F485064
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 898 | 456 | 1796 | 138 |
Family's Representative Sequence
| Representative Sequence | 3300005365|Ga0070688_100693764|Ga0070688_1006937641 |
| Length | 151 |
| Sequence | VLDGSFTRIQDMGGINPYIEQVKADLPKQPYELTFVLGDSGETRTVRVEPEKLPYGHDGLPGSVLDIAMGAGVHLDHACGGVAACSTCHVIVEQGSETCSAVLEAEEDMLDLAAGVTDKSRLGCQCIPNGTVPMRVRIPEWNRNLVMEPPH |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 2 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 3 | 2162886012 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 | Metagenome | Rhizosphere |
| 4 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 5 | 3300002155 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 | Metagenome | Rhizosphere |
| 6 | 3300003347 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM | Metagenome | Rhizosphere |
| 7 | 3300003349 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM | Metagenome | Rhizosphere |
| 8 | 3300003371 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM | Metagenome | Rhizosphere |
| 9 | 3300003383 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM | Metagenome | Rhizosphere |
| 10 | 3300003392 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM | Metagenome | Rhizosphere |
| 11 | 3300003399 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM | Metagenome | Rhizosphere |
| 12 | 3300003400 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM | Metagenome | Rhizosphere |
| 13 | 3300003405 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM | Metagenome | Rhizosphere |
| 14 | 3300004799 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 15 | 3300004800 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 16 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 17 | 3300005277 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v2 (version 2) | Metagenome | Rhizosphere |
| 18 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 19 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 20 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 21 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 22 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 23 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 26 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 27 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 30 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 32 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 33 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 34 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 36 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 37 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 38 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 47 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 49 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 50 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 53 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 54 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 59 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 60 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 61 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 62 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 63 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 64 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 66 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 67 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 68 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 69 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 71 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 72 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 76 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 78 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 79 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 80 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 81 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 82 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 83 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 84 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 85 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 86 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 87 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 88 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 89 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 90 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 91 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 92 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 93 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 94 | 3300006194 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 | Metagenome | Rhizosphere |
| 95 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 97 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 98 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 99 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 100 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 101 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 102 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 103 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 104 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 105 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 107 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 108 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 109 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 118 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 119 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 120 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 121 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 122 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 134 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 135 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 136 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 137 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 138 | 3300024225 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 | Metagenome | Rhizosphere |
| 139 | 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Metagenome | Rhizosphere |
| 140 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300027252 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300027360 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300027364 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300027378 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300027395 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300027424 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300027462 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300027471 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300027526 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300027552 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300027614 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300027617 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 216 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 220 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 221 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 222 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 223 | 3300030760 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 224 | 3300030878 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 225 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 226 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 227 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 228 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 229 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 230 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 231 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 232 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 233 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 234 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 235 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 236 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 237 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 238 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 239 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 240 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 241 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 242 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 243 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 244 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 245 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 246 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 247 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 248 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 249 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 250 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 251 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 252 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 253 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 254 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 255 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 256 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 257 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 258 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 259 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 260 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 261 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 262 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 263 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 264 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 265 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 266 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 267 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 268 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 269 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 270 | 3300042000 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 | Metagenome | Rhizosphere |
| 271 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 272 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 273 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 274 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 275 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 276 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 277 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 278 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 279 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 280 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 281 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 282 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 283 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 284 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 285 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 330 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 331 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 332 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 333 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 334 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 335 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 336 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 337 | 3300049513 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control | Metagenome | Rhizosphere |
| 338 | 3300049514 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought | Metagenome | Rhizosphere |
| 339 | 3300049515 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought | Metagenome | Rhizosphere |
| 340 | 3300049516 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_B_5_drought | Metagenome | Rhizosphere |
| 341 | 3300049517 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control | Metagenome | Rhizosphere |
| 342 | 3300049518 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control | Metagenome | Rhizosphere |
| 343 | 3300049519 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought | Metagenome | Rhizosphere |
| 344 | 3300049520 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought | Metagenome | Rhizosphere |
| 345 | 3300049522 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control | Metagenome | Rhizosphere |
| 346 | 3300049523 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control | Metagenome | Rhizosphere |
| 347 | 3300049524 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H21_B_7_control | Metagenome | Rhizosphere |
| 348 | 3300049525 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F21_B_7_control | Metagenome | Rhizosphere |
| 349 | 3300049526 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_B_7_control | Metagenome | Rhizosphere |
| 350 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 351 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 352 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 353 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 354 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 355 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 356 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 357 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 358 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 359 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 360 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 361 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 362 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 363 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 364 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 365 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 366 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 367 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 368 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 369 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 370 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 371 | 3300049649 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought | Metagenome | Rhizosphere |
| 372 | 3300049650 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought | Metagenome | Rhizosphere |
| 373 | 3300049651 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought | Metagenome | Rhizosphere |
| 374 | 3300049653 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control | Metagenome | Rhizosphere |
| 375 | 3300049654 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control | Metagenome | Rhizosphere |
| 376 | 3300049655 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_B_0_drought | Metagenome | Rhizosphere |
| 377 | 3300049656 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought | Metagenome | Rhizosphere |
| 378 | 3300049657 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought | Metagenome | Rhizosphere |
| 379 | 3300049658 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought | Metagenome | Rhizosphere |
| 380 | 3300049660 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control | Metagenome | Rhizosphere |
| 381 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 382 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 383 | 3300049665 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought | Metagenome | Rhizosphere |
| 384 | 3300049666 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A4_B_2_control | Metagenome | Rhizosphere |
| 385 | 3300049667 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control | Metagenome | Rhizosphere |
| 386 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 387 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 388 | 3300049670 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought | Metagenome | Rhizosphere |
| 389 | 3300049672 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought | Metagenome | Rhizosphere |
| 390 | 3300049673 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought | Metagenome | Rhizosphere |
| 391 | 3300049674 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought | Metagenome | Rhizosphere |
| 392 | 3300049676 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_A_3_control | Metagenome | Rhizosphere |
| 393 | 3300049677 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control | Metagenome | Rhizosphere |
| 394 | 3300049678 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought | Metagenome | Rhizosphere |
| 395 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 396 | 3300049680 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought | Metagenome | Rhizosphere |
| 397 | 3300049681 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought | Metagenome | Rhizosphere |
| 398 | 3300049682 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought | Metagenome | Rhizosphere |
| 399 | 3300049683 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control | Metagenome | Rhizosphere |
| 400 | 3300049684 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_B_3_control | Metagenome | Rhizosphere |
| 401 | 3300049685 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_B_3_control | Metagenome | Rhizosphere |
| 402 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 403 | 3300049687 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought | Metagenome | Rhizosphere |
| 404 | 3300049689 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_A_4_drought | Metagenome | Rhizosphere |
| 405 | 3300049690 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought | Metagenome | Rhizosphere |
| 406 | 3300049703 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control | Metagenome | Rhizosphere |
| 407 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 408 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 409 | 3300049706 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control | Metagenome | Rhizosphere |
| 410 | 3300049707 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought | Metagenome | Rhizosphere |
| 411 | 3300049708 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control | Metagenome | Rhizosphere |
| 412 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 413 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 414 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 415 | 3300049757 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_B_2_control | Metagenome | Rhizosphere |
| 416 | 3300049759 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought | Metagenome | Rhizosphere |
| 417 | 3300049762 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control | Metagenome | Rhizosphere |
| 418 | 3300049763 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control | Metagenome | Rhizosphere |
| 419 | 3300049765 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought | Metagenome | Rhizosphere |
| 420 | 3300049766 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought | Metagenome | Rhizosphere |
| 421 | 3300049767 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought | Metagenome | Rhizosphere |
| 422 | 3300049768 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought | Metagenome | Rhizosphere |
| 423 | 3300049769 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought | Metagenome | Rhizosphere |
| 424 | 3300049770 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control | Metagenome | Rhizosphere |
| 425 | 3300049771 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_B_4_control | Metagenome | Rhizosphere |
| 426 | 3300049772 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_B_4_control | Metagenome | Rhizosphere |
| 427 | 3300049773 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_B_4_control | Metagenome | Rhizosphere |
| 428 | 3300049774 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_A_5_drought | Metagenome | Rhizosphere |
| 429 | 3300049775 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought | Metagenome | Rhizosphere |
| 430 | 3300049776 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought | Metagenome | Rhizosphere |
| 431 | 3300049777 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control | Metagenome | Rhizosphere |
| 432 | 3300049778 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control | Metagenome | Rhizosphere |
| 433 | 3300049779 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought | Metagenome | Rhizosphere |
| 434 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 435 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 436 | 3300049850 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control | Metagenome | Rhizosphere |
| 437 | 3300049851 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought | Metagenome | Rhizosphere |
| 438 | 3300049852 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control | Metagenome | Rhizosphere |
| 439 | 3300049853 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought | Metagenome | Rhizosphere |
| 440 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 441 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 442 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 443 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 444 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 445 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 446 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 447 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 448 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 449 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 450 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 451 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 452 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 453 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 454 | 3300059426 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 455 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 456 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.66 |
| Metatranscriptomes | 1.34 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 1.11 |
| Rhizosphere | 98.89 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 10.91 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070688_100693764 | 3300005365 | Unclassified | 788 |
| 2 | SwRhRL2b_contig_3098461 | 2162886007 | Bacteria | 1267 |
| 3 | MBSR1b_contig_11399222 | 2162886012 | Bacteria | 824 |
| 4 | MBSR1b_contig_1366838 | 2162886012 | Unclassified | 886 |
| 5 | MBSR1b_contig_6479971 | 2162886012 | Bacteria | 828 |
| 6 | JGI24737J22298_10075309 | 3300001990 | Bacteria | 1006 |
| 7 | JGI24033J26618_1016908 | 3300002155 | Bacteria | 910 |
| 8 | JGI26128J50194_1003181 | 3300003347 | Bacteria | 1083 |
| 9 | JGI26129J50193_1001555 | 3300003349 | Bacteria | 1565 |
| 10 | JGI26145J50221_1000561 | 3300003371 | Bacteria | 3158 |
| 11 | JGI26140J50224_102308 | 3300003383 | Bacteria | 690 |
| 12 | JGI26134J50242_100742 | 3300003392 | Bacteria | 1109 |
| 13 | JGI26136J50244_100585 | 3300003399 | Bacteria | 1216 |
| 14 | JGI26131J50246_101860 | 3300003400 | Bacteria | 655 |
| 15 | JGI26132J50249_101294 | 3300003405 | Bacteria | 824 |
| 16 | Ga0058863_11536952 | 3300004799 | Bacteria | 570 |
| 17 | Ga0058861_11487509 | 3300004800 | Bacteria | 616 |
| 18 | Ga0058862_12291842 | 3300004803 | Bacteria | 762 |
| 19 | Ga0065716_1009788 | 3300005277 | Bacteria | 643 |
| 20 | Ga0065714_10325405 | 3300005288 | Bacteria | 663 |
| 21 | Ga0065704_10072118 | 3300005289 | Bacteria | 9115 |
| 22 | Ga0065712_10024731 | 3300005290 | Bacteria | 2044 |
| 23 | Ga0065715_10006020 | 3300005293 | Bacteria | 5541 |
| 24 | Ga0065715_10508887 | 3300005293 | Bacteria | 773 |
| 25 | Ga0065715_10979395 | 3300005293 | Bacteria | 551 |
| 26 | Ga0065707_10083597 | 3300005295 | Bacteria | 8651 |
| 27 | Ga0065707_10204501 | 3300005295 | Bacteria | 1294 |
| 28 | Ga0065707_10294391 | 3300005295 | Bacteria | 1018 |
| 29 | Ga0070658_11018639 | 3300005327 | Unclassified | 720 |
| 30 | Ga0070676_10002068 | 3300005328 | Bacteria | 10205 |
| 31 | Ga0070676_10014982 | 3300005328 | Bacteria | 4268 |
| 32 | Ga0070683_100081151 | 3300005329 | Bacteria | 3036 |
| 33 | Ga0070683_100493197 | 3300005329 | Unclassified | 1170 |
| 34 | Ga0070690_100003571 | 3300005330 | Bacteria | 8536 |
| 35 | Ga0070690_100007665 | 3300005330 | Bacteria | 6188 |
| 36 | Ga0070690_100011134 | 3300005330 | Bacteria | 5253 |
| 37 | Ga0070690_100091108 | 3300005330 | Bacteria | 2008 |
| 38 | Ga0070690_100265558 | 3300005330 | Bacteria | 1219 |
| 39 | Ga0070670_100003892 | 3300005331 | Bacteria | 12449 |
| 40 | Ga0070670_100005867 | 3300005331 | Bacteria | 10379 |
| 41 | Ga0070670_100146333 | 3300005331 | Bacteria | 2044 |
| 42 | Ga0070677_10019583 | 3300005333 | Bacteria | 2454 |
| 43 | Ga0070677_10019972 | 3300005333 | Bacteria | 2434 |
| 44 | Ga0068869_100054290 | 3300005334 | Bacteria | 2916 |
| 45 | Ga0068869_100345245 | 3300005334 | Unclassified | 1212 |
| 46 | Ga0068869_101221253 | 3300005334 | Unclassified | 661 |
| 47 | Ga0070666_10002093 | 3300005335 | Bacteria | 12135 |
| 48 | Ga0070666_10020870 | 3300005335 | Bacteria | 4239 |
| 49 | Ga0070666_10322016 | 3300005335 | Bacteria | 1103 |
| 50 | Ga0070680_100002097 | 3300005336 | Bacteria | 14721 |
| 51 | Ga0070680_100371663 | 3300005336 | Bacteria | 1217 |
| 52 | Ga0070682_100446792 | 3300005337 | Bacteria | 989 |
| 53 | Ga0070682_100811848 | 3300005337 | Bacteria | 761 |
| 54 | Ga0070682_101595288 | 3300005337 | Bacteria | 564 |
| 55 | Ga0068868_100021963 | 3300005338 | Bacteria | 4811 |
| 56 | Ga0068868_100036007 | 3300005338 | Bacteria | 3828 |
| 57 | Ga0068868_100709941 | 3300005338 | Bacteria | 900 |
| 58 | Ga0070660_100007210 | 3300005339 | Bacteria | 7734 |
| 59 | Ga0070689_100000081 | 3300005340 | Bacteria | 56567 |
| 60 | Ga0070689_100007586 | 3300005340 | Bacteria | 7599 |
| 61 | Ga0070689_100550331 | 3300005340 | Bacteria | 994 |
| 62 | Ga0070689_100777942 | 3300005340 | Bacteria | 840 |
| 63 | Ga0070689_100994667 | 3300005340 | Bacteria | 746 |
| 64 | Ga0070691_10052857 | 3300005341 | Bacteria | 1942 |
| 65 | Ga0070691_10233554 | 3300005341 | Bacteria | 980 |
| 66 | Ga0070687_100007956 | 3300005343 | Bacteria | 4463 |
| 67 | Ga0070687_100012805 | 3300005343 | Bacteria | 3717 |
| 68 | Ga0070687_100037369 | 3300005343 | Bacteria | 2427 |
| 69 | Ga0070661_100020862 | 3300005344 | Bacteria | 4675 |
| 70 | Ga0070661_100047799 | 3300005344 | Bacteria | 3131 |
| 71 | Ga0070669_100094986 | 3300005353 | Bacteria | 2241 |
| 72 | Ga0070669_100437839 | 3300005353 | Bacteria | 1075 |
| 73 | Ga0070675_100004564 | 3300005354 | Bacteria | 10571 |
| 74 | Ga0070675_100014323 | 3300005354 | Bacteria | 6252 |
| 75 | Ga0070671_100003618 | 3300005355 | Bacteria | 12095 |
| 76 | Ga0070674_100001987 | 3300005356 | Bacteria | 11195 |
| 77 | Ga0070674_100018373 | 3300005356 | Bacteria | 4419 |
| 78 | Ga0070674_100037200 | 3300005356 | Bacteria | 3272 |
| 79 | Ga0070673_100000165 | 3300005364 | Bacteria | 31811 |
| 80 | Ga0070688_100000241 | 3300005365 | Bacteria | 28868 |
| 81 | Ga0070688_100028746 | 3300005365 | Bacteria | 3322 |
| 82 | Ga0070688_100255938 | 3300005365 | Bacteria | 1248 |
| 83 | Ga0070659_100033907 | 3300005366 | Bacteria | 3969 |
| 84 | Ga0070659_100872448 | 3300005366 | Bacteria | 785 |
| 85 | Ga0070667_100013530 | 3300005367 | Bacteria | 6742 |
| 86 | Ga0070667_100147636 | 3300005367 | Bacteria | 2063 |
| 87 | Ga0070667_101982149 | 3300005367 | Bacteria | 548 |
| 88 | Ga0070709_10084460 | 3300005434 | Bacteria | 2079 |
| 89 | Ga0070709_10990788 | 3300005434 | Bacteria | 668 |
| 90 | Ga0070709_11732898 | 3300005434 | Bacteria | 510 |
| 91 | Ga0070714_100332814 | 3300005435 | Bacteria | 1422 |
| 92 | Ga0070714_100450336 | 3300005435 | Bacteria | 1223 |
| 93 | Ga0070713_100032631 | 3300005436 | Bacteria | 4161 |
| 94 | Ga0070713_100249838 | 3300005436 | Bacteria | 1617 |
| 95 | Ga0070713_100646202 | 3300005436 | Bacteria | 1007 |
| 96 | Ga0070713_102345903 | 3300005436 | Unclassified | 516 |
| 97 | Ga0070701_10000085 | 3300005438 | Bacteria | 26001 |
| 98 | Ga0070701_10041041 | 3300005438 | Bacteria | 2356 |
| 99 | Ga0070701_10160044 | 3300005438 | Bacteria | 1303 |
| 100 | Ga0070711_100043840 | 3300005439 | Bacteria | 3033 |
| 101 | Ga0070711_100236028 | 3300005439 | Bacteria | 1428 |
| 102 | Ga0070711_101478780 | 3300005439 | Unclassified | 592 |
| 103 | Ga0070705_100069821 | 3300005440 | Bacteria | 2119 |
| 104 | Ga0070700_100001201 | 3300005441 | Bacteria | 12835 |
| 105 | Ga0070700_100026596 | 3300005441 | Bacteria | 3419 |
| 106 | Ga0070700_100073734 | 3300005441 | Bacteria | 2185 |
| 107 | Ga0070700_100468628 | 3300005441 | Bacteria | 962 |
| 108 | Ga0070694_100133408 | 3300005444 | Bacteria | 1796 |
| 109 | Ga0070694_100223772 | 3300005444 | Bacteria | 1413 |
| 110 | Ga0070694_100449007 | 3300005444 | Bacteria | 1018 |
| 111 | Ga0070708_100052594 | 3300005445 | Bacteria | 3612 |
| 112 | Ga0070708_100319883 | 3300005445 | Bacteria | 1461 |
| 113 | Ga0070708_100358704 | 3300005445 | Bacteria | 1374 |
| 114 | Ga0070708_100524246 | 3300005445 | Bacteria | 1117 |
| 115 | Ga0070708_101274862 | 3300005445 | Unclassified | 687 |
| 116 | Ga0070663_100037356 | 3300005455 | Bacteria | 3381 |
| 117 | Ga0070663_100280647 | 3300005455 | Unclassified | 1327 |
| 118 | Ga0070678_100005988 | 3300005456 | Bacteria | 7086 |
| 119 | Ga0070678_100007798 | 3300005456 | Bacteria | 6369 |
| 120 | Ga0070678_100448810 | 3300005456 | Bacteria | 1129 |
| 121 | Ga0070662_100000802 | 3300005457 | Bacteria | 19329 |
| 122 | Ga0070662_100109033 | 3300005457 | Bacteria | 2106 |
| 123 | Ga0070662_100576218 | 3300005457 | Bacteria | 945 |
| 124 | Ga0070662_100620765 | 3300005457 | Bacteria | 910 |
| 125 | Ga0070681_10001263 | 3300005458 | Bacteria | 22049 |
| 126 | Ga0070681_10022902 | 3300005458 | Bacteria | 6277 |
| 127 | Ga0070681_10481000 | 3300005458 | Bacteria | 1154 |
| 128 | Ga0068867_100010665 | 3300005459 | Bacteria | 6482 |
| 129 | Ga0068867_100014838 | 3300005459 | Bacteria | 5524 |
| 130 | Ga0068867_100090189 | 3300005459 | Bacteria | 2325 |
| 131 | Ga0068867_101923854 | 3300005459 | Bacteria | 558 |
| 132 | Ga0070685_10000038 | 3300005466 | Bacteria | 79350 |
| 133 | Ga0070685_10041135 | 3300005466 | Bacteria | 2632 |
| 134 | Ga0070685_10046744 | 3300005466 | Bacteria | 2486 |
| 135 | Ga0070706_100096076 | 3300005467 | Bacteria | 2751 |
| 136 | Ga0070706_100368848 | 3300005467 | Bacteria | 1337 |
| 137 | Ga0070706_100416882 | 3300005467 | Bacteria | 1250 |
| 138 | Ga0070706_100610691 | 3300005467 | Bacteria | 1013 |
| 139 | Ga0070707_100000025 | 3300005468 | Bacteria | 124890 |
| 140 | Ga0070707_100000190 | 3300005468 | Bacteria | 61096 |
| 141 | Ga0070707_100003340 | 3300005468 | Bacteria | 15155 |
| 142 | Ga0070707_100145165 | 3300005468 | Bacteria | 2310 |
| 143 | Ga0070707_100430776 | 3300005468 | Bacteria | 1279 |
| 144 | Ga0070707_102266286 | 3300005468 | Bacteria | 510 |
| 145 | Ga0070698_100018005 | 3300005471 | Bacteria | 7439 |
| 146 | Ga0070698_100019346 | 3300005471 | Bacteria | 7153 |
| 147 | Ga0070698_100260146 | 3300005471 | Bacteria | 1667 |
| 148 | Ga0070698_100661558 | 3300005471 | Bacteria | 986 |
| 149 | Ga0070698_101220326 | 3300005471 | Bacteria | 701 |
| 150 | Ga0070699_100041739 | 3300005518 | Bacteria | 3970 |
| 151 | Ga0070699_100045770 | 3300005518 | Bacteria | 3786 |
| 152 | Ga0070699_100168797 | 3300005518 | Bacteria | 1938 |
| 153 | Ga0070699_100963033 | 3300005518 | Bacteria | 782 |
| 154 | Ga0070699_101220549 | 3300005518 | Unclassified | 690 |
| 155 | Ga0070679_100074038 | 3300005530 | Bacteria | 3396 |
| 156 | Ga0070679_100604753 | 3300005530 | Bacteria | 1040 |
| 157 | Ga0070679_100706994 | 3300005530 | Bacteria | 950 |
| 158 | Ga0070684_100055282 | 3300005535 | Bacteria | 3459 |
| 159 | Ga0070697_100030452 | 3300005536 | Bacteria | 4335 |
| 160 | Ga0070697_100110158 | 3300005536 | Bacteria | 2294 |
| 161 | Ga0070697_100116870 | 3300005536 | Bacteria | 2228 |
| 162 | Ga0070697_100118038 | 3300005536 | Bacteria | 2216 |
| 163 | Ga0070697_100218045 | 3300005536 | Bacteria | 1626 |
| 164 | Ga0070697_100396063 | 3300005536 | Bacteria | 1198 |
| 165 | Ga0070697_100638678 | 3300005536 | Bacteria | 937 |
| 166 | Ga0070697_101877292 | 3300005536 | Bacteria | 536 |
| 167 | Ga0068853_101291100 | 3300005539 | Unclassified | 705 |
| 168 | Ga0070672_100001107 | 3300005543 | Bacteria | 16445 |
| 169 | Ga0070672_100305707 | 3300005543 | Bacteria | 1349 |
| 170 | Ga0070686_100000189 | 3300005544 | Bacteria | 43166 |
| 171 | Ga0070686_100008451 | 3300005544 | Bacteria | 5764 |
| 172 | Ga0070686_100015467 | 3300005544 | Bacteria | 4421 |
| 173 | Ga0070686_100058000 | 3300005544 | Bacteria | 2490 |
| 174 | Ga0070686_100265013 | 3300005544 | Bacteria | 1261 |
| 175 | Ga0070695_100033536 | 3300005545 | Bacteria | 3213 |
| 176 | Ga0070695_100034160 | 3300005545 | Bacteria | 3186 |
| 177 | Ga0070695_100076398 | 3300005545 | Unclassified | 2206 |
| 178 | Ga0070695_100548875 | 3300005545 | Unclassified | 900 |
| 179 | Ga0070695_100605181 | 3300005545 | Bacteria | 861 |
| 180 | Ga0070695_100671980 | 3300005545 | Bacteria | 820 |
| 181 | Ga0070696_100015885 | 3300005546 | Bacteria | 5060 |
| 182 | Ga0070696_100054033 | 3300005546 | Bacteria | 2798 |
| 183 | Ga0070696_100415740 | 3300005546 | Bacteria | 1055 |
| 184 | Ga0070693_100010301 | 3300005547 | Bacteria | 4681 |
| 185 | Ga0070693_100929485 | 3300005547 | Bacteria | 654 |
| 186 | Ga0070665_100017033 | 3300005548 | Bacteria | 7287 |
| 187 | Ga0070665_100261803 | 3300005548 | Bacteria | 1731 |
| 188 | Ga0070704_100010083 | 3300005549 | Bacteria | 5742 |
| 189 | Ga0070704_100051390 | 3300005549 | Bacteria | 2902 |
| 190 | Ga0070704_100060199 | 3300005549 | Bacteria | 2712 |
| 191 | Ga0070704_100213647 | 3300005549 | Bacteria | 1564 |
| 192 | Ga0070664_100079786 | 3300005564 | Bacteria | 2818 |
| 193 | Ga0068857_100017459 | 3300005577 | Bacteria | 6289 |
| 194 | Ga0070702_100040740 | 3300005615 | Bacteria | 2601 |
| 195 | Ga0070702_100069902 | 3300005615 | Bacteria | 2070 |
| 196 | Ga0070702_100729792 | 3300005615 | Bacteria | 758 |
| 197 | Ga0068859_100001732 | 3300005617 | Bacteria | 22236 |
| 198 | Ga0068859_100128404 | 3300005617 | Bacteria | 2606 |
| 199 | Ga0068859_102014727 | 3300005617 | Bacteria | 637 |
| 200 | Ga0068859_102774989 | 3300005617 | Bacteria | 538 |
| 201 | Ga0068866_10106644 | 3300005718 | Unclassified | 1555 |
| 202 | Ga0068861_100039277 | 3300005719 | Bacteria | 3531 |
| 203 | Ga0068851_10165104 | 3300005834 | Bacteria | 1219 |
| 204 | Ga0068870_10001055 | 3300005840 | Bacteria | 10908 |
| 205 | Ga0068863_100369190 | 3300005841 | Bacteria | 1400 |
| 206 | Ga0068863_101398474 | 3300005841 | Bacteria | 707 |
| 207 | Ga0068858_100189327 | 3300005842 | Bacteria | 1944 |
| 208 | Ga0068858_100199356 | 3300005842 | Bacteria | 1892 |
| 209 | Ga0068860_100011445 | 3300005843 | Bacteria | 8739 |
| 210 | Ga0068860_101871736 | 3300005843 | Bacteria | 622 |
| 211 | Ga0068862_100031296 | 3300005844 | Bacteria | 4490 |
| 212 | Ga0081455_10003551 | 3300005937 | Bacteria | 17897 |
| 213 | Ga0081455_10155919 | 3300005937 | Bacteria | 1755 |
| 214 | Ga0070717_10056863 | 3300006028 | Bacteria | 3233 |
| 215 | Ga0070717_10714167 | 3300006028 | Bacteria | 911 |
| 216 | Ga0070717_11544411 | 3300006028 | Bacteria | 602 |
| 217 | Ga0075432_10000545 | 3300006058 | Bacteria | 11323 |
| 218 | Ga0070715_10143175 | 3300006163 | Bacteria | 1163 |
| 219 | Ga0070715_10240070 | 3300006163 | Bacteria | 942 |
| 220 | Ga0070716_100061012 | 3300006173 | Bacteria | 2180 |
| 221 | Ga0070712_100758575 | 3300006175 | Bacteria | 831 |
| 222 | Ga0075427_10000956 | 3300006194 | Bacteria | 3565 |
| 223 | Ga0097621_100019150 | 3300006237 | Bacteria | 5247 |
| 224 | Ga0097621_100044572 | 3300006237 | Bacteria | 3579 |
| 225 | Ga0097621_100096876 | 3300006237 | Bacteria | 2476 |
| 226 | Ga0068871_100026242 | 3300006358 | Bacteria | 4544 |
| 227 | Ga0068871_100077713 | 3300006358 | Bacteria | 2744 |
| 228 | Ga0068871_100399529 | 3300006358 | Bacteria | 1224 |
| 229 | Ga0068871_100605461 | 3300006358 | Unclassified | 997 |
| 230 | Ga0068871_101231086 | 3300006358 | Bacteria | 703 |
| 231 | Ga0075428_100126114 | 3300006844 | Bacteria | 2786 |
| 232 | Ga0075428_100355295 | 3300006844 | Bacteria | 1572 |
| 233 | Ga0075428_100700287 | 3300006844 | Bacteria | 1079 |
| 234 | Ga0075430_100000881 | 3300006846 | Bacteria | 23566 |
| 235 | Ga0075430_100001970 | 3300006846 | Bacteria | 16904 |
| 236 | Ga0075430_100027202 | 3300006846 | Bacteria | 4862 |
| 237 | Ga0075430_100549086 | 3300006846 | Bacteria | 953 |
| 238 | Ga0075430_100916276 | 3300006846 | Bacteria | 722 |
| 239 | Ga0075431_100008565 | 3300006847 | Bacteria | 10242 |
| 240 | Ga0075431_100065696 | 3300006847 | Bacteria | 3746 |
| 241 | Ga0075431_100691611 | 3300006847 | Bacteria | 998 |
| 242 | Ga0075431_101959743 | 3300006847 | Bacteria | 541 |
| 243 | Ga0075433_10039498 | 3300006852 | Bacteria | 4082 |
| 244 | Ga0075433_10055110 | 3300006852 | Bacteria | 3470 |
| 245 | Ga0075433_10059767 | 3300006852 | Bacteria | 3335 |
| 246 | Ga0075433_10170589 | 3300006852 | Bacteria | 1936 |
| 247 | Ga0075433_11950568 | 3300006852 | Unclassified | 503 |
| 248 | Ga0075434_100028211 | 3300006871 | Bacteria | 5515 |
| 249 | Ga0075434_100365029 | 3300006871 | Unclassified | 1465 |
| 250 | Ga0075429_100001415 | 3300006880 | Bacteria | 19657 |
| 251 | Ga0075429_100034112 | 3300006880 | Bacteria | 4422 |
| 252 | Ga0075429_100037332 | 3300006880 | Bacteria | 4229 |
| 253 | Ga0075429_100131029 | 3300006880 | Bacteria | 2193 |
| 254 | Ga0068865_100099312 | 3300006881 | Bacteria | 2128 |
| 255 | Ga0068865_100243790 | 3300006881 | Bacteria | 1415 |
| 256 | Ga0075436_100130127 | 3300006914 | Bacteria | 1765 |
| 257 | Ga0075436_100357741 | 3300006914 | Bacteria | 1053 |
| 258 | Ga0097620_100001732 | 3300006931 | Bacteria | 22236 |
| 259 | Ga0097620_100128405 | 3300006931 | Bacteria | 2606 |
| 260 | Ga0097620_102015169 | 3300006931 | Bacteria | 637 |
| 261 | Ga0097620_102774554 | 3300006931 | Bacteria | 538 |
| 262 | Ga0075435_100022814 | 3300007076 | Bacteria | 4831 |
| 263 | Ga0075435_100027269 | 3300007076 | Bacteria | 4466 |
| 264 | Ga0099794_10465136 | 3300007265 | Unclassified | 664 |
| 265 | Ga0099795_10042582 | 3300007788 | Bacteria | 1621 |
| 266 | Ga0105240_10053334 | 3300009093 | Bacteria | 5076 |
| 267 | Ga0105240_10063425 | 3300009093 | Bacteria | 4597 |
| 268 | Ga0105240_10441420 | 3300009093 | Bacteria | 1458 |
| 269 | Ga0105240_12088518 | 3300009093 | Unclassified | 588 |
| 270 | Ga0111539_10001494 | 3300009094 | Bacteria | 31265 |
| 271 | Ga0111539_10063514 | 3300009094 | Bacteria | 4369 |
| 272 | Ga0111539_10118138 | 3300009094 | Bacteria | 3108 |
| 273 | Ga0105245_10004145 | 3300009098 | Bacteria | 12875 |
| 274 | Ga0105245_10210477 | 3300009098 | Bacteria | 1871 |
| 275 | Ga0105245_10459106 | 3300009098 | Bacteria | 1284 |
| 276 | Ga0105247_10586695 | 3300009101 | Bacteria | 825 |
| 277 | Ga0114129_10010292 | 3300009147 | Bacteria | 13344 |
| 278 | Ga0114129_10016441 | 3300009147 | Bacteria | 10530 |
| 279 | Ga0114129_10055075 | 3300009147 | Bacteria | 5574 |
| 280 | Ga0114129_10511068 | 3300009147 | Bacteria | 1567 |
| 281 | Ga0114129_10809396 | 3300009147 | Unclassified | 1194 |
| 282 | Ga0114129_10832038 | 3300009147 | Unclassified | 1175 |
| 283 | Ga0114129_12263430 | 3300009147 | Unclassified | 653 |
| 284 | Ga0105243_10002277 | 3300009148 | Bacteria | 16097 |
| 285 | Ga0105243_10713212 | 3300009148 | Bacteria | 979 |
| 286 | Ga0105243_10912388 | 3300009148 | Bacteria | 875 |
| 287 | Ga0105242_10000981 | 3300009176 | Bacteria | 22290 |
| 288 | Ga0105242_10027992 | 3300009176 | Bacteria | 4482 |
| 289 | Ga0105242_10326433 | 3300009176 | Bacteria | 1409 |
| 290 | Ga0105242_12901813 | 3300009176 | Unclassified | 530 |
| 291 | Ga0105248_10003541 | 3300009177 | Bacteria | 17306 |
| 292 | Ga0105238_10215046 | 3300009551 | Bacteria | 1898 |
| 293 | Ga0105249_10017552 | 3300009553 | Bacteria | 6355 |
| 294 | Ga0099796_10100585 | 3300010159 | Unclassified | 1087 |
| 295 | Ga0099796_10114203 | 3300010159 | Bacteria | 1031 |
| 296 | Ga0105239_10018468 | 3300010375 | Bacteria | 7703 |
| 297 | Ga0105239_11397270 | 3300010375 | Bacteria | 808 |
| 298 | Ga0105246_10000570 | 3300011119 | Bacteria | 20413 |
| 299 | Ga0157373_10142159 | 3300013100 | Bacteria | 1688 |
| 300 | Ga0157371_10010918 | 3300013102 | Bacteria | 7042 |
| 301 | Ga0157371_10452788 | 3300013102 | Bacteria | 944 |
| 302 | Ga0157369_10572488 | 3300013105 | Bacteria | 1167 |
| 303 | Ga0157374_10026660 | 3300013296 | Bacteria | 5202 |
| 304 | Ga0157374_10037277 | 3300013296 | Bacteria | 4461 |
| 305 | Ga0157374_11465699 | 3300013296 | Bacteria | 706 |
| 306 | Ga0157378_10001673 | 3300013297 | Bacteria | 19999 |
| 307 | Ga0157378_10002752 | 3300013297 | Bacteria | 15669 |
| 308 | Ga0157378_10004862 | 3300013297 | Bacteria | 11781 |
| 309 | Ga0157378_10129077 | 3300013297 | Bacteria | 2338 |
| 310 | Ga0157378_10159698 | 3300013297 | Bacteria | 2107 |
| 311 | Ga0157378_10169670 | 3300013297 | Bacteria | 2046 |
| 312 | Ga0157378_12710927 | 3300013297 | Bacteria | 548 |
| 313 | Ga0163162_10041329 | 3300013306 | Bacteria | 4613 |
| 314 | Ga0163162_10459489 | 3300013306 | Bacteria | 1405 |
| 315 | Ga0157372_10148516 | 3300013307 | Bacteria | 2704 |
| 316 | Ga0157372_10160711 | 3300013307 | Bacteria | 2596 |
| 317 | Ga0157372_10760008 | 3300013307 | Bacteria | 1127 |
| 318 | Ga0157375_10001146 | 3300013308 | Bacteria | 22918 |
| 319 | Ga0157375_10131371 | 3300013308 | Bacteria | 2623 |
| 320 | Ga0157375_10215461 | 3300013308 | Bacteria | 2078 |
| 321 | Ga0157375_10359101 | 3300013308 | Bacteria | 1623 |
| 322 | Ga0157380_10344376 | 3300014326 | Bacteria | 1392 |
| 323 | Ga0157377_10003772 | 3300014745 | Bacteria | 6876 |
| 324 | Ga0157376_10000756 | 3300014969 | Bacteria | 21043 |
| 325 | Ga0157376_10002052 | 3300014969 | Bacteria | 13508 |
| 326 | Ga0157376_10119736 | 3300014969 | Bacteria | 2331 |
| 327 | Ga0157376_10300733 | 3300014969 | Bacteria | 1519 |
| 328 | Ga0182005_1052662 | 3300015265 | Unclassified | 1108 |
| 329 | Ga0206356_11679057 | 3300020070 | Bacteria | 514 |
| 330 | Ga0206352_11339017 | 3300020078 | Bacteria | 563 |
| 331 | Ga0206350_10179344 | 3300020080 | Unclassified | 658 |
| 332 | Ga0224712_10280968 | 3300022467 | Bacteria | 775 |
| 333 | Ga0224572_1037376 | 3300024225 | Bacteria | 918 |
| 334 | Ga0228598_1013344 | 3300024227 | Unclassified | 1627 |
| 335 | Ga0207697_10037764 | 3300025315 | Bacteria | 1979 |
| 336 | Ga0207653_10006534 | 3300025885 | Bacteria | 3641 |
| 337 | Ga0207682_10033360 | 3300025893 | Bacteria | 2072 |
| 338 | Ga0207682_10049999 | 3300025893 | Bacteria | 1727 |
| 339 | Ga0207642_10019662 | 3300025899 | Bacteria | 2620 |
| 340 | Ga0207642_10124390 | 3300025899 | Unclassified | 1336 |
| 341 | Ga0207642_10286501 | 3300025899 | Bacteria | 949 |
| 342 | Ga0207710_10337982 | 3300025900 | Bacteria | 765 |
| 343 | Ga0207688_10007146 | 3300025901 | Bacteria | 6073 |
| 344 | Ga0207680_10003134 | 3300025903 | Bacteria | 7762 |
| 345 | Ga0207680_10005853 | 3300025903 | Bacteria | 5900 |
| 346 | Ga0207680_10340752 | 3300025903 | Bacteria | 1052 |
| 347 | Ga0207680_11049575 | 3300025903 | Bacteria | 583 |
| 348 | Ga0207685_10005019 | 3300025905 | Bacteria | 3442 |
| 349 | Ga0207685_10138037 | 3300025905 | Bacteria | 1090 |
| 350 | Ga0207685_10761664 | 3300025905 | Unclassified | 531 |
| 351 | Ga0207699_10098907 | 3300025906 | Bacteria | 1847 |
| 352 | Ga0207699_10352639 | 3300025906 | Bacteria | 1039 |
| 353 | Ga0207645_10000816 | 3300025907 | Bacteria | 26089 |
| 354 | Ga0207645_10001849 | 3300025907 | Bacteria | 17061 |
| 355 | Ga0207643_10148109 | 3300025908 | Bacteria | 1406 |
| 356 | Ga0207705_10065333 | 3300025909 | Bacteria | 2630 |
| 357 | Ga0207684_10077781 | 3300025910 | Bacteria | 2822 |
| 358 | Ga0207684_10082720 | 3300025910 | Bacteria | 2734 |
| 359 | Ga0207684_10122257 | 3300025910 | Bacteria | 2232 |
| 360 | Ga0207684_10138099 | 3300025910 | Bacteria | 2094 |
| 361 | Ga0207707_10151448 | 3300025912 | Bacteria | 2027 |
| 362 | Ga0207707_10429798 | 3300025912 | Bacteria | 1131 |
| 363 | Ga0207695_10113923 | 3300025913 | Bacteria | 2680 |
| 364 | Ga0207695_10893478 | 3300025913 | Unclassified | 768 |
| 365 | Ga0207693_10550947 | 3300025915 | Bacteria | 899 |
| 366 | Ga0207663_10422947 | 3300025916 | Bacteria | 1023 |
| 367 | Ga0207663_11123479 | 3300025916 | Unclassified | 632 |
| 368 | Ga0207660_10078981 | 3300025917 | Bacteria | 2413 |
| 369 | Ga0207660_11092007 | 3300025917 | Bacteria | 650 |
| 370 | Ga0207662_10000352 | 3300025918 | Bacteria | 20858 |
| 371 | Ga0207662_10015626 | 3300025918 | Bacteria | 4273 |
| 372 | Ga0207657_10001576 | 3300025919 | Bacteria | 24487 |
| 373 | Ga0207649_10102535 | 3300025920 | Bacteria | 1897 |
| 374 | Ga0207649_10285663 | 3300025920 | Bacteria | 1201 |
| 375 | Ga0207652_10265783 | 3300025921 | Bacteria | 1547 |
| 376 | Ga0207652_10362994 | 3300025921 | Bacteria | 1307 |
| 377 | Ga0207652_11205363 | 3300025921 | Bacteria | 659 |
| 378 | Ga0207646_10000002 | 3300025922 | Bacteria | 550880 |
| 379 | Ga0207646_10000054 | 3300025922 | Bacteria | 160414 |
| 380 | Ga0207646_10001160 | 3300025922 | Bacteria | 33445 |
| 381 | Ga0207646_10086748 | 3300025922 | Bacteria | 2801 |
| 382 | Ga0207646_10210160 | 3300025922 | Bacteria | 1757 |
| 383 | Ga0207681_10072002 | 3300025923 | Bacteria | 2412 |
| 384 | Ga0207681_10104389 | 3300025923 | Bacteria | 2050 |
| 385 | Ga0207650_10002690 | 3300025925 | Bacteria | 12273 |
| 386 | Ga0207650_10170259 | 3300025925 | Bacteria | 1730 |
| 387 | Ga0207650_11076996 | 3300025925 | Unclassified | 684 |
| 388 | Ga0207659_10020863 | 3300025926 | Bacteria | 4338 |
| 389 | Ga0207659_10279133 | 3300025926 | Bacteria | 1365 |
| 390 | Ga0207687_10376076 | 3300025927 | Bacteria | 1163 |
| 391 | Ga0207687_10708284 | 3300025927 | Bacteria | 855 |
| 392 | Ga0207700_10188101 | 3300025928 | Bacteria | 1733 |
| 393 | Ga0207700_11656816 | 3300025928 | Unclassified | 565 |
| 394 | Ga0207664_10342830 | 3300025929 | Bacteria | 1321 |
| 395 | Ga0207644_10198814 | 3300025931 | Bacteria | 1580 |
| 396 | Ga0207690_10252180 | 3300025932 | Bacteria | 1364 |
| 397 | Ga0207706_10001393 | 3300025933 | Bacteria | 24144 |
| 398 | Ga0207706_10028379 | 3300025933 | Bacteria | 4998 |
| 399 | Ga0207706_10369541 | 3300025933 | Bacteria | 1246 |
| 400 | Ga0207686_10004526 | 3300025934 | Bacteria | 7449 |
| 401 | Ga0207686_10066146 | 3300025934 | Bacteria | 2308 |
| 402 | Ga0207686_10261846 | 3300025934 | Bacteria | 1268 |
| 403 | Ga0207709_10004532 | 3300025935 | Bacteria | 8016 |
| 404 | Ga0207670_10000053 | 3300025936 | Bacteria | 85565 |
| 405 | Ga0207670_10637889 | 3300025936 | Bacteria | 877 |
| 406 | Ga0207670_11483836 | 3300025936 | Bacteria | 576 |
| 407 | Ga0207670_11785987 | 3300025936 | Unclassified | 523 |
| 408 | Ga0207669_10005484 | 3300025937 | Bacteria | 5697 |
| 409 | Ga0207669_10012019 | 3300025937 | Bacteria | 4239 |
| 410 | Ga0207704_10025527 | 3300025938 | Bacteria | 3225 |
| 411 | Ga0207665_10160631 | 3300025939 | Bacteria | 1616 |
| 412 | Ga0207665_10217650 | 3300025939 | Bacteria | 1398 |
| 413 | Ga0207665_10234300 | 3300025939 | Bacteria | 1350 |
| 414 | Ga0207691_10000870 | 3300025940 | Bacteria | 30029 |
| 415 | Ga0207691_10004262 | 3300025940 | Bacteria | 13886 |
| 416 | Ga0207711_10049366 | 3300025941 | Bacteria | 3603 |
| 417 | Ga0207689_10006189 | 3300025942 | Bacteria | 10597 |
| 418 | Ga0207661_10228006 | 3300025944 | Unclassified | 1649 |
| 419 | Ga0207661_10342273 | 3300025944 | Bacteria | 1348 |
| 420 | Ga0207661_10718813 | 3300025944 | Bacteria | 919 |
| 421 | Ga0207679_10018681 | 3300025945 | Bacteria | 4649 |
| 422 | Ga0207679_10078373 | 3300025945 | Bacteria | 2517 |
| 423 | Ga0207679_10104725 | 3300025945 | Bacteria | 2220 |
| 424 | Ga0207651_10000601 | 3300025960 | Bacteria | 15169 |
| 425 | Ga0207651_10143366 | 3300025960 | Bacteria | 1848 |
| 426 | Ga0207712_11965099 | 3300025961 | Unclassified | 524 |
| 427 | Ga0207668_10076663 | 3300025972 | Bacteria | 2408 |
| 428 | Ga0207640_10041402 | 3300025981 | Bacteria | 2930 |
| 429 | Ga0207658_10273311 | 3300025986 | Bacteria | 1445 |
| 430 | Ga0207658_10641917 | 3300025986 | Unclassified | 956 |
| 431 | Ga0207658_10753927 | 3300025986 | Bacteria | 882 |
| 432 | Ga0207677_10102633 | 3300026023 | Bacteria | 2109 |
| 433 | Ga0207677_10148613 | 3300026023 | Bacteria | 1804 |
| 434 | Ga0207677_10630871 | 3300026023 | Bacteria | 944 |
| 435 | Ga0207678_10041910 | 3300026067 | Bacteria | 3968 |
| 436 | Ga0207678_10468281 | 3300026067 | Bacteria | 1096 |
| 437 | Ga0207708_10001032 | 3300026075 | Bacteria | 20847 |
| 438 | Ga0207708_10001978 | 3300026075 | Bacteria | 15119 |
| 439 | Ga0207708_10160025 | 3300026075 | Bacteria | 1778 |
| 440 | Ga0207708_11163398 | 3300026075 | Bacteria | 674 |
| 441 | Ga0207641_10363034 | 3300026088 | Bacteria | 1383 |
| 442 | Ga0207641_11528495 | 3300026088 | Bacteria | 669 |
| 443 | Ga0207648_10000181 | 3300026089 | Bacteria | 66545 |
| 444 | Ga0207648_10005069 | 3300026089 | Bacteria | 13356 |
| 445 | Ga0207674_10023369 | 3300026116 | Bacteria | 6624 |
| 446 | Ga0207675_100141689 | 3300026118 | Bacteria | 2284 |
| 447 | Ga0207683_10001223 | 3300026121 | Bacteria | 23303 |
| 448 | Ga0207683_10002408 | 3300026121 | Bacteria | 16339 |
| 449 | Ga0207698_10346390 | 3300026142 | Bacteria | 1402 |
| 450 | Ga0209973_1002415 | 3300027252 | Bacteria | 1748 |
| 451 | Ga0209969_1000216 | 3300027360 | Bacteria | 7724 |
| 452 | Ga0209967_1000122 | 3300027364 | Bacteria | 10508 |
| 453 | Ga0209967_1015523 | 3300027364 | Bacteria | 1090 |
| 454 | Ga0209981_1000223 | 3300027378 | Bacteria | 7250 |
| 455 | Ga0209996_1000045 | 3300027395 | Bacteria | 18099 |
| 456 | Ga0209984_1000065 | 3300027424 | Bacteria | 11184 |
| 457 | Ga0209984_1009482 | 3300027424 | Bacteria | 1238 |
| 458 | Ga0209984_1075189 | 3300027424 | Bacteria | 506 |
| 459 | Ga0210000_1000076 | 3300027462 | Bacteria | 14195 |
| 460 | Ga0209995_1000065 | 3300027471 | Bacteria | 16664 |
| 461 | Ga0209995_1033882 | 3300027471 | Bacteria | 858 |
| 462 | Ga0209968_1000034 | 3300027526 | Bacteria | 25056 |
| 463 | Ga0209999_1000616 | 3300027543 | Bacteria | 5670 |
| 464 | Ga0209982_1000098 | 3300027552 | Bacteria | 8970 |
| 465 | Ga0209970_1000359 | 3300027614 | Bacteria | 7652 |
| 466 | Ga0210002_1000027 | 3300027617 | Bacteria | 22815 |
| 467 | Ga0209588_1048753 | 3300027671 | Bacteria | 1371 |
| 468 | Ga0209971_1000286 | 3300027682 | Bacteria | 14107 |
| 469 | Ga0209971_1020531 | 3300027682 | Bacteria | 1571 |
| 470 | Ga0209971_1030455 | 3300027682 | Bacteria | 1292 |
| 471 | Ga0209966_1000222 | 3300027695 | Bacteria | 21953 |
| 472 | Ga0209966_1011888 | 3300027695 | Bacteria | 1591 |
| 473 | Ga0209998_10000176 | 3300027717 | Bacteria | 23626 |
| 474 | Ga0209974_10000328 | 3300027876 | Bacteria | 15585 |
| 475 | Ga0209974_10000545 | 3300027876 | Bacteria | 12572 |
| 476 | Ga0209974_10054532 | 3300027876 | Bacteria | 1347 |
| 477 | Ga0207428_10002328 | 3300027907 | Bacteria | 19030 |
| 478 | Ga0207428_10002568 | 3300027907 | Bacteria | 18149 |
| 479 | Ga0268266_10206173 | 3300028379 | Bacteria | 1801 |
| 480 | Ga0268266_10287607 | 3300028379 | Bacteria | 1530 |
| 481 | Ga0268265_10064445 | 3300028380 | Bacteria | 2823 |
| 482 | Ga0268264_11083710 | 3300028381 | Bacteria | 809 |
| 483 | Ga0265319_1010876 | 3300028563 | Bacteria | 3769 |
| 484 | Ga0265334_10194590 | 3300028573 | Bacteria | 706 |
| 485 | Ga0265318_10000439 | 3300028577 | Bacteria | 31462 |
| 486 | Ga0265338_10865254 | 3300028800 | Unclassified | 617 |
| 487 | Ga0265762_1017359 | 3300030760 | Bacteria | 1309 |
| 488 | Ga0265770_1013571 | 3300030878 | Bacteria | 1220 |
| 489 | Ga0265760_10022067 | 3300031090 | Bacteria | 1844 |
| 490 | Ga0265760_10077749 | 3300031090 | Unclassified | 1024 |
| 491 | Ga0265760_10291900 | 3300031090 | Unclassified | 576 |
| 492 | Ga0265332_10016920 | 3300031238 | Bacteria | 3217 |
| 493 | Ga0265320_10000140 | 3300031240 | Bacteria | 61452 |
| 494 | Ga0265325_10204056 | 3300031241 | Unclassified | 910 |
| 495 | Ga0265329_10002035 | 3300031242 | Bacteria | 9471 |
| 496 | Ga0265329_10014615 | 3300031242 | Bacteria | 2767 |
| 497 | Ga0265340_10005730 | 3300031247 | Bacteria | 6861 |
| 498 | Ga0265331_10000041 | 3300031250 | Bacteria | 191831 |
| 499 | Ga0265331_10048745 | 3300031250 | Bacteria | 2035 |
| 500 | Ga0265331_10098801 | 3300031250 | Bacteria | 1345 |
| 501 | Ga0265316_10002673 | 3300031344 | Bacteria | 18367 |
| 502 | Ga0265316_10009564 | 3300031344 | Bacteria | 8914 |
| 503 | Ga0307408_100148245 | 3300031548 | Unclassified | 1849 |
| 504 | Ga0265313_10006224 | 3300031595 | Bacteria | 8521 |
| 505 | Ga0265314_10026534 | 3300031711 | Bacteria | 4352 |
| 506 | Ga0265342_10000124 | 3300031712 | Bacteria | 85296 |
| 507 | Ga0307405_10072312 | 3300031731 | Bacteria | 2222 |
| 508 | Ga0307413_10242169 | 3300031824 | Unclassified | 1332 |
| 509 | Ga0307413_11872312 | 3300031824 | Unclassified | 538 |
| 510 | Ga0307410_10091894 | 3300031852 | Unclassified | 2156 |
| 511 | Ga0307406_10051879 | 3300031901 | Bacteria | 2606 |
| 512 | Ga0307407_10119627 | 3300031903 | Unclassified | 1667 |
| 513 | Ga0307412_10016024 | 3300031911 | Bacteria | 4454 |
| 514 | Ga0307412_10190217 | 3300031911 | Bacteria | 1551 |
| 515 | Ga0307409_100019582 | 3300031995 | Bacteria | 4587 |
| 516 | Ga0307409_100064422 | 3300031995 | Bacteria | 2879 |
| 517 | Ga0307409_101232964 | 3300031995 | Bacteria | 772 |
| 518 | Ga0307416_100077603 | 3300032002 | Bacteria | 2790 |
| 519 | Ga0307416_100194562 | 3300032002 | Bacteria | 1917 |
| 520 | Ga0307414_10139658 | 3300032004 | Bacteria | 1895 |
| 521 | Ga0307414_11426353 | 3300032004 | Bacteria | 644 |
| 522 | Ga0307411_10308395 | 3300032005 | Bacteria | 1272 |
| 523 | Ga0307415_100067501 | 3300032126 | Bacteria | 2499 |
| 524 | Ga0307415_100288338 | 3300032126 | Bacteria | 1354 |
| 525 | Ga0307415_100992916 | 3300032126 | Bacteria | 780 |
| 526 | Ga0373926_0004739 | 3300035083 | Bacteria | 4470 |
| 527 | Ga0373940_0134909 | 3300035088 | Bacteria | 776 |
| 528 | Ga0373952_0181845 | 3300035092 | Bacteria | 607 |
| 529 | Ga0373923_0316558 | 3300035111 | Unclassified | 741 |
| 530 | Ga0373936_0037213 | 3300035113 | Bacteria | 1943 |
| 531 | Ga0373953_0055979 | 3300035117 | Bacteria | 1603 |
| 532 | Ga0373954_0201318 | 3300035118 | Bacteria | 978 |
| 533 | Ga0373956_0193592 | 3300035119 | Bacteria | 963 |
| 534 | Ga0373956_0225221 | 3300035119 | Bacteria | 890 |
| 535 | Ga0373957_0093858 | 3300035120 | Unclassified | 1195 |
| 536 | Ga0373960_0085963 | 3300035121 | Unclassified | 999 |
| 537 | Ga0373955_0340038 | 3300035172 | Bacteria | 908 |
| 538 | Ga0373961_0009234 | 3300035241 | Bacteria | 2410 |
| 539 | Ga0373961_0164035 | 3300035241 | Unclassified | 765 |
| 540 | Ga0373961_0223493 | 3300035241 | Unclassified | 672 |
| 541 | Ga0373962_0024361 | 3300035242 | Bacteria | 1618 |
| 542 | Ga0373962_0075398 | 3300035242 | Bacteria | 1015 |
| 543 | Ga0373924_0165970 | 3300035410 | Unclassified | 969 |
| 544 | Ga0373935_0024328 | 3300035692 | Bacteria | 3727 |
| 545 | Ga0373935_1303596 | 3300035692 | Unclassified | 542 |
| 546 | Ga0373927_0069235 | 3300035695 | Bacteria | 2284 |
| 547 | Ga0373927_0310498 | 3300035695 | Bacteria | 1038 |
| 548 | Ga0373927_0485418 | 3300035695 | Unclassified | 816 |
| 549 | Ga0373933_0014214 | 3300035724 | Bacteria | 4422 |
| 550 | Ga0373933_0227764 | 3300035724 | Bacteria | 1197 |
| 551 | Ga0373933_0593260 | 3300035724 | Bacteria | 727 |
| 552 | Ga0373933_0745062 | 3300035724 | Bacteria | 645 |
| 553 | Ga0373937_0035051 | 3300036401 | Bacteria | 4565 |
| 554 | Ga0373937_0118881 | 3300036401 | Bacteria | 2462 |
| 555 | Ga0373925_0076561 | 3300037068 | Bacteria | 2537 |
| 556 | Ga0439438_033108 | 3300041405 | Bacteria | 1367 |
| 557 | Ga0439461_0011687 | 3300041410 | Bacteria | 1633 |
| 558 | Ga0439466_0029467 | 3300041411 | Bacteria | 1888 |
| 559 | Ga0439437_004669 | 3300042000 | Bacteria | 1498 |
| 560 | Ga0439448_0098732 | 3300042005 | Bacteria | 991 |
| 561 | Ga0439450_136445 | 3300042008 | Bacteria | 638 |
| 562 | Ga0439455_0028267 | 3300042012 | Unclassified | 1380 |
| 563 | Ga0439455_0202142 | 3300042012 | Unclassified | 575 |
| 564 | Ga0450923_005616 | 3300042125 | Unclassified | 2036 |
| 565 | Ga0439446_0122358 | 3300042156 | Bacteria | 838 |
| 566 | Ga0439458_0052481 | 3300042157 | Bacteria | 1008 |
| 567 | Ga0439435_0287007 | 3300042436 | Unclassified | 561 |
| 568 | Ga0439464_0034121 | 3300042439 | Bacteria | 1434 |
| 569 | Ga0439460_0091381 | 3300042461 | Unclassified | 968 |
| 570 | Ga0451577_0000885 | 3300042876 | Bacteria | 44482 |
| 571 | Ga0451577_0027189 | 3300042876 | Bacteria | 5178 |
| 572 | Ga0451577_0067331 | 3300042876 | Bacteria | 3194 |
| 573 | Ga0451577_0235158 | 3300042876 | Bacteria | 1657 |
| 574 | Ga0451577_0560195 | 3300042876 | Bacteria | 1037 |
| 575 | Ga0451577_0788213 | 3300042876 | Bacteria | 859 |
| 576 | Ga0451577_0939340 | 3300042876 | Bacteria | 778 |
| 577 | Ga0453683_0014159 | 3300044673 | Bacteria | 5184 |
| 578 | Ga0453683_0014207 | 3300044673 | Bacteria | 5176 |
| 579 | Ga0453683_0034684 | 3300044673 | Unclassified | 3181 |
| 580 | Ga0453683_0074707 | 3300044673 | Bacteria | 2122 |
| 581 | Ga0453683_0473262 | 3300044673 | Bacteria | 812 |
| 582 | Ga0453683_1124894 | 3300044673 | Bacteria | 524 |
| 583 | Ga0453684_0007009 | 3300044712 | Bacteria | 21065 |
| 584 | Ga0453684_0050436 | 3300044712 | Bacteria | 5475 |
| 585 | Ga0453684_0130041 | 3300044712 | Bacteria | 3022 |
| 586 | Ga0453684_0162077 | 3300044712 | Bacteria | 2644 |
| 587 | Ga0453684_1781265 | 3300044712 | Unclassified | 627 |
| 588 | Ga0451576_0002419 | 3300045051 | Bacteria | 27969 |
| 589 | Ga0451576_0036759 | 3300045051 | Bacteria | 5189 |
| 590 | Ga0451576_0046815 | 3300045051 | Bacteria | 4552 |
| 591 | Ga0451576_0074698 | 3300045051 | Bacteria | 3527 |
| 592 | Ga0451576_0258020 | 3300045051 | Bacteria | 1822 |
| 593 | Ga0451576_0701360 | 3300045051 | Bacteria | 1063 |
| 594 | Ga0451576_0822275 | 3300045051 | Unclassified | 975 |
| 595 | Ga0451576_1221899 | 3300045051 | Bacteria | 784 |
| 596 | Ga0466967_0143428 | 3300045976 | Bacteria | 2226 |
| 597 | Ga0466967_0542838 | 3300045976 | Bacteria | 1144 |
| 598 | Ga0466967_1388620 | 3300045976 | Bacteria | 699 |
| 599 | Ga0495592_0016988 | 3300046454 | Bacteria | 5525 |
| 600 | Ga0495592_0206511 | 3300046454 | Bacteria | 1322 |
| 601 | Ga0495603_0460916 | 3300046455 | Unclassified | 728 |
| 602 | Ga0495629_0388864 | 3300046459 | Bacteria | 949 |
| 603 | Ga0495651_0000133 | 3300046462 | Bacteria | 55122 |
| 604 | Ga0495651_0027170 | 3300046462 | Bacteria | 4458 |
| 605 | Ga0495651_0353254 | 3300046462 | Bacteria | 971 |
| 606 | Ga0495651_0426347 | 3300046462 | Bacteria | 861 |
| 607 | Ga0495653_0047314 | 3300046463 | Bacteria | 3327 |
| 608 | Ga0495580_0017781 | 3300046472 | Bacteria | 5304 |
| 609 | Ga0495580_0350557 | 3300046472 | Bacteria | 1000 |
| 610 | Ga0495580_0618850 | 3300046472 | Bacteria | 714 |
| 611 | Ga0495582_0170029 | 3300046473 | Bacteria | 1241 |
| 612 | Ga0495639_0058938 | 3300046475 | Bacteria | 1757 |
| 613 | Ga0495662_0011783 | 3300046476 | Bacteria | 4273 |
| 614 | Ga0495662_0368581 | 3300046476 | Bacteria | 706 |
| 615 | Ga0495664_0008170 | 3300046477 | Bacteria | 5830 |
| 616 | Ga0495664_0114648 | 3300046477 | Bacteria | 1628 |
| 617 | Ga0495594_0080667 | 3300046499 | Bacteria | 1816 |
| 618 | Ga0495594_0355498 | 3300046499 | Bacteria | 834 |
| 619 | Ga0495608_0057025 | 3300046511 | Bacteria | 2578 |
| 620 | Ga0495618_0008021 | 3300046514 | Bacteria | 6392 |
| 621 | Ga0495618_0267493 | 3300046514 | Unclassified | 1069 |
| 622 | Ga0495618_0375641 | 3300046514 | Bacteria | 873 |
| 623 | Ga0495628_0006374 | 3300046516 | Bacteria | 10311 |
| 624 | Ga0495628_0307405 | 3300046516 | Bacteria | 1172 |
| 625 | Ga0495628_0392985 | 3300046516 | Bacteria | 1014 |
| 626 | Ga0495628_0653145 | 3300046516 | Bacteria | 747 |
| 627 | Ga0495628_0909103 | 3300046516 | Bacteria | 610 |
| 628 | Ga0495630_0000009 | 3300046517 | Bacteria | 305799 |
| 629 | Ga0495630_0003389 | 3300046517 | Bacteria | 11100 |
| 630 | Ga0495630_0039018 | 3300046517 | Bacteria | 3551 |
| 631 | Ga0495630_0049420 | 3300046517 | Bacteria | 3148 |
| 632 | Ga0495630_0056500 | 3300046517 | Bacteria | 2941 |
| 633 | Ga0495630_0289324 | 3300046517 | Bacteria | 1252 |
| 634 | Ga0495666_0059499 | 3300046526 | Bacteria | 1827 |
| 635 | Ga0495666_0084259 | 3300046526 | Bacteria | 1502 |
| 636 | Ga0495666_0463799 | 3300046526 | Bacteria | 567 |
| 637 | Ga0495652_0019370 | 3300046529 | Bacteria | 6062 |
| 638 | Ga0495652_0114813 | 3300046529 | Bacteria | 2159 |
| 639 | Ga0495652_0516649 | 3300046529 | Bacteria | 826 |
| 640 | Ga0495665_0000488 | 3300046531 | Bacteria | 19910 |
| 641 | Ga0495665_0622710 | 3300046531 | Unclassified | 538 |
| 642 | Ga0495640_0063811 | 3300046533 | Bacteria | 2493 |
| 643 | Ga0495586_0004352 | 3300046535 | Bacteria | 7571 |
| 644 | Ga0495586_0371757 | 3300046535 | Bacteria | 822 |
| 645 | Ga0495587_0030912 | 3300046536 | Bacteria | 3246 |
| 646 | Ga0495645_0012588 | 3300046543 | Bacteria | 5965 |
| 647 | Ga0495667_0001795 | 3300046559 | Bacteria | 14239 |
| 648 | Ga0495667_0006569 | 3300046559 | Bacteria | 7893 |
| 649 | Ga0495634_0086891 | 3300046642 | Bacteria | 2036 |
| 650 | Ga0495635_0008062 | 3300046663 | Bacteria | 7358 |
| 651 | Ga0495635_0085165 | 3300046663 | Bacteria | 2162 |
| 652 | Ga0495635_0274410 | 3300046663 | Unclassified | 1133 |
| 653 | Ga0495635_0432840 | 3300046663 | Unclassified | 871 |
| 654 | Ga0495657_0010028 | 3300046675 | Bacteria | 7146 |
| 655 | Ga0495657_0046711 | 3300046675 | Bacteria | 2930 |
| 656 | Ga0495657_0145560 | 3300046675 | Unclassified | 1474 |
| 657 | Ga0495657_0377446 | 3300046675 | Bacteria | 836 |
| 658 | Ga0495599_0266851 | 3300046678 | Unclassified | 1039 |
| 659 | Ga0495623_0002491 | 3300046679 | Bacteria | 12214 |
| 660 | Ga0495646_0476055 | 3300046680 | Bacteria | 643 |
| 661 | Ga0495658_0102958 | 3300046683 | Bacteria | 1707 |
| 662 | Ga0495658_0145936 | 3300046683 | Bacteria | 1450 |
| 663 | Ga0495658_0407445 | 3300046683 | Unclassified | 867 |
| 664 | Ga0495613_0101555 | 3300046689 | Unclassified | 2077 |
| 665 | Ga0495624_0041360 | 3300046690 | Bacteria | 2948 |
| 666 | Ga0495600_0009744 | 3300046809 | Bacteria | 5938 |
| 667 | Ga0495600_0102321 | 3300046809 | Bacteria | 1867 |
| 668 | Ga0495581_0042163 | 3300047315 | Bacteria | 2642 |
| 669 | Ga0495604_0005212 | 3300047317 | Bacteria | 10298 |
| 670 | Ga0495604_0012739 | 3300047317 | Bacteria | 6693 |
| 671 | Ga0495636_0030451 | 3300047318 | Bacteria | 2207 |
| 672 | Ga0495674_0006221 | 3300047319 | Bacteria | 11451 |
| 673 | Ga0495674_0032577 | 3300047319 | Bacteria | 4727 |
| 674 | Ga0495674_0040290 | 3300047319 | Bacteria | 4179 |
| 675 | Ga0495674_0064800 | 3300047319 | Bacteria | 3175 |
| 676 | Ga0495676_0627742 | 3300047321 | Bacteria | 698 |
| 677 | Ga0495680_0000776 | 3300047322 | Bacteria | 35791 |
| 678 | Ga0495680_0019706 | 3300047322 | Bacteria | 5691 |
| 679 | Ga0495680_0038037 | 3300047322 | Bacteria | 3850 |
| 680 | Ga0495680_0093061 | 3300047322 | Bacteria | 2257 |
| 681 | Ga0495675_0000189 | 3300047444 | Bacteria | 45006 |
| 682 | Ga0495675_0035688 | 3300047444 | Bacteria | 3175 |
| 683 | Ga0495675_0046116 | 3300047444 | Bacteria | 2775 |
| 684 | Ga0495675_0069202 | 3300047444 | Bacteria | 2229 |
| 685 | Ga0495675_0077206 | 3300047444 | Bacteria | 2098 |
| 686 | Ga0495684_0028190 | 3300047471 | Bacteria | 4312 |
| 687 | Ga0495684_0033388 | 3300047471 | Bacteria | 3946 |
| 688 | Ga0495593_0004934 | 3300047673 | Bacteria | 7908 |
| 689 | Ga0495602_0067362 | 3300048088 | Bacteria | 3080 |
| 690 | Ga0495602_0209859 | 3300048088 | Bacteria | 1479 |
| 691 | Ga0495602_0522345 | 3300048088 | Unclassified | 827 |
| 692 | Ga0495614_0061367 | 3300048089 | Bacteria | 1615 |
| 693 | Ga0496101_0498450 | 3300048904 | Unclassified | 962 |
| 694 | Ga0496102_0458974 | 3300048905 | Bacteria | 1195 |
| 695 | Ga0496102_1018844 | 3300048905 | Bacteria | 748 |
| 696 | Ga0496105_0061027 | 3300048908 | Bacteria | 3111 |
| 697 | Ga0496106_0098511 | 3300048909 | Bacteria | 2265 |
| 698 | Ga0496108_0020204 | 3300048911 | Bacteria | 5474 |
| 699 | Ga0496111_0360376 | 3300048914 | Bacteria | 1076 |
| 700 | Ga0496112_0067688 | 3300048915 | Bacteria | 3525 |
| 701 | Ga0496112_0317780 | 3300048915 | Unclassified | 1502 |
| 702 | Ga0496114_0029603 | 3300048917 | Bacteria | 4503 |
| 703 | Ga0501290_000596 | 3300049513 | Bacteria | 5444 |
| 704 | Ga0501291_000823 | 3300049514 | Unclassified | 3523 |
| 705 | Ga0501291_006467 | 3300049514 | Bacteria | 1564 |
| 706 | Ga0501292_000168 | 3300049515 | Bacteria | 10742 |
| 707 | Ga0501293_000091 | 3300049516 | Bacteria | 5880 |
| 708 | Ga0501294_000266 | 3300049517 | Bacteria | 6452 |
| 709 | Ga0501295_000127 | 3300049518 | Bacteria | 7586 |
| 710 | Ga0501296_000124 | 3300049519 | Bacteria | 8997 |
| 711 | Ga0501297_000183 | 3300049520 | Bacteria | 6575 |
| 712 | Ga0501299_000137 | 3300049522 | Bacteria | 8191 |
| 713 | Ga0501299_009942 | 3300049522 | Bacteria | 1579 |
| 714 | Ga0501300_000091 | 3300049523 | Bacteria | 12910 |
| 715 | Ga0501301_000204 | 3300049524 | Bacteria | 3383 |
| 716 | Ga0501302_000192 | 3300049525 | Unclassified | 3154 |
| 717 | Ga0501303_002264 | 3300049526 | Bacteria | 1478 |
| 718 | Ga0501031_0007856 | 3300049568 | Bacteria | 6943 |
| 719 | Ga0501031_0024641 | 3300049568 | Bacteria | 3922 |
| 720 | Ga0501031_0110242 | 3300049568 | Bacteria | 1797 |
| 721 | Ga0501031_0234020 | 3300049568 | Bacteria | 1195 |
| 722 | Ga0501032_0112874 | 3300049569 | Bacteria | 1798 |
| 723 | Ga0501032_0151462 | 3300049569 | Bacteria | 1525 |
| 724 | Ga0501032_0923148 | 3300049569 | Bacteria | 549 |
| 725 | Ga0501033_0727093 | 3300049570 | Bacteria | 674 |
| 726 | Ga0501036_0013265 | 3300049572 | Bacteria | 6841 |
| 727 | Ga0501036_0271641 | 3300049572 | Bacteria | 1419 |
| 728 | Ga0501036_0397120 | 3300049572 | Bacteria | 1150 |
| 729 | Ga0501037_0030552 | 3300049573 | Bacteria | 3981 |
| 730 | Ga0501037_0042528 | 3300049573 | Bacteria | 3338 |
| 731 | Ga0501037_0378656 | 3300049573 | Unclassified | 973 |
| 732 | Ga0501038_0191237 | 3300049574 | Bacteria | 1647 |
| 733 | Ga0501038_0668934 | 3300049574 | Bacteria | 780 |
| 734 | Ga0501039_0000259 | 3300049575 | Bacteria | 38736 |
| 735 | Ga0501039_0024687 | 3300049575 | Bacteria | 4617 |
| 736 | Ga0501039_0026928 | 3300049575 | Bacteria | 4419 |
| 737 | Ga0501039_0063705 | 3300049575 | Bacteria | 2857 |
| 738 | Ga0501039_0124375 | 3300049575 | Bacteria | 2023 |
| 739 | Ga0501039_0125603 | 3300049575 | Unclassified | 2012 |
| 740 | Ga0501039_0347647 | 3300049575 | Bacteria | 1165 |
| 741 | Ga0501039_0430797 | 3300049575 | Bacteria | 1036 |
| 742 | Ga0501040_0157761 | 3300049576 | Bacteria | 1603 |
| 743 | Ga0501040_0255552 | 3300049576 | Bacteria | 1250 |
| 744 | Ga0501040_0407963 | 3300049576 | Bacteria | 976 |
| 745 | Ga0501040_0604137 | 3300049576 | Unclassified | 792 |
| 746 | Ga0501041_0003282 | 3300049577 | Bacteria | 9302 |
| 747 | Ga0501041_0007520 | 3300049577 | Bacteria | 6394 |
| 748 | Ga0501041_0066861 | 3300049577 | Bacteria | 2203 |
| 749 | Ga0501041_0087281 | 3300049577 | Bacteria | 1925 |
| 750 | Ga0501041_0274045 | 3300049577 | Bacteria | 1061 |
| 751 | Ga0501041_0962930 | 3300049577 | Bacteria | 549 |
| 752 | Ga0501042_0011092 | 3300049578 | Bacteria | 6069 |
| 753 | Ga0501042_0029514 | 3300049578 | Bacteria | 3868 |
| 754 | Ga0501042_0056731 | 3300049578 | Bacteria | 2794 |
| 755 | Ga0501042_0176510 | 3300049578 | Bacteria | 1541 |
| 756 | Ga0501043_0095962 | 3300049579 | Bacteria | 2331 |
| 757 | Ga0501043_0237026 | 3300049579 | Bacteria | 1408 |
| 758 | Ga0501043_0825702 | 3300049579 | Bacteria | 669 |
| 759 | Ga0501046_0008527 | 3300049580 | Bacteria | 8927 |
| 760 | Ga0501046_0196868 | 3300049580 | Bacteria | 1501 |
| 761 | Ga0501046_0358383 | 3300049580 | Bacteria | 1058 |
| 762 | Ga0501046_0370167 | 3300049580 | Unclassified | 1038 |
| 763 | Ga0501047_1097035 | 3300049581 | Unclassified | 609 |
| 764 | Ga0501048_0020819 | 3300049582 | Bacteria | 4806 |
| 765 | Ga0501067_0316572 | 3300049583 | Bacteria | 869 |
| 766 | Ga0501068_0061113 | 3300049584 | Bacteria | 2289 |
| 767 | Ga0501071_0026305 | 3300049587 | Bacteria | 4083 |
| 768 | Ga0501071_0068747 | 3300049587 | Bacteria | 2578 |
| 769 | Ga0501071_1022860 | 3300049587 | Unclassified | 638 |
| 770 | Ga0501072_0056665 | 3300049588 | Bacteria | 3088 |
| 771 | Ga0501072_1243448 | 3300049588 | Bacteria | 578 |
| 772 | Ga0501075_0096426 | 3300049591 | Unclassified | 2244 |
| 773 | Ga0501075_0130022 | 3300049591 | Bacteria | 1918 |
| 774 | Ga0501076_0032355 | 3300049592 | Bacteria | 4081 |
| 775 | Ga0501076_0071673 | 3300049592 | Bacteria | 2772 |
| 776 | Ga0501076_0101851 | 3300049592 | Bacteria | 2315 |
| 777 | Ga0501076_0744089 | 3300049592 | Bacteria | 809 |
| 778 | Ga0501077_0043062 | 3300049593 | Bacteria | 2869 |
| 779 | Ga0501077_0392024 | 3300049593 | Bacteria | 887 |
| 780 | Ga0501198_000458 | 3300049649 | Bacteria | 5058 |
| 781 | Ga0501199_000094 | 3300049650 | Bacteria | 6405 |
| 782 | Ga0501201_000059 | 3300049651 | Bacteria | 7815 |
| 783 | Ga0501206_000319 | 3300049653 | Bacteria | 5638 |
| 784 | Ga0501207_000525 | 3300049654 | Bacteria | 4343 |
| 785 | Ga0501208_001976 | 3300049655 | Bacteria | 2067 |
| 786 | Ga0501209_009181 | 3300049656 | Bacteria | 1985 |
| 787 | Ga0501210_000160 | 3300049657 | Unclassified | 2618 |
| 788 | Ga0501211_001072 | 3300049658 | Bacteria | 2891 |
| 789 | Ga0501216_000290 | 3300049660 | Bacteria | 5594 |
| 790 | Ga0501217_000296 | 3300049661 | Bacteria | 7861 |
| 791 | Ga0501223_015667 | 3300049663 | Unclassified | 1500 |
| 792 | Ga0501227_004686 | 3300049665 | Bacteria | 2935 |
| 793 | Ga0501228_000863 | 3300049666 | Bacteria | 2060 |
| 794 | Ga0501230_000052 | 3300049667 | Bacteria | 7460 |
| 795 | Ga0501233_000992 | 3300049668 | Bacteria | 4820 |
| 796 | Ga0501235_002306 | 3300049669 | Bacteria | 4109 |
| 797 | Ga0501236_000177 | 3300049670 | Bacteria | 6621 |
| 798 | Ga0501239_000405 | 3300049672 | Bacteria | 3267 |
| 799 | Ga0501240_002350 | 3300049673 | Bacteria | 1996 |
| 800 | Ga0501242_034102 | 3300049674 | Bacteria | 699 |
| 801 | Ga0501246_000917 | 3300049676 | Bacteria | 2201 |
| 802 | Ga0501247_002159 | 3300049677 | Bacteria | 2019 |
| 803 | Ga0501248_000106 | 3300049678 | Bacteria | 3735 |
| 804 | Ga0501249_003923 | 3300049679 | Bacteria | 3007 |
| 805 | Ga0501250_000268 | 3300049680 | Bacteria | 3224 |
| 806 | Ga0501251_000523 | 3300049681 | Bacteria | 3410 |
| 807 | Ga0501252_014004 | 3300049682 | Bacteria | 986 |
| 808 | Ga0501253_000188 | 3300049683 | Bacteria | 4619 |
| 809 | Ga0501255_002517 | 3300049684 | Unclassified | 1617 |
| 810 | Ga0501256_000662 | 3300049685 | Bacteria | 2284 |
| 811 | Ga0501257_007736 | 3300049686 | Bacteria | 2404 |
| 812 | Ga0501258_001404 | 3300049687 | Bacteria | 1959 |
| 813 | Ga0501260_000088 | 3300049689 | Bacteria | 6066 |
| 814 | Ga0501261_000448 | 3300049690 | Bacteria | 5329 |
| 815 | Ga0501219_001067 | 3300049703 | Bacteria | 3143 |
| 816 | Ga0501219_018201 | 3300049703 | Unclassified | 590 |
| 817 | Ga0501221_001674 | 3300049704 | Unclassified | 3683 |
| 818 | Ga0501225_0001217 | 3300049705 | Bacteria | 8021 |
| 819 | Ga0501229_001027 | 3300049706 | Bacteria | 3193 |
| 820 | Ga0501234_004015 | 3300049707 | Bacteria | 2309 |
| 821 | Ga0501245_000456 | 3300049708 | Bacteria | 4963 |
| 822 | Ga0501079_0043565 | 3300049741 | Bacteria | 3464 |
| 823 | Ga0501079_0292848 | 3300049741 | Bacteria | 1273 |
| 824 | Ga0501080_0349833 | 3300049742 | Bacteria | 1335 |
| 825 | Ga0501080_0440377 | 3300049742 | Bacteria | 1169 |
| 826 | Ga0501080_0682945 | 3300049742 | Bacteria | 907 |
| 827 | Ga0501081_0703345 | 3300049743 | Bacteria | 759 |
| 828 | Ga0501232_000074 | 3300049757 | Bacteria | 4956 |
| 829 | Ga0501262_000877 | 3300049759 | Bacteria | 3434 |
| 830 | Ga0501265_000313 | 3300049762 | Bacteria | 4997 |
| 831 | Ga0501266_000479 | 3300049763 | Bacteria | 5277 |
| 832 | Ga0501268_000379 | 3300049765 | Bacteria | 4703 |
| 833 | Ga0501269_001737 | 3300049766 | Bacteria | 2784 |
| 834 | Ga0501270_000263 | 3300049767 | Bacteria | 4439 |
| 835 | Ga0501271_000105 | 3300049768 | Bacteria | 6598 |
| 836 | Ga0501272_000260 | 3300049769 | Bacteria | 4432 |
| 837 | Ga0501273_000076 | 3300049770 | Bacteria | 6236 |
| 838 | Ga0501274_004833 | 3300049771 | Bacteria | 1124 |
| 839 | Ga0501275_000626 | 3300049772 | Bacteria | 3883 |
| 840 | Ga0501276_000427 | 3300049773 | Unclassified | 2560 |
| 841 | Ga0501278_000475 | 3300049774 | Bacteria | 3121 |
| 842 | Ga0501279_000219 | 3300049775 | Bacteria | 7997 |
| 843 | Ga0501280_003447 | 3300049776 | Bacteria | 2430 |
| 844 | Ga0501281_01061 | 3300049777 | Bacteria | 2254 |
| 845 | Ga0501282_000187 | 3300049778 | Bacteria | 7575 |
| 846 | Ga0501283_000084 | 3300049779 | Bacteria | 11644 |
| 847 | Ga0501283_033640 | 3300049779 | Bacteria | 868 |
| 848 | Ga0501035_0078709 | 3300049822 | Bacteria | 2912 |
| 849 | Ga0501035_0087901 | 3300049822 | Bacteria | 2739 |
| 850 | Ga0501045_0103836 | 3300049824 | Bacteria | 2105 |
| 851 | Ga0501045_0627112 | 3300049824 | Bacteria | 795 |
| 852 | Ga0501204_012958 | 3300049850 | Bacteria | 1007 |
| 853 | Ga0501212_003312 | 3300049851 | Bacteria | 2012 |
| 854 | Ga0501220_00817 | 3300049852 | Bacteria | 1033 |
| 855 | Ga0501226_006179 | 3300049853 | Bacteria | 1359 |
| 856 | nmdc:mga05p37_217721_c1 | 3300050507 | Bacteria | 2306 |
| 857 | nmdc:mga05p37_232437_c1 | 3300050507 | Bacteria | 2221 |
| 858 | nmdc:mga05p37_516642_c1 | 3300050507 | Unclassified | 1367 |
| 859 | nmdc:mga05p37_689088_c1 | 3300050507 | Unclassified | 664 |
| 860 | nmdc:mga05p37_714191_c1 | 3300050507 | Unclassified | 1111 |
| 861 | nmdc:mga05p37_9370_c1 | 3300050507 | Bacteria | 11588 |
| 862 | nmdc:mga09592_18965_c1 | 3300050508 | Bacteria | 5644 |
| 863 | nmdc:mga09592_37184_c1 | 3300050508 | Bacteria | 4083 |
| 864 | nmdc:mga09592_70775_c1 | 3300050508 | Bacteria | 2960 |
| 865 | nmdc:mga09592_73782_c1 | 3300050508 | Bacteria | 2900 |
| 866 | nmdc:mga0qj67_243258_c1 | 3300050509 | Bacteria | 1460 |
| 867 | nmdc:mga0qj67_3453_c1 | 3300050509 | Bacteria | 11387 |
| 868 | nmdc:mga0qj67_739313_c1 | 3300050509 | Bacteria | 781 |
| 869 | nmdc:mga06r32_1269608_c1 | 3300050510 | Eukaryota | 681 |
| 870 | nmdc:mga06r32_46745_c1 | 3300050510 | Bacteria | 4130 |
| 871 | nmdc:mga08y16_3045_c1 | 3300050511 | Bacteria | 17316 |
| 872 | nmdc:mga08y16_42567_c1 | 3300050511 | Bacteria | 4757 |
| 873 | nmdc:mga0n895_48754_c1 | 3300050512 | Bacteria | 4148 |
| 874 | nmdc:mga0n895_63614_c1 | 3300050512 | Bacteria | 3648 |
| 875 | nmdc:mga0n895_704614_c1 | 3300050512 | Unclassified | 1005 |
| 876 | nmdc:mga0rr50_185639_c1 | 3300050513 | Bacteria | 1702 |
| 877 | nmdc:mga0rr50_32887_c1 | 3300050513 | Bacteria | 3701 |
| 878 | nmdc:mga0rr50_414627_c1 | 3300050513 | Bacteria | 1139 |
| 879 | nmdc:mga0rr50_909572_c1 | 3300050513 | Unclassified | 750 |
| 880 | nmdc:mga08x19_115395_c1 | 3300050514 | Bacteria | 1795 |
| 881 | nmdc:mga08x19_121143_c1 | 3300050514 | Bacteria | 1754 |
| 882 | nmdc:mga08x19_45660_c1 | 3300050514 | Bacteria | 2799 |
| 883 | nmdc:mga0a205_1032725_c1 | 3300050515 | Unclassified | 669 |
| 884 | nmdc:mga0a205_188639_c1 | 3300050515 | Bacteria | 1954 |
| 885 | nmdc:mga0a205_23376_c1 | 3300050515 | Bacteria | 5863 |
| 886 | nmdc:mga0a205_24681_c1 | 3300050515 | Bacteria | 5720 |
| 887 | nmdc:mga0a205_47014_c1 | 3300050515 | Bacteria | 4163 |
| 888 | Ga0495612_0000625 | 3300053078 | Bacteria | 14181 |
| 889 | Ga0495595_0439141 | 3300053084 | Unclassified | 663 |
| 890 | Ga0495619_0072722 | 3300053085 | Bacteria | 2303 |
| 891 | Ga0495619_0680632 | 3300053085 | Bacteria | 700 |
| 892 | Ga0501084_0031657 | 3300054114 | Bacteria | 4422 |
| 893 | Ga0590075_042208 | 3300059424 | Bacteria | 1166 |
| 894 | Ga0590077_024193 | 3300059426 | Unclassified | 1304 |
| 895 | Ga0501082_0096087 | 3300060353 | Bacteria | 2561 |
| 896 | Ga0501082_0479154 | 3300060353 | Bacteria | 1088 |
| 897 | Ga0501082_0990695 | 3300060353 | Bacteria | 735 |
| 898 | Ga0530510_0470836 | 3300061734 | Bacteria | 951 |
| 899 | Ga0070688_100693764 | |||
| 900 | SwRhRL2b_contig_3098461 | |||
| 901 | MBSR1b_contig_11399222 | |||
| 902 | MBSR1b_contig_1366838 | |||
| 903 | MBSR1b_contig_6479971 | |||
| 904 | JGI24737J22298_10075309 | |||
| 905 | JGI24033J26618_1016908 | |||
| 906 | JGI26128J50194_1003181 | |||
| 907 | JGI26129J50193_1001555 | |||
| 908 | JGI26145J50221_1000561 | |||
| 909 | JGI26140J50224_102308 | |||
| 910 | JGI26134J50242_100742 | |||
| 911 | JGI26136J50244_100585 | |||
| 912 | JGI26131J50246_101860 | |||
| 913 | JGI26132J50249_101294 | |||
| 914 | Ga0058863_11536952 | |||
| 915 | Ga0058861_11487509 | |||
| 916 | Ga0058862_12291842 | |||
| 917 | Ga0065716_1009788 | |||
| 918 | Ga0065714_10325405 | |||
| 919 | Ga0065704_10072118 | |||
| 920 | Ga0065712_10024731 | |||
| 921 | Ga0065715_10006020 | |||
| 922 | Ga0065715_10508887 | |||
| 923 | Ga0065715_10979395 | |||
| 924 | Ga0065707_10083597 | |||
| 925 | Ga0065707_10204501 | |||
| 926 | Ga0065707_10294391 | |||
| 927 | Ga0070658_11018639 | |||
| 928 | Ga0070676_10002068 | |||
| 929 | Ga0070676_10014982 | |||
| 930 | Ga0070683_100081151 | |||
| 931 | Ga0070683_100493197 | |||
| 932 | Ga0070690_100003571 | |||
| 933 | Ga0070690_100007665 | |||
| 934 | Ga0070690_100011134 | |||
| 935 | Ga0070690_100091108 | |||
| 936 | Ga0070690_100265558 | |||
| 937 | Ga0070670_100003892 | |||
| 938 | Ga0070670_100005867 | |||
| 939 | Ga0070670_100146333 | |||
| 940 | Ga0070677_10019583 | |||
| 941 | Ga0070677_10019972 | |||
| 942 | Ga0068869_100054290 | |||
| 943 | Ga0068869_100345245 | |||
| 944 | Ga0068869_101221253 | |||
| 945 | Ga0070666_10002093 | |||
| 946 | Ga0070666_10020870 | |||
| 947 | Ga0070666_10322016 | |||
| 948 | Ga0070680_100002097 | |||
| 949 | Ga0070680_100371663 | |||
| 950 | Ga0070682_100446792 | |||
| 951 | Ga0070682_100811848 | |||
| 952 | Ga0070682_101595288 | |||
| 953 | Ga0068868_100021963 | |||
| 954 | Ga0068868_100036007 | |||
| 955 | Ga0068868_100709941 | |||
| 956 | Ga0070660_100007210 | |||
| 957 | Ga0070689_100000081 | |||
| 958 | Ga0070689_100007586 | |||
| 959 | Ga0070689_100550331 | |||
| 960 | Ga0070689_100777942 | |||
| 961 | Ga0070689_100994667 | |||
| 962 | Ga0070691_10052857 | |||
| 963 | Ga0070691_10233554 | |||
| 964 | Ga0070687_100007956 | |||
| 965 | Ga0070687_100012805 | |||
| 966 | Ga0070687_100037369 | |||
| 967 | Ga0070661_100020862 | |||
| 968 | Ga0070661_100047799 | |||
| 969 | Ga0070669_100094986 | |||
| 970 | Ga0070669_100437839 | |||
| 971 | Ga0070675_100004564 | |||
| 972 | Ga0070675_100014323 | |||
| 973 | Ga0070671_100003618 | |||
| 974 | Ga0070674_100001987 | |||
| 975 | Ga0070674_100018373 | |||
| 976 | Ga0070674_100037200 | |||
| 977 | Ga0070673_100000165 | |||
| 978 | Ga0070688_100000241 | |||
| 979 | Ga0070688_100028746 | |||
| 980 | Ga0070688_100255938 | |||
| 981 | Ga0070659_100033907 | |||
| 982 | Ga0070659_100872448 | |||
| 983 | Ga0070667_100013530 | |||
| 984 | Ga0070667_100147636 | |||
| 985 | Ga0070667_101982149 | |||
| 986 | Ga0070709_10084460 | |||
| 987 | Ga0070709_10990788 | |||
| 988 | Ga0070709_11732898 | |||
| 989 | Ga0070714_100332814 | |||
| 990 | Ga0070714_100450336 | |||
| 991 | Ga0070713_100032631 | |||
| 992 | Ga0070713_100249838 | |||
| 993 | Ga0070713_100646202 | |||
| 994 | Ga0070713_102345903 | |||
| 995 | Ga0070701_10000085 | |||
| 996 | Ga0070701_10041041 | |||
| 997 | Ga0070701_10160044 | |||
| 998 | Ga0070711_100043840 | |||
| 999 | Ga0070711_100236028 | |||
| 1000 | Ga0070711_101478780 | |||
| 1001 | Ga0070705_100069821 | |||
| 1002 | Ga0070700_100001201 | |||
| 1003 | Ga0070700_100026596 | |||
| 1004 | Ga0070700_100073734 | |||
| 1005 | Ga0070700_100468628 | |||
| 1006 | Ga0070694_100133408 | |||
| 1007 | Ga0070694_100223772 | |||
| 1008 | Ga0070694_100449007 | |||
| 1009 | Ga0070708_100052594 | |||
| 1010 | Ga0070708_100319883 | |||
| 1011 | Ga0070708_100358704 | |||
| 1012 | Ga0070708_100524246 | |||
| 1013 | Ga0070708_101274862 | |||
| 1014 | Ga0070663_100037356 | |||
| 1015 | Ga0070663_100280647 | |||
| 1016 | Ga0070678_100005988 | |||
| 1017 | Ga0070678_100007798 | |||
| 1018 | Ga0070678_100448810 | |||
| 1019 | Ga0070662_100000802 | |||
| 1020 | Ga0070662_100109033 | |||
| 1021 | Ga0070662_100576218 | |||
| 1022 | Ga0070662_100620765 | |||
| 1023 | Ga0070681_10001263 | |||
| 1024 | Ga0070681_10022902 | |||
| 1025 | Ga0070681_10481000 | |||
| 1026 | Ga0068867_100010665 | |||
| 1027 | Ga0068867_100014838 | |||
| 1028 | Ga0068867_100090189 | |||
| 1029 | Ga0068867_101923854 | |||
| 1030 | Ga0070685_10000038 | |||
| 1031 | Ga0070685_10041135 | |||
| 1032 | Ga0070685_10046744 | |||
| 1033 | Ga0070706_100096076 | |||
| 1034 | Ga0070706_100368848 | |||
| 1035 | Ga0070706_100416882 | |||
| 1036 | Ga0070706_100610691 | |||
| 1037 | Ga0070707_100000025 | |||
| 1038 | Ga0070707_100000190 | |||
| 1039 | Ga0070707_100003340 | |||
| 1040 | Ga0070707_100145165 | |||
| 1041 | Ga0070707_100430776 | |||
| 1042 | Ga0070707_102266286 | |||
| 1043 | Ga0070698_100018005 | |||
| 1044 | Ga0070698_100019346 | |||
| 1045 | Ga0070698_100260146 | |||
| 1046 | Ga0070698_100661558 | |||
| 1047 | Ga0070698_101220326 | |||
| 1048 | Ga0070699_100041739 | |||
| 1049 | Ga0070699_100045770 | |||
| 1050 | Ga0070699_100168797 | |||
| 1051 | Ga0070699_100963033 | |||
| 1052 | Ga0070699_101220549 | |||
| 1053 | Ga0070679_100074038 | |||
| 1054 | Ga0070679_100604753 | |||
| 1055 | Ga0070679_100706994 | |||
| 1056 | Ga0070684_100055282 | |||
| 1057 | Ga0070697_100030452 | |||
| 1058 | Ga0070697_100110158 | |||
| 1059 | Ga0070697_100116870 | |||
| 1060 | Ga0070697_100118038 | |||
| 1061 | Ga0070697_100218045 | |||
| 1062 | Ga0070697_100396063 | |||
| 1063 | Ga0070697_100638678 | |||
| 1064 | Ga0070697_101877292 | |||
| 1065 | Ga0068853_101291100 | |||
| 1066 | Ga0070672_100001107 | |||
| 1067 | Ga0070672_100305707 | |||
| 1068 | Ga0070686_100000189 | |||
| 1069 | Ga0070686_100008451 | |||
| 1070 | Ga0070686_100015467 | |||
| 1071 | Ga0070686_100058000 | |||
| 1072 | Ga0070686_100265013 | |||
| 1073 | Ga0070695_100033536 | |||
| 1074 | Ga0070695_100034160 | |||
| 1075 | Ga0070695_100076398 | |||
| 1076 | Ga0070695_100548875 | |||
| 1077 | Ga0070695_100605181 | |||
| 1078 | Ga0070695_100671980 | |||
| 1079 | Ga0070696_100015885 | |||
| 1080 | Ga0070696_100054033 | |||
| 1081 | Ga0070696_100415740 | |||
| 1082 | Ga0070693_100010301 | |||
| 1083 | Ga0070693_100929485 | |||
| 1084 | Ga0070665_100017033 | |||
| 1085 | Ga0070665_100261803 | |||
| 1086 | Ga0070704_100010083 | |||
| 1087 | Ga0070704_100051390 | |||
| 1088 | Ga0070704_100060199 | |||
| 1089 | Ga0070704_100213647 | |||
| 1090 | Ga0070664_100079786 | |||
| 1091 | Ga0068857_100017459 | |||
| 1092 | Ga0070702_100040740 | |||
| 1093 | Ga0070702_100069902 | |||
| 1094 | Ga0070702_100729792 | |||
| 1095 | Ga0068859_100001732 | |||
| 1096 | Ga0068859_100128404 | |||
| 1097 | Ga0068859_102014727 | |||
| 1098 | Ga0068859_102774989 | |||
| 1099 | Ga0068866_10106644 | |||
| 1100 | Ga0068861_100039277 | |||
| 1101 | Ga0068851_10165104 | |||
| 1102 | Ga0068870_10001055 | |||
| 1103 | Ga0068863_100369190 | |||
| 1104 | Ga0068863_101398474 | |||
| 1105 | Ga0068858_100189327 | |||
| 1106 | Ga0068858_100199356 | |||
| 1107 | Ga0068860_100011445 | |||
| 1108 | Ga0068860_101871736 | |||
| 1109 | Ga0068862_100031296 | |||
| 1110 | Ga0081455_10003551 | |||
| 1111 | Ga0081455_10155919 | |||
| 1112 | Ga0070717_10056863 | |||
| 1113 | Ga0070717_10714167 | |||
| 1114 | Ga0070717_11544411 | |||
| 1115 | Ga0075432_10000545 | |||
| 1116 | Ga0070715_10143175 | |||
| 1117 | Ga0070715_10240070 | |||
| 1118 | Ga0070716_100061012 | |||
| 1119 | Ga0070712_100758575 | |||
| 1120 | Ga0075427_10000956 | |||
| 1121 | Ga0097621_100019150 | |||
| 1122 | Ga0097621_100044572 | |||
| 1123 | Ga0097621_100096876 | |||
| 1124 | Ga0068871_100026242 | |||
| 1125 | Ga0068871_100077713 | |||
| 1126 | Ga0068871_100399529 | |||
| 1127 | Ga0068871_100605461 | |||
| 1128 | Ga0068871_101231086 | |||
| 1129 | Ga0075428_100126114 | |||
| 1130 | Ga0075428_100355295 | |||
| 1131 | Ga0075428_100700287 | |||
| 1132 | Ga0075430_100000881 | |||
| 1133 | Ga0075430_100001970 | |||
| 1134 | Ga0075430_100027202 | |||
| 1135 | Ga0075430_100549086 | |||
| 1136 | Ga0075430_100916276 | |||
| 1137 | Ga0075431_100008565 | |||
| 1138 | Ga0075431_100065696 | |||
| 1139 | Ga0075431_100691611 | |||
| 1140 | Ga0075431_101959743 | |||
| 1141 | Ga0075433_10039498 | |||
| 1142 | Ga0075433_10055110 | |||
| 1143 | Ga0075433_10059767 | |||
| 1144 | Ga0075433_10170589 | |||
| 1145 | Ga0075433_11950568 | |||
| 1146 | Ga0075434_100028211 | |||
| 1147 | Ga0075434_100365029 | |||
| 1148 | Ga0075429_100001415 | |||
| 1149 | Ga0075429_100034112 | |||
| 1150 | Ga0075429_100037332 | |||
| 1151 | Ga0075429_100131029 | |||
| 1152 | Ga0068865_100099312 | |||
| 1153 | Ga0068865_100243790 | |||
| 1154 | Ga0075436_100130127 | |||
| 1155 | Ga0075436_100357741 | |||
| 1156 | Ga0097620_100001732 | |||
| 1157 | Ga0097620_100128405 | |||
| 1158 | Ga0097620_102015169 | |||
| 1159 | Ga0097620_102774554 | |||
| 1160 | Ga0075435_100022814 | |||
| 1161 | Ga0075435_100027269 | |||
| 1162 | Ga0099794_10465136 | |||
| 1163 | Ga0099795_10042582 | |||
| 1164 | Ga0105240_10053334 | |||
| 1165 | Ga0105240_10063425 | |||
| 1166 | Ga0105240_10441420 | |||
| 1167 | Ga0105240_12088518 | |||
| 1168 | Ga0111539_10001494 | |||
| 1169 | Ga0111539_10063514 | |||
| 1170 | Ga0111539_10118138 | |||
| 1171 | Ga0105245_10004145 | |||
| 1172 | Ga0105245_10210477 | |||
| 1173 | Ga0105245_10459106 | |||
| 1174 | Ga0105247_10586695 | |||
| 1175 | Ga0114129_10010292 | |||
| 1176 | Ga0114129_10016441 | |||
| 1177 | Ga0114129_10055075 | |||
| 1178 | Ga0114129_10511068 | |||
| 1179 | Ga0114129_10809396 | |||
| 1180 | Ga0114129_10832038 | |||
| 1181 | Ga0114129_12263430 | |||
| 1182 | Ga0105243_10002277 | |||
| 1183 | Ga0105243_10713212 | |||
| 1184 | Ga0105243_10912388 | |||
| 1185 | Ga0105242_10000981 | |||
| 1186 | Ga0105242_10027992 | |||
| 1187 | Ga0105242_10326433 | |||
| 1188 | Ga0105242_12901813 | |||
| 1189 | Ga0105248_10003541 | |||
| 1190 | Ga0105238_10215046 | |||
| 1191 | Ga0105249_10017552 | |||
| 1192 | Ga0099796_10100585 | |||
| 1193 | Ga0099796_10114203 | |||
| 1194 | Ga0105239_10018468 | |||
| 1195 | Ga0105239_11397270 | |||
| 1196 | Ga0105246_10000570 | |||
| 1197 | Ga0157373_10142159 | |||
| 1198 | Ga0157371_10010918 | |||
| 1199 | Ga0157371_10452788 | |||
| 1200 | Ga0157369_10572488 | |||
| 1201 | Ga0157374_10026660 | |||
| 1202 | Ga0157374_10037277 | |||
| 1203 | Ga0157374_11465699 | |||
| 1204 | Ga0157378_10001673 | |||
| 1205 | Ga0157378_10002752 | |||
| 1206 | Ga0157378_10004862 | |||
| 1207 | Ga0157378_10129077 | |||
| 1208 | Ga0157378_10159698 | |||
| 1209 | Ga0157378_10169670 | |||
| 1210 | Ga0157378_12710927 | |||
| 1211 | Ga0163162_10041329 | |||
| 1212 | Ga0163162_10459489 | |||
| 1213 | Ga0157372_10148516 | |||
| 1214 | Ga0157372_10160711 | |||
| 1215 | Ga0157372_10760008 | |||
| 1216 | Ga0157375_10001146 | |||
| 1217 | Ga0157375_10131371 | |||
| 1218 | Ga0157375_10215461 | |||
| 1219 | Ga0157375_10359101 | |||
| 1220 | Ga0157380_10344376 | |||
| 1221 | Ga0157377_10003772 | |||
| 1222 | Ga0157376_10000756 | |||
| 1223 | Ga0157376_10002052 | |||
| 1224 | Ga0157376_10119736 | |||
| 1225 | Ga0157376_10300733 | |||
| 1226 | Ga0182005_1052662 | |||
| 1227 | Ga0206356_11679057 | |||
| 1228 | Ga0206352_11339017 | |||
| 1229 | Ga0206350_10179344 | |||
| 1230 | Ga0224712_10280968 | |||
| 1231 | Ga0224572_1037376 | |||
| 1232 | Ga0228598_1013344 | |||
| 1233 | Ga0207697_10037764 | |||
| 1234 | Ga0207653_10006534 | |||
| 1235 | Ga0207682_10033360 | |||
| 1236 | Ga0207682_10049999 | |||
| 1237 | Ga0207642_10019662 | |||
| 1238 | Ga0207642_10124390 | |||
| 1239 | Ga0207642_10286501 | |||
| 1240 | Ga0207710_10337982 | |||
| 1241 | Ga0207688_10007146 | |||
| 1242 | Ga0207680_10003134 | |||
| 1243 | Ga0207680_10005853 | |||
| 1244 | Ga0207680_10340752 | |||
| 1245 | Ga0207680_11049575 | |||
| 1246 | Ga0207685_10005019 | |||
| 1247 | Ga0207685_10138037 | |||
| 1248 | Ga0207685_10761664 | |||
| 1249 | Ga0207699_10098907 | |||
| 1250 | Ga0207699_10352639 | |||
| 1251 | Ga0207645_10000816 | |||
| 1252 | Ga0207645_10001849 | |||
| 1253 | Ga0207643_10148109 | |||
| 1254 | Ga0207705_10065333 | |||
| 1255 | Ga0207684_10077781 | |||
| 1256 | Ga0207684_10082720 | |||
| 1257 | Ga0207684_10122257 | |||
| 1258 | Ga0207684_10138099 | |||
| 1259 | Ga0207707_10151448 | |||
| 1260 | Ga0207707_10429798 | |||
| 1261 | Ga0207695_10113923 | |||
| 1262 | Ga0207695_10893478 | |||
| 1263 | Ga0207693_10550947 | |||
| 1264 | Ga0207663_10422947 | |||
| 1265 | Ga0207663_11123479 | |||
| 1266 | Ga0207660_10078981 | |||
| 1267 | Ga0207660_11092007 | |||
| 1268 | Ga0207662_10000352 | |||
| 1269 | Ga0207662_10015626 | |||
| 1270 | Ga0207657_10001576 | |||
| 1271 | Ga0207649_10102535 | |||
| 1272 | Ga0207649_10285663 | |||
| 1273 | Ga0207652_10265783 | |||
| 1274 | Ga0207652_10362994 | |||
| 1275 | Ga0207652_11205363 | |||
| 1276 | Ga0207646_10000002 | |||
| 1277 | Ga0207646_10000054 | |||
| 1278 | Ga0207646_10001160 | |||
| 1279 | Ga0207646_10086748 | |||
| 1280 | Ga0207646_10210160 | |||
| 1281 | Ga0207681_10072002 | |||
| 1282 | Ga0207681_10104389 | |||
| 1283 | Ga0207650_10002690 | |||
| 1284 | Ga0207650_10170259 | |||
| 1285 | Ga0207650_11076996 | |||
| 1286 | Ga0207659_10020863 | |||
| 1287 | Ga0207659_10279133 | |||
| 1288 | Ga0207687_10376076 | |||
| 1289 | Ga0207687_10708284 | |||
| 1290 | Ga0207700_10188101 | |||
| 1291 | Ga0207700_11656816 | |||
| 1292 | Ga0207664_10342830 | |||
| 1293 | Ga0207644_10198814 | |||
| 1294 | Ga0207690_10252180 | |||
| 1295 | Ga0207706_10001393 | |||
| 1296 | Ga0207706_10028379 | |||
| 1297 | Ga0207706_10369541 | |||
| 1298 | Ga0207686_10004526 | |||
| 1299 | Ga0207686_10066146 | |||
| 1300 | Ga0207686_10261846 | |||
| 1301 | Ga0207709_10004532 | |||
| 1302 | Ga0207670_10000053 | |||
| 1303 | Ga0207670_10637889 | |||
| 1304 | Ga0207670_11483836 | |||
| 1305 | Ga0207670_11785987 | |||
| 1306 | Ga0207669_10005484 | |||
| 1307 | Ga0207669_10012019 | |||
| 1308 | Ga0207704_10025527 | |||
| 1309 | Ga0207665_10160631 | |||
| 1310 | Ga0207665_10217650 | |||
| 1311 | Ga0207665_10234300 | |||
| 1312 | Ga0207691_10000870 | |||
| 1313 | Ga0207691_10004262 | |||
| 1314 | Ga0207711_10049366 | |||
| 1315 | Ga0207689_10006189 | |||
| 1316 | Ga0207661_10228006 | |||
| 1317 | Ga0207661_10342273 | |||
| 1318 | Ga0207661_10718813 | |||
| 1319 | Ga0207679_10018681 | |||
| 1320 | Ga0207679_10078373 | |||
| 1321 | Ga0207679_10104725 | |||
| 1322 | Ga0207651_10000601 | |||
| 1323 | Ga0207651_10143366 | |||
| 1324 | Ga0207712_11965099 | |||
| 1325 | Ga0207668_10076663 | |||
| 1326 | Ga0207640_10041402 | |||
| 1327 | Ga0207658_10273311 | |||
| 1328 | Ga0207658_10641917 | |||
| 1329 | Ga0207658_10753927 | |||
| 1330 | Ga0207677_10102633 | |||
| 1331 | Ga0207677_10148613 | |||
| 1332 | Ga0207677_10630871 | |||
| 1333 | Ga0207678_10041910 | |||
| 1334 | Ga0207678_10468281 | |||
| 1335 | Ga0207708_10001032 | |||
| 1336 | Ga0207708_10001978 | |||
| 1337 | Ga0207708_10160025 | |||
| 1338 | Ga0207708_11163398 | |||
| 1339 | Ga0207641_10363034 | |||
| 1340 | Ga0207641_11528495 | |||
| 1341 | Ga0207648_10000181 | |||
| 1342 | Ga0207648_10005069 | |||
| 1343 | Ga0207674_10023369 | |||
| 1344 | Ga0207675_100141689 | |||
| 1345 | Ga0207683_10001223 | |||
| 1346 | Ga0207683_10002408 | |||
| 1347 | Ga0207698_10346390 | |||
| 1348 | Ga0209973_1002415 | |||
| 1349 | Ga0209969_1000216 | |||
| 1350 | Ga0209967_1000122 | |||
| 1351 | Ga0209967_1015523 | |||
| 1352 | Ga0209981_1000223 | |||
| 1353 | Ga0209996_1000045 | |||
| 1354 | Ga0209984_1000065 | |||
| 1355 | Ga0209984_1009482 | |||
| 1356 | Ga0209984_1075189 | |||
| 1357 | Ga0210000_1000076 | |||
| 1358 | Ga0209995_1000065 | |||
| 1359 | Ga0209995_1033882 | |||
| 1360 | Ga0209968_1000034 | |||
| 1361 | Ga0209999_1000616 | |||
| 1362 | Ga0209982_1000098 | |||
| 1363 | Ga0209970_1000359 | |||
| 1364 | Ga0210002_1000027 | |||
| 1365 | Ga0209588_1048753 | |||
| 1366 | Ga0209971_1000286 | |||
| 1367 | Ga0209971_1020531 | |||
| 1368 | Ga0209971_1030455 | |||
| 1369 | Ga0209966_1000222 | |||
| 1370 | Ga0209966_1011888 | |||
| 1371 | Ga0209998_10000176 | |||
| 1372 | Ga0209974_10000328 | |||
| 1373 | Ga0209974_10000545 | |||
| 1374 | Ga0209974_10054532 | |||
| 1375 | Ga0207428_10002328 | |||
| 1376 | Ga0207428_10002568 | |||
| 1377 | Ga0268266_10206173 | |||
| 1378 | Ga0268266_10287607 | |||
| 1379 | Ga0268265_10064445 | |||
| 1380 | Ga0268264_11083710 | |||
| 1381 | Ga0265319_1010876 | |||
| 1382 | Ga0265334_10194590 | |||
| 1383 | Ga0265318_10000439 | |||
| 1384 | Ga0265338_10865254 | |||
| 1385 | Ga0265762_1017359 | |||
| 1386 | Ga0265770_1013571 | |||
| 1387 | Ga0265760_10022067 | |||
| 1388 | Ga0265760_10077749 | |||
| 1389 | Ga0265760_10291900 | |||
| 1390 | Ga0265332_10016920 | |||
| 1391 | Ga0265320_10000140 | |||
| 1392 | Ga0265325_10204056 | |||
| 1393 | Ga0265329_10002035 | |||
| 1394 | Ga0265329_10014615 | |||
| 1395 | Ga0265340_10005730 | |||
| 1396 | Ga0265331_10000041 | |||
| 1397 | Ga0265331_10048745 | |||
| 1398 | Ga0265331_10098801 | |||
| 1399 | Ga0265316_10002673 | |||
| 1400 | Ga0265316_10009564 | |||
| 1401 | Ga0307408_100148245 | |||
| 1402 | Ga0265313_10006224 | |||
| 1403 | Ga0265314_10026534 | |||
| 1404 | Ga0265342_10000124 | |||
| 1405 | Ga0307405_10072312 | |||
| 1406 | Ga0307413_10242169 | |||
| 1407 | Ga0307413_11872312 | |||
| 1408 | Ga0307410_10091894 | |||
| 1409 | Ga0307406_10051879 | |||
| 1410 | Ga0307407_10119627 | |||
| 1411 | Ga0307412_10016024 | |||
| 1412 | Ga0307412_10190217 | |||
| 1413 | Ga0307409_100019582 | |||
| 1414 | Ga0307409_100064422 | |||
| 1415 | Ga0307409_101232964 | |||
| 1416 | Ga0307416_100077603 | |||
| 1417 | Ga0307416_100194562 | |||
| 1418 | Ga0307414_10139658 | |||
| 1419 | Ga0307414_11426353 | |||
| 1420 | Ga0307411_10308395 | |||
| 1421 | Ga0307415_100067501 | |||
| 1422 | Ga0307415_100288338 | |||
| 1423 | Ga0307415_100992916 | |||
| 1424 | Ga0373926_0004739 | |||
| 1425 | Ga0373940_0134909 | |||
| 1426 | Ga0373952_0181845 | |||
| 1427 | Ga0373923_0316558 | |||
| 1428 | Ga0373936_0037213 | |||
| 1429 | Ga0373953_0055979 | |||
| 1430 | Ga0373954_0201318 | |||
| 1431 | Ga0373956_0193592 | |||
| 1432 | Ga0373956_0225221 | |||
| 1433 | Ga0373957_0093858 | |||
| 1434 | Ga0373960_0085963 | |||
| 1435 | Ga0373955_0340038 | |||
| 1436 | Ga0373961_0009234 | |||
| 1437 | Ga0373961_0164035 | |||
| 1438 | Ga0373961_0223493 | |||
| 1439 | Ga0373962_0024361 | |||
| 1440 | Ga0373962_0075398 | |||
| 1441 | Ga0373924_0165970 | |||
| 1442 | Ga0373935_0024328 | |||
| 1443 | Ga0373935_1303596 | |||
| 1444 | Ga0373927_0069235 | |||
| 1445 | Ga0373927_0310498 | |||
| 1446 | Ga0373927_0485418 | |||
| 1447 | Ga0373933_0014214 | |||
| 1448 | Ga0373933_0227764 | |||
| 1449 | Ga0373933_0593260 | |||
| 1450 | Ga0373933_0745062 | |||
| 1451 | Ga0373937_0035051 | |||
| 1452 | Ga0373937_0118881 | |||
| 1453 | Ga0373925_0076561 | |||
| 1454 | Ga0439438_033108 | |||
| 1455 | Ga0439461_0011687 | |||
| 1456 | Ga0439466_0029467 | |||
| 1457 | Ga0439437_004669 | |||
| 1458 | Ga0439448_0098732 | |||
| 1459 | Ga0439450_136445 | |||
| 1460 | Ga0439455_0028267 | |||
| 1461 | Ga0439455_0202142 | |||
| 1462 | Ga0450923_005616 | |||
| 1463 | Ga0439446_0122358 | |||
| 1464 | Ga0439458_0052481 | |||
| 1465 | Ga0439435_0287007 | |||
| 1466 | Ga0439464_0034121 | |||
| 1467 | Ga0439460_0091381 | |||
| 1468 | Ga0451577_0000885 | |||
| 1469 | Ga0451577_0027189 | |||
| 1470 | Ga0451577_0067331 | |||
| 1471 | Ga0451577_0235158 | |||
| 1472 | Ga0451577_0560195 | |||
| 1473 | Ga0451577_0788213 | |||
| 1474 | Ga0451577_0939340 | |||
| 1475 | Ga0453683_0014159 | |||
| 1476 | Ga0453683_0014207 | |||
| 1477 | Ga0453683_0034684 | |||
| 1478 | Ga0453683_0074707 | |||
| 1479 | Ga0453683_0473262 | |||
| 1480 | Ga0453683_1124894 | |||
| 1481 | Ga0453684_0007009 | |||
| 1482 | Ga0453684_0050436 | |||
| 1483 | Ga0453684_0130041 | |||
| 1484 | Ga0453684_0162077 | |||
| 1485 | Ga0453684_1781265 | |||
| 1486 | Ga0451576_0002419 | |||
| 1487 | Ga0451576_0036759 | |||
| 1488 | Ga0451576_0046815 | |||
| 1489 | Ga0451576_0074698 | |||
| 1490 | Ga0451576_0258020 | |||
| 1491 | Ga0451576_0701360 | |||
| 1492 | Ga0451576_0822275 | |||
| 1493 | Ga0451576_1221899 | |||
| 1494 | Ga0466967_0143428 | |||
| 1495 | Ga0466967_0542838 | |||
| 1496 | Ga0466967_1388620 | |||
| 1497 | Ga0495592_0016988 | |||
| 1498 | Ga0495592_0206511 | |||
| 1499 | Ga0495603_0460916 | |||
| 1500 | Ga0495629_0388864 | |||
| 1501 | Ga0495651_0000133 | |||
| 1502 | Ga0495651_0027170 | |||
| 1503 | Ga0495651_0353254 | |||
| 1504 | Ga0495651_0426347 | |||
| 1505 | Ga0495653_0047314 | |||
| 1506 | Ga0495580_0017781 | |||
| 1507 | Ga0495580_0350557 | |||
| 1508 | Ga0495580_0618850 | |||
| 1509 | Ga0495582_0170029 | |||
| 1510 | Ga0495639_0058938 | |||
| 1511 | Ga0495662_0011783 | |||
| 1512 | Ga0495662_0368581 | |||
| 1513 | Ga0495664_0008170 | |||
| 1514 | Ga0495664_0114648 | |||
| 1515 | Ga0495594_0080667 | |||
| 1516 | Ga0495594_0355498 | |||
| 1517 | Ga0495608_0057025 | |||
| 1518 | Ga0495618_0008021 | |||
| 1519 | Ga0495618_0267493 | |||
| 1520 | Ga0495618_0375641 | |||
| 1521 | Ga0495628_0006374 | |||
| 1522 | Ga0495628_0307405 | |||
| 1523 | Ga0495628_0392985 | |||
| 1524 | Ga0495628_0653145 | |||
| 1525 | Ga0495628_0909103 | |||
| 1526 | Ga0495630_0000009 | |||
| 1527 | Ga0495630_0003389 | |||
| 1528 | Ga0495630_0039018 | |||
| 1529 | Ga0495630_0049420 | |||
| 1530 | Ga0495630_0056500 | |||
| 1531 | Ga0495630_0289324 | |||
| 1532 | Ga0495666_0059499 | |||
| 1533 | Ga0495666_0084259 | |||
| 1534 | Ga0495666_0463799 | |||
| 1535 | Ga0495652_0019370 | |||
| 1536 | Ga0495652_0114813 | |||
| 1537 | Ga0495652_0516649 | |||
| 1538 | Ga0495665_0000488 | |||
| 1539 | Ga0495665_0622710 | |||
| 1540 | Ga0495640_0063811 | |||
| 1541 | Ga0495586_0004352 | |||
| 1542 | Ga0495586_0371757 | |||
| 1543 | Ga0495587_0030912 | |||
| 1544 | Ga0495645_0012588 | |||
| 1545 | Ga0495667_0001795 | |||
| 1546 | Ga0495667_0006569 | |||
| 1547 | Ga0495634_0086891 | |||
| 1548 | Ga0495635_0008062 | |||
| 1549 | Ga0495635_0085165 | |||
| 1550 | Ga0495635_0274410 | |||
| 1551 | Ga0495635_0432840 | |||
| 1552 | Ga0495657_0010028 | |||
| 1553 | Ga0495657_0046711 | |||
| 1554 | Ga0495657_0145560 | |||
| 1555 | Ga0495657_0377446 | |||
| 1556 | Ga0495599_0266851 | |||
| 1557 | Ga0495623_0002491 | |||
| 1558 | Ga0495646_0476055 | |||
| 1559 | Ga0495658_0102958 | |||
| 1560 | Ga0495658_0145936 | |||
| 1561 | Ga0495658_0407445 | |||
| 1562 | Ga0495613_0101555 | |||
| 1563 | Ga0495624_0041360 | |||
| 1564 | Ga0495600_0009744 | |||
| 1565 | Ga0495600_0102321 | |||
| 1566 | Ga0495581_0042163 | |||
| 1567 | Ga0495604_0005212 | |||
| 1568 | Ga0495604_0012739 | |||
| 1569 | Ga0495636_0030451 | |||
| 1570 | Ga0495674_0006221 | |||
| 1571 | Ga0495674_0032577 | |||
| 1572 | Ga0495674_0040290 | |||
| 1573 | Ga0495674_0064800 | |||
| 1574 | Ga0495676_0627742 | |||
| 1575 | Ga0495680_0000776 | |||
| 1576 | Ga0495680_0019706 | |||
| 1577 | Ga0495680_0038037 | |||
| 1578 | Ga0495680_0093061 | |||
| 1579 | Ga0495675_0000189 | |||
| 1580 | Ga0495675_0035688 | |||
| 1581 | Ga0495675_0046116 | |||
| 1582 | Ga0495675_0069202 | |||
| 1583 | Ga0495675_0077206 | |||
| 1584 | Ga0495684_0028190 | |||
| 1585 | Ga0495684_0033388 | |||
| 1586 | Ga0495593_0004934 | |||
| 1587 | Ga0495602_0067362 | |||
| 1588 | Ga0495602_0209859 | |||
| 1589 | Ga0495602_0522345 | |||
| 1590 | Ga0495614_0061367 | |||
| 1591 | Ga0496101_0498450 | |||
| 1592 | Ga0496102_0458974 | |||
| 1593 | Ga0496102_1018844 | |||
| 1594 | Ga0496105_0061027 | |||
| 1595 | Ga0496106_0098511 | |||
| 1596 | Ga0496108_0020204 | |||
| 1597 | Ga0496111_0360376 | |||
| 1598 | Ga0496112_0067688 | |||
| 1599 | Ga0496112_0317780 | |||
| 1600 | Ga0496114_0029603 | |||
| 1601 | Ga0501290_000596 | |||
| 1602 | Ga0501291_000823 | |||
| 1603 | Ga0501291_006467 | |||
| 1604 | Ga0501292_000168 | |||
| 1605 | Ga0501293_000091 | |||
| 1606 | Ga0501294_000266 | |||
| 1607 | Ga0501295_000127 | |||
| 1608 | Ga0501296_000124 | |||
| 1609 | Ga0501297_000183 | |||
| 1610 | Ga0501299_000137 | |||
| 1611 | Ga0501299_009942 | |||
| 1612 | Ga0501300_000091 | |||
| 1613 | Ga0501301_000204 | |||
| 1614 | Ga0501302_000192 | |||
| 1615 | Ga0501303_002264 | |||
| 1616 | Ga0501031_0007856 | |||
| 1617 | Ga0501031_0024641 | |||
| 1618 | Ga0501031_0110242 | |||
| 1619 | Ga0501031_0234020 | |||
| 1620 | Ga0501032_0112874 | |||
| 1621 | Ga0501032_0151462 | |||
| 1622 | Ga0501032_0923148 | |||
| 1623 | Ga0501033_0727093 | |||
| 1624 | Ga0501036_0013265 | |||
| 1625 | Ga0501036_0271641 | |||
| 1626 | Ga0501036_0397120 | |||
| 1627 | Ga0501037_0030552 | |||
| 1628 | Ga0501037_0042528 | |||
| 1629 | Ga0501037_0378656 | |||
| 1630 | Ga0501038_0191237 | |||
| 1631 | Ga0501038_0668934 | |||
| 1632 | Ga0501039_0000259 | |||
| 1633 | Ga0501039_0024687 | |||
| 1634 | Ga0501039_0026928 | |||
| 1635 | Ga0501039_0063705 | |||
| 1636 | Ga0501039_0124375 | |||
| 1637 | Ga0501039_0125603 | |||
| 1638 | Ga0501039_0347647 | |||
| 1639 | Ga0501039_0430797 | |||
| 1640 | Ga0501040_0157761 | |||
| 1641 | Ga0501040_0255552 | |||
| 1642 | Ga0501040_0407963 | |||
| 1643 | Ga0501040_0604137 | |||
| 1644 | Ga0501041_0003282 | |||
| 1645 | Ga0501041_0007520 | |||
| 1646 | Ga0501041_0066861 | |||
| 1647 | Ga0501041_0087281 | |||
| 1648 | Ga0501041_0274045 | |||
| 1649 | Ga0501041_0962930 | |||
| 1650 | Ga0501042_0011092 | |||
| 1651 | Ga0501042_0029514 | |||
| 1652 | Ga0501042_0056731 | |||
| 1653 | Ga0501042_0176510 | |||
| 1654 | Ga0501043_0095962 | |||
| 1655 | Ga0501043_0237026 | |||
| 1656 | Ga0501043_0825702 | |||
| 1657 | Ga0501046_0008527 | |||
| 1658 | Ga0501046_0196868 | |||
| 1659 | Ga0501046_0358383 | |||
| 1660 | Ga0501046_0370167 | |||
| 1661 | Ga0501047_1097035 | |||
| 1662 | Ga0501048_0020819 | |||
| 1663 | Ga0501067_0316572 | |||
| 1664 | Ga0501068_0061113 | |||
| 1665 | Ga0501071_0026305 | |||
| 1666 | Ga0501071_0068747 | |||
| 1667 | Ga0501071_1022860 | |||
| 1668 | Ga0501072_0056665 | |||
| 1669 | Ga0501072_1243448 | |||
| 1670 | Ga0501075_0096426 | |||
| 1671 | Ga0501075_0130022 | |||
| 1672 | Ga0501076_0032355 | |||
| 1673 | Ga0501076_0071673 | |||
| 1674 | Ga0501076_0101851 | |||
| 1675 | Ga0501076_0744089 | |||
| 1676 | Ga0501077_0043062 | |||
| 1677 | Ga0501077_0392024 | |||
| 1678 | Ga0501198_000458 | |||
| 1679 | Ga0501199_000094 | |||
| 1680 | Ga0501201_000059 | |||
| 1681 | Ga0501206_000319 | |||
| 1682 | Ga0501207_000525 | |||
| 1683 | Ga0501208_001976 | |||
| 1684 | Ga0501209_009181 | |||
| 1685 | Ga0501210_000160 | |||
| 1686 | Ga0501211_001072 | |||
| 1687 | Ga0501216_000290 | |||
| 1688 | Ga0501217_000296 | |||
| 1689 | Ga0501223_015667 | |||
| 1690 | Ga0501227_004686 | |||
| 1691 | Ga0501228_000863 | |||
| 1692 | Ga0501230_000052 | |||
| 1693 | Ga0501233_000992 | |||
| 1694 | Ga0501235_002306 | |||
| 1695 | Ga0501236_000177 | |||
| 1696 | Ga0501239_000405 | |||
| 1697 | Ga0501240_002350 | |||
| 1698 | Ga0501242_034102 | |||
| 1699 | Ga0501246_000917 | |||
| 1700 | Ga0501247_002159 | |||
| 1701 | Ga0501248_000106 | |||
| 1702 | Ga0501249_003923 | |||
| 1703 | Ga0501250_000268 | |||
| 1704 | Ga0501251_000523 | |||
| 1705 | Ga0501252_014004 | |||
| 1706 | Ga0501253_000188 | |||
| 1707 | Ga0501255_002517 | |||
| 1708 | Ga0501256_000662 | |||
| 1709 | Ga0501257_007736 | |||
| 1710 | Ga0501258_001404 | |||
| 1711 | Ga0501260_000088 | |||
| 1712 | Ga0501261_000448 | |||
| 1713 | Ga0501219_001067 | |||
| 1714 | Ga0501219_018201 | |||
| 1715 | Ga0501221_001674 | |||
| 1716 | Ga0501225_0001217 | |||
| 1717 | Ga0501229_001027 | |||
| 1718 | Ga0501234_004015 | |||
| 1719 | Ga0501245_000456 | |||
| 1720 | Ga0501079_0043565 | |||
| 1721 | Ga0501079_0292848 | |||
| 1722 | Ga0501080_0349833 | |||
| 1723 | Ga0501080_0440377 | |||
| 1724 | Ga0501080_0682945 | |||
| 1725 | Ga0501081_0703345 | |||
| 1726 | Ga0501232_000074 | |||
| 1727 | Ga0501262_000877 | |||
| 1728 | Ga0501265_000313 | |||
| 1729 | Ga0501266_000479 | |||
| 1730 | Ga0501268_000379 | |||
| 1731 | Ga0501269_001737 | |||
| 1732 | Ga0501270_000263 | |||
| 1733 | Ga0501271_000105 | |||
| 1734 | Ga0501272_000260 | |||
| 1735 | Ga0501273_000076 | |||
| 1736 | Ga0501274_004833 | |||
| 1737 | Ga0501275_000626 | |||
| 1738 | Ga0501276_000427 | |||
| 1739 | Ga0501278_000475 | |||
| 1740 | Ga0501279_000219 | |||
| 1741 | Ga0501280_003447 | |||
| 1742 | Ga0501281_01061 | |||
| 1743 | Ga0501282_000187 | |||
| 1744 | Ga0501283_000084 | |||
| 1745 | Ga0501283_033640 | |||
| 1746 | Ga0501035_0078709 | |||
| 1747 | Ga0501035_0087901 | |||
| 1748 | Ga0501045_0103836 | |||
| 1749 | Ga0501045_0627112 | |||
| 1750 | Ga0501204_012958 | |||
| 1751 | Ga0501212_003312 | |||
| 1752 | Ga0501220_00817 | |||
| 1753 | Ga0501226_006179 | |||
| 1754 | nmdc:mga05p37_217721_c1 | |||
| 1755 | nmdc:mga05p37_232437_c1 | |||
| 1756 | nmdc:mga05p37_516642_c1 | |||
| 1757 | nmdc:mga05p37_689088_c1 | |||
| 1758 | nmdc:mga05p37_714191_c1 | |||
| 1759 | nmdc:mga05p37_9370_c1 | |||
| 1760 | nmdc:mga09592_18965_c1 | |||
| 1761 | nmdc:mga09592_37184_c1 | |||
| 1762 | nmdc:mga09592_70775_c1 | |||
| 1763 | nmdc:mga09592_73782_c1 | |||
| 1764 | nmdc:mga0qj67_243258_c1 | |||
| 1765 | nmdc:mga0qj67_3453_c1 | |||
| 1766 | nmdc:mga0qj67_739313_c1 | |||
| 1767 | nmdc:mga06r32_1269608_c1 | |||
| 1768 | nmdc:mga06r32_46745_c1 | |||
| 1769 | nmdc:mga08y16_3045_c1 | |||
| 1770 | nmdc:mga08y16_42567_c1 | |||
| 1771 | nmdc:mga0n895_48754_c1 | |||
| 1772 | nmdc:mga0n895_63614_c1 | |||
| 1773 | nmdc:mga0n895_704614_c1 | |||
| 1774 | nmdc:mga0rr50_185639_c1 | |||
| 1775 | nmdc:mga0rr50_32887_c1 | |||
| 1776 | nmdc:mga0rr50_414627_c1 | |||
| 1777 | nmdc:mga0rr50_909572_c1 | |||
| 1778 | nmdc:mga08x19_115395_c1 | |||
| 1779 | nmdc:mga08x19_121143_c1 | |||
| 1780 | nmdc:mga08x19_45660_c1 | |||
| 1781 | nmdc:mga0a205_1032725_c1 | |||
| 1782 | nmdc:mga0a205_188639_c1 | |||
| 1783 | nmdc:mga0a205_23376_c1 | |||
| 1784 | nmdc:mga0a205_24681_c1 | |||
| 1785 | nmdc:mga0a205_47014_c1 | |||
| 1786 | Ga0495612_0000625 | |||
| 1787 | Ga0495595_0439141 | |||
| 1788 | Ga0495619_0072722 | |||
| 1789 | Ga0495619_0680632 | |||
| 1790 | Ga0501084_0031657 | |||
| 1791 | Ga0590075_042208 | |||
| 1792 | Ga0590077_024193 | |||
| 1793 | Ga0501082_0096087 | |||
| 1794 | Ga0501082_0479154 | |||
| 1795 | Ga0501082_0990695 | |||
| 1796 | Ga0530510_0470836 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7plo-assembly1.cif.gz_R | h. sapiens replisome-cul2/lrr1 complex | 0.9584 | 21 | 34 |
| 6bvb-assembly1.cif.gz_C | crystal structure of hif-2alpha-pvhl-elongin b-elongin c | 0.9381 | 21 | 34 |
| 7jtp-assembly1.cif.gz_K | crystal structure of protac ms67 in complex with the wd repeat-containing protein 5 and pvhl:elonginc:elonginb | 0.9217 | 21 | 34 |
| 3zrf-assembly1.cif.gz_B | pvhl54-213-elob-eloc complex_apo | 0.8994 | 21 | 34 |
| 3mks-assembly2.cif.gz_A | crystal structure of yeast cdc4/skp1 in complex with an allosteric inhibitor scf-i2 | 0.8753 | 21 | 34 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q4DLU6_155_281_3.30.710.10 | Alpha Beta;2-Layer Sandwich;Potassium Channel Kv1.1; Chain A;Potassium Channel Kv1.1; Chain A | 0.9521 | 21 | 34 | 3.30.710.10 |
| af_Q59RB3_7_100_3.30.710.10 | Alpha Beta;2-Layer Sandwich;Potassium Channel Kv1.1; Chain A;Potassium Channel Kv1.1; Chain A | 0.9374 | 21 | 34 | 3.30.710.10 |
| af_Q54Q05_13_109_3.30.710.10 | Alpha Beta;2-Layer Sandwich;Potassium Channel Kv1.1; Chain A;Potassium Channel Kv1.1; Chain A | 0.9255 | 21 | 34 | 3.30.710.10 |
| 2izvC00 | Alpha Beta;2-Layer Sandwich;Potassium Channel Kv1.1; Chain A;Potassium Channel Kv1.1; Chain A | 0.914 | 21 | 34 | 3.30.710.10 |
| af_Q9USX9_3_97_3.30.710.10 | Alpha Beta;2-Layer Sandwich;Potassium Channel Kv1.1; Chain A;Potassium Channel Kv1.1; Chain A | 0.9085 | 21 | 34 | 3.30.710.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2J4YFL3-F1-model_v4 | ISC system 2Fe-2S type ferredoxin | 0.9734 | 76 | 128 |
GO:0005829
GO:0009055 GO:0051537 GO:0140647 |
| AF-A0A1F2W601-F1-model_v4 | 2Fe-2S ferredoxin-type domain-containing protein | 0.9346 | 32 | 127 |
GO:0009055
GO:0051537 GO:0140647 |
| AF-A0A1F7NN45-F1-model_v4 | 2Fe-2S ferredoxin-type domain-containing protein | 0.9304 | 47 | 127 |
GO:0009055
GO:0051537 GO:0140647 |
| AF-A0A1F7PWV8-F1-model_v4 | Ferredoxin | 0.9235 | 18 | 129 |
GO:0009055
GO:0051537 GO:0140647 |
| AF-A0A6L5CA48-F1-model_v4 | deleted | 0.9206 | 71 | 127 |
|