria 16301
564 Ga0495662_0000694 3300046476 Bacteria 15948
565 Ga0495662_0034097 3300046476 Bacteria 2458
566 Ga0495664_0000007 3300046477 Bacteria 386710
567 Ga0495594_0000003 3300046499 Bacteria 199267
568 Ga0495594_0076609 3300046499 Bacteria 1865
569 Ga0495596_0031416 3300046500 Bacteria 2121
570 Ga0495608_0000031 3300046511 Bacteria 145255
571 Ga0495608_0010826 3300046511 Bacteria 6357
572 Ga0495608_0017412 3300046511 Bacteria 4969
573 Ga0495608_0124169 3300046511 Bacteria 1654
574 Ga0495610_0028993 3300046512 Bacteria 2921
575 Ga0495620_0000210 3300046515 Bacteria 44013
576 Ga0495620_0099892 3300046515 Bacteria 1158
577 Ga0495628_0000144 3300046516 Bacteria 61254
578 Ga0495628_0002459 3300046516 Bacteria 16708
579 Ga0495628_0010479 3300046516 Bacteria 7873
580 Ga0495628_0017322 3300046516 Bacteria 5999
581 Ga0495628_0268967 3300046516 Bacteria 1268
582 Ga0495630_0005219 3300046517 Bacteria 9153
583 Ga0495630_0018710 3300046517 Bacteria 5089
584 Ga0495630_0042919 3300046517 Bacteria 3377
585 Ga0495630_0098599 3300046517 Bacteria 2210
586 Ga0495644_0007172 3300046523 Bacteria 4306
587 Ga0495652_0018945 3300046529 Bacteria 6133
588 Ga0495652_0049582 3300046529 Bacteria 3594
589 Ga0495652_0050844 3300046529 Bacteria 3542
590 Ga0495665_0000252 3300046531 Bacteria 26953
591 Ga0495640_0012743 3300046533 Bacteria 6419
592 Ga0495640_0051398 3300046533 Bacteria 2833
593 Ga0495640_0104286 3300046533 Bacteria 1858
594 Ga0495586_0007791 3300046535 Bacteria 5710
595 Ga0495586_0064936 3300046535 Bacteria 1989
596 Ga0495587_0005378 3300046536 Bacteria 8376
597 Ga0495587_0023376 3300046536 Bacteria 3798
598 Ga0495587_0033470 3300046536 Bacteria 3103
599 Ga0495645_0004644 3300046543 Bacteria 9373
600 Ga0495645_0028397 3300046543 Bacteria 4065
601 Ga0495622_0000714 3300046557 Bacteria 18760
602 Ga0495667_0000032 3300046559 Bacteria 143493
603 Ga0495667_0000751 3300046559 Bacteria 20850
604 Ga0495667_0006812 3300046559 Bacteria 7759
605 Ga0495667_0014712 3300046559 Bacteria 5288
606 Ga0495667_0037733 3300046559 Bacteria 3220
607 Ga0495667_0085538 3300046559 Bacteria 2047
608 Ga0495656_0000241 3300046615 Bacteria 19365
609 Ga0495634_0027184 3300046642 Bacteria 3982
610 Ga0495634_0031253 3300046642 Bacteria 3668
611 Ga0495634_0053650 3300046642 Bacteria 2700
612 Ga0495634_0088730 3300046642 Bacteria 2011
613 Ga0495635_0000016 3300046663 Bacteria 214088
614 Ga0495635_0008147 3300046663 Bacteria 7320
615 Ga0495635_0047428 3300046663 Bacteria 2962
616 Ga0495635_0082131 3300046663 Bacteria 2205
617 Ga0495657_0000024 3300046675 Bacteria 145255
618 Ga0495657_0009618 3300046675 Bacteria 7321
619 Ga0495657_0053616 3300046675 Bacteria 2698
620 Ga0495657_0124448 3300046675 Bacteria 1621
621 Ga0495599_0048369 3300046678 Bacteria 2666
622 Ga0495623_0132179 3300046679 Bacteria 1493
623 Ga0495646_0013457 3300046680 Bacteria 5200
624 Ga0495646_0076361 3300046680 Bacteria 1962
625 Ga0495647_0000025 3300046681 Bacteria 65184
626 Ga0495658_0000026 3300046683 Bacteria 77681
627 Ga0495658_0005678 3300046683 Bacteria 6130
628 Ga0495669_0000260 3300046684 Bacteria 30549
629 Ga0495613_0000073 3300046689 Bacteria 98688
630 Ga0495613_0000152 3300046689 Bacteria 68384
631 Ga0495613_0004101 3300046689 Bacteria 10892
632 Ga0495613_0059131 3300046689 Bacteria 2810
633 Ga0495624_0000009 3300046690 Bacteria 145026
634 Ga0495624_0006961 3300046690 Bacteria 7976
635 Ga0495600_0015949 3300046809 Bacteria 4760
636 Ga0495600_0018385 3300046809 Bacteria 4452
637 Ga0495600_0041962 3300046809 Bacteria 2982
638 Ga0495600_0047287 3300046809 Bacteria 2806
639 Ga0495581_0002805 3300047315 Bacteria 9949
640 Ga0495581_0114745 3300047315 Bacteria 1567
641 Ga0495604_0000019 3300047317 Bacteria 175064
642 Ga0495604_0000985 3300047317 Bacteria 23770
643 Ga0495604_0009430 3300047317 Bacteria 7719
644 Ga0495604_0041144 3300047317 Bacteria 3625
645 Ga0495674_0008594 3300047319 Bacteria 9721
646 Ga0495674_0010971 3300047319 Bacteria 8560
647 Ga0495674_0165465 3300047319 Bacteria 1848
648 Ga0495674_0186670 3300047319 Bacteria 1725
649 Ga0495672_0003817 3300047320 Bacteria 12682
650 Ga0495676_0002041 3300047321 Bacteria 17764
651 Ga0495680_0000317 3300047322 Bacteria 53949
652 Ga0495680_0000647 3300047322 Bacteria 39030
653 Ga0495680_0004252 3300047322 Bacteria 13751
654 Ga0495680_0005066 3300047322 Bacteria 12439
655 Ga0495680_0012179 3300047322 Bacteria 7587
656 Ga0495680_0034820 3300047322 Bacteria 4062
657 Ga0495675_0000428 3300047444 Bacteria 28143
658 Ga0495685_034437 3300047447 Bacteria 1740
659 Ga0495684_0002738 3300047471 Bacteria 13936
660 Ga0495684_0006287 3300047471 Bacteria 9231
661 Ga0495684_0053340 3300047471 Bacteria 3085
662 Ga0495593_0001836 3300047673 Bacteria 12644
663 Ga0495602_0001790 3300048088 Bacteria 21477
664 Ga0495602_0059786 3300048088 Bacteria 3324
665 Ga0495614_0019808 3300048089 Bacteria 2911
666 Ga0496100_0000018 3300048903 Bacteria 162451
667 Ga0496100_0016785 3300048903 Bacteria 4306
668 Ga0496100_0037106 3300048903 Bacteria 3078
669 Ga0496101_0000221 3300048904 Bacteria 42499
670 Ga0496101_0004996 3300048904 Bacteria 8422
671 Ga0496101_0009188 3300048904 Bacteria 6487
672 Ga0496101_0024859 3300048904 Bacteria 4151
673 Ga0496101_0088697 3300048904 Bacteria 2298
674 Ga0496101_0094853 3300048904 Bacteria 2225
675 Ga0496102_0000146 3300048905 Bacteria 96361
676 Ga0496102_0008457 3300048905 Bacteria 8823
677 Ga0496102_0299530 3300048905 Bacteria 1515
678 Ga0496103_0000008 3300048906 Bacteria 340474
679 Ga0496103_0006820 3300048906 Bacteria 6815
680 Ga0496103_0112031 3300048906 Bacteria 1734
681 Ga0496104_0000001 3300048907 Bacteria 711867
682 Ga0496104_0000004 3300048907 Bacteria 641830
683 Ga0496104_0004466 3300048907 Bacteria 12184
684 Ga0496104_0126464 3300048907 Bacteria 2454
685 Ga0496104_0538909 3300048907 Bacteria 1078
686 Ga0496105_0000001 3300048908 Bacteria 1328178
687 Ga0496105_0001569 3300048908 Bacteria 16195
688 Ga0496105_0014782 3300048908 Bacteria 6214
689 Ga0496105_0019941 3300048908 Bacteria 5412
690 Ga0496105_0144081 3300048908 Bacteria 1960
691 Ga0496106_0000018 3300048909 Bacteria 175028
692 Ga0496106_0000149 3300048909 Bacteria 51656
693 Ga0496106_0004661 3300048909 Bacteria 10163
694 Ga0496106_0047208 3300048909 Bacteria 3240
695 Ga0496106_0130396 3300048909 Bacteria 1971
696 Ga0496107_0000006 3300048910 Bacteria 258746
697 Ga0496107_0001394 3300048910 Bacteria 14913
698 Ga0496107_0005792 3300048910 Bacteria 8456
699 Ga0496107_0028637 3300048910 Bacteria 3959
700 Ga0496107_0037613 3300048910 Bacteria 3473
701 Ga0496107_0043697 3300048910 Bacteria 3220
702 Ga0496108_0036583 3300048911 Bacteria 4085
703 Ga0496108_0059129 3300048911 Bacteria 3223
704 Ga0496108_0099543 3300048911 Bacteria 2478
705 Ga0496109_0000028 3300048912 Bacteria 168138
706 Ga0496109_0005575 3300048912 Bacteria 10537
707 Ga0496109_0007622 3300048912 Bacteria 9177
708 Ga0496109_0023298 3300048912 Bacteria 5494
709 Ga0496109_0222627 3300048912 Bacteria 1774
710 Ga0496110_0002884 3300048913 Bacteria 12998
711 Ga0496110_0006813 3300048913 Bacteria 9086
712 Ga0496110_0046655 3300048913 Bacteria 3791
713 Ga0496110_0096919 3300048913 Bacteria 2643
714 Ga0496110_0151465 3300048913 Bacteria 2100
715 Ga0496110_0321171 3300048913 Bacteria 1410
716 Ga0496111_0000021 3300048914 Bacteria 67813
717 Ga0496111_0003320 3300048914 Bacteria 9950
718 Ga0496111_0011955 3300048914 Bacteria 5867
719 Ga0496111_0014669 3300048914 Bacteria 5358
720 Ga0496111_0096713 3300048914 Bacteria 2167
721 Ga0496111_0183989 3300048914 Bacteria 1553
722 Ga0496112_0000003 3300048915 Bacteria 660147
723 Ga0496112_0001614 3300048915 Bacteria 17446
724 Ga0496112_0109544 3300048915 Bacteria 2732
725 Ga0496112_0212348 3300048915 Bacteria 1892
726 Ga0496112_0253016 3300048915 Bacteria 1712
727 Ga0496112_0301760 3300048915 Bacteria 1547
728 Ga0496113_0000029 3300048916 Bacteria 61873
729 Ga0496113_0020403 3300048916 Bacteria 4658
730 Ga0496113_0062447 3300048916 Bacteria 2813
731 Ga0496113_0072702 3300048916 Bacteria 2618
732 Ga0496113_0089276 3300048916 Bacteria 2372
733 Ga0496114_0000014 3300048917 Bacteria 297902
734 Ga0496114_0001831 3300048917 Bacteria 16108
735 Ga0496114_0026518 3300048917 Bacteria 4744
736 Ga0496114_0148873 3300048917 Bacteria 2030
737 Ga0496114_0156407 3300048917 Bacteria 1979
738 Ga0496115_0000003 3300048918 Bacteria 354994
739 Ga0496115_0000581 3300048918 Bacteria 28187
740 Ga0496115_0001725 3300048918 Bacteria 15676
741 Ga0496115_0002312 3300048918 Bacteria 13653
742 Ga0496115_0005472 3300048918 Bacteria 9241
743 Ga0496115_0049967 3300048918 Bacteria 3349
744 Ga0496115_0056458 3300048918 Bacteria 3156
745 Ga0496115_0123722 3300048918 Bacteria 2129
746 Ga0496117_0020230 3300048920 Bacteria 5433
747 Ga0496118_0005186 3300048921 Bacteria 14915
748 Ga0496120_0020129 3300048923 Bacteria 4250
749 Ga0496121_0052505 3300048924 Bacteria 3423
750 Ga0496121_0101167 3300048924 Bacteria 2223
751 Ga0496122_0033730 3300048925 Bacteria 4204
752 Ga0496126_0000108 3300048929 Bacteria 197529
753 Ga0496126_0049736 3300048929 Bacteria 3825
754 Ga0501031_0000434 3300049568 Bacteria 24055
755 Ga0501031_0029713 3300049568 Bacteria 3566
756 Ga0501031_0214164 3300049568 Bacteria 1255
757 Ga0501032_0000899 3300049569 Bacteria 24104
758 Ga0501032_0022440 3300049569 Bacteria 4374
759 Ga0501033_0001140 3300049570 Bacteria 24003
760 Ga0501034_0124121 3300049571 Bacteria 2567
761 Ga0501036_0029623 3300049572 Bacteria 4623
762 Ga0501036_0136395 3300049572 Bacteria 2071
763 Ga0501037_0000774 3300049573 Bacteria 24049
764 Ga0501037_0026648 3300049573 Bacteria 4271
765 Ga0501037_0301482 3300049573 Bacteria 1113
766 Ga0501038_0001146 3300049574 Bacteria 24003
767 Ga0501038_0037491 3300049574 Bacteria 4250
768 Ga0501039_0098643 3300049575 Bacteria 2279
769 Ga0501039_0098657 3300049575 Bacteria 2279
770 Ga0501039_0161109 3300049575 Bacteria 1763
771 Ga0501040_0001638 3300049576 Bacteria 14279
772 Ga0501041_0177508 3300049577 Bacteria 1333
773 Ga0501042_0037517 3300049578 Bacteria 3439
774 Ga0501042_0080269 3300049578 Bacteria 2337
775 Ga0501042_0112800 3300049578 Bacteria 1957
776 Ga0501043_0001082 3300049579 Bacteria 23968
777 Ga0501043_0003201 3300049579 Bacteria 13542
778 Ga0501046_0000447 3300049580 Bacteria 41432
779 Ga0501046_0044376 3300049580 Bacteria 3536
780 Ga0501046_0152886 3300049580 Bacteria 1740
781 Ga0501047_0001335 3300049581 Bacteria 24206
782 Ga0501047_0007455 3300049581 Bacteria 10299
783 Ga0501047_0038927 3300049581 Bacteria 4599
784 Ga0501048_0000734 3300049582 Bacteria 24021
785 Ga0501048_0081483 3300049582 Bacteria 2283
786 Ga0501067_0000348 3300049583 Bacteria 25209
787 Ga0501067_0012878 3300049583 Bacteria 4632
788 Ga0501067_0052936 3300049583 Bacteria 2249
789 Ga0501067_0059253 3300049583 Bacteria 2119
790 Ga0501067_0069396 3300049583 Bacteria 1951
791 Ga0501069_0007590 3300049585 Bacteria 5693
792 Ga0501069_0029114 3300049585 Bacteria 3030
793 Ga0501069_0038721 3300049585 Bacteria 2632
794 Ga0501069_0078624 3300049585 Bacteria 1855
795 Ga0501070_0001137 3300049586 Bacteria 23887
796 Ga0501070_0158987 3300049586 Bacteria 1863
797 Ga0501071_0008414 3300049587 Bacteria 6821
798 Ga0501071_0070366 3300049587 Bacteria 2548
799 Ga0501071_0104050 3300049587 Bacteria 2095
800 Ga0501071_0126080 3300049587 Bacteria 1900
801 Ga0501072_0001313 3300049588 Bacteria 18633
802 Ga0501072_0108814 3300049588 Bacteria 2205
803 Ga0501072_0134549 3300049588 Bacteria 1971
804 Ga0501072_0148604 3300049588 Bacteria 1868
805 Ga0501073_0038032 3300049589 Bacteria 3415
806 Ga0501073_0049364 3300049589 Bacteria 2951
807 Ga0501074_0019804 3300049590 Bacteria 4887
808 Ga0501074_0030021 3300049590 Bacteria 3939
809 Ga0501074_0038770 3300049590 Bacteria 3451
810 Ga0501074_0146388 3300049590 Bacteria 1689
811 Ga0501074_0147057 3300049590 Bacteria 1685
812 Ga0501075_0000392 3300049591 Bacteria 25374
813 Ga0501075_0019774 3300049591 Bacteria 4888
814 Ga0501075_0068979 3300049591 Bacteria 2672
815 Ga0501075_0181602 3300049591 Bacteria 1605
816 Ga0501075_0290189 3300049591 Bacteria 1246
817 Ga0501076_0001177 3300049592 Bacteria 17330
818 Ga0501076_0022538 3300049592 Bacteria 4840
819 Ga0501076_0142235 3300049592 Bacteria 1950
820 Ga0501076_0233089 3300049592 Bacteria 1505
821 Ga0501077_0041582 3300049593 Bacteria 2925
822 Ga0501077_0082185 3300049593 Bacteria 2041
823 Ga0501077_0083695 3300049593 Bacteria 2022
824 Ga0501079_0008992 3300049741 Bacteria 7564
825 Ga0501079_0017085 3300049741 Bacteria 5541
826 Ga0501079_0048229 3300049741 Bacteria 3287
827 Ga0501079_0185868 3300049741 Bacteria 1622
828 Ga0501080_0050087 3300049742 Bacteria 3888
829 Ga0501080_0060002 3300049742 Bacteria 3540
830 Ga0501080_0153800 3300049742 Bacteria 2125
831 Ga0501080_0245961 3300049742 Bacteria 1631
832 Ga0501081_0003995 3300049743 Bacteria 9452
833 Ga0501081_0054341 3300049743 Bacteria 2767
834 Ga0501083_0008535 3300049744 Bacteria 7233
835 Ga0501083_0023660 3300049744 Bacteria 4259
836 Ga0501035_0002398 3300049822 Bacteria 18377
837 Ga0501044_0003241 3300049823 Bacteria 18299
838 Ga0501044_0036460 3300049823 Bacteria 5145
839 Ga0501044_0049171 3300049823 Bacteria 4353
840 Ga0501044_0167828 3300049823 Bacteria 2168
841 Ga0501045_0013972 3300049824 Bacteria 5683
842 Ga0501045_0060787 3300049824 Bacteria 2770
843 Ga0501045_0214013 3300049824 Bacteria 1435
844 nmdc:mga05p37_105614_c1 3300050507 Bacteria 3464
845 nmdc:mga05p37_144872_c1 3300050507 Bacteria 2909
846 nmdc:mga05p37_170780_c1 3300050507 Bacteria 2652
847 nmdc:mga05p37_71033_c2 3300050507 Bacteria 4064
848 nmdc:mga09592_69165_c1 3300050508 Bacteria 2995
849 nmdc:mga0qj67_1444_c1 3300050509 Bacteria 16634
850 nmdc:mga06r32_13083_c1 3300050510 Bacteria 7510
851 nmdc:mga06r32_2689_c1 3300050510 Bacteria 15905
852 nmdc:mga08y16_143200_c1 3300050511 Bacteria 2485
853 nmdc:mga08y16_26286_c1 3300050511 Bacteria 6137
854 nmdc:mga08y16_9951_c1 3300050511 Bacteria 9982
855 nmdc:mga0n895_128747_c1 3300050512 Bacteria 2556
856 nmdc:mga0n895_47389_c1 3300050512 Bacteria 4202
857 nmdc:mga08x19_101069_c1 3300050514 Bacteria 1913
858 nmdc:mga0a205_1916_c1 3300050515 Bacteria 18075
859 nmdc:mga0a205_38052_c1 3300050515 Bacteria 4627
860 nmdc:mga0a205_87386_c1 3300050515 Bacteria 3012
861 Ga0495601_0002204 3300053077 Bacteria 10967
862 Ga0495601_0108345 3300053077 Bacteria 1797
863 Ga0495601_0139636 3300053077 Bacteria 1580
864 Ga0495612_0001555 3300053078 Bacteria 9456
865 Ga0495612_0015066 3300053078 Bacteria 3101
866 Ga0495655_0000001 3300053083 Bacteria 419518
867 Ga0495655_0001262 3300053083 Bacteria 3908
868 Ga0495655_0005518 3300053083 Bacteria 2240
869 Ga0495595_0000014 3300053084 Bacteria 145255
870 Ga0495595_0002816 3300053084 Bacteria 6842
871 Ga0495619_0000055 3300053085 Bacteria 95570
872 Ga0495619_0000147 3300053085 Bacteria 51947
873 Ga0495619_0000534 3300053085 Bacteria 25127
874 Ga0495619_0003046 3300053085 Bacteria 10884
875 Ga0495619_0058131 3300053085 Bacteria 2566
876 Ga0495619_0063950 3300053085 Bacteria 2452
877 Ga0495619_0146912 3300053085 Bacteria 1626
878 Ga0495619_0280505 3300053085 Bacteria 1154
879 Ga0500556_0000593 3300053104 Bacteria 23858
880 Ga0500614_000026 3300053123 Bacteria 35584
881 Ga0500628_000017 3300053129 Bacteria 90481
882 Ga0500616_0004992 3300053153 Bacteria 9198
883 Ga0501084_0007832 3300054114 Bacteria 8791
884 Ga0501084_0285733 3300054114 Bacteria 1393
885 Ga0501082_0039672 3300060353 Bacteria 4062
886 Ga0501082_0048052 3300060353 Bacteria 3677
887 Ga0501082_0051874 3300060353 Bacteria 3535
888 Ga0501082_0235564 3300060353 Bacteria 1593
889 Ga0466962_0003841 3300061719 Bacteria 7179
890 Ga0466962_0004523 3300061719 Bacteria 6670
891 Ga0466962_0038804 3300061719 Bacteria 2281
892 Ga0530510_0003223 3300061734 Bacteria 11205
893 Ga0530510_0013546 3300061734 Bacteria 5736
894 Ga0530510_0069871 3300061734 Bacteria 2548
895 Ga0530510_0099208 3300061734 Bacteria 2129
896 Ga0530510_0179866 3300061734 Bacteria 1568
897 8007378304 8007375930 Bacteria 4080554
898 nmdc:mga0qj67_37429_c1
899 LJQas_1008039
900 JGI24738J21930_10008605
901 JGI25406J46586_10014128
902 JGI25406J46586_10016276
903 JGI25407J50210_10005129
904 JGI25407J50210_10013832
905 JGI25407J50210_10014324
906 Ga0070658_10064661
907 Ga0070658_10245389
908 Ga0070683_100001429
909 Ga0070683_100006385
910 Ga0070683_100008554
911 Ga0070683_100030210
912 Ga0070670_100090285
913 Ga0068869_100066940
914 Ga0070666_10029341
915 Ga0070680_100081060
916 Ga0070680_100101413
917 Ga0070680_100143896
918 Ga0070680_100301560
919 Ga0070682_100000045
920 Ga0070682_100002116
921 Ga0070682_100014100
922 Ga0070682_100063203
923 Ga0070682_100080129
924 Ga0070682_100080676
925 Ga0070682_100212589
926 Ga0068868_100005956
927 Ga0068868_100025245
928 Ga0070660_100001878
929 Ga0070660_100002874
930 Ga0070660_100044156
931 Ga0070661_100000023
932 Ga0070661_100029830
933 Ga0070661_100036846
934 Ga0070692_10016243
935 Ga0070668_100015307
936 Ga0070668_100116183
937 Ga0070675_100000053
938 Ga0070675_100195855
939 Ga0070674_100000082
940 Ga0070674_100070535
941 Ga0070674_100158725
942 Ga0070688_100000300
943 Ga0070688_100000630
944 Ga0070688_100060783
945 Ga0070659_100006539
946 Ga0070659_100024338
947 Ga0070659_100037986
948 Ga0070667_100000695
949 Ga0070713_100000009
950 Ga0070713_100160693
951 Ga0070711_100092307
952 Ga0070711_100247965
953 Ga0070705_100054509
954 Ga0070700_100080988
955 Ga0070700_100272372
956 Ga0070663_100023142
957 Ga0070678_100007927
958 Ga0070662_100000016
959 Ga0070662_100068086
960 Ga0070662_100093451
961 Ga0070681_10010625
962 Ga0070681_10013721
963 Ga0070681_10019078
964 Ga0070681_10028864
965 Ga0070681_10056580
966 Ga0070681_10105644
967 Ga0068867_100006031
968 Ga0068867_100054845
969 Ga0070685_10000282
970 Ga0070685_10000320
971 Ga0070707_100229613
972 Ga0070679_100000312
973 Ga0070679_100014166
974 Ga0070679_100031669
975 Ga0070679_100033291
976 Ga0070679_100068574
977 Ga0070684_100011922
978 Ga0070684_100023464
979 Ga0070684_100024068
980 Ga0070684_100024149
981 Ga0070684_100025949
982 Ga0070684_100038133
983 Ga0070684_100091076
984 Ga0070684_100138659
985 Ga0070697_100097586
986 Ga0068853_100002766
987 Ga0070686_100242430
988 Ga0070693_100006705
989 Ga0070693_100169542
990 Ga0070665_100000244
991 Ga0070665_100005026
992 Ga0070665_100017879
993 Ga0070665_100223482
994 Ga0070665_100279050
995 Ga0070704_100028529
996 Ga0070704_100148947
997 Ga0068855_100046966
998 Ga0068855_100204032
999 Ga0070664_100128239
1000 Ga0070664_100272162
1001 Ga0068857_100058998
1002 Ga0068854_100000031
1003 Ga0068856_100001194
1004 Ga0068856_100026366
1005 Ga0068856_100043149
1006 Ga0068856_100173482
1007 Ga0068856_100184340
1008 Ga0070702_100010129
1009 Ga0068852_100000296
1010 Ga0068852_100006184
1011 Ga0068852_100044814
1012 Ga0068852_100239073
1013 Ga0068864_100000045
1014 Ga0068864_100058920
1015 Ga0068866_10000001
1016 Ga0068866_10005928
1017 Ga0068861_100002566
1018 Ga0068851_10000656
1019 Ga0068851_10019515
1020 Ga0068863_100000021
1021 Ga0068863_100024278
1022 Ga0068863_100339780
1023 Ga0068858_100000267
1024 Ga0068858_100001207
1025 Ga0068860_100130464
1026 Ga0068862_100008832
1027 Ga0081455_10003252
1028 Ga0081455_10027049
1029 Ga0081455_10028011
1030 Ga0081455_10055109
1031 Ga0081455_10057361
1032 Ga0081455_10149621
1033 Ga0081538_10000219
1034 Ga0081538_10000241
1035 Ga0081538_10002025
1036 Ga0081538_10003073
1037 Ga0081538_10003315
1038 Ga0081538_10004594
1039 Ga0081538_10011818
1040 Ga0081538_10016142
1041 Ga0081538_10021887
1042 Ga0081538_10046933
1043 Ga0081538_10047697
1044 Ga0081538_10077193
1045 Ga0081540_1002225
1046 Ga0081539_10001668
1047 Ga0081539_10001929
1048 Ga0081539_10002491
1049 Ga0081539_10009624
1050 Ga0081539_10017082
1051 Ga0075364_10188149
1052 Ga0070715_10000001
1053 Ga0070716_100135735
1054 Ga0070716_100217633
1055 Ga0070716_100224153
1056 Ga0070716_100263271
1057 Ga0070712_100001071
1058 Ga0070712_100003981
1059 Ga0070712_100056677
1060 Ga0070712_100186842
1061 Ga0070712_100343399
1062 Ga0097621_100365845
1063 Ga0075428_100023575
1064 Ga0075428_100047387
1065 Ga0075430_100000824
1066 Ga0075431_100000747
1067 Ga0075431_100002897
1068 Ga0075431_100230163
1069 Ga0075431_100257275
1070 Ga0075433_10001485
1071 Ga0075433_10015865
1072 Ga0075433_10018515
1073 Ga0075434_100034518
1074 Ga0075434_100137545
1075 Ga0068865_100000104
1076 Ga0068865_100034775
1077 Ga0075436_100228362
1078 Ga0079104_1000337
1079 Ga0079104_1005865
1080 Ga0079104_1028242
1081 Ga0105240_10031253
1082 Ga0105240_10324663
1083 Ga0111539_10044466
1084 Ga0111539_10065301
1085 Ga0111539_10078234
1086 Ga0111539_10102572
1087 Ga0105245_10000236
1088 Ga0105245_10000545
1089 Ga0105245_10002692
1090 Ga0105245_10006569
1091 Ga0105245_10042529
1092 Ga0105245_10108988
1093 Ga0105245_10240515
1094 Ga0105245_10247711
1095 Ga0105245_10282589
1096 Ga0105247_10054722
1097 Ga0105247_10067293
1098 Ga0114129_10014103
1099 Ga0114129_10124004
1100 Ga0114129_10215708
1101 Ga0114129_10411207
1102 Ga0114129_10765283
1103 Ga0105243_10014354
1104 Ga0105243_10046579
1105 Ga0105243_10086529
1106 Ga0105243_10297599
1107 Ga0105242_10000194
1108 Ga0105242_10000819
1109 Ga0105242_10132675
1110 Ga0105242_10193474
1111 Ga0105238_10000011
1112 Ga0105238_10040063
1113 Ga0105238_10081390
1114 Ga0105249_10148229
1115 Ga0105249_10183328
1116 Ga0105239_10130675
1117 Ga0105239_10351710
1118 Ga0105239_10374451
1119 Ga0105239_10392819
1120 Ga0157342_1005311
1121 Ga0157373_10093096
1122 Ga0157371_10005434
1123 Ga0157371_10049109
1124 Ga0157371_10050500
1125 Ga0157370_10014865
1126 Ga0157370_10069784
1127 Ga0157370_10140814
1128 Ga0157370_10146104
1129 Ga0157370_10160855
1130 Ga0157370_10286935
1131 Ga0157369_10001239
1132 Ga0157369_10003551
1133 Ga0157369_10033166
1134 Ga0157369_10193773
1135 Ga0157369_10195655
1136 Ga0157369_10342026
1137 Ga0157374_10001108
1138 Ga0157374_10451073
1139 Ga0157378_10289166
1140 Ga0163162_10044877
1141 Ga0157372_10000409
1142 Ga0157372_10031427
1143 Ga0157372_10035008
1144 Ga0157372_10068938
1145 Ga0157372_10080269
1146 Ga0157372_10100239
1147 Ga0157372_10176247
1148 Ga0157372_10478890
1149 Ga0157375_10106522
1150 Ga0157380_10000059
1151 Ga0157380_10002264
1152 Ga0182008_10083110
1153 Ga0157379_10023085
1154 Ga0157376_10176393
1155 Ga0157376_10212168
1156 Ga0206356_10112548
1157 Ga0206356_10303627
1158 Ga0206356_10601656
1159 Ga0206351_10463088
1160 Ga0206350_10365630
1161 Ga0206353_11406144
1162 Ga0206353_11805222
1163 Ga0213874_10000607
1164 Ga0213876_10004540
1165 Ga0213876_10005317
1166 Ga0213876_10007254
1167 Ga0213875_10000199
1168 Ga0213875_10015454
1169 Ga0224712_10009509
1170 Ga0207656_10002957
1171 Ga0207656_10102513
1172 Ga0207642_10000007
1173 Ga0207642_10024114
1174 Ga0207642_10040399
1175 Ga0207642_10041359
1176 Ga0207680_10010826
1177 Ga0207685_10000011
1178 Ga0207643_10147964
1179 Ga0207705_10112357
1180 Ga0207707_10018013
1181 Ga0207707_10023261
1182 Ga0207707_10068277
1183 Ga0207707_10333648
1184 Ga0207695_10268436
1185 Ga0207693_10000677
1186 Ga0207693_10001903
1187 Ga0207693_10002622
1188 Ga0207693_10258315
1189 Ga0207663_10229404
1190 Ga0207660_10027356
1191 Ga0207660_10064247
1192 Ga0207660_10065864
1193 Ga0207662_10055643
1194 Ga0207662_10124173
1195 Ga0207657_10004630
1196 Ga0207657_10006016
1197 Ga0207657_10011291
1198 Ga0207657_10036543
1199 Ga0207657_10043544
1200 Ga0207657_10058586
1201 Ga0207649_10000063
1202 Ga0207649_10077206
1203 Ga0207652_10000483
1204 Ga0207652_10040831
1205 Ga0207652_10110598
1206 Ga0207652_10125620
1207 Ga0207652_10131242
1208 Ga0207652_10169370
1209 Ga0207652_10368781
1210 Ga0207681_10279254
1211 Ga0207694_10000004
1212 Ga0207694_10051979
1213 Ga0207650_10024224
1214 Ga0207659_10000010
1215 Ga0207659_10227067
1216 Ga0207687_10000007
1217 Ga0207687_10000247
1218 Ga0207687_10004769
1219 Ga0207687_10034822
1220 Ga0207700_10000025
1221 Ga0207700_10003610
1222 Ga0207700_10021302
1223 Ga0207664_10000060
1224 Ga0207664_10020656
1225 Ga0207664_10100265
1226 Ga0207664_10123464
1227 Ga0207644_10175626
1228 Ga0207644_10238498
1229 Ga0207690_10000117
1230 Ga0207690_10001648
1231 Ga0207690_10048283
1232 Ga0207690_10050488
1233 Ga0207690_10379369
1234 Ga0207706_10000068
1235 Ga0207706_10040857
1236 Ga0207686_10000033
1237 Ga0207686_10000428
1238 Ga0207686_10254242
1239 Ga0207709_10233345
1240 Ga0207669_10000012
1241 Ga0207704_10000146
1242 Ga0207665_10047824
1243 Ga0207665_10182238
1244 Ga0207665_10209651
1245 Ga0207691_10001039
1246 Ga0207711_10000020
1247 Ga0207661_10000492
1248 Ga0207661_10008086
1249 Ga0207661_10009162
1250 Ga0207661_10009503
1251 Ga0207661_10027150
1252 Ga0207661_10029153
1253 Ga0207661_10037197
1254 Ga0207661_10188469
1255 Ga0207679_10115103
1256 Ga0207667_10150188
1257 Ga0207712_10020852
1258 Ga0207712_10070266
1259 Ga0207712_10160173
1260 Ga0207640_10000015
1261 Ga0207640_10188590
1262 Ga0207658_10025449
1263 Ga0207677_10019123
1264 Ga0207703_10000040
1265 Ga0207703_10001815
1266 Ga0207639_10005404
1267 Ga0207639_10047900
1268 Ga0207678_10012342
1269 Ga0207678_10170749
1270 Ga0207708_10109055
1271 Ga0207702_10000607
1272 Ga0207702_10017650
1273 Ga0207702_10088937
1274 Ga0207702_10185986
1275 Ga0207702_10214928
1276 Ga0207702_10389868
1277 Ga0207641_10007104
1278 Ga0207641_10275188
1279 Ga0207648_10007855
1280 Ga0207676_10000016
1281 Ga0207674_10014502
1282 Ga0207674_10116495
1283 Ga0207675_100002174
1284 Ga0207675_100096249
1285 Ga0207675_100466808
1286 Ga0207683_10022220
1287 Ga0207683_10055774
1288 Ga0207698_10000012
1289 Ga0207698_10018265
1290 Ga0209281_1000131
1291 Ga0209281_1000502
1292 Ga0209281_1004136
1293 Ga0209281_1013085
1294 Ga0207428_10020123
1295 Ga0207428_10041096
1296 Ga0207428_10055546
1297 Ga0207428_10214585
1298 Ga0268266_10000020
1299 Ga0268266_10055957
1300 Ga0268265_10000555
1301 Ga0268264_10006502
1302 Ga0265337_1000002
1303 Ga0265326_10000007
1304 Ga0265326_10000024
1305 Ga0265319_1000116
1306 Ga0265334_10000078
1307 Ga0265318_10017106
1308 Ga0265322_10000001
1309 Ga0265336_10003815
1310 Ga0265338_10016842
1311 Ga0265338_10098748
1312 Ga0265324_10000309
1313 Ga0265324_10003299
1314 Ga0265328_10001155
1315 Ga0265320_10000002
1316 Ga0265329_10014821
1317 Ga0265331_10005257
1318 Ga0265327_10000011
1319 Ga0265314_10000058
1320 Ga0307405_10119453
1321 Ga0307413_10045649
1322 Ga0307410_10054203
1323 Ga0307407_10015214
1324 Ga0307407_10119466
1325 Ga0307409_100015871
1326 Ga0307409_100033327
1327 Ga0307409_100090481
1328 Ga0307409_100172243
1329 Ga0307409_100188824
1330 Ga0307416_100010497
1331 Ga0307411_10231509
1332 Ga0307415_100000109
1333 Ga0307415_100020877
1334 Ga0307415_100121081
1335 Ga0307415_100177466
1336 Ga0307415_100357145
1337 Ga0373956_0111322
1338 Ga0373943_0000450
1339 Ga0373946_0004358
1340 Ga0373927_0022758
1341 Ga0373933_0023238
1342 Ga0373947_0002176
1343 Ga0373937_0011597
1344 Ga0373937_0168677
1345 Ga0373937_0334799
1346 Ga0373925_0003354
1347 Ga0395899_0019528
1348 Ga0395899_0040871
1349 Ga0395899_0075426
1350 Ga0395900_0017631
1351 Ga0395900_0022240
1352 Ga0395900_0068406
1353 Ga0395900_0257804
1354 Ga0395900_0452587
1355 Ga0395900_0462972
1356 Ga0395898_0002496
1357 Ga0395898_0018707
1358 Ga0395898_0031362
1359 Ga0395898_0042172
1360 Ga0395898_0053265
1361 Ga0395898_0053394
1362 Ga0395898_0075926
1363 Ga0395898_0105247
1364 Ga0395898_0535496
1365 Ga0395905_0010080
1366 Ga0395905_0071433
1367 Ga0395905_0168995
1368 Ga0395905_0172870
1369 Ga0436364_0457216
1370 Ga0436364_0527107
1371 Ga0436364_1168514
1372 Ga0395901_0014107
1373 Ga0395901_0018370
1374 Ga0395901_0026219
1375 Ga0395901_0077464
1376 Ga0395901_0095660
1377 Ga0395901_0129283
1378 Ga0395901_0148255
1379 Ga0395901_0232358
1380 Ga0395901_0254951
1381 Ga0395901_0472338
1382 Ga0395901_0577279
1383 Ga0436365_0344023
1384 Ga0436365_0494891
1385 Ga0436365_0823300
1386 Ga0436365_1182882
1387 Ga0436365_1248745
1388 Ga0436365_1574649
1389 Ga0436363_0675171
1390 Ga0451798_0735618
1391 Ga0451833_0016179
1392 Ga0451853_0128655
1393 Ga0466965_0098246
1394 Ga0466966_0087254
1395 Ga0466961_0009994
1396 Ga0466961_0019451
1397 Ga0466961_0122770
1398 Ga0466963_0000023
1399 Ga0466963_0005370
1400 Ga0466963_0025380
1401 Ga0466963_0061539
1402 Ga0466963_0073596
1403 Ga0466963_0118600
1404 Ga0466964_0018912
1405 Ga0466964_0057309
1406 Ga0466971_0001268
1407 Ga0466971_0013005
1408 Ga0466971_0124073
1409 Ga0466968_0009508
1410 Ga0466957_0000566
1411 Ga0466957_0088050
1412 Ga0466960_0024390
1413 Ga0466960_0064375
1414 Ga0466960_0095012
1415 Ga0466959_0001055
1416 Ga0466959_0052484
1417 Ga0466959_0137177
1418 Ga0466959_0156171
1419 Ga0466958_0002895
1420 Ga0466958_0006736
1421 Ga0466958_0027368
1422 Ga0466958_0080234
1423 Ga0466967_0000027
1424 Ga0466967_0004155
1425 Ga0466967_0007145
1426 Ga0466967_0010564
1427 Ga0466967_0010911
1428 Ga0466967_0013454
1429 Ga0466967_0016955
1430 Ga0466967_0027982
1431 Ga0466967_0061995
1432 Ga0466967_0064480
1433 Ga0466967_0066201
1434 Ga0466967_0180119
1435 Ga0466967_0210347
1436 Ga0466967_0211313
1437 Ga0466967_0226742
1438 Ga0466967_0506817
1439 Ga0466967_0624440
1440 Ga0495592_0000036
1441 Ga0495603_0000097
1442 Ga0495603_0007864
1443 Ga0495603_0012162
1444 Ga0495629_0009397
1445 Ga0495629_0024338
1446 Ga0495629_0081278
1447 Ga0495638_0065726
1448 Ga0495641_0000003
1449 Ga0495651_0003583
1450 Ga0495651_0117342
1451 Ga0495653_0038949
1452 Ga0495653_0073344
1453 Ga0495653_0107237
1454 Ga0495653_0135719
1455 Ga0495580_0200013
1456 Ga0495582_0000029
1457 Ga0495582_0000066
1458 Ga0495582_0201094
1459 Ga0495639_0001185
1460 Ga0495662_0000650
1461 Ga0495662_0000694
1462 Ga0495662_0034097
1463 Ga0495664_0000007
1464 Ga0495594_0000003
1465 Ga0495594_0076609
1466 Ga0495596_0031416
1467 Ga0495608_0000031
1468 Ga0495608_0010826
1469 Ga0495608_0017412
1470 Ga0495608_0124169
1471 Ga0495610_0028993
1472 Ga0495620_0000210
1473 Ga0495620_0099892
1474 Ga0495628_0000144
1475 Ga0495628_0002459
1476 Ga0495628_0010479
1477 Ga0495628_0017322
1478 Ga0495628_0268967
1479 Ga0495630_0005219
1480 Ga0495630_0018710
1481 Ga0495630_0042919
1482 Ga0495630_0098599
1483 Ga0495644_0007172
1484 Ga0495652_0018945
1485 Ga0495652_0049582
1486 Ga0495652_0050844
1487 Ga0495665_0000252
1488 Ga0495640_0012743
1489 Ga0495640_0051398
1490 Ga0495640_0104286
1491 Ga0495586_0007791
1492 Ga0495586_0064936
1493 Ga0495587_0005378
1494 Ga0495587_0023376
1495 Ga0495587_0033470
1496 Ga0495645_0004644
1497 Ga0495645_0028397
1498 Ga0495622_0000714
1499 Ga0495667_0000032
1500 Ga0495667_0000751
1501 Ga0495667_0006812
1502 Ga0495667_0014712
1503 Ga0495667_0037733
1504 Ga0495667_0085538
1505 Ga0495656_0000241
1506 Ga0495634_0027184
1507 Ga0495634_0031253
1508 Ga0495634_0053650
1509 Ga0495634_0088730
1510 Ga0495635_0000016
1511 Ga0495635_0008147
1512 Ga0495635_0047428
1513 Ga0495635_0082131
1514 Ga0495657_0000024
1515 Ga0495657_0009618
1516 Ga0495657_0053616
1517 Ga0495657_0124448
1518 Ga0495599_0048369
1519 Ga0495623_0132179
1520 Ga0495646_0013457
1521 Ga0495646_0076361
1522 Ga0495647_0000025
1523 Ga0495658_0000026
1524 Ga0495658_0005678
1525 Ga0495669_0000260
1526 Ga0495613_0000073
1527 Ga0495613_0000152
1528 Ga0495613_0004101
1529 Ga0495613_0059131
1530 Ga0495624_0000009
1531 Ga0495624_0006961
1532 Ga0495600_0015949
1533 Ga0495600_0018385
1534 Ga0495600_0041962
1535 Ga0495600_0047287
1536 Ga0495581_0002805
1537 Ga0495581_0114745
1538 Ga0495604_0000019
1539 Ga0495604_0000985
1540 Ga0495604_0009430
1541 Ga0495604_0041144
1542 Ga0495674_0008594
1543 Ga0495674_0010971
1544 Ga0495674_0165465
1545 Ga0495674_0186670
1546 Ga0495672_0003817
1547 Ga0495676_0002041
1548 Ga0495680_0000317
1549 Ga0495680_0000647
1550 Ga0495680_0004252
1551 Ga0495680_0005066
1552 Ga0495680_0012179
1553 Ga0495680_0034820
1554 Ga0495675_0000428
1555 Ga0495685_034437
1556 Ga0495684_0002738
1557 Ga0495684_0006287
1558 Ga0495684_0053340
1559 Ga0495593_0001836
1560 Ga0495602_0001790
1561 Ga0495602_0059786
1562 Ga0495614_0019808
1563 Ga0496100_0000018
1564 Ga0496100_0016785
1565 Ga0496100_0037106
1566 Ga0496101_0000221
1567 Ga0496101_0004996
1568 Ga0496101_0009188
1569 Ga0496101_0024859
1570 Ga0496101_0088697
1571 Ga0496101_0094853
1572 Ga0496102_0000146
1573 Ga0496102_0008457
1574 Ga0496102_0299530
1575 Ga0496103_0000008
1576 Ga0496103_0006820
1577 Ga0496103_0112031
1578 Ga0496104_0000001
1579 Ga0496104_0000004
1580 Ga0496104_0004466
1581 Ga0496104_0126464
1582 Ga0496104_0538909
1583 Ga0496105_0000001
1584 Ga0496105_0001569
1585 Ga0496105_0014782
1586 Ga0496105_0019941
1587 Ga0496105_0144081
1588 Ga0496106_0000018
1589 Ga0496106_0000149
1590 Ga0496106_0004661
1591 Ga0496106_0047208
1592 Ga0496106_0130396
1593 Ga0496107_0000006
1594 Ga0496107_0001394
1595 Ga0496107_0005792
1596 Ga0496107_0028637
1597 Ga0496107_0037613
1598 Ga0496107_0043697
1599 Ga0496108_0036583
1600 Ga0496108_0059129
1601 Ga0496108_0099543
1602 Ga0496109_0000028
1603 Ga0496109_0005575
1604 Ga0496109_0007622
1605 Ga0496109_0023298
1606 Ga0496109_0222627
1607 Ga0496110_0002884
1608 Ga0496110_0006813
1609 Ga0496110_0046655
1610 Ga0496110_0096919
1611 Ga0496110_0151465
1612 Ga0496110_0321171
1613 Ga0496111_0000021
1614 Ga0496111_0003320
1615 Ga0496111_0011955
1616 Ga0496111_0014669
1617 Ga0496111_0096713
1618 Ga0496111_0183989
1619 Ga0496112_0000003
1620 Ga0496112_0001614
1621 Ga0496112_0109544
1622 Ga0496112_0212348
1623 Ga0496112_0253016
1624 Ga0496112_0301760
1625 Ga0496113_0000029
1626 Ga0496113_0020403
1627 Ga0496113_0062447
1628 Ga0496113_0072702
1629 Ga0496113_0089276
1630 Ga0496114_0000014
1631 Ga0496114_0001831
1632 Ga0496114_0026518
1633 Ga0496114_0148873
1634 Ga0496114_0156407
1635 Ga0496115_0000003
1636 Ga0496115_0000581
1637 Ga0496115_0001725
1638 Ga0496115_0002312
1639 Ga0496115_0005472
1640 Ga0496115_0049967
1641 Ga0496115_0056458
1642 Ga0496115_0123722
1643 Ga0496117_0020230
1644 Ga0496118_0005186
1645 Ga0496120_0020129
1646 Ga0496121_0052505
1647 Ga0496121_0101167
1648 Ga0496122_0033730
1649 Ga0496126_0000108
1650 Ga0496126_0049736
1651 Ga0501031_0000434
1652 Ga0501031_0029713
1653 Ga0501031_0214164
1654 Ga0501032_0000899
1655 Ga0501032_0022440
1656 Ga0501033_0001140
1657 Ga0501034_0124121
1658 Ga0501036_0029623
1659 Ga0501036_0136395
1660 Ga0501037_0000774
1661 Ga0501037_0026648
1662 Ga0501037_0301482
1663 Ga0501038_0001146
1664 Ga0501038_0037491
1665 Ga0501039_0098643
1666 Ga0501039_0098657
1667 Ga0501039_0161109
1668 Ga0501040_0001638
1669 Ga0501041_0177508
1670 Ga0501042_0037517
1671 Ga0501042_0080269
1672 Ga0501042_0112800
1673 Ga0501043_0001082
1674 Ga0501043_0003201
1675 Ga0501046_0000447
1676 Ga0501046_0044376
1677 Ga0501046_0152886
1678 Ga0501047_0001335
1679 Ga0501047_0007455
1680 Ga0501047_0038927
1681 Ga0501048_0000734
1682 Ga0501048_0081483
1683 Ga0501067_0000348
1684 Ga0501067_0012878
1685 Ga0501067_0052936
1686 Ga0501067_0059253
1687 Ga0501067_0069396
1688 Ga0501069_0007590
1689 Ga0501069_0029114
1690 Ga0501069_0038721
1691 Ga0501069_0078624
1692 Ga0501070_0001137
1693 Ga0501070_0158987
1694 Ga0501071_0008414
1695 Ga0501071_0070366
1696 Ga0501071_0104050
1697 Ga0501071_0126080
1698 Ga0501072_0001313
1699 Ga0501072_0108814
1700 Ga0501072_0134549
1701 Ga0501072_0148604
1702 Ga0501073_0038032
1703 Ga0501073_0049364
1704 Ga0501074_0019804
1705 Ga0501074_0030021
1706 Ga0501074_0038770
1707 Ga0501074_0146388
1708 Ga0501074_0147057
1709 Ga0501075_0000392
1710 Ga0501075_0019774
1711 Ga0501075_0068979
1712 Ga0501075_0181602
1713 Ga0501075_0290189
1714 Ga0501076_0001177
1715 Ga0501076_0022538
1716 Ga0501076_0142235
1717 Ga0501076_0233089
1718 Ga0501077_0041582
1719 Ga0501077_0082185
1720 Ga0501077_0083695
1721 Ga0501079_0008992
1722 Ga0501079_0017085
1723 Ga0501079_0048229
1724 Ga0501079_0185868
1725 Ga0501080_0050087
1726 Ga0501080_0060002
1727 Ga0501080_0153800
1728 Ga0501080_0245961
1729 Ga0501081_0003995
1730 Ga0501081_0054341
1731 Ga0501083_0008535
1732 Ga0501083_0023660
1733 Ga0501035_0002398
1734 Ga0501044_0003241
1735 Ga0501044_0036460
1736 Ga0501044_0049171
1737 Ga0501044_0167828
1738 Ga0501045_0013972
1739 Ga0501045_0060787
1740 Ga0501045_0214013
1741 nmdc:mga05p37_105614_c1
1742 nmdc:mga05p37_144872_c1
1743 nmdc:mga05p37_170780_c1
1744 nmdc:mga05p37_71033_c2
1745 nmdc:mga09592_69165_c1
1746 nmdc:mga0qj67_1444_c1
1747 nmdc:mga06r32_13083_c1
1748 nmdc:mga06r32_2689_c1
1749 nmdc:mga08y16_143200_c1
1750 nmdc:mga08y16_26286_c1
1751 nmdc:mga08y16_9951_c1
1752 nmdc:mga0n895_128747_c1
1753 nmdc:mga0n895_47389_c1
1754 nmdc:mga08x19_101069_c1
1755 nmdc:mga0a205_1916_c1
1756 nmdc:mga0a205_38052_c1
1757 nmdc:mga0a205_87386_c1
1758 Ga0495601_0002204
1759 Ga0495601_0108345
1760 Ga0495601_0139636
1761 Ga0495612_0001555
1762 Ga0495612_0015066
1763 Ga0495655_0000001
1764 Ga0495655_0001262
1765 Ga0495655_0005518
1766 Ga0495595_0000014
1767 Ga0495595_0002816
1768 Ga0495619_0000055
1769 Ga0495619_0000147
1770 Ga0495619_0000534
1771 Ga0495619_0003046
1772 Ga0495619_0058131
1773 Ga0495619_0063950
1774 Ga0495619_0146912
1775 Ga0495619_0280505
1776 Ga0500556_0000593
1777 Ga0500614_000026
1778 Ga0500628_000017
1779 Ga0500616_0004992
1780 Ga0501084_0007832
1781 Ga0501084_0285733
1782 Ga0501082_0039672
1783 Ga0501082_0048052
1784 Ga0501082_0051874
1785 Ga0501082_0235564
1786 Ga0466962_0003841
1787 Ga0466962_0004523
1788 Ga0466962_0038804
1789 Ga0530510_0003223
1790 Ga0530510_0013546
1791 Ga0530510_0069871
1792 Ga0530510_0099208
1793 Ga0530510_0179866
1794 8007378304

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03462

PCRF

PCRF domain

32

220

0.97

PF00472

RF-1

RF-1 domain

227

338

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
5u4j-assembly1.cif.gz_v structural basis of co-translational quality control by arfa and rf2 bound to ribosome 0.9609 86 184
6boh-assembly2.cif.gz_OC antibiotic blasticidin s and e. coli release factor 1 (containing deletion 302-304) bound to the 70s ribosome 0.9045 79 186
6boh-assembly2.cif.gz_OC antibiotic blasticidin s and e. coli release factor 1 (containing deletion 302-304) bound to the 70s ribosome 0.8818 79 186
6b4v-assembly1.cif.gz_JA antibiotic blasticidin s and e. coli release factor 1 bound to the 70s ribosome 0.8753 79 330
5o2r-assembly1.cif.gz_v cryo-em structure of the proline-rich antimicrobial peptide api137 bound to the terminating ribosome 0.8743 86 325
ID Description Score Start End Superfamily
af_A0A1D6IEG8_11_112_3.30.70.1660 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.984 83 184 3.30.70.1660
af_A0A1D6IEG8_11_112_3.30.70.1660 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9651 83 184 3.30.70.1660
1gqeA02 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9646 84 325 3.30.70.1660
af_P30775_152_262_3.30.70.1660 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9625 84 186 3.30.70.1660
af_Q54RE7_180_291_3.30.70.1660 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9496 82 193 3.30.70.1660
ID Description Score Start End GO Terms
AF-X1A613-F1-model_v4 Peptide chain release factor domain-containing protein 0.9864 76 177 GO:0006415
AF-X1A613-F1-model_v4 Peptide chain release factor domain-containing protein 0.9496 76 177 GO:0006415
AF-A0A1V5PSR0-F1-model_v4 Peptide chain release factor 2 (RF-2) 0.9448 21 324 GO:0005737
GO:0016149
AF-K1SNK6-F1-model_v4 Peptide chain release factor 2 0.9448 30 152 GO:0006415
AF-A0A1Y2CA51-F1-model_v4 PCRF-domain-containing protein 0.9424 16 184 GO:0006415

Map