F485064

General Info

Members Datasets Scaffolds Average Seq Length
898 456 1796 138

Family's Representative Sequence

Representative Sequence 3300005365|Ga0070688_100693764|Ga0070688_1006937641
Length 151
Sequence VLDGSFTRIQDMGGINPYIEQVKADLPKQPYELTFVLGDSGETRTVRVEPEKLPYGHDGLPGSVLDIAMGAGVHLDHACGGVAACSTCHVIVEQGSETCSAVLEAEEDMLDLAAGVTDKSRLGCQCIPNGTVPMRVRIPEWNRNLVMEPPH

Samples

Sample ID Description Type Environment
1 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
6 3300003347 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM Metagenome Rhizosphere
7 3300003349 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM Metagenome Rhizosphere
8 3300003371 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM Metagenome Rhizosphere
9 3300003383 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM Metagenome Rhizosphere
10 3300003392 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM Metagenome Rhizosphere
11 3300003399 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM Metagenome Rhizosphere
12 3300003400 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM Metagenome Rhizosphere
13 3300003405 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM Metagenome Rhizosphere
14 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
15 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
16 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
17 3300005277 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v2 (version 2) Metagenome Rhizosphere
18 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
19 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
20 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
21 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
22 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
23 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
24 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
25 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
26 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
27 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
28 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
29 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
30 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
31 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
32 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
33 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
34 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
35 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
36 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
37 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
38 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
39 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
40 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
41 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
42 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
43 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
44 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
45 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
46 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
47 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
48 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
49 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
50 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
51 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
52 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
53 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
54 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
55 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
56 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
57 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
58 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
59 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
60 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
61 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
62 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
63 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
64 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
65 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
66 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
67 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
68 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
69 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
70 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
71 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
72 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
73 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
74 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
75 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
76 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
77 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
78 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
79 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
80 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
81 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
82 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
83 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
84 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
85 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
86 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
87 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
88 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
89 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
90 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
91 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
92 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
93 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
94 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
95 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
96 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
97 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
98 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
99 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
100 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
101 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
102 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
103 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
104 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
105 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
106 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
107 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
108 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
109 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
110 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
111 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
112 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
113 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
114 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
115 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
116 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
117 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
118 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
119 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
120 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
121 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
122 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
123 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
124 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
125 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
126 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
127 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
128 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
129 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
130 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
131 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
132 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
133 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
134 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
135 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
136 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
137 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
138 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
139 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
140 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300027252 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) Metagenome Rhizosphere
198 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
199 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
200 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
201 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
202 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
203 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
204 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
205 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
206 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
207 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
208 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
209 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
210 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
212 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
213 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
214 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
215 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
216 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
218 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
219 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
220 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
221 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
222 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
223 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
224 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
225 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
226 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
227 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
228 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
229 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
230 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
231 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
232 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
233 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
234 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
235 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
236 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
237 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
238 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
239 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
240 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
241 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
242 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
243 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
244 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
245 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
246 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
247 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
248 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
249 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
250 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
251 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
252 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
253 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
254 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
255 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
256 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
257 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
258 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
259 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
260 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
261 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
262 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
263 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
264 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
265 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
266 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
267 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
268 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
269 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
270 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
271 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
272 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
273 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
274 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
275 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
276 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
277 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
278 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
279 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
280 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
281 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
282 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
283 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
284 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
285 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
286 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
287 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
288 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
289 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
290 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
291 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
292 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
293 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
294 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
295 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
296 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
297 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
298 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
299 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
300 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
301 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
302 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
303 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
304 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
305 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
306 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
307 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
308 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
309 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
310 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
311 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
312 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
313 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
314 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
315 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
316 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
317 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
318 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
319 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
320 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
321 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
322 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
323 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
324 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
325 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
326 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
327 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
328 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
329 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
330 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
331 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
332 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
333 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
334 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
335 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
336 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
337 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
338 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
339 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
340 3300049516 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_B_5_drought Metagenome Rhizosphere
341 3300049517 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control Metagenome Rhizosphere
342 3300049518 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control Metagenome Rhizosphere
343 3300049519 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought Metagenome Rhizosphere
344 3300049520 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought Metagenome Rhizosphere
345 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
346 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
347 3300049524 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H21_B_7_control Metagenome Rhizosphere
348 3300049525 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F21_B_7_control Metagenome Rhizosphere
349 3300049526 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_B_7_control Metagenome Rhizosphere
350 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
351 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
352 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
353 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
354 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
355 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
356 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
357 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
358 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
359 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
360 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
361 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
362 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
363 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
364 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
365 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
366 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
367 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
368 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
369 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
370 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
371 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
372 3300049650 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought Metagenome Rhizosphere
373 3300049651 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought Metagenome Rhizosphere
374 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
375 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
376 3300049655 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_B_0_drought Metagenome Rhizosphere
377 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
378 3300049657 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought Metagenome Rhizosphere
379 3300049658 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought Metagenome Rhizosphere
380 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
381 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
382 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
383 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
384 3300049666 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A4_B_2_control Metagenome Rhizosphere
385 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
386 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
387 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
388 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
389 3300049672 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought Metagenome Rhizosphere
390 3300049673 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought Metagenome Rhizosphere
391 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
392 3300049676 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_A_3_control Metagenome Rhizosphere
393 3300049677 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control Metagenome Rhizosphere
394 3300049678 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought Metagenome Rhizosphere
395 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
396 3300049680 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought Metagenome Rhizosphere
397 3300049681 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought Metagenome Rhizosphere
398 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
399 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
400 3300049684 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_B_3_control Metagenome Rhizosphere
401 3300049685 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_B_3_control Metagenome Rhizosphere
402 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
403 3300049687 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought Metagenome Rhizosphere
404 3300049689 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_A_4_drought Metagenome Rhizosphere
405 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
406 3300049703 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control Metagenome Rhizosphere
407 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
408 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
409 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
410 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
411 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
412 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
413 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
414 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
415 3300049757 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_B_2_control Metagenome Rhizosphere
416 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
417 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
418 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
419 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
420 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
421 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
422 3300049768 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought Metagenome Rhizosphere
423 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
424 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
425 3300049771 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_B_4_control Metagenome Rhizosphere
426 3300049772 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_B_4_control Metagenome Rhizosphere
427 3300049773 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_B_4_control Metagenome Rhizosphere
428 3300049774 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_A_5_drought Metagenome Rhizosphere
429 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
430 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
431 3300049777 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control Metagenome Rhizosphere
432 3300049778 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control Metagenome Rhizosphere
433 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
434 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
435 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
436 3300049850 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control Metagenome Rhizosphere
437 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
438 3300049852 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control Metagenome Rhizosphere
439 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
440 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
441 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
442 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
443 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
444 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
445 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
446 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
447 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
448 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
449 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
450 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
451 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
452 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
453 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
454 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
455 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
456 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.66
Metatranscriptomes 1.34
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.11
Rhizosphere 98.89
Stem 0
Stem Tuber 0
Unclassified 10.91

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070688_100693764 3300005365 Unclassified 788
2 SwRhRL2b_contig_3098461 2162886007 Bacteria 1267
3 MBSR1b_contig_11399222 2162886012 Bacteria 824
4 MBSR1b_contig_1366838 2162886012 Unclassified 886
5 MBSR1b_contig_6479971 2162886012 Bacteria 828
6 JGI24737J22298_10075309 3300001990 Bacteria 1006
7 JGI24033J26618_1016908 3300002155 Bacteria 910
8 JGI26128J50194_1003181 3300003347 Bacteria 1083
9 JGI26129J50193_1001555 3300003349 Bacteria 1565
10 JGI26145J50221_1000561 3300003371 Bacteria 3158
11 JGI26140J50224_102308 3300003383 Bacteria 690
12 JGI26134J50242_100742 3300003392 Bacteria 1109
13 JGI26136J50244_100585 3300003399 Bacteria 1216
14 JGI26131J50246_101860 3300003400 Bacteria 655
15 JGI26132J50249_101294 3300003405 Bacteria 824
16 Ga0058863_11536952 3300004799 Bacteria 570
17 Ga0058861_11487509 3300004800 Bacteria 616
18 Ga0058862_12291842 3300004803 Bacteria 762
19 Ga0065716_1009788 3300005277 Bacteria 643
20 Ga0065714_10325405 3300005288 Bacteria 663
21 Ga0065704_10072118 3300005289 Bacteria 9115
22 Ga0065712_10024731 3300005290 Bacteria 2044
23 Ga0065715_10006020 3300005293 Bacteria 5541
24 Ga0065715_10508887 3300005293 Bacteria 773
25 Ga0065715_10979395 3300005293 Bacteria 551
26 Ga0065707_10083597 3300005295 Bacteria 8651
27 Ga0065707_10204501 3300005295 Bacteria 1294
28 Ga0065707_10294391 3300005295 Bacteria 1018
29 Ga0070658_11018639 3300005327 Unclassified 720
30 Ga0070676_10002068 3300005328 Bacteria 10205
31 Ga0070676_10014982 3300005328 Bacteria 4268
32 Ga0070683_100081151 3300005329 Bacteria 3036
33 Ga0070683_100493197 3300005329 Unclassified 1170
34 Ga0070690_100003571 3300005330 Bacteria 8536
35 Ga0070690_100007665 3300005330 Bacteria 6188
36 Ga0070690_100011134 3300005330 Bacteria 5253
37 Ga0070690_100091108 3300005330 Bacteria 2008
38 Ga0070690_100265558 3300005330 Bacteria 1219
39 Ga0070670_100003892 3300005331 Bacteria 12449
40 Ga0070670_100005867 3300005331 Bacteria 10379
41 Ga0070670_100146333 3300005331 Bacteria 2044
42 Ga0070677_10019583 3300005333 Bacteria 2454
43 Ga0070677_10019972 3300005333 Bacteria 2434
44 Ga0068869_100054290 3300005334 Bacteria 2916
45 Ga0068869_100345245 3300005334 Unclassified 1212
46 Ga0068869_101221253 3300005334 Unclassified 661
47 Ga0070666_10002093 3300005335 Bacteria 12135
48 Ga0070666_10020870 3300005335 Bacteria 4239
49 Ga0070666_10322016 3300005335 Bacteria 1103
50 Ga0070680_100002097 3300005336 Bacteria 14721
51 Ga0070680_100371663 3300005336 Bacteria 1217
52 Ga0070682_100446792 3300005337 Bacteria 989
53 Ga0070682_100811848 3300005337 Bacteria 761
54 Ga0070682_101595288 3300005337 Bacteria 564
55 Ga0068868_100021963 3300005338 Bacteria 4811
56 Ga0068868_100036007 3300005338 Bacteria 3828
57 Ga0068868_100709941 3300005338 Bacteria 900
58 Ga0070660_100007210 3300005339 Bacteria 7734
59 Ga0070689_100000081 3300005340 Bacteria 56567
60 Ga0070689_100007586 3300005340 Bacteria 7599
61 Ga0070689_100550331 3300005340 Bacteria 994
62 Ga0070689_100777942 3300005340 Bacteria 840
63 Ga0070689_100994667 3300005340 Bacteria 746
64 Ga0070691_10052857 3300005341 Bacteria 1942
65 Ga0070691_10233554 3300005341 Bacteria 980
66 Ga0070687_100007956 3300005343 Bacteria 4463
67 Ga0070687_100012805 3300005343 Bacteria 3717
68 Ga0070687_100037369 3300005343 Bacteria 2427
69 Ga0070661_100020862 3300005344 Bacteria 4675
70 Ga0070661_100047799 3300005344 Bacteria 3131
71 Ga0070669_100094986 3300005353 Bacteria 2241
72 Ga0070669_100437839 3300005353 Bacteria 1075
73 Ga0070675_100004564 3300005354 Bacteria 10571
74 Ga0070675_100014323 3300005354 Bacteria 6252
75 Ga0070671_100003618 3300005355 Bacteria 12095
76 Ga0070674_100001987 3300005356 Bacteria 11195
77 Ga0070674_100018373 3300005356 Bacteria 4419
78 Ga0070674_100037200 3300005356 Bacteria 3272
79 Ga0070673_100000165 3300005364 Bacteria 31811
80 Ga0070688_100000241 3300005365 Bacteria 28868
81 Ga0070688_100028746 3300005365 Bacteria 3322
82 Ga0070688_100255938 3300005365 Bacteria 1248
83 Ga0070659_100033907 3300005366 Bacteria 3969
84 Ga0070659_100872448 3300005366 Bacteria 785
85 Ga0070667_100013530 3300005367 Bacteria 6742
86 Ga0070667_100147636 3300005367 Bacteria 2063
87 Ga0070667_101982149 3300005367 Bacteria 548
88 Ga0070709_10084460 3300005434 Bacteria 2079
89 Ga0070709_10990788 3300005434 Bacteria 668
90 Ga0070709_11732898 3300005434 Bacteria 510
91 Ga0070714_100332814 3300005435 Bacteria 1422
92 Ga0070714_100450336 3300005435 Bacteria 1223
93 Ga0070713_100032631 3300005436 Bacteria 4161
94 Ga0070713_100249838 3300005436 Bacteria 1617
95 Ga0070713_100646202 3300005436 Bacteria 1007
96 Ga0070713_102345903 3300005436 Unclassified 516
97 Ga0070701_10000085 3300005438 Bacteria 26001
98 Ga0070701_10041041 3300005438 Bacteria 2356
99 Ga0070701_10160044 3300005438 Bacteria 1303
100 Ga0070711_100043840 3300005439 Bacteria 3033
101 Ga0070711_100236028 3300005439 Bacteria 1428
102 Ga0070711_101478780 3300005439 Unclassified 592
103 Ga0070705_100069821 3300005440 Bacteria 2119
104 Ga0070700_100001201 3300005441 Bacteria 12835
105 Ga0070700_100026596 3300005441 Bacteria 3419
106 Ga0070700_100073734 3300005441 Bacteria 2185
107 Ga0070700_100468628 3300005441 Bacteria 962
108 Ga0070694_100133408 3300005444 Bacteria 1796
109 Ga0070694_100223772 3300005444 Bacteria 1413
110 Ga0070694_100449007 3300005444 Bacteria 1018
111 Ga0070708_100052594 3300005445 Bacteria 3612
112 Ga0070708_100319883 3300005445 Bacteria 1461
113 Ga0070708_100358704 3300005445 Bacteria 1374
114 Ga0070708_100524246 3300005445 Bacteria 1117
115 Ga0070708_101274862 3300005445 Unclassified 687
116 Ga0070663_100037356 3300005455 Bacteria 3381
117 Ga0070663_100280647 3300005455 Unclassified 1327
118 Ga0070678_100005988 3300005456 Bacteria 7086
119 Ga0070678_100007798 3300005456 Bacteria 6369
120 Ga0070678_100448810 3300005456 Bacteria 1129
121 Ga0070662_100000802 3300005457 Bacteria 19329
122 Ga0070662_100109033 3300005457 Bacteria 2106
123 Ga0070662_100576218 3300005457 Bacteria 945
124 Ga0070662_100620765 3300005457 Bacteria 910
125 Ga0070681_10001263 3300005458 Bacteria 22049
126 Ga0070681_10022902 3300005458 Bacteria 6277
127 Ga0070681_10481000 3300005458 Bacteria 1154
128 Ga0068867_100010665 3300005459 Bacteria 6482
129 Ga0068867_100014838 3300005459 Bacteria 5524
130 Ga0068867_100090189 3300005459 Bacteria 2325
131 Ga0068867_101923854 3300005459 Bacteria 558
132 Ga0070685_10000038 3300005466 Bacteria 79350
133 Ga0070685_10041135 3300005466 Bacteria 2632
134 Ga0070685_10046744 3300005466 Bacteria 2486
135 Ga0070706_100096076 3300005467 Bacteria 2751
136 Ga0070706_100368848 3300005467 Bacteria 1337
137 Ga0070706_100416882 3300005467 Bacteria 1250
138 Ga0070706_100610691 3300005467 Bacteria 1013
139 Ga0070707_100000025 3300005468 Bacteria 124890
140 Ga0070707_100000190 3300005468 Bacteria 61096
141 Ga0070707_100003340 3300005468 Bacteria 15155
142 Ga0070707_100145165 3300005468 Bacteria 2310
143 Ga0070707_100430776 3300005468 Bacteria 1279
144 Ga0070707_102266286 3300005468 Bacteria 510
145 Ga0070698_100018005 3300005471 Bacteria 7439
146 Ga0070698_100019346 3300005471 Bacteria 7153
147 Ga0070698_100260146 3300005471 Bacteria 1667
148 Ga0070698_100661558 3300005471 Bacteria 986
149 Ga0070698_101220326 3300005471 Bacteria 701
150 Ga0070699_100041739 3300005518 Bacteria 3970
151 Ga0070699_100045770 3300005518 Bacteria 3786
152 Ga0070699_100168797 3300005518 Bacteria 1938
153 Ga0070699_100963033 3300005518 Bacteria 782
154 Ga0070699_101220549 3300005518 Unclassified 690
155 Ga0070679_100074038 3300005530 Bacteria 3396
156 Ga0070679_100604753 3300005530 Bacteria 1040
157 Ga0070679_100706994 3300005530 Bacteria 950
158 Ga0070684_100055282 3300005535 Bacteria 3459
159 Ga0070697_100030452 3300005536 Bacteria 4335
160 Ga0070697_100110158 3300005536 Bacteria 2294
161 Ga0070697_100116870 3300005536 Bacteria 2228
162 Ga0070697_100118038 3300005536 Bacteria 2216
163 Ga0070697_100218045 3300005536 Bacteria 1626
164 Ga0070697_100396063 3300005536 Bacteria 1198
165 Ga0070697_100638678 3300005536 Bacteria 937
166 Ga0070697_101877292 3300005536 Bacteria 536
167 Ga0068853_101291100 3300005539 Unclassified 705
168 Ga0070672_100001107 3300005543 Bacteria 16445
169 Ga0070672_100305707 3300005543 Bacteria 1349
170 Ga0070686_100000189 3300005544 Bacteria 43166
171 Ga0070686_100008451 3300005544 Bacteria 5764
172 Ga0070686_100015467 3300005544 Bacteria 4421
173 Ga0070686_100058000 3300005544 Bacteria 2490
174 Ga0070686_100265013 3300005544 Bacteria 1261
175 Ga0070695_100033536 3300005545 Bacteria 3213
176 Ga0070695_100034160 3300005545 Bacteria 3186
177 Ga0070695_100076398 3300005545 Unclassified 2206
178 Ga0070695_100548875 3300005545 Unclassified 900
179 Ga0070695_100605181 3300005545 Bacteria 861
180 Ga0070695_100671980 3300005545 Bacteria 820
181 Ga0070696_100015885 3300005546 Bacteria 5060
182 Ga0070696_100054033 3300005546 Bacteria 2798
183 Ga0070696_100415740 3300005546 Bacteria 1055
184 Ga0070693_100010301 3300005547 Bacteria 4681
185 Ga0070693_100929485 3300005547 Bacteria 654
186 Ga0070665_100017033 3300005548 Bacteria 7287
187 Ga0070665_100261803 3300005548 Bacteria 1731
188 Ga0070704_100010083 3300005549 Bacteria 5742
189 Ga0070704_100051390 3300005549 Bacteria 2902
190 Ga0070704_100060199 3300005549 Bacteria 2712
191 Ga0070704_100213647 3300005549 Bacteria 1564
192 Ga0070664_100079786 3300005564 Bacteria 2818
193 Ga0068857_100017459 3300005577 Bacteria 6289
194 Ga0070702_100040740 3300005615 Bacteria 2601
195 Ga0070702_100069902 3300005615 Bacteria 2070
196 Ga0070702_100729792 3300005615 Bacteria 758
197 Ga0068859_100001732 3300005617 Bacteria 22236
198 Ga0068859_100128404 3300005617 Bacteria 2606
199 Ga0068859_102014727 3300005617 Bacteria 637
200 Ga0068859_102774989 3300005617 Bacteria 538
201 Ga0068866_10106644 3300005718 Unclassified 1555
202 Ga0068861_100039277 3300005719 Bacteria 3531
203 Ga0068851_10165104 3300005834 Bacteria 1219
204 Ga0068870_10001055 3300005840 Bacteria 10908
205 Ga0068863_100369190 3300005841 Bacteria 1400
206 Ga0068863_101398474 3300005841 Bacteria 707
207 Ga0068858_100189327 3300005842 Bacteria 1944
208 Ga0068858_100199356 3300005842 Bacteria 1892
209 Ga0068860_100011445 3300005843 Bacteria 8739
210 Ga0068860_101871736 3300005843 Bacteria 622
211 Ga0068862_100031296 3300005844 Bacteria 4490
212 Ga0081455_10003551 3300005937 Bacteria 17897
213 Ga0081455_10155919 3300005937 Bacteria 1755
214 Ga0070717_10056863 3300006028 Bacteria 3233
215 Ga0070717_10714167 3300006028 Bacteria 911
216 Ga0070717_11544411 3300006028 Bacteria 602
217 Ga0075432_10000545 3300006058 Bacteria 11323
218 Ga0070715_10143175 3300006163 Bacteria 1163
219 Ga0070715_10240070 3300006163 Bacteria 942
220 Ga0070716_100061012 3300006173 Bacteria 2180
221 Ga0070712_100758575 3300006175 Bacteria 831
222 Ga0075427_10000956 3300006194 Bacteria 3565
223 Ga0097621_100019150 3300006237 Bacteria 5247
224 Ga0097621_100044572 3300006237 Bacteria 3579
225 Ga0097621_100096876 3300006237 Bacteria 2476
226 Ga0068871_100026242 3300006358 Bacteria 4544
227 Ga0068871_100077713 3300006358 Bacteria 2744
228 Ga0068871_100399529 3300006358 Bacteria 1224
229 Ga0068871_100605461 3300006358 Unclassified 997
230 Ga0068871_101231086 3300006358 Bacteria 703
231 Ga0075428_100126114 3300006844 Bacteria 2786
232 Ga0075428_100355295 3300006844 Bacteria 1572
233 Ga0075428_100700287 3300006844 Bacteria 1079
234 Ga0075430_100000881 3300006846 Bacteria 23566
235 Ga0075430_100001970 3300006846 Bacteria 16904
236 Ga0075430_100027202 3300006846 Bacteria 4862
237 Ga0075430_100549086 3300006846 Bacteria 953
238 Ga0075430_100916276 3300006846 Bacteria 722
239 Ga0075431_100008565 3300006847 Bacteria 10242
240 Ga0075431_100065696 3300006847 Bacteria 3746
241 Ga0075431_100691611 3300006847 Bacteria 998
242 Ga0075431_101959743 3300006847 Bacteria 541
243 Ga0075433_10039498 3300006852 Bacteria 4082
244 Ga0075433_10055110 3300006852 Bacteria 3470
245 Ga0075433_10059767 3300006852 Bacteria 3335
246 Ga0075433_10170589 3300006852 Bacteria 1936
247 Ga0075433_11950568 3300006852 Unclassified 503
248 Ga0075434_100028211 3300006871 Bacteria 5515
249 Ga0075434_100365029 3300006871 Unclassified 1465
250 Ga0075429_100001415 3300006880 Bacteria 19657
251 Ga0075429_100034112 3300006880 Bacteria 4422
252 Ga0075429_100037332 3300006880 Bacteria 4229
253 Ga0075429_100131029 3300006880 Bacteria 2193
254 Ga0068865_100099312 3300006881 Bacteria 2128
255 Ga0068865_100243790 3300006881 Bacteria 1415
256 Ga0075436_100130127 3300006914 Bacteria 1765
257 Ga0075436_100357741 3300006914 Bacteria 1053
258 Ga0097620_100001732 3300006931 Bacteria 22236
259 Ga0097620_100128405 3300006931 Bacteria 2606
260 Ga0097620_102015169 3300006931 Bacteria 637
261 Ga0097620_102774554 3300006931 Bacteria 538
262 Ga0075435_100022814 3300007076 Bacteria 4831
263 Ga0075435_100027269 3300007076 Bacteria 4466
264 Ga0099794_10465136 3300007265 Unclassified 664
265 Ga0099795_10042582 3300007788 Bacteria 1621
266 Ga0105240_10053334 3300009093 Bacteria 5076
267 Ga0105240_10063425 3300009093 Bacteria 4597
268 Ga0105240_10441420 3300009093 Bacteria 1458
269 Ga0105240_12088518 3300009093 Unclassified 588
270 Ga0111539_10001494 3300009094 Bacteria 31265
271 Ga0111539_10063514 3300009094 Bacteria 4369
272 Ga0111539_10118138 3300009094 Bacteria 3108
273 Ga0105245_10004145 3300009098 Bacteria 12875
274 Ga0105245_10210477 3300009098 Bacteria 1871
275 Ga0105245_10459106 3300009098 Bacteria 1284
276 Ga0105247_10586695 3300009101 Bacteria 825
277 Ga0114129_10010292 3300009147 Bacteria 13344
278 Ga0114129_10016441 3300009147 Bacteria 10530
279 Ga0114129_10055075 3300009147 Bacteria 5574
280 Ga0114129_10511068 3300009147 Bacteria 1567
281 Ga0114129_10809396 3300009147 Unclassified 1194
282 Ga0114129_10832038 3300009147 Unclassified 1175
283 Ga0114129_12263430 3300009147 Unclassified 653
284 Ga0105243_10002277 3300009148 Bacteria 16097
285 Ga0105243_10713212 3300009148 Bacteria 979
286 Ga0105243_10912388 3300009148 Bacteria 875
287 Ga0105242_10000981 3300009176 Bacteria 22290
288 Ga0105242_10027992 3300009176 Bacteria 4482
289 Ga0105242_10326433 3300009176 Bacteria 1409
290 Ga0105242_12901813 3300009176 Unclassified 530
291 Ga0105248_10003541 3300009177 Bacteria 17306
292 Ga0105238_10215046 3300009551 Bacteria 1898
293 Ga0105249_10017552 3300009553 Bacteria 6355
294 Ga0099796_10100585 3300010159 Unclassified 1087
295 Ga0099796_10114203 3300010159 Bacteria 1031
296 Ga0105239_10018468 3300010375 Bacteria 7703
297 Ga0105239_11397270 3300010375 Bacteria 808
298 Ga0105246_10000570 3300011119 Bacteria 20413
299 Ga0157373_10142159 3300013100 Bacteria 1688
300 Ga0157371_10010918 3300013102 Bacteria 7042
301 Ga0157371_10452788 3300013102 Bacteria 944
302 Ga0157369_10572488 3300013105 Bacteria 1167
303 Ga0157374_10026660 3300013296 Bacteria 5202
304 Ga0157374_10037277 3300013296 Bacteria 4461
305 Ga0157374_11465699 3300013296 Bacteria 706
306 Ga0157378_10001673 3300013297 Bacteria 19999
307 Ga0157378_10002752 3300013297 Bacteria 15669
308 Ga0157378_10004862 3300013297 Bacteria 11781
309 Ga0157378_10129077 3300013297 Bacteria 2338
310 Ga0157378_10159698 3300013297 Bacteria 2107
311 Ga0157378_10169670 3300013297 Bacteria 2046
312 Ga0157378_12710927 3300013297 Bacteria 548
313 Ga0163162_10041329 3300013306 Bacteria 4613
314 Ga0163162_10459489 3300013306 Bacteria 1405
315 Ga0157372_10148516 3300013307 Bacteria 2704
316 Ga0157372_10160711 3300013307 Bacteria 2596
317 Ga0157372_10760008 3300013307 Bacteria 1127
318 Ga0157375_10001146 3300013308 Bacteria 22918
319 Ga0157375_10131371 3300013308 Bacteria 2623
320 Ga0157375_10215461 3300013308 Bacteria 2078
321 Ga0157375_10359101 3300013308 Bacteria 1623
322 Ga0157380_10344376 3300014326 Bacteria 1392
323 Ga0157377_10003772 3300014745 Bacteria 6876
324 Ga0157376_10000756 3300014969 Bacteria 21043
325 Ga0157376_10002052 3300014969 Bacteria 13508
326 Ga0157376_10119736 3300014969 Bacteria 2331
327 Ga0157376_10300733 3300014969 Bacteria 1519
328 Ga0182005_1052662 3300015265 Unclassified 1108
329 Ga0206356_11679057 3300020070 Bacteria 514
330 Ga0206352_11339017 3300020078 Bacteria 563
331 Ga0206350_10179344 3300020080 Unclassified 658
332 Ga0224712_10280968 3300022467 Bacteria 775
333 Ga0224572_1037376 3300024225 Bacteria 918
334 Ga0228598_1013344 3300024227 Unclassified 1627
335 Ga0207697_10037764 3300025315 Bacteria 1979
336 Ga0207653_10006534 3300025885 Bacteria 3641
337 Ga0207682_10033360 3300025893 Bacteria 2072
338 Ga0207682_10049999 3300025893 Bacteria 1727
339 Ga0207642_10019662 3300025899 Bacteria 2620
340 Ga0207642_10124390 3300025899 Unclassified 1336
341 Ga0207642_10286501 3300025899 Bacteria 949
342 Ga0207710_10337982 3300025900 Bacteria 765
343 Ga0207688_10007146 3300025901 Bacteria 6073
344 Ga0207680_10003134 3300025903 Bacteria 7762
345 Ga0207680_10005853 3300025903 Bacteria 5900
346 Ga0207680_10340752 3300025903 Bacteria 1052
347 Ga0207680_11049575 3300025903 Bacteria 583
348 Ga0207685_10005019 3300025905 Bacteria 3442
349 Ga0207685_10138037 3300025905 Bacteria 1090
350 Ga0207685_10761664 3300025905 Unclassified 531
351 Ga0207699_10098907 3300025906 Bacteria 1847
352 Ga0207699_10352639 3300025906 Bacteria 1039
353 Ga0207645_10000816 3300025907 Bacteria 26089
354 Ga0207645_10001849 3300025907 Bacteria 17061
355 Ga0207643_10148109 3300025908 Bacteria 1406
356 Ga0207705_10065333 3300025909 Bacteria 2630
357 Ga0207684_10077781 3300025910 Bacteria 2822
358 Ga0207684_10082720 3300025910 Bacteria 2734
359 Ga0207684_10122257 3300025910 Bacteria 2232
360 Ga0207684_10138099 3300025910 Bacteria 2094
361 Ga0207707_10151448 3300025912 Bacteria 2027
362 Ga0207707_10429798 3300025912 Bacteria 1131
363 Ga0207695_10113923 3300025913 Bacteria 2680
364 Ga0207695_10893478 3300025913 Unclassified 768
365 Ga0207693_10550947 3300025915 Bacteria 899
366 Ga0207663_10422947 3300025916 Bacteria 1023
367 Ga0207663_11123479 3300025916 Unclassified 632
368 Ga0207660_10078981 3300025917 Bacteria 2413
369 Ga0207660_11092007 3300025917 Bacteria 650
370 Ga0207662_10000352 3300025918 Bacteria 20858
371 Ga0207662_10015626 3300025918 Bacteria 4273
372 Ga0207657_10001576 3300025919 Bacteria 24487
373 Ga0207649_10102535 3300025920 Bacteria 1897
374 Ga0207649_10285663 3300025920 Bacteria 1201
375 Ga0207652_10265783 3300025921 Bacteria 1547
376 Ga0207652_10362994 3300025921 Bacteria 1307
377 Ga0207652_11205363 3300025921 Bacteria 659
378 Ga0207646_10000002 3300025922 Bacteria 550880
379 Ga0207646_10000054 3300025922 Bacteria 160414
380 Ga0207646_10001160 3300025922 Bacteria 33445
381 Ga0207646_10086748 3300025922 Bacteria 2801
382 Ga0207646_10210160 3300025922 Bacteria 1757
383 Ga0207681_10072002 3300025923 Bacteria 2412
384 Ga0207681_10104389 3300025923 Bacteria 2050
385 Ga0207650_10002690 3300025925 Bacteria 12273
386 Ga0207650_10170259 3300025925 Bacteria 1730
387 Ga0207650_11076996 3300025925 Unclassified 684
388 Ga0207659_10020863 3300025926 Bacteria 4338
389 Ga0207659_10279133 3300025926 Bacteria 1365
390 Ga0207687_10376076 3300025927 Bacteria 1163
391 Ga0207687_10708284 3300025927 Bacteria 855
392 Ga0207700_10188101 3300025928 Bacteria 1733
393 Ga0207700_11656816 3300025928 Unclassified 565
394 Ga0207664_10342830 3300025929 Bacteria 1321
395 Ga0207644_10198814 3300025931 Bacteria 1580
396 Ga0207690_10252180 3300025932 Bacteria 1364
397 Ga0207706_10001393 3300025933 Bacteria 24144
398 Ga0207706_10028379 3300025933 Bacteria 4998
399 Ga0207706_10369541 3300025933 Bacteria 1246
400 Ga0207686_10004526 3300025934 Bacteria 7449
401 Ga0207686_10066146 3300025934 Bacteria 2308
402 Ga0207686_10261846 3300025934 Bacteria 1268
403 Ga0207709_10004532 3300025935 Bacteria 8016
404 Ga0207670_10000053 3300025936 Bacteria 85565
405 Ga0207670_10637889 3300025936 Bacteria 877
406 Ga0207670_11483836 3300025936 Bacteria 576
407 Ga0207670_11785987 3300025936 Unclassified 523
408 Ga0207669_10005484 3300025937 Bacteria 5697
409 Ga0207669_10012019 3300025937 Bacteria 4239
410 Ga0207704_10025527 3300025938 Bacteria 3225
411 Ga0207665_10160631 3300025939 Bacteria 1616
412 Ga0207665_10217650 3300025939 Bacteria 1398
413 Ga0207665_10234300 3300025939 Bacteria 1350
414 Ga0207691_10000870 3300025940 Bacteria 30029
415 Ga0207691_10004262 3300025940 Bacteria 13886
416 Ga0207711_10049366 3300025941 Bacteria 3603
417 Ga0207689_10006189 3300025942 Bacteria 10597
418 Ga0207661_10228006 3300025944 Unclassified 1649
419 Ga0207661_10342273 3300025944 Bacteria 1348
420 Ga0207661_10718813 3300025944 Bacteria 919
421 Ga0207679_10018681 3300025945 Bacteria 4649
422 Ga0207679_10078373 3300025945 Bacteria 2517
423 Ga0207679_10104725 3300025945 Bacteria 2220
424 Ga0207651_10000601 3300025960 Bacteria 15169
425 Ga0207651_10143366 3300025960 Bacteria 1848
426 Ga0207712_11965099 3300025961 Unclassified 524
427 Ga0207668_10076663 3300025972 Bacteria 2408
428 Ga0207640_10041402 3300025981 Bacteria 2930
429 Ga0207658_10273311 3300025986 Bacteria 1445
430 Ga0207658_10641917 3300025986 Unclassified 956
431 Ga0207658_10753927 3300025986 Bacteria 882
432 Ga0207677_10102633 3300026023 Bacteria 2109
433 Ga0207677_10148613 3300026023 Bacteria 1804
434 Ga0207677_10630871 3300026023 Bacteria 944
435 Ga0207678_10041910 3300026067 Bacteria 3968
436 Ga0207678_10468281 3300026067 Bacteria 1096
437 Ga0207708_10001032 3300026075 Bacteria 20847
438 Ga0207708_10001978 3300026075 Bacteria 15119
439 Ga0207708_10160025 3300026075 Bacteria 1778
440 Ga0207708_11163398 3300026075 Bacteria 674
441 Ga0207641_10363034 3300026088 Bacteria 1383
442 Ga0207641_11528495 3300026088 Bacteria 669
443 Ga0207648_10000181 3300026089 Bacteria 66545
444 Ga0207648_10005069 3300026089 Bacteria 13356
445 Ga0207674_10023369 3300026116 Bacteria 6624
446 Ga0207675_100141689 3300026118 Bacteria 2284
447 Ga0207683_10001223 3300026121 Bacteria 23303
448 Ga0207683_10002408 3300026121 Bacteria 16339
449 Ga0207698_10346390 3300026142 Bacteria 1402
450 Ga0209973_1002415 3300027252 Bacteria 1748
451 Ga0209969_1000216 3300027360 Bacteria 7724
452 Ga0209967_1000122 3300027364 Bacteria 10508
453 Ga0209967_1015523 3300027364 Bacteria 1090
454 Ga0209981_1000223 3300027378 Bacteria 7250
455 Ga0209996_1000045 3300027395 Bacteria 18099
456 Ga0209984_1000065 3300027424 Bacteria 11184
457 Ga0209984_1009482 3300027424 Bacteria 1238
458 Ga0209984_1075189 3300027424 Bacteria 506
459 Ga0210000_1000076 3300027462 Bacteria 14195
460 Ga0209995_1000065 3300027471 Bacteria 16664
461 Ga0209995_1033882 3300027471 Bacteria 858
462 Ga0209968_1000034 3300027526 Bacteria 25056
463 Ga0209999_1000616 3300027543 Bacteria 5670
464 Ga0209982_1000098 3300027552 Bacteria 8970
465 Ga0209970_1000359 3300027614 Bacteria 7652
466 Ga0210002_1000027 3300027617 Bacteria 22815
467 Ga0209588_1048753 3300027671 Bacteria 1371
468 Ga0209971_1000286 3300027682 Bacteria 14107
469 Ga0209971_1020531 3300027682 Bacteria 1571
470 Ga0209971_1030455 3300027682 Bacteria 1292
471 Ga0209966_1000222 3300027695 Bacteria 21953
472 Ga0209966_1011888 3300027695 Bacteria 1591
473 Ga0209998_10000176 3300027717 Bacteria 23626
474 Ga0209974_10000328 3300027876 Bacteria 15585
475 Ga0209974_10000545 3300027876 Bacteria 12572
476 Ga0209974_10054532 3300027876 Bacteria 1347
477 Ga0207428_10002328 3300027907 Bacteria 19030
478 Ga0207428_10002568 3300027907 Bacteria 18149
479 Ga0268266_10206173 3300028379 Bacteria 1801
480 Ga0268266_10287607 3300028379 Bacteria 1530
481 Ga0268265_10064445 3300028380 Bacteria 2823
482 Ga0268264_11083710 3300028381 Bacteria 809
483 Ga0265319_1010876 3300028563 Bacteria 3769
484 Ga0265334_10194590 3300028573 Bacteria 706
485 Ga0265318_10000439 3300028577 Bacteria 31462
486 Ga0265338_10865254 3300028800 Unclassified 617
487 Ga0265762_1017359 3300030760 Bacteria 1309
488 Ga0265770_1013571 3300030878 Bacteria 1220
489 Ga0265760_10022067 3300031090 Bacteria 1844
490 Ga0265760_10077749 3300031090 Unclassified 1024
491 Ga0265760_10291900 3300031090 Unclassified 576
492 Ga0265332_10016920 3300031238 Bacteria 3217
493 Ga0265320_10000140 3300031240 Bacteria 61452
494 Ga0265325_10204056 3300031241 Unclassified 910
495 Ga0265329_10002035 3300031242 Bacteria 9471
496 Ga0265329_10014615 3300031242 Bacteria 2767
497 Ga0265340_10005730 3300031247 Bacteria 6861
498 Ga0265331_10000041 3300031250 Bacteria 191831
499 Ga0265331_10048745 3300031250 Bacteria 2035
500 Ga0265331_10098801 3300031250 Bacteria 1345
501 Ga0265316_10002673 3300031344 Bacteria 18367
502 Ga0265316_10009564 3300031344 Bacteria 8914
503 Ga0307408_100148245 3300031548 Unclassified 1849
504 Ga0265313_10006224 3300031595 Bacteria 8521
505 Ga0265314_10026534 3300031711 Bacteria 4352
506 Ga0265342_10000124 3300031712 Bacteria 85296
507 Ga0307405_10072312 3300031731 Bacteria 2222
508 Ga0307413_10242169 3300031824 Unclassified 1332
509 Ga0307413_11872312 3300031824 Unclassified 538
510 Ga0307410_10091894 3300031852 Unclassified 2156
511 Ga0307406_10051879 3300031901 Bacteria 2606
512 Ga0307407_10119627 3300031903 Unclassified 1667
513 Ga0307412_10016024 3300031911 Bacteria 4454
514 Ga0307412_10190217 3300031911 Bacteria 1551
515 Ga0307409_100019582 3300031995 Bacteria 4587
516 Ga0307409_100064422 3300031995 Bacteria 2879
517 Ga0307409_101232964 3300031995 Bacteria 772
518 Ga0307416_100077603 3300032002 Bacteria 2790
519 Ga0307416_100194562 3300032002 Bacteria 1917
520 Ga0307414_10139658 3300032004 Bacteria 1895
521 Ga0307414_11426353 3300032004 Bacteria 644
522 Ga0307411_10308395 3300032005 Bacteria 1272
523 Ga0307415_100067501 3300032126 Bacteria 2499
524 Ga0307415_100288338 3300032126 Bacteria 1354
525 Ga0307415_100992916 3300032126 Bacteria 780
526 Ga0373926_0004739 3300035083 Bacteria 4470
527 Ga0373940_0134909 3300035088 Bacteria 776
528 Ga0373952_0181845 3300035092 Bacteria 607
529 Ga0373923_0316558 3300035111 Unclassified 741
530 Ga0373936_0037213 3300035113 Bacteria 1943
531 Ga0373953_0055979 3300035117 Bacteria 1603
532 Ga0373954_0201318 3300035118 Bacteria 978
533 Ga0373956_0193592 3300035119 Bacteria 963
534 Ga0373956_0225221 3300035119 Bacteria 890
535 Ga0373957_0093858 3300035120 Unclassified 1195
536 Ga0373960_0085963 3300035121 Unclassified 999
537 Ga0373955_0340038 3300035172 Bacteria 908
538 Ga0373961_0009234 3300035241 Bacteria 2410
539 Ga0373961_0164035 3300035241 Unclassified 765
540 Ga0373961_0223493 3300035241 Unclassified 672
541 Ga0373962_0024361 3300035242 Bacteria 1618
542 Ga0373962_0075398 3300035242 Bacteria 1015
543 Ga0373924_0165970 3300035410 Unclassified 969
544 Ga0373935_0024328 3300035692 Bacteria 3727
545 Ga0373935_1303596 3300035692 Unclassified 542
546 Ga0373927_0069235 3300035695 Bacteria 2284
547 Ga0373927_0310498 3300035695 Bacteria 1038
548 Ga0373927_0485418 3300035695 Unclassified 816
549 Ga0373933_0014214 3300035724 Bacteria 4422
550 Ga0373933_0227764 3300035724 Bacteria 1197
551 Ga0373933_0593260 3300035724 Bacteria 727
552 Ga0373933_0745062 3300035724 Bacteria 645
553 Ga0373937_0035051 3300036401 Bacteria 4565
554 Ga0373937_0118881 3300036401 Bacteria 2462
555 Ga0373925_0076561 3300037068 Bacteria 2537
556 Ga0439438_033108 3300041405 Bacteria 1367
557 Ga0439461_0011687 3300041410 Bacteria 1633
558 Ga0439466_0029467 3300041411 Bacteria 1888
559 Ga0439437_004669 3300042000 Bacteria 1498
560 Ga0439448_0098732 3300042005 Bacteria 991
561 Ga0439450_136445 3300042008 Bacteria 638
562 Ga0439455_0028267 3300042012 Unclassified 1380
563 Ga0439455_0202142 3300042012 Unclassified 575
564 Ga0450923_005616 3300042125 Unclassified 2036
565 Ga0439446_0122358 3300042156 Bacteria 838
566 Ga0439458_0052481 3300042157 Bacteria 1008
567 Ga0439435_0287007 3300042436 Unclassified 561
568 Ga0439464_0034121 3300042439 Bacteria 1434
569 Ga0439460_0091381 3300042461 Unclassified 968
570 Ga0451577_0000885 3300042876 Bacteria 44482
571 Ga0451577_0027189 3300042876 Bacteria 5178
572 Ga0451577_0067331 3300042876 Bacteria 3194
573 Ga0451577_0235158 3300042876 Bacteria 1657
574 Ga0451577_0560195 3300042876 Bacteria 1037
575 Ga0451577_0788213 3300042876 Bacteria 859
576 Ga0451577_0939340 3300042876 Bacteria 778
577 Ga0453683_0014159 3300044673 Bacteria 5184
578 Ga0453683_0014207 3300044673 Bacteria 5176
579 Ga0453683_0034684 3300044673 Unclassified 3181
580 Ga0453683_0074707 3300044673 Bacteria 2122
581 Ga0453683_0473262 3300044673 Bacteria 812
582 Ga0453683_1124894 3300044673 Bacteria 524
583 Ga0453684_0007009 3300044712 Bacteria 21065
584 Ga0453684_0050436 3300044712 Bacteria 5475
585 Ga0453684_0130041 3300044712 Bacteria 3022
586 Ga0453684_0162077 3300044712 Bacteria 2644
587 Ga0453684_1781265 3300044712 Unclassified 627
588 Ga0451576_0002419 3300045051 Bacteria 27969
589 Ga0451576_0036759 3300045051 Bacteria 5189
590 Ga0451576_0046815 3300045051 Bacteria 4552
591 Ga0451576_0074698 3300045051 Bacteria 3527
592 Ga0451576_0258020 3300045051 Bacteria 1822
593 Ga0451576_0701360 3300045051 Bacteria 1063
594 Ga0451576_0822275 3300045051 Unclassified 975
595 Ga0451576_1221899 3300045051 Bacteria 784
596 Ga0466967_0143428 3300045976 Bacteria 2226
597 Ga0466967_0542838 3300045976 Bacteria 1144
598 Ga0466967_1388620 3300045976 Bacteria 699
599 Ga0495592_0016988 3300046454 Bacteria 5525
600 Ga0495592_0206511 3300046454 Bacteria 1322
601 Ga0495603_0460916 3300046455 Unclassified 728
602 Ga0495629_0388864 3300046459 Bacteria 949
603 Ga0495651_0000133 3300046462 Bacteria 55122
604 Ga0495651_0027170 3300046462 Bacteria 4458
605 Ga0495651_0353254 3300046462 Bacteria 971
606 Ga0495651_0426347 3300046462 Bacteria 861
607 Ga0495653_0047314 3300046463 Bacteria 3327
608 Ga0495580_0017781 3300046472 Bacteria 5304
609 Ga0495580_0350557 3300046472 Bacteria 1000
610 Ga0495580_0618850 3300046472 Bacteria 714
611 Ga0495582_0170029 3300046473 Bacteria 1241
612 Ga0495639_0058938 3300046475 Bacteria 1757
613 Ga0495662_0011783 3300046476 Bacteria 4273
614 Ga0495662_0368581 3300046476 Bacteria 706
615 Ga0495664_0008170 3300046477 Bacteria 5830
616 Ga0495664_0114648 3300046477 Bacteria 1628
617 Ga0495594_0080667 3300046499 Bacteria 1816
618 Ga0495594_0355498 3300046499 Bacteria 834
619 Ga0495608_0057025 3300046511 Bacteria 2578
620 Ga0495618_0008021 3300046514 Bacteria 6392
621 Ga0495618_0267493 3300046514 Unclassified 1069
622 Ga0495618_0375641 3300046514 Bacteria 873
623 Ga0495628_0006374 3300046516 Bacteria 10311
624 Ga0495628_0307405 3300046516 Bacteria 1172
625 Ga0495628_0392985 3300046516 Bacteria 1014
626 Ga0495628_0653145 3300046516 Bacteria 747
627 Ga0495628_0909103 3300046516 Bacteria 610
628 Ga0495630_0000009 3300046517 Bacteria 305799
629 Ga0495630_0003389 3300046517 Bacteria 11100
630 Ga0495630_0039018 3300046517 Bacteria 3551
631 Ga0495630_0049420 3300046517 Bacteria 3148
632 Ga0495630_0056500 3300046517 Bacteria 2941
633 Ga0495630_0289324 3300046517 Bacteria 1252
634 Ga0495666_0059499 3300046526 Bacteria 1827
635 Ga0495666_0084259 3300046526 Bacteria 1502
636 Ga0495666_0463799 3300046526 Bacteria 567
637 Ga0495652_0019370 3300046529 Bacteria 6062
638 Ga0495652_0114813 3300046529 Bacteria 2159
639 Ga0495652_0516649 3300046529 Bacteria 826
640 Ga0495665_0000488 3300046531 Bacteria 19910
641 Ga0495665_0622710 3300046531 Unclassified 538
642 Ga0495640_0063811 3300046533 Bacteria 2493
643 Ga0495586_0004352 3300046535 Bacteria 7571
644 Ga0495586_0371757 3300046535 Bacteria 822
645 Ga0495587_0030912 3300046536 Bacteria 3246
646 Ga0495645_0012588 3300046543 Bacteria 5965
647 Ga0495667_0001795 3300046559 Bacteria 14239
648 Ga0495667_0006569 3300046559 Bacteria 7893
649 Ga0495634_0086891 3300046642 Bacteria 2036
650 Ga0495635_0008062 3300046663 Bacteria 7358
651 Ga0495635_0085165 3300046663 Bacteria 2162
652 Ga0495635_0274410 3300046663 Unclassified 1133
653 Ga0495635_0432840 3300046663 Unclassified 871
654 Ga0495657_0010028 3300046675 Bacteria 7146
655 Ga0495657_0046711 3300046675 Bacteria 2930
656 Ga0495657_0145560 3300046675 Unclassified 1474
657 Ga0495657_0377446 3300046675 Bacteria 836
658 Ga0495599_0266851 3300046678 Unclassified 1039
659 Ga0495623_0002491 3300046679 Bacteria 12214
660 Ga0495646_0476055 3300046680 Bacteria 643
661 Ga0495658_0102958 3300046683 Bacteria 1707
662 Ga0495658_0145936 3300046683 Bacteria 1450
663 Ga0495658_0407445 3300046683 Unclassified 867
664 Ga0495613_0101555 3300046689 Unclassified 2077
665 Ga0495624_0041360 3300046690 Bacteria 2948
666 Ga0495600_0009744 3300046809 Bacteria 5938
667 Ga0495600_0102321 3300046809 Bacteria 1867
668 Ga0495581_0042163 3300047315 Bacteria 2642
669 Ga0495604_0005212 3300047317 Bacteria 10298
670 Ga0495604_0012739 3300047317 Bacteria 6693
671 Ga0495636_0030451 3300047318 Bacteria 2207
672 Ga0495674_0006221 3300047319 Bacteria 11451
673 Ga0495674_0032577 3300047319 Bacteria 4727
674 Ga0495674_0040290 3300047319 Bacteria 4179
675 Ga0495674_0064800 3300047319 Bacteria 3175
676 Ga0495676_0627742 3300047321 Bacteria 698
677 Ga0495680_0000776 3300047322 Bacteria 35791
678 Ga0495680_0019706 3300047322 Bacteria 5691
679 Ga0495680_0038037 3300047322 Bacteria 3850
680 Ga0495680_0093061 3300047322 Bacteria 2257
681 Ga0495675_0000189 3300047444 Bacteria 45006
682 Ga0495675_0035688 3300047444 Bacteria 3175
683 Ga0495675_0046116 3300047444 Bacteria 2775
684 Ga0495675_0069202 3300047444 Bacteria 2229
685 Ga0495675_0077206 3300047444 Bacteria 2098
686 Ga0495684_0028190 3300047471 Bacteria 4312
687 Ga0495684_0033388 3300047471 Bacteria 3946
688 Ga0495593_0004934 3300047673 Bacteria 7908
689 Ga0495602_0067362 3300048088 Bacteria 3080
690 Ga0495602_0209859 3300048088 Bacteria 1479
691 Ga0495602_0522345 3300048088 Unclassified 827
692 Ga0495614_0061367 3300048089 Bacteria 1615
693 Ga0496101_0498450 3300048904 Unclassified 962
694 Ga0496102_0458974 3300048905 Bacteria 1195
695 Ga0496102_1018844 3300048905 Bacteria 748
696 Ga0496105_0061027 3300048908 Bacteria 3111
697 Ga0496106_0098511 3300048909 Bacteria 2265
698 Ga0496108_0020204 3300048911 Bacteria 5474
699 Ga0496111_0360376 3300048914 Bacteria 1076
700 Ga0496112_0067688 3300048915 Bacteria 3525
701 Ga0496112_0317780 3300048915 Unclassified 1502
702 Ga0496114_0029603 3300048917 Bacteria 4503
703 Ga0501290_000596 3300049513 Bacteria 5444
704 Ga0501291_000823 3300049514 Unclassified 3523
705 Ga0501291_006467 3300049514 Bacteria 1564
706 Ga0501292_000168 3300049515 Bacteria 10742
707 Ga0501293_000091 3300049516 Bacteria 5880
708 Ga0501294_000266 3300049517 Bacteria 6452
709 Ga0501295_000127 3300049518 Bacteria 7586
710 Ga0501296_000124 3300049519 Bacteria 8997
711 Ga0501297_000183 3300049520 Bacteria 6575
712 Ga0501299_000137 3300049522 Bacteria 8191
713 Ga0501299_009942 3300049522 Bacteria 1579
714 Ga0501300_000091 3300049523 Bacteria 12910
715 Ga0501301_000204 3300049524 Bacteria 3383
716 Ga0501302_000192 3300049525 Unclassified 3154
717 Ga0501303_002264 3300049526 Bacteria 1478
718 Ga0501031_0007856 3300049568 Bacteria 6943
719 Ga0501031_0024641 3300049568 Bacteria 3922
720 Ga0501031_0110242 3300049568 Bacteria 1797
721 Ga0501031_0234020 3300049568 Bacteria 1195
722 Ga0501032_0112874 3300049569 Bacteria 1798
723 Ga0501032_0151462 3300049569 Bacteria 1525
724 Ga0501032_0923148 3300049569 Bacteria 549
725 Ga0501033_0727093 3300049570 Bacteria 674
726 Ga0501036_0013265 3300049572 Bacteria 6841
727 Ga0501036_0271641 3300049572 Bacteria 1419
728 Ga0501036_0397120 3300049572 Bacteria 1150
729 Ga0501037_0030552 3300049573 Bacteria 3981
730 Ga0501037_0042528 3300049573 Bacteria 3338
731 Ga0501037_0378656 3300049573 Unclassified 973
732 Ga0501038_0191237 3300049574 Bacteria 1647
733 Ga0501038_0668934 3300049574 Bacteria 780
734 Ga0501039_0000259 3300049575 Bacteria 38736
735 Ga0501039_0024687 3300049575 Bacteria 4617
736 Ga0501039_0026928 3300049575 Bacteria 4419
737 Ga0501039_0063705 3300049575 Bacteria 2857
738 Ga0501039_0124375 3300049575 Bacteria 2023
739 Ga0501039_0125603 3300049575 Unclassified 2012
740 Ga0501039_0347647 3300049575 Bacteria 1165
741 Ga0501039_0430797 3300049575 Bacteria 1036
742 Ga0501040_0157761 3300049576 Bacteria 1603
743 Ga0501040_0255552 3300049576 Bacteria 1250
744 Ga0501040_0407963 3300049576 Bacteria 976
745 Ga0501040_0604137 3300049576 Unclassified 792
746 Ga0501041_0003282 3300049577 Bacteria 9302
747 Ga0501041_0007520 3300049577 Bacteria 6394
748 Ga0501041_0066861 3300049577 Bacteria 2203
749 Ga0501041_0087281 3300049577 Bacteria 1925
750 Ga0501041_0274045 3300049577 Bacteria 1061
751 Ga0501041_0962930 3300049577 Bacteria 549
752 Ga0501042_0011092 3300049578 Bacteria 6069
753 Ga0501042_0029514 3300049578 Bacteria 3868
754 Ga0501042_0056731 3300049578 Bacteria 2794
755 Ga0501042_0176510 3300049578 Bacteria 1541
756 Ga0501043_0095962 3300049579 Bacteria 2331
757 Ga0501043_0237026 3300049579 Bacteria 1408
758 Ga0501043_0825702 3300049579 Bacteria 669
759 Ga0501046_0008527 3300049580 Bacteria 8927
760 Ga0501046_0196868 3300049580 Bacteria 1501
761 Ga0501046_0358383 3300049580 Bacteria 1058
762 Ga0501046_0370167 3300049580 Unclassified 1038
763 Ga0501047_1097035 3300049581 Unclassified 609
764 Ga0501048_0020819 3300049582 Bacteria 4806
765 Ga0501067_0316572 3300049583 Bacteria 869
766 Ga0501068_0061113 3300049584 Bacteria 2289
767 Ga0501071_0026305 3300049587 Bacteria 4083
768 Ga0501071_0068747 3300049587 Bacteria 2578
769 Ga0501071_1022860 3300049587 Unclassified 638
770 Ga0501072_0056665 3300049588 Bacteria 3088
771 Ga0501072_1243448 3300049588 Bacteria 578
772 Ga0501075_0096426 3300049591 Unclassified 2244
773 Ga0501075_0130022 3300049591 Bacteria 1918
774 Ga0501076_0032355 3300049592 Bacteria 4081
775 Ga0501076_0071673 3300049592 Bacteria 2772
776 Ga0501076_0101851 3300049592 Bacteria 2315
777 Ga0501076_0744089 3300049592 Bacteria 809
778 Ga0501077_0043062 3300049593 Bacteria 2869
779 Ga0501077_0392024 3300049593 Bacteria 887
780 Ga0501198_000458 3300049649 Bacteria 5058
781 Ga0501199_000094 3300049650 Bacteria 6405
782 Ga0501201_000059 3300049651 Bacteria 7815
783 Ga0501206_000319 3300049653 Bacteria 5638
784 Ga0501207_000525 3300049654 Bacteria 4343
785 Ga0501208_001976 3300049655 Bacteria 2067
786 Ga0501209_009181 3300049656 Bacteria 1985
787 Ga0501210_000160 3300049657 Unclassified 2618
788 Ga0501211_001072 3300049658 Bacteria 2891
789 Ga0501216_000290 3300049660 Bacteria 5594
790 Ga0501217_000296 3300049661 Bacteria 7861
791 Ga0501223_015667 3300049663 Unclassified 1500
792 Ga0501227_004686 3300049665 Bacteria 2935
793 Ga0501228_000863 3300049666 Bacteria 2060
794 Ga0501230_000052 3300049667 Bacteria 7460
795 Ga0501233_000992 3300049668 Bacteria 4820
796 Ga0501235_002306 3300049669 Bacteria 4109
797 Ga0501236_000177 3300049670 Bacteria 6621
798 Ga0501239_000405 3300049672 Bacteria 3267
799 Ga0501240_002350 3300049673 Bacteria 1996
800 Ga0501242_034102 3300049674 Bacteria 699
801 Ga0501246_000917 3300049676 Bacteria 2201
802 Ga0501247_002159 3300049677 Bacteria 2019
803 Ga0501248_000106 3300049678 Bacteria 3735
804 Ga0501249_003923 3300049679 Bacteria 3007
805 Ga0501250_000268 3300049680 Bacteria 3224
806 Ga0501251_000523 3300049681 Bacteria 3410
807 Ga0501252_014004 3300049682 Bacteria 986
808 Ga0501253_000188 3300049683 Bacteria 4619
809 Ga0501255_002517 3300049684 Unclassified 1617
810 Ga0501256_000662 3300049685 Bacteria 2284
811 Ga0501257_007736 3300049686 Bacteria 2404
812 Ga0501258_001404 3300049687 Bacteria 1959
813 Ga0501260_000088 3300049689 Bacteria 6066
814 Ga0501261_000448 3300049690 Bacteria 5329
815 Ga0501219_001067 3300049703 Bacteria 3143
816 Ga0501219_018201 3300049703 Unclassified 590
817 Ga0501221_001674 3300049704 Unclassified 3683
818 Ga0501225_0001217 3300049705 Bacteria 8021
819 Ga0501229_001027 3300049706 Bacteria 3193
820 Ga0501234_004015 3300049707 Bacteria 2309
821 Ga0501245_000456 3300049708 Bacteria 4963
822 Ga0501079_0043565 3300049741 Bacteria 3464
823 Ga0501079_0292848 3300049741 Bacteria 1273
824 Ga0501080_0349833 3300049742 Bacteria 1335
825 Ga0501080_0440377 3300049742 Bacteria 1169
826 Ga0501080_0682945 3300049742 Bacteria 907
827 Ga0501081_0703345 3300049743 Bacteria 759
828 Ga0501232_000074 3300049757 Bacteria 4956
829 Ga0501262_000877 3300049759 Bacteria 3434
830 Ga0501265_000313 3300049762 Bacteria 4997
831 Ga0501266_000479 3300049763 Bacteria 5277
832 Ga0501268_000379 3300049765 Bacteria 4703
833 Ga0501269_001737 3300049766 Bacteria 2784
834 Ga0501270_000263 3300049767 Bacteria 4439
835 Ga0501271_000105 3300049768 Bacteria 6598
836 Ga0501272_000260 3300049769 Bacteria 4432
837 Ga0501273_000076 3300049770 Bacteria 6236
838 Ga0501274_004833 3300049771 Bacteria 1124
839 Ga0501275_000626 3300049772 Bacteria 3883
840 Ga0501276_000427 3300049773 Unclassified 2560
841 Ga0501278_000475 3300049774 Bacteria 3121
842 Ga0501279_000219 3300049775 Bacteria 7997
843 Ga0501280_003447 3300049776 Bacteria 2430
844 Ga0501281_01061 3300049777 Bacteria 2254
845 Ga0501282_000187 3300049778 Bacteria 7575
846 Ga0501283_000084 3300049779 Bacteria 11644
847 Ga0501283_033640 3300049779 Bacteria 868
848 Ga0501035_0078709 3300049822 Bacteria 2912
849 Ga0501035_0087901 3300049822 Bacteria 2739
850 Ga0501045_0103836 3300049824 Bacteria 2105
851 Ga0501045_0627112 3300049824 Bacteria 795
852 Ga0501204_012958 3300049850 Bacteria 1007
853 Ga0501212_003312 3300049851 Bacteria 2012
854 Ga0501220_00817 3300049852 Bacteria 1033
855 Ga0501226_006179 3300049853 Bacteria 1359
856 nmdc:mga05p37_217721_c1 3300050507 Bacteria 2306
857 nmdc:mga05p37_232437_c1 3300050507 Bacteria 2221
858 nmdc:mga05p37_516642_c1 3300050507 Unclassified 1367
859 nmdc:mga05p37_689088_c1 3300050507 Unclassified 664
860 nmdc:mga05p37_714191_c1 3300050507 Unclassified 1111
861 nmdc:mga05p37_9370_c1 3300050507 Bacteria 11588
862 nmdc:mga09592_18965_c1 3300050508 Bacteria 5644
863 nmdc:mga09592_37184_c1 3300050508 Bacteria 4083
864 nmdc:mga09592_70775_c1 3300050508 Bacteria 2960
865 nmdc:mga09592_73782_c1 3300050508 Bacteria 2900
866 nmdc:mga0qj67_243258_c1 3300050509 Bacteria 1460
867 nmdc:mga0qj67_3453_c1 3300050509 Bacteria 11387
868 nmdc:mga0qj67_739313_c1 3300050509 Bacteria 781
869 nmdc:mga06r32_1269608_c1 3300050510 Eukaryota 681
870 nmdc:mga06r32_46745_c1 3300050510 Bacteria 4130
871 nmdc:mga08y16_3045_c1 3300050511 Bacteria 17316
872 nmdc:mga08y16_42567_c1 3300050511 Bacteria 4757
873 nmdc:mga0n895_48754_c1 3300050512 Bacteria 4148
874 nmdc:mga0n895_63614_c1 3300050512 Bacteria 3648
875 nmdc:mga0n895_704614_c1 3300050512 Unclassified 1005
876 nmdc:mga0rr50_185639_c1 3300050513 Bacteria 1702
877 nmdc:mga0rr50_32887_c1 3300050513 Bacteria 3701
878 nmdc:mga0rr50_414627_c1 3300050513 Bacteria 1139
879 nmdc:mga0rr50_909572_c1 3300050513 Unclassified 750
880 nmdc:mga08x19_115395_c1 3300050514 Bacteria 1795
881 nmdc:mga08x19_121143_c1 3300050514 Bacteria 1754
882 nmdc:mga08x19_45660_c1 3300050514 Bacteria 2799
883 nmdc:mga0a205_1032725_c1 3300050515 Unclassified 669
884 nmdc:mga0a205_188639_c1 3300050515 Bacteria 1954
885 nmdc:mga0a205_23376_c1 3300050515 Bacteria 5863
886 nmdc:mga0a205_24681_c1 3300050515 Bacteria 5720
887 nmdc:mga0a205_47014_c1 3300050515 Bacteria 4163
888 Ga0495612_0000625 3300053078 Bacteria 14181
889 Ga0495595_0439141 3300053084 Unclassified 663
890 Ga0495619_0072722 3300053085 Bacteria 2303
891 Ga0495619_0680632 3300053085 Bacteria 700
892 Ga0501084_0031657 3300054114 Bacteria 4422
893 Ga0590075_042208 3300059424 Bacteria 1166
894 Ga0590077_024193 3300059426 Unclassified 1304
895 Ga0501082_0096087 3300060353 Bacteria 2561
896 Ga0501082_0479154 3300060353 Bacteria 1088
897 Ga0501082_0990695 3300060353 Bacteria 735
898 Ga0530510_0470836 3300061734 Bacteria 951
899 Ga0070688_100693764
900 SwRhRL2b_contig_3098461
901 MBSR1b_contig_11399222
902 MBSR1b_contig_1366838
903 MBSR1b_contig_6479971
904 JGI24737J22298_10075309
905 JGI24033J26618_1016908
906 JGI26128J50194_1003181
907 JGI26129J50193_1001555
908 JGI26145J50221_1000561
909 JGI26140J50224_102308
910 JGI26134J50242_100742
911 JGI26136J50244_100585
912 JGI26131J50246_101860
913 JGI26132J50249_101294
914 Ga0058863_11536952
915 Ga0058861_11487509
916 Ga0058862_12291842
917 Ga0065716_1009788
918 Ga0065714_10325405
919 Ga0065704_10072118
920 Ga0065712_10024731
921 Ga0065715_10006020
922 Ga0065715_10508887
923 Ga0065715_10979395
924 Ga0065707_10083597
925 Ga0065707_10204501
926 Ga0065707_10294391
927 Ga0070658_11018639
928 Ga0070676_10002068
929 Ga0070676_10014982
930 Ga0070683_100081151
931 Ga0070683_100493197
932 Ga0070690_100003571
933 Ga0070690_100007665
934 Ga0070690_100011134
935 Ga0070690_100091108
936 Ga0070690_100265558
937 Ga0070670_100003892
938 Ga0070670_100005867
939 Ga0070670_100146333
940 Ga0070677_10019583
941 Ga0070677_10019972
942 Ga0068869_100054290
943 Ga0068869_100345245
944 Ga0068869_101221253
945 Ga0070666_10002093
946 Ga0070666_10020870
947 Ga0070666_10322016
948 Ga0070680_100002097
949 Ga0070680_100371663
950 Ga0070682_100446792
951 Ga0070682_100811848
952 Ga0070682_101595288
953 Ga0068868_100021963
954 Ga0068868_100036007
955 Ga0068868_100709941
956 Ga0070660_100007210
957 Ga0070689_100000081
958 Ga0070689_100007586
959 Ga0070689_100550331
960 Ga0070689_100777942
961 Ga0070689_100994667
962 Ga0070691_10052857
963 Ga0070691_10233554
964 Ga0070687_100007956
965 Ga0070687_100012805
966 Ga0070687_100037369
967 Ga0070661_100020862
968 Ga0070661_100047799
969 Ga0070669_100094986
970 Ga0070669_100437839
971 Ga0070675_100004564
972 Ga0070675_100014323
973 Ga0070671_100003618
974 Ga0070674_100001987
975 Ga0070674_100018373
976 Ga0070674_100037200
977 Ga0070673_100000165
978 Ga0070688_100000241
979 Ga0070688_100028746
980 Ga0070688_100255938
981 Ga0070659_100033907
982 Ga0070659_100872448
983 Ga0070667_100013530
984 Ga0070667_100147636
985 Ga0070667_101982149
986 Ga0070709_10084460
987 Ga0070709_10990788
988 Ga0070709_11732898
989 Ga0070714_100332814
990 Ga0070714_100450336
991 Ga0070713_100032631
992 Ga0070713_100249838
993 Ga0070713_100646202
994 Ga0070713_102345903
995 Ga0070701_10000085
996 Ga0070701_10041041
997 Ga0070701_10160044
998 Ga0070711_100043840
999 Ga0070711_100236028
1000 Ga0070711_101478780
1001 Ga0070705_100069821
1002 Ga0070700_100001201
1003 Ga0070700_100026596
1004 Ga0070700_100073734
1005 Ga0070700_100468628
1006 Ga0070694_100133408
1007 Ga0070694_100223772
1008 Ga0070694_100449007
1009 Ga0070708_100052594
1010 Ga0070708_100319883
1011 Ga0070708_100358704
1012 Ga0070708_100524246
1013 Ga0070708_101274862
1014 Ga0070663_100037356
1015 Ga0070663_100280647
1016 Ga0070678_100005988
1017 Ga0070678_100007798
1018 Ga0070678_100448810
1019 Ga0070662_100000802
1020 Ga0070662_100109033
1021 Ga0070662_100576218
1022 Ga0070662_100620765
1023 Ga0070681_10001263
1024 Ga0070681_10022902
1025 Ga0070681_10481000
1026 Ga0068867_100010665
1027 Ga0068867_100014838
1028 Ga0068867_100090189
1029 Ga0068867_101923854
1030 Ga0070685_10000038
1031 Ga0070685_10041135
1032 Ga0070685_10046744
1033 Ga0070706_100096076
1034 Ga0070706_100368848
1035 Ga0070706_100416882
1036 Ga0070706_100610691
1037 Ga0070707_100000025
1038 Ga0070707_100000190
1039 Ga0070707_100003340
1040 Ga0070707_100145165
1041 Ga0070707_100430776
1042 Ga0070707_102266286
1043 Ga0070698_100018005
1044 Ga0070698_100019346
1045 Ga0070698_100260146
1046 Ga0070698_100661558
1047 Ga0070698_101220326
1048 Ga0070699_100041739
1049 Ga0070699_100045770
1050 Ga0070699_100168797
1051 Ga0070699_100963033
1052 Ga0070699_101220549
1053 Ga0070679_100074038
1054 Ga0070679_100604753
1055 Ga0070679_100706994
1056 Ga0070684_100055282
1057 Ga0070697_100030452
1058 Ga0070697_100110158
1059 Ga0070697_100116870
1060 Ga0070697_100118038
1061 Ga0070697_100218045
1062 Ga0070697_100396063
1063 Ga0070697_100638678
1064 Ga0070697_101877292
1065 Ga0068853_101291100
1066 Ga0070672_100001107
1067 Ga0070672_100305707
1068 Ga0070686_100000189
1069 Ga0070686_100008451
1070 Ga0070686_100015467
1071 Ga0070686_100058000
1072 Ga0070686_100265013
1073 Ga0070695_100033536
1074 Ga0070695_100034160
1075 Ga0070695_100076398
1076 Ga0070695_100548875
1077 Ga0070695_100605181
1078 Ga0070695_100671980
1079 Ga0070696_100015885
1080 Ga0070696_100054033
1081 Ga0070696_100415740
1082 Ga0070693_100010301
1083 Ga0070693_100929485
1084 Ga0070665_100017033
1085 Ga0070665_100261803
1086 Ga0070704_100010083
1087 Ga0070704_100051390
1088 Ga0070704_100060199
1089 Ga0070704_100213647
1090 Ga0070664_100079786
1091 Ga0068857_100017459
1092 Ga0070702_100040740
1093 Ga0070702_100069902
1094 Ga0070702_100729792
1095 Ga0068859_100001732
1096 Ga0068859_100128404
1097 Ga0068859_102014727
1098 Ga0068859_102774989
1099 Ga0068866_10106644
1100 Ga0068861_100039277
1101 Ga0068851_10165104
1102 Ga0068870_10001055
1103 Ga0068863_100369190
1104 Ga0068863_101398474
1105 Ga0068858_100189327
1106 Ga0068858_100199356
1107 Ga0068860_100011445
1108 Ga0068860_101871736
1109 Ga0068862_100031296
1110 Ga0081455_10003551
1111 Ga0081455_10155919
1112 Ga0070717_10056863
1113 Ga0070717_10714167
1114 Ga0070717_11544411
1115 Ga0075432_10000545
1116 Ga0070715_10143175
1117 Ga0070715_10240070
1118 Ga0070716_100061012
1119 Ga0070712_100758575
1120 Ga0075427_10000956
1121 Ga0097621_100019150
1122 Ga0097621_100044572
1123 Ga0097621_100096876
1124 Ga0068871_100026242
1125 Ga0068871_100077713
1126 Ga0068871_100399529
1127 Ga0068871_100605461
1128 Ga0068871_101231086
1129 Ga0075428_100126114
1130 Ga0075428_100355295
1131 Ga0075428_100700287
1132 Ga0075430_100000881
1133 Ga0075430_100001970
1134 Ga0075430_100027202
1135 Ga0075430_100549086
1136 Ga0075430_100916276
1137 Ga0075431_100008565
1138 Ga0075431_100065696
1139 Ga0075431_100691611
1140 Ga0075431_101959743
1141 Ga0075433_10039498
1142 Ga0075433_10055110
1143 Ga0075433_10059767
1144 Ga0075433_10170589
1145 Ga0075433_11950568
1146 Ga0075434_100028211
1147 Ga0075434_100365029
1148 Ga0075429_100001415
1149 Ga0075429_100034112
1150 Ga0075429_100037332
1151 Ga0075429_100131029
1152 Ga0068865_100099312
1153 Ga0068865_100243790
1154 Ga0075436_100130127
1155 Ga0075436_100357741
1156 Ga0097620_100001732
1157 Ga0097620_100128405
1158 Ga0097620_102015169
1159 Ga0097620_102774554
1160 Ga0075435_100022814
1161 Ga0075435_100027269
1162 Ga0099794_10465136
1163 Ga0099795_10042582
1164 Ga0105240_10053334
1165 Ga0105240_10063425
1166 Ga0105240_10441420
1167 Ga0105240_12088518
1168 Ga0111539_10001494
1169 Ga0111539_10063514
1170 Ga0111539_10118138
1171 Ga0105245_10004145
1172 Ga0105245_10210477
1173 Ga0105245_10459106
1174 Ga0105247_10586695
1175 Ga0114129_10010292
1176 Ga0114129_10016441
1177 Ga0114129_10055075
1178 Ga0114129_10511068
1179 Ga0114129_10809396
1180 Ga0114129_10832038
1181 Ga0114129_12263430
1182 Ga0105243_10002277
1183 Ga0105243_10713212
1184 Ga0105243_10912388
1185 Ga0105242_10000981
1186 Ga0105242_10027992
1187 Ga0105242_10326433
1188 Ga0105242_12901813
1189 Ga0105248_10003541
1190 Ga0105238_10215046
1191 Ga0105249_10017552
1192 Ga0099796_10100585
1193 Ga0099796_10114203
1194 Ga0105239_10018468
1195 Ga0105239_11397270
1196 Ga0105246_10000570
1197 Ga0157373_10142159
1198 Ga0157371_10010918
1199 Ga0157371_10452788
1200 Ga0157369_10572488
1201 Ga0157374_10026660
1202 Ga0157374_10037277
1203 Ga0157374_11465699
1204 Ga0157378_10001673
1205 Ga0157378_10002752
1206 Ga0157378_10004862
1207 Ga0157378_10129077
1208 Ga0157378_10159698
1209 Ga0157378_10169670
1210 Ga0157378_12710927
1211 Ga0163162_10041329
1212 Ga0163162_10459489
1213 Ga0157372_10148516
1214 Ga0157372_10160711
1215 Ga0157372_10760008
1216 Ga0157375_10001146
1217 Ga0157375_10131371
1218 Ga0157375_10215461
1219 Ga0157375_10359101
1220 Ga0157380_10344376
1221 Ga0157377_10003772
1222 Ga0157376_10000756
1223 Ga0157376_10002052
1224 Ga0157376_10119736
1225 Ga0157376_10300733
1226 Ga0182005_1052662
1227 Ga0206356_11679057
1228 Ga0206352_11339017
1229 Ga0206350_10179344
1230 Ga0224712_10280968
1231 Ga0224572_1037376
1232 Ga0228598_1013344
1233 Ga0207697_10037764
1234 Ga0207653_10006534
1235 Ga0207682_10033360
1236 Ga0207682_10049999
1237 Ga0207642_10019662
1238 Ga0207642_10124390
1239 Ga0207642_10286501
1240 Ga0207710_10337982
1241 Ga0207688_10007146
1242 Ga0207680_10003134
1243 Ga0207680_10005853
1244 Ga0207680_10340752
1245 Ga0207680_11049575
1246 Ga0207685_10005019
1247 Ga0207685_10138037
1248 Ga0207685_10761664
1249 Ga0207699_10098907
1250 Ga0207699_10352639
1251 Ga0207645_10000816
1252 Ga0207645_10001849
1253 Ga0207643_10148109
1254 Ga0207705_10065333
1255 Ga0207684_10077781
1256 Ga0207684_10082720
1257 Ga0207684_10122257
1258 Ga0207684_10138099
1259 Ga0207707_10151448
1260 Ga0207707_10429798
1261 Ga0207695_10113923
1262 Ga0207695_10893478
1263 Ga0207693_10550947
1264 Ga0207663_10422947
1265 Ga0207663_11123479
1266 Ga0207660_10078981
1267 Ga0207660_11092007
1268 Ga0207662_10000352
1269 Ga0207662_10015626
1270 Ga0207657_10001576
1271 Ga0207649_10102535
1272 Ga0207649_10285663
1273 Ga0207652_10265783
1274 Ga0207652_10362994
1275 Ga0207652_11205363
1276 Ga0207646_10000002
1277 Ga0207646_10000054
1278 Ga0207646_10001160
1279 Ga0207646_10086748
1280 Ga0207646_10210160
1281 Ga0207681_10072002
1282 Ga0207681_10104389
1283 Ga0207650_10002690
1284 Ga0207650_10170259
1285 Ga0207650_11076996
1286 Ga0207659_10020863
1287 Ga0207659_10279133
1288 Ga0207687_10376076
1289 Ga0207687_10708284
1290 Ga0207700_10188101
1291 Ga0207700_11656816
1292 Ga0207664_10342830
1293 Ga0207644_10198814
1294 Ga0207690_10252180
1295 Ga0207706_10001393
1296 Ga0207706_10028379
1297 Ga0207706_10369541
1298 Ga0207686_10004526
1299 Ga0207686_10066146
1300 Ga0207686_10261846
1301 Ga0207709_10004532
1302 Ga0207670_10000053
1303 Ga0207670_10637889
1304 Ga0207670_11483836
1305 Ga0207670_11785987
1306 Ga0207669_10005484
1307 Ga0207669_10012019
1308 Ga0207704_10025527
1309 Ga0207665_10160631
1310 Ga0207665_10217650
1311 Ga0207665_10234300
1312 Ga0207691_10000870
1313 Ga0207691_10004262
1314 Ga0207711_10049366
1315 Ga0207689_10006189
1316 Ga0207661_10228006
1317 Ga0207661_10342273
1318 Ga0207661_10718813
1319 Ga0207679_10018681
1320 Ga0207679_10078373
1321 Ga0207679_10104725
1322 Ga0207651_10000601
1323 Ga0207651_10143366
1324 Ga0207712_11965099
1325 Ga0207668_10076663
1326 Ga0207640_10041402
1327 Ga0207658_10273311
1328 Ga0207658_10641917
1329 Ga0207658_10753927
1330 Ga0207677_10102633
1331 Ga0207677_10148613
1332 Ga0207677_10630871
1333 Ga0207678_10041910
1334 Ga0207678_10468281
1335 Ga0207708_10001032
1336 Ga0207708_10001978
1337 Ga0207708_10160025
1338 Ga0207708_11163398
1339 Ga0207641_10363034
1340 Ga0207641_11528495
1341 Ga0207648_10000181
1342 Ga0207648_10005069
1343 Ga0207674_10023369
1344 Ga0207675_100141689
1345 Ga0207683_10001223
1346 Ga0207683_10002408
1347 Ga0207698_10346390
1348 Ga0209973_1002415
1349 Ga0209969_1000216
1350 Ga0209967_1000122
1351 Ga0209967_1015523
1352 Ga0209981_1000223
1353 Ga0209996_1000045
1354 Ga0209984_1000065
1355 Ga0209984_1009482
1356 Ga0209984_1075189
1357 Ga0210000_1000076
1358 Ga0209995_1000065
1359 Ga0209995_1033882
1360 Ga0209968_1000034
1361 Ga0209999_1000616
1362 Ga0209982_1000098
1363 Ga0209970_1000359
1364 Ga0210002_1000027
1365 Ga0209588_1048753
1366 Ga0209971_1000286
1367 Ga0209971_1020531
1368 Ga0209971_1030455
1369 Ga0209966_1000222
1370 Ga0209966_1011888
1371 Ga0209998_10000176
1372 Ga0209974_10000328
1373 Ga0209974_10000545
1374 Ga0209974_10054532
1375 Ga0207428_10002328
1376 Ga0207428_10002568
1377 Ga0268266_10206173
1378 Ga0268266_10287607
1379 Ga0268265_10064445
1380 Ga0268264_11083710
1381 Ga0265319_1010876
1382 Ga0265334_10194590
1383 Ga0265318_10000439
1384 Ga0265338_10865254
1385 Ga0265762_1017359
1386 Ga0265770_1013571
1387 Ga0265760_10022067
1388 Ga0265760_10077749
1389 Ga0265760_10291900
1390 Ga0265332_10016920
1391 Ga0265320_10000140
1392 Ga0265325_10204056
1393 Ga0265329_10002035
1394 Ga0265329_10014615
1395 Ga0265340_10005730
1396 Ga0265331_10000041
1397 Ga0265331_10048745
1398 Ga0265331_10098801
1399 Ga0265316_10002673
1400 Ga0265316_10009564
1401 Ga0307408_100148245
1402 Ga0265313_10006224
1403 Ga0265314_10026534
1404 Ga0265342_10000124
1405 Ga0307405_10072312
1406 Ga0307413_10242169
1407 Ga0307413_11872312
1408 Ga0307410_10091894
1409 Ga0307406_10051879
1410 Ga0307407_10119627
1411 Ga0307412_10016024
1412 Ga0307412_10190217
1413 Ga0307409_100019582
1414 Ga0307409_100064422
1415 Ga0307409_101232964
1416 Ga0307416_100077603
1417 Ga0307416_100194562
1418 Ga0307414_10139658
1419 Ga0307414_11426353
1420 Ga0307411_10308395
1421 Ga0307415_100067501
1422 Ga0307415_100288338
1423 Ga0307415_100992916
1424 Ga0373926_0004739
1425 Ga0373940_0134909
1426 Ga0373952_0181845
1427 Ga0373923_0316558
1428 Ga0373936_0037213
1429 Ga0373953_0055979
1430 Ga0373954_0201318
1431 Ga0373956_0193592
1432 Ga0373956_0225221
1433 Ga0373957_0093858
1434 Ga0373960_0085963
1435 Ga0373955_0340038
1436 Ga0373961_0009234
1437 Ga0373961_0164035
1438 Ga0373961_0223493
1439 Ga0373962_0024361
1440 Ga0373962_0075398
1441 Ga0373924_0165970
1442 Ga0373935_0024328
1443 Ga0373935_1303596
1444 Ga0373927_0069235
1445 Ga0373927_0310498
1446 Ga0373927_0485418
1447 Ga0373933_0014214
1448 Ga0373933_0227764
1449 Ga0373933_0593260
1450 Ga0373933_0745062
1451 Ga0373937_0035051
1452 Ga0373937_0118881
1453 Ga0373925_0076561
1454 Ga0439438_033108
1455 Ga0439461_0011687
1456 Ga0439466_0029467
1457 Ga0439437_004669
1458 Ga0439448_0098732
1459 Ga0439450_136445
1460 Ga0439455_0028267
1461 Ga0439455_0202142
1462 Ga0450923_005616
1463 Ga0439446_0122358
1464 Ga0439458_0052481
1465 Ga0439435_0287007
1466 Ga0439464_0034121
1467 Ga0439460_0091381
1468 Ga0451577_0000885
1469 Ga0451577_0027189
1470 Ga0451577_0067331
1471 Ga0451577_0235158
1472 Ga0451577_0560195
1473 Ga0451577_0788213
1474 Ga0451577_0939340
1475 Ga0453683_0014159
1476 Ga0453683_0014207
1477 Ga0453683_0034684
1478 Ga0453683_0074707
1479 Ga0453683_0473262
1480 Ga0453683_1124894
1481 Ga0453684_0007009
1482 Ga0453684_0050436
1483 Ga0453684_0130041
1484 Ga0453684_0162077
1485 Ga0453684_1781265
1486 Ga0451576_0002419
1487 Ga0451576_0036759
1488 Ga0451576_0046815
1489 Ga0451576_0074698
1490 Ga0451576_0258020
1491 Ga0451576_0701360
1492 Ga0451576_0822275
1493 Ga0451576_1221899
1494 Ga0466967_0143428
1495 Ga0466967_0542838
1496 Ga0466967_1388620
1497 Ga0495592_0016988
1498 Ga0495592_0206511
1499 Ga0495603_0460916
1500 Ga0495629_0388864
1501 Ga0495651_0000133
1502 Ga0495651_0027170
1503 Ga0495651_0353254
1504 Ga0495651_0426347
1505 Ga0495653_0047314
1506 Ga0495580_0017781
1507 Ga0495580_0350557
1508 Ga0495580_0618850
1509 Ga0495582_0170029
1510 Ga0495639_0058938
1511 Ga0495662_0011783
1512 Ga0495662_0368581
1513 Ga0495664_0008170
1514 Ga0495664_0114648
1515 Ga0495594_0080667
1516 Ga0495594_0355498
1517 Ga0495608_0057025
1518 Ga0495618_0008021
1519 Ga0495618_0267493
1520 Ga0495618_0375641
1521 Ga0495628_0006374
1522 Ga0495628_0307405
1523 Ga0495628_0392985
1524 Ga0495628_0653145
1525 Ga0495628_0909103
1526 Ga0495630_0000009
1527 Ga0495630_0003389
1528 Ga0495630_0039018
1529 Ga0495630_0049420
1530 Ga0495630_0056500
1531 Ga0495630_0289324
1532 Ga0495666_0059499
1533 Ga0495666_0084259
1534 Ga0495666_0463799
1535 Ga0495652_0019370
1536 Ga0495652_0114813
1537 Ga0495652_0516649
1538 Ga0495665_0000488
1539 Ga0495665_0622710
1540 Ga0495640_0063811
1541 Ga0495586_0004352
1542 Ga0495586_0371757
1543 Ga0495587_0030912
1544 Ga0495645_0012588
1545 Ga0495667_0001795
1546 Ga0495667_0006569
1547 Ga0495634_0086891
1548 Ga0495635_0008062
1549 Ga0495635_0085165
1550 Ga0495635_0274410
1551 Ga0495635_0432840
1552 Ga0495657_0010028
1553 Ga0495657_0046711
1554 Ga0495657_0145560
1555 Ga0495657_0377446
1556 Ga0495599_0266851
1557 Ga0495623_0002491
1558 Ga0495646_0476055
1559 Ga0495658_0102958
1560 Ga0495658_0145936
1561 Ga0495658_0407445
1562 Ga0495613_0101555
1563 Ga0495624_0041360
1564 Ga0495600_0009744
1565 Ga0495600_0102321
1566 Ga0495581_0042163
1567 Ga0495604_0005212
1568 Ga0495604_0012739
1569 Ga0495636_0030451
1570 Ga0495674_0006221
1571 Ga0495674_0032577
1572 Ga0495674_0040290
1573 Ga0495674_0064800
1574 Ga0495676_0627742
1575 Ga0495680_0000776
1576 Ga0495680_0019706
1577 Ga0495680_0038037
1578 Ga0495680_0093061
1579 Ga0495675_0000189
1580 Ga0495675_0035688
1581 Ga0495675_0046116
1582 Ga0495675_0069202
1583 Ga0495675_0077206
1584 Ga0495684_0028190
1585 Ga0495684_0033388
1586 Ga0495593_0004934
1587 Ga0495602_0067362
1588 Ga0495602_0209859
1589 Ga0495602_0522345
1590 Ga0495614_0061367
1591 Ga0496101_0498450
1592 Ga0496102_0458974
1593 Ga0496102_1018844
1594 Ga0496105_0061027
1595 Ga0496106_0098511
1596 Ga0496108_0020204
1597 Ga0496111_0360376
1598 Ga0496112_0067688
1599 Ga0496112_0317780
1600 Ga0496114_0029603
1601 Ga0501290_000596
1602 Ga0501291_000823
1603 Ga0501291_006467
1604 Ga0501292_000168
1605 Ga0501293_000091
1606 Ga0501294_000266
1607 Ga0501295_000127
1608 Ga0501296_000124
1609 Ga0501297_000183
1610 Ga0501299_000137
1611 Ga0501299_009942
1612 Ga0501300_000091
1613 Ga0501301_000204
1614 Ga0501302_000192
1615 Ga0501303_002264
1616 Ga0501031_0007856
1617 Ga0501031_0024641
1618 Ga0501031_0110242
1619 Ga0501031_0234020
1620 Ga0501032_0112874
1621 Ga0501032_0151462
1622 Ga0501032_0923148
1623 Ga0501033_0727093
1624 Ga0501036_0013265
1625 Ga0501036_0271641
1626 Ga0501036_0397120
1627 Ga0501037_0030552
1628 Ga0501037_0042528
1629 Ga0501037_0378656
1630 Ga0501038_0191237
1631 Ga0501038_0668934
1632 Ga0501039_0000259
1633 Ga0501039_0024687
1634 Ga0501039_0026928
1635 Ga0501039_0063705
1636 Ga0501039_0124375
1637 Ga0501039_0125603
1638 Ga0501039_0347647
1639 Ga0501039_0430797
1640 Ga0501040_0157761
1641 Ga0501040_0255552
1642 Ga0501040_0407963
1643 Ga0501040_0604137
1644 Ga0501041_0003282
1645 Ga0501041_0007520
1646 Ga0501041_0066861
1647 Ga0501041_0087281
1648 Ga0501041_0274045
1649 Ga0501041_0962930
1650 Ga0501042_0011092
1651 Ga0501042_0029514
1652 Ga0501042_0056731
1653 Ga0501042_0176510
1654 Ga0501043_0095962
1655 Ga0501043_0237026
1656 Ga0501043_0825702
1657 Ga0501046_0008527
1658 Ga0501046_0196868
1659 Ga0501046_0358383
1660 Ga0501046_0370167
1661 Ga0501047_1097035
1662 Ga0501048_0020819
1663 Ga0501067_0316572
1664 Ga0501068_0061113
1665 Ga0501071_0026305
1666 Ga0501071_0068747
1667 Ga0501071_1022860
1668 Ga0501072_0056665
1669 Ga0501072_1243448
1670 Ga0501075_0096426
1671 Ga0501075_0130022
1672 Ga0501076_0032355
1673 Ga0501076_0071673
1674 Ga0501076_0101851
1675 Ga0501076_0744089
1676 Ga0501077_0043062
1677 Ga0501077_0392024
1678 Ga0501198_000458
1679 Ga0501199_000094
1680 Ga0501201_000059
1681 Ga0501206_000319
1682 Ga0501207_000525
1683 Ga0501208_001976
1684 Ga0501209_009181
1685 Ga0501210_000160
1686 Ga0501211_001072
1687 Ga0501216_000290
1688 Ga0501217_000296
1689 Ga0501223_015667
1690 Ga0501227_004686
1691 Ga0501228_000863
1692 Ga0501230_000052
1693 Ga0501233_000992
1694 Ga0501235_002306
1695 Ga0501236_000177
1696 Ga0501239_000405
1697 Ga0501240_002350
1698 Ga0501242_034102
1699 Ga0501246_000917
1700 Ga0501247_002159
1701 Ga0501248_000106
1702 Ga0501249_003923
1703 Ga0501250_000268
1704 Ga0501251_000523
1705 Ga0501252_014004
1706 Ga0501253_000188
1707 Ga0501255_002517
1708 Ga0501256_000662
1709 Ga0501257_007736
1710 Ga0501258_001404
1711 Ga0501260_000088
1712 Ga0501261_000448
1713 Ga0501219_001067
1714 Ga0501219_018201
1715 Ga0501221_001674
1716 Ga0501225_0001217
1717 Ga0501229_001027
1718 Ga0501234_004015
1719 Ga0501245_000456
1720 Ga0501079_0043565
1721 Ga0501079_0292848
1722 Ga0501080_0349833
1723 Ga0501080_0440377
1724 Ga0501080_0682945
1725 Ga0501081_0703345
1726 Ga0501232_000074
1727 Ga0501262_000877
1728 Ga0501265_000313
1729 Ga0501266_000479
1730 Ga0501268_000379
1731 Ga0501269_001737
1732 Ga0501270_000263
1733 Ga0501271_000105
1734 Ga0501272_000260
1735 Ga0501273_000076
1736 Ga0501274_004833
1737 Ga0501275_000626
1738 Ga0501276_000427
1739 Ga0501278_000475
1740 Ga0501279_000219
1741 Ga0501280_003447
1742 Ga0501281_01061
1743 Ga0501282_000187
1744 Ga0501283_000084
1745 Ga0501283_033640
1746 Ga0501035_0078709
1747 Ga0501035_0087901
1748 Ga0501045_0103836
1749 Ga0501045_0627112
1750 Ga0501204_012958
1751 Ga0501212_003312
1752 Ga0501220_00817
1753 Ga0501226_006179
1754 nmdc:mga05p37_217721_c1
1755 nmdc:mga05p37_232437_c1
1756 nmdc:mga05p37_516642_c1
1757 nmdc:mga05p37_689088_c1
1758 nmdc:mga05p37_714191_c1
1759 nmdc:mga05p37_9370_c1
1760 nmdc:mga09592_18965_c1
1761 nmdc:mga09592_37184_c1
1762 nmdc:mga09592_70775_c1
1763 nmdc:mga09592_73782_c1
1764 nmdc:mga0qj67_243258_c1
1765 nmdc:mga0qj67_3453_c1
1766 nmdc:mga0qj67_739313_c1
1767 nmdc:mga06r32_1269608_c1
1768 nmdc:mga06r32_46745_c1
1769 nmdc:mga08y16_3045_c1
1770 nmdc:mga08y16_42567_c1
1771 nmdc:mga0n895_48754_c1
1772 nmdc:mga0n895_63614_c1
1773 nmdc:mga0n895_704614_c1
1774 nmdc:mga0rr50_185639_c1
1775 nmdc:mga0rr50_32887_c1
1776 nmdc:mga0rr50_414627_c1
1777 nmdc:mga0rr50_909572_c1
1778 nmdc:mga08x19_115395_c1
1779 nmdc:mga08x19_121143_c1
1780 nmdc:mga08x19_45660_c1
1781 nmdc:mga0a205_1032725_c1
1782 nmdc:mga0a205_188639_c1
1783 nmdc:mga0a205_23376_c1
1784 nmdc:mga0a205_24681_c1
1785 nmdc:mga0a205_47014_c1
1786 Ga0495612_0000625
1787 Ga0495595_0439141
1788 Ga0495619_0072722
1789 Ga0495619_0680632
1790 Ga0501084_0031657
1791 Ga0590075_042208
1792 Ga0590077_024193
1793 Ga0501082_0096087
1794 Ga0501082_0479154
1795 Ga0501082_0990695
1796 Ga0530510_0470836

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00111

Fer2

2Fe-2S iron-sulfur cluster binding domain

59

129

0.77

Structural Annotation

Top 5 Hits

ID Description Score Start End
7plo-assembly1.cif.gz_R h. sapiens replisome-cul2/lrr1 complex 0.9584 21 34
6bvb-assembly1.cif.gz_C crystal structure of hif-2alpha-pvhl-elongin b-elongin c 0.9381 21 34
7jtp-assembly1.cif.gz_K crystal structure of protac ms67 in complex with the wd repeat-containing protein 5 and pvhl:elonginc:elonginb 0.9217 21 34
3zrf-assembly1.cif.gz_B pvhl54-213-elob-eloc complex_apo 0.8994 21 34
3mks-assembly2.cif.gz_A crystal structure of yeast cdc4/skp1 in complex with an allosteric inhibitor scf-i2 0.8753 21 34
ID Description Score Start End Superfamily
af_Q4DLU6_155_281_3.30.710.10 Alpha Beta;2-Layer Sandwich;Potassium Channel Kv1.1; Chain A;Potassium Channel Kv1.1; Chain A 0.9521 21 34 3.30.710.10
af_Q59RB3_7_100_3.30.710.10 Alpha Beta;2-Layer Sandwich;Potassium Channel Kv1.1; Chain A;Potassium Channel Kv1.1; Chain A 0.9374 21 34 3.30.710.10
af_Q54Q05_13_109_3.30.710.10 Alpha Beta;2-Layer Sandwich;Potassium Channel Kv1.1; Chain A;Potassium Channel Kv1.1; Chain A 0.9255 21 34 3.30.710.10
2izvC00 Alpha Beta;2-Layer Sandwich;Potassium Channel Kv1.1; Chain A;Potassium Channel Kv1.1; Chain A 0.914 21 34 3.30.710.10
af_Q9USX9_3_97_3.30.710.10 Alpha Beta;2-Layer Sandwich;Potassium Channel Kv1.1; Chain A;Potassium Channel Kv1.1; Chain A 0.9085 21 34 3.30.710.10
ID Description Score Start End GO Terms
AF-A0A2J4YFL3-F1-model_v4 ISC system 2Fe-2S type ferredoxin 0.9734 76 128 GO:0005829
GO:0009055
GO:0051537
GO:0140647
AF-A0A1F2W601-F1-model_v4 2Fe-2S ferredoxin-type domain-containing protein 0.9346 32 127 GO:0009055
GO:0051537
GO:0140647
AF-A0A1F7NN45-F1-model_v4 2Fe-2S ferredoxin-type domain-containing protein 0.9304 47 127 GO:0009055
GO:0051537
GO:0140647
AF-A0A1F7PWV8-F1-model_v4 Ferredoxin 0.9235 18 129 GO:0009055
GO:0051537
GO:0140647
AF-A0A6L5CA48-F1-model_v4 deleted 0.9206 71 127

Map