F485071

General Info

Members Datasets Scaffolds Average Seq Length
898 426 1796 330

Family's Representative Sequence

Representative Sequence 3300009147|Ga0114129_10359091|Ga0114129_103590912
Length 389
Sequence LSATNHGNSKGRSVAASEIAATFDAALQAGGAAPANFAPIARFAYERTDCCGANSRAFRVMAKLRFSIAIGDYDRTRPLLDGRVQIDGVDPVFMTLSPEEIFFRAFRSQEFDICELSMSSFTVKTAHNDCPYVGVPAFVSRAFRHTSIYVRTDRVRAPAGLKGKKVGLPEYQLTACVWARAILEDDHGVKPADIHWVRGGIEEAGRPEKITLKLPPGVRLDNAPEGKTISQLLADGAIDGFIAPRPPTLDRAKHPNIGWLFADPTAAAKDYFKRTGIFPIMHMTGVRRELAERHPWLPAAVLKALEQSKALTLKNLGDTSATKVTLPFVEEQLKAARELMGEDFWSYGVAPNRKVLETFLRHHHAQGLSPRLVAVEEMFHPGTLESFKL

Samples

Sample ID Description Type Environment
1 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
2 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
3 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
4 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
5 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
6 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
7 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
8 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
9 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
10 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
11 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
12 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
13 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
14 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
15 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
16 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
17 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
18 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
19 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
20 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
21 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
22 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
23 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
24 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
25 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
26 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
27 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
28 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
29 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
30 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
31 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
32 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
33 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
34 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
35 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
36 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
37 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
38 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
39 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
40 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
41 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
42 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
43 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
44 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
45 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
46 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
47 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
48 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
49 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
50 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
51 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
52 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
53 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
54 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
55 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
56 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
57 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
58 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
59 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
60 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
61 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
62 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
63 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
64 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
65 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
66 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
67 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
68 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
69 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
70 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
71 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
72 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
73 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
74 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
75 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
76 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
77 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
78 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
79 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
80 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
81 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
82 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
83 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
84 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
85 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
86 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
87 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
88 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
89 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
90 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
91 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
92 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
93 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
94 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
95 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
96 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
97 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
98 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
99 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
100 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
101 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
102 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
103 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
104 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
105 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
106 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
107 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
108 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
109 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
110 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
111 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
112 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
113 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
114 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
115 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
116 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
117 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
118 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
119 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
120 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
121 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
122 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
123 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
124 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
125 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
126 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
127 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
128 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
129 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
130 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
131 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
132 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
133 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
134 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
135 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
136 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
137 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
138 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
139 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
140 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
141 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
142 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
143 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
144 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
145 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
146 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
147 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
148 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
149 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
150 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
151 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
153 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
154 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
155 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
156 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
157 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
158 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
159 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
160 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
212 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
213 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
216 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
217 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
218 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
219 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
220 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
221 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
223 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
224 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
225 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
226 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
227 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
228 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
229 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
230 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
231 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
232 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
233 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
234 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
235 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
236 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
237 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
238 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
239 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
240 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
241 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
242 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
243 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
244 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
245 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
246 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
247 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
248 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
249 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
250 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
251 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
252 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
253 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
254 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
255 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
256 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
257 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
258 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
259 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
260 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
261 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
262 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
263 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
264 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
265 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
266 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
267 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
268 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
269 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
270 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
271 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
272 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
273 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
274 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
275 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
276 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
277 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
278 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
279 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
280 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
281 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
282 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
283 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
284 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
285 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
286 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
287 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
288 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
289 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
290 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
291 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
292 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
293 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
294 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
295 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
296 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
297 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
298 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
299 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
300 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
301 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
302 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
303 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
304 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
305 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
306 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
307 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
308 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
309 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
310 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
311 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
312 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
313 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
314 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
315 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
316 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
317 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
318 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
319 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
320 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
321 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
322 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
323 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
324 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
325 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
326 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
327 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
328 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
329 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
330 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
331 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
332 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
333 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
334 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
335 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
336 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
337 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
338 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
339 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
340 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
341 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
342 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
343 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
344 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
345 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
346 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
347 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
348 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
349 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
350 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
351 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
352 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
353 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
354 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
355 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
356 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
357 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
358 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
359 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
360 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
361 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
362 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
363 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
364 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
365 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
366 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
367 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
368 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
369 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
370 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
371 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
372 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
373 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
374 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
375 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
376 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
377 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
378 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
379 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
380 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
381 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
382 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
383 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
384 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
385 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
386 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
387 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
388 3300049778 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control Metagenome Rhizosphere
389 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
390 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
391 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
392 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
393 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
394 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
395 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
396 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
397 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
398 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
399 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
400 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
401 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
402 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
403 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
404 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
405 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
406 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
407 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
408 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
409 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
410 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
411 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
412 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
413 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
414 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
415 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
416 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
417 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
418 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
419 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
420 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
421 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
422 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
423 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
424 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
425 2643221547 Pseudolabrys sp. Root1462 Isolate Unclassified
426 2837678835 Jiella endophytica CBS5Q-3 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.78
Metatranscriptomes 0
Isolates 0.22

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.9
Nodule 0.22
Rhizoplane 7.35
Rhizosphere 85.63
Stem 0
Stem Tuber 0
Unclassified 3.01

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0114129_10359091 3300009147 Bacteria 1928
2 ARcpr5yngRDRAFT_c000210 3300000043 Bacteria 9009
3 JGI24752J21851_1001364 3300001976 Bacteria 3298
4 JGI24746J21847_1000091 3300001977 Bacteria 9974
5 JGI24739J22299_10001085 3300001989 Bacteria 10126
6 JGI24737J22298_10000945 3300001990 Bacteria 10309
7 JGI24737J22298_10059255 3300001990 Bacteria 1154
8 JGI24743J22301_10003780 3300001991 Bacteria 2419
9 JGI24743J22301_10008026 3300001991 Bacteria 1842
10 JGI24750J21931_1000009 3300002070 Bacteria 22897
11 JGI24750J21931_1003333 3300002070 Unclassified 1925
12 JGI24750J21931_1003424 3300002070 Unclassified 1900
13 JGI24745J21846_1000043 3300002073 Bacteria 8500
14 JGI24748J21848_1002279 3300002074 Bacteria 2153
15 JGI24738J21930_10000069 3300002075 Bacteria 21758
16 JGI24749J21850_1001500 3300002076 Bacteria 3302
17 JGI24035J26624_1000336 3300002126 Bacteria 4390
18 JGI24033J26618_1003700 3300002155 Bacteria 1622
19 JGI24034J26672_10000258 3300002239 Bacteria 6974
20 JGI24742J22300_10000041 3300002244 Bacteria 18966
21 JGI24742J22300_10000607 3300002244 Bacteria 5391
22 JGI24751J29686_10002673 3300002459 Bacteria 3590
23 JGI25406J46586_10012414 3300003203 Bacteria 3697
24 JGI25153J46596_10000010 3300003215 Bacteria 337769
25 JGI25404J52841_10000199 3300003659 Bacteria 7152
26 Ga0055534_1000063 3300003784 Bacteria 81542
27 Ga0055528_1000070 3300003790 Bacteria 81542
28 Ga0055540_1005204 3300003792 Bacteria 5565
29 Ga0055531_10000406 3300003794 Bacteria 41415
30 Ga0065712_10092257 3300005290 Bacteria 2338
31 Ga0065715_10089103 3300005293 Bacteria 14332
32 Ga0070676_10000036 3300005328 Bacteria 40368
33 Ga0070676_10164156 3300005328 Bacteria 1432
34 Ga0070683_100000898 3300005329 Bacteria 22112
35 Ga0070683_100119955 3300005329 Bacteria 2484
36 Ga0070690_100000402 3300005330 Bacteria 21886
37 Ga0070690_100025638 3300005330 Bacteria 3631
38 Ga0070670_100087762 3300005331 Bacteria 2673
39 Ga0070677_10000124 3300005333 Bacteria 25567
40 Ga0068869_100000087 3300005334 Bacteria 42211
41 Ga0068869_100113414 3300005334 Unclassified 2064
42 Ga0070666_10004335 3300005335 Bacteria 8635
43 Ga0070666_10039271 3300005335 Bacteria 3154
44 Ga0070680_100001046 3300005336 Bacteria 19811
45 Ga0070680_100027578 3300005336 Bacteria 4548
46 Ga0070680_100346512 3300005336 Bacteria 1263
47 Ga0070682_100000341 3300005337 Bacteria 32124
48 Ga0068868_100007302 3300005338 Bacteria 7862
49 Ga0068868_100116455 3300005338 Bacteria 2176
50 Ga0070660_100002798 3300005339 Bacteria 11989
51 Ga0070660_100072025 3300005339 Unclassified 2699
52 Ga0070689_100001365 3300005340 Bacteria 15504
53 Ga0070689_100089519 3300005340 Bacteria 2424
54 Ga0070689_100095645 3300005340 Bacteria 2346
55 Ga0070689_100107712 3300005340 Bacteria 2213
56 Ga0070691_10005903 3300005341 Bacteria 5587
57 Ga0070687_100000339 3300005343 Bacteria 15932
58 Ga0070687_100169404 3300005343 Bacteria 1298
59 Ga0070661_100000017 3300005344 Bacteria 153232
60 Ga0070692_10000018 3300005345 Bacteria 33825
61 Ga0070692_10020333 3300005345 Bacteria 3219
62 Ga0070668_100001356 3300005347 Bacteria 17522
63 Ga0070668_100022599 3300005347 Bacteria 4756
64 Ga0070669_100000217 3300005353 Bacteria 47833
65 Ga0070669_100010139 3300005353 Bacteria 6701
66 Ga0070675_100000088 3300005354 Bacteria 53698
67 Ga0070675_100154113 3300005354 Bacteria 1972
68 Ga0070671_100001697 3300005355 Bacteria 16710
69 Ga0070671_100002748 3300005355 Bacteria 13664
70 Ga0070671_100090950 3300005355 Bacteria 2555
71 Ga0070671_100103130 3300005355 Bacteria 2393
72 Ga0070674_100001565 3300005356 Bacteria 12257
73 Ga0070673_100000239 3300005364 Bacteria 27611
74 Ga0070673_100085592 3300005364 Unclassified 2567
75 Ga0070688_100000084 3300005365 Bacteria 47194
76 Ga0070688_100005224 3300005365 Bacteria 6819
77 Ga0070688_100007541 3300005365 Bacteria 5872
78 Ga0070659_100001069 3300005366 Bacteria 20041
79 Ga0070659_100102280 3300005366 Bacteria 2306
80 Ga0070667_100006312 3300005367 Bacteria 9850
81 Ga0070667_100050860 3300005367 Bacteria 3492
82 Ga0070667_100155391 3300005367 Bacteria 2012
83 Ga0070703_10002012 3300005406 Bacteria 5947
84 Ga0070709_10040697 3300005434 Bacteria 2859
85 Ga0070709_10269662 3300005434 Bacteria 1233
86 Ga0070714_100024644 3300005435 Bacteria 4957
87 Ga0070714_100042480 3300005435 Bacteria 3841
88 Ga0070713_100004591 3300005436 Bacteria 9304
89 Ga0070713_100024720 3300005436 Bacteria 4685
90 Ga0070713_100062022 3300005436 Bacteria 3130
91 Ga0070713_100184933 3300005436 Bacteria 1875
92 Ga0070701_10000061 3300005438 Bacteria 28962
93 Ga0070711_100155658 3300005439 Bacteria 1728
94 Ga0070711_100381713 3300005439 Bacteria 1140
95 Ga0070705_100000425 3300005440 Bacteria 24231
96 Ga0070705_100119391 3300005440 Unclassified 1700
97 Ga0070700_100000430 3300005441 Bacteria 21259
98 Ga0070700_100001942 3300005441 Bacteria 10475
99 Ga0070694_100000401 3300005444 Bacteria 23534
100 Ga0070708_100217808 3300005445 Bacteria 1790
101 Ga0070663_100000713 3300005455 Bacteria 17941
102 Ga0070663_100022243 3300005455 Bacteria 4235
103 Ga0070678_100000053 3300005456 Bacteria 40418
104 Ga0070662_100000284 3300005457 Bacteria 30040
105 Ga0070662_100018792 3300005457 Bacteria 4681
106 Ga0070662_100057181 3300005457 Bacteria 2833
107 Ga0070681_10000493 3300005458 Bacteria 32198
108 Ga0070681_10062755 3300005458 Bacteria 3689
109 Ga0070681_10461698 3300005458 Unclassified 1182
110 Ga0068867_100000503 3300005459 Bacteria 26056
111 Ga0068867_100008910 3300005459 Bacteria 7080
112 Ga0068867_100020401 3300005459 Bacteria 4722
113 Ga0068867_100028314 3300005459 Bacteria 4034
114 Ga0070685_10001195 3300005466 Bacteria 13859
115 Ga0070699_100027166 3300005518 Bacteria 4937
116 Ga0070679_100000679 3300005530 Bacteria 29087
117 Ga0070679_100004801 3300005530 Bacteria 12466
118 Ga0070679_100166547 3300005530 Bacteria 2177
119 Ga0070684_100000144 3300005535 Bacteria 47665
120 Ga0068853_100068798 3300005539 Bacteria 3079
121 Ga0068853_100129992 3300005539 Unclassified 2254
122 Ga0068853_100314702 3300005539 Bacteria 1450
123 Ga0070672_100000014 3300005543 Bacteria 72627
124 Ga0070672_100005008 3300005543 Bacteria 8731
125 Ga0070672_100040524 3300005543 Bacteria 3574
126 Ga0070672_100088038 3300005543 Bacteria 2500
127 Ga0070686_100000899 3300005544 Bacteria 17300
128 Ga0070686_100017839 3300005544 Bacteria 4154
129 Ga0070695_100002430 3300005545 Bacteria 10707
130 Ga0070696_100010312 3300005546 Bacteria 6258
131 Ga0070696_100056349 3300005546 Bacteria 2741
132 Ga0070693_100000686 3300005547 Bacteria 15001
133 Ga0070693_100037772 3300005547 Bacteria 2695
134 Ga0070665_100071240 3300005548 Bacteria 3482
135 Ga0070665_100379443 3300005548 Bacteria 1421
136 Ga0070704_100000593 3300005549 Bacteria 17367
137 Ga0068855_100008091 3300005563 Bacteria 12704
138 Ga0068855_100069346 3300005563 Bacteria 4103
139 Ga0068855_100396996 3300005563 Bacteria 1512
140 Ga0070664_100004463 3300005564 Bacteria 11235
141 Ga0070664_100032419 3300005564 Bacteria 4370
142 Ga0070664_100074850 3300005564 Bacteria 2907
143 Ga0070664_100086090 3300005564 Bacteria 2715
144 Ga0068857_100001474 3300005577 Bacteria 18724
145 Ga0068854_100000168 3300005578 Bacteria 44522
146 Ga0068854_100083231 3300005578 Bacteria 2366
147 Ga0068856_100000932 3300005614 Bacteria 31354
148 Ga0068856_100067589 3300005614 Bacteria 3532
149 Ga0070702_100000047 3300005615 Bacteria 33510
150 Ga0070702_100028282 3300005615 Bacteria 3037
151 Ga0068852_100001577 3300005616 Bacteria 15493
152 Ga0068859_100005578 3300005617 Bacteria 12818
153 Ga0068859_100044635 3300005617 Bacteria 4453
154 Ga0068859_100079439 3300005617 Bacteria 3321
155 Ga0068864_100000507 3300005618 Bacteria 33520
156 Ga0068864_100022018 3300005618 Bacteria 5342
157 Ga0068864_100052253 3300005618 Bacteria 3521
158 Ga0068866_10002442 3300005718 Bacteria 7669
159 Ga0068866_10019232 3300005718 Bacteria 3104
160 Ga0068861_100000315 3300005719 Bacteria 27094
161 Ga0068861_100003730 3300005719 Bacteria 10161
162 Ga0068870_10000002 3300005840 Bacteria 91107
163 Ga0068870_10022401 3300005840 Bacteria 3104
164 Ga0068863_100000981 3300005841 Bacteria 28643
165 Ga0068858_100000356 3300005842 Bacteria 48189
166 Ga0068858_100049336 3300005842 Bacteria 3898
167 Ga0068860_100000747 3300005843 Bacteria 36976
168 Ga0068860_100018552 3300005843 Bacteria 6767
169 Ga0068860_100022098 3300005843 Bacteria 6158
170 Ga0068862_100000671 3300005844 Bacteria 35004
171 Ga0068862_100011911 3300005844 Bacteria 7183
172 Ga0068862_100043290 3300005844 Bacteria 3838
173 Ga0081455_10000276 3300005937 Bacteria 68055
174 Ga0081455_10011354 3300005937 Bacteria 8956
175 Ga0081455_10025859 3300005937 Bacteria 5410
176 Ga0081540_1000017 3300005983 Bacteria 164991
177 Ga0081540_1000045 3300005983 Bacteria 134124
178 Ga0081540_1097669 3300005983 Bacteria 1274
179 Ga0081539_10005839 3300005985 Bacteria 12218
180 Ga0070717_10034636 3300006028 Bacteria 4083
181 Ga0070717_10047826 3300006028 Bacteria 3506
182 Ga0070717_10131680 3300006028 Bacteria 2151
183 Ga0070717_10198870 3300006028 Bacteria 1755
184 Ga0075365_10013475 3300006038 Bacteria 4893
185 Ga0075365_10027459 3300006038 Bacteria 3622
186 Ga0070715_10005699 3300006163 Bacteria 4176
187 Ga0070715_10027950 3300006163 Bacteria 2257
188 Ga0070715_10037741 3300006163 Bacteria 2001
189 Ga0070716_100012210 3300006173 Bacteria 4348
190 Ga0070716_100266304 3300006173 Bacteria 1175
191 Ga0070712_100001956 3300006175 Bacteria 12621
192 Ga0070712_100012254 3300006175 Bacteria 5451
193 Ga0070712_100279792 3300006175 Bacteria 1343
194 Ga0075367_10040600 3300006178 Bacteria 2717
195 Ga0075367_10081021 3300006178 Bacteria 1964
196 Ga0097621_100000144 3300006237 Bacteria 43169
197 Ga0097621_100135418 3300006237 Unclassified 2100
198 Ga0075370_10002905 3300006353 Bacteria 8044
199 Ga0068871_100000110 3300006358 Bacteria 49756
200 Ga0075428_100152716 3300006844 Bacteria 2508
201 Ga0075428_100165283 3300006844 Bacteria 2401
202 Ga0075428_100179820 3300006844 Bacteria 2290
203 Ga0075428_100188735 3300006844 Bacteria 2230
204 Ga0075428_100443187 3300006844 Bacteria 1391
205 Ga0075430_100002679 3300006846 Bacteria 14868
206 Ga0075430_100089430 3300006846 Bacteria 2576
207 Ga0075431_100000111 3300006847 Bacteria 52069
208 Ga0075431_100034269 3300006847 Bacteria 5231
209 Ga0075431_100044271 3300006847 Bacteria 4591
210 Ga0075431_100078188 3300006847 Bacteria 3415
211 Ga0075431_100224539 3300006847 Bacteria 1915
212 Ga0075431_100228971 3300006847 Bacteria 1894
213 Ga0075433_10032425 3300006852 Bacteria 4475
214 Ga0075434_100000084 3300006871 Bacteria 50928
215 Ga0075434_100001952 3300006871 Bacteria 17878
216 Ga0075434_100195945 3300006871 Bacteria 2040
217 Ga0075434_100489400 3300006871 Bacteria 1251
218 Ga0068865_100000066 3300006881 Bacteria 54564
219 Ga0068865_100008038 3300006881 Bacteria 6512
220 Ga0068865_100027772 3300006881 Bacteria 3741
221 Ga0097620_100005578 3300006931 Bacteria 12818
222 Ga0097620_100044641 3300006931 Bacteria 4453
223 Ga0097620_100079438 3300006931 Bacteria 3321
224 Ga0099826_10000077 3300006948 Bacteria 51489
225 Ga0075435_100078463 3300007076 Unclassified 2708
226 Ga0075435_100152365 3300007076 Bacteria 1944
227 Ga0099794_10007547 3300007265 Bacteria 4474
228 Ga0105250_10023051 3300009092 Bacteria 2508
229 Ga0105240_10032085 3300009093 Bacteria 6803
230 Ga0111539_10000652 3300009094 Bacteria 44828
231 Ga0111539_10111721 3300009094 Bacteria 3206
232 Ga0111539_10143686 3300009094 Bacteria 2793
233 Ga0111539_10198207 3300009094 Bacteria 2342
234 Ga0111539_10411744 3300009094 Bacteria 1575
235 Ga0105245_10000287 3300009098 Bacteria 48204
236 Ga0105245_10055067 3300009098 Bacteria 3572
237 Ga0105245_10126618 3300009098 Bacteria 2392
238 Ga0105245_10145675 3300009098 Bacteria 2235
239 Ga0105247_10001223 3300009101 Bacteria 19057
240 Ga0114129_10029477 3300009147 Bacteria 7774
241 Ga0114129_10077932 3300009147 Bacteria 4609
242 Ga0114129_10144969 3300009147 Bacteria 3253
243 Ga0114129_10385262 3300009147 Bacteria 1851
244 Ga0105243_10000106 3300009148 Bacteria 95432
245 Ga0105243_10000695 3300009148 Bacteria 32613
246 Ga0105243_10034179 3300009148 Bacteria 3934
247 Ga0105243_10047868 3300009148 Bacteria 3369
248 Ga0105241_10000204 3300009174 Bacteria 44532
249 Ga0105242_10000792 3300009176 Bacteria 24525
250 Ga0105242_10211282 3300009176 Bacteria 1730
251 Ga0105242_10285383 3300009176 Bacteria 1501
252 Ga0105248_10002487 3300009177 Bacteria 20479
253 Ga0105248_10186540 3300009177 Bacteria 2337
254 Ga0105248_10195515 3300009177 Bacteria 2279
255 Ga0105237_10002795 3300009545 Bacteria 21203
256 Ga0105237_10234589 3300009545 Bacteria 1836
257 Ga0105238_10023825 3300009551 Bacteria 6240
258 Ga0105238_10072072 3300009551 Bacteria 3451
259 Ga0105238_10312433 3300009551 Bacteria 1557
260 Ga0105249_10000279 3300009553 Bacteria 53594
261 Ga0105249_10014648 3300009553 Bacteria 6932
262 Ga0105249_10044279 3300009553 Bacteria 4047
263 Ga0105239_10001686 3300010375 Bacteria 29130
264 Ga0105239_10083023 3300010375 Bacteria 3528
265 Ga0105239_10179323 3300010375 Bacteria 2370
266 Ga0105239_10302120 3300010375 Bacteria 1802
267 Ga0105239_10480059 3300010375 Bacteria 1412
268 Ga0105246_10000095 3300011119 Bacteria 38417
269 Ga0157373_10184590 3300013100 Bacteria 1469
270 Ga0157371_10009056 3300013102 Bacteria 7871
271 Ga0157370_10010506 3300013104 Bacteria 9750
272 Ga0157369_10150782 3300013105 Bacteria 2457
273 Ga0157374_10001348 3300013296 Bacteria 20895
274 Ga0157378_10000631 3300013297 Bacteria 33043
275 Ga0157378_10007666 3300013297 Bacteria 9421
276 Ga0157378_10344212 3300013297 Bacteria 1455
277 Ga0157378_10401672 3300013297 Bacteria 1350
278 Ga0163162_10000850 3300013306 Bacteria 28391
279 Ga0163162_10005487 3300013306 Bacteria 12255
280 Ga0163162_10350730 3300013306 Bacteria 1608
281 Ga0157372_10047887 3300013307 Bacteria 4751
282 Ga0157375_10000135 3300013308 Bacteria 73281
283 Ga0157375_10108044 3300013308 Bacteria 2876
284 Ga0163163_10065736 3300014325 Bacteria 3601
285 Ga0163163_10095849 3300014325 Bacteria 2987
286 Ga0157380_10000052 3300014326 Bacteria 67030
287 Ga0157380_10032855 3300014326 Bacteria 3993
288 Ga0157380_10100558 3300014326 Bacteria 2407
289 Ga0157380_10309385 3300014326 Bacteria 1459
290 Ga0157380_10320735 3300014326 Bacteria 1436
291 Ga0182008_10034200 3300014497 Bacteria 2549
292 Ga0157377_10000076 3300014745 Bacteria 75835
293 Ga0157379_10000060 3300014968 Bacteria 69312
294 Ga0157379_10098958 3300014968 Unclassified 2618
295 Ga0157379_10113953 3300014968 Bacteria 2430
296 Ga0157376_10000141 3300014969 Bacteria 49288
297 Ga0157376_10061915 3300014969 Bacteria 3147
298 Ga0157376_10232853 3300014969 Bacteria 1712
299 Ga0163161_10006630 3300017792 Bacteria 8017
300 Ga0163161_10018879 3300017792 Bacteria 4833
301 Ga0163161_10054737 3300017792 Bacteria 2896
302 Ga0163161_10192464 3300017792 Bacteria 1569
303 Ga0213872_10060315 3300021361 Bacteria 1716
304 Ga0213876_10032765 3300021384 Bacteria 2740
305 Ga0213875_10002544 3300021388 Bacteria 10884
306 Ga0209565_1000130 3300025263 Bacteria 108121
307 Ga0207666_1000005 3300025271 Bacteria 54011
308 Ga0209455_1002615 3300025272 Bacteria 6843
309 Ga0209673_1000106 3300025273 Bacteria 185426
310 Ga0209673_1019334 3300025273 Bacteria 2449
311 Ga0207673_1000002 3300025290 Bacteria 18299
312 Ga0209675_1000058 3300025291 Bacteria 185426
313 Ga0209025_1004721 3300025294 Bacteria 11622
314 Ga0209758_1000033 3300025297 Bacteria 469998
315 Ga0209051_1000059 3300025303 Bacteria 260307
316 Ga0209257_1000022 3300025304 Bacteria 765258
317 Ga0207697_10000011 3300025315 Bacteria 65035
318 Ga0207653_10023402 3300025885 Bacteria 1967
319 Ga0207682_10000051 3300025893 Bacteria 49249
320 Ga0207682_10000572 3300025893 Bacteria 17018
321 Ga0207682_10018113 3300025893 Bacteria 2751
322 Ga0207692_10103603 3300025898 Unclassified 1567
323 Ga0207692_10110724 3300025898 Bacteria 1522
324 Ga0207642_10000229 3300025899 Bacteria 16538
325 Ga0207642_10084277 3300025899 Unclassified 1552
326 Ga0207710_10090826 3300025900 Bacteria 1429
327 Ga0207688_10000001 3300025901 Bacteria 107505
328 Ga0207688_10008121 3300025901 Bacteria 5704
329 Ga0207680_10009743 3300025903 Bacteria 4779
330 Ga0207647_10012355 3300025904 Bacteria 5944
331 Ga0207647_10071943 3300025904 Unclassified 2086
332 Ga0207645_10000121 3300025907 Bacteria 58999
333 Ga0207645_10065556 3300025907 Bacteria 2321
334 Ga0207643_10000009 3300025908 Bacteria 160496
335 Ga0207643_10014436 3300025908 Bacteria 4290
336 Ga0207684_10024320 3300025910 Bacteria 5165
337 Ga0207654_10000271 3300025911 Bacteria 31641
338 Ga0207707_10000840 3300025912 Bacteria 30189
339 Ga0207707_10002707 3300025912 Bacteria 15840
340 Ga0207707_10008018 3300025912 Bacteria 9172
341 Ga0207695_10014787 3300025913 Bacteria 9221
342 Ga0207671_10030003 3300025914 Bacteria 4057
343 Ga0207693_10001099 3300025915 Bacteria 24306
344 Ga0207693_10011118 3300025915 Bacteria 7292
345 Ga0207693_10011491 3300025915 Bacteria 7162
346 Ga0207693_10028715 3300025915 Bacteria 4396
347 Ga0207663_10033490 3300025916 Bacteria 3061
348 Ga0207663_10096716 3300025916 Bacteria 1973
349 Ga0207663_10192185 3300025916 Bacteria 1466
350 Ga0207660_10000426 3300025917 Bacteria 27755
351 Ga0207660_10059281 3300025917 Bacteria 2747
352 Ga0207662_10000120 3300025918 Bacteria 37721
353 Ga0207662_10077363 3300025918 Bacteria 2024
354 Ga0207657_10002826 3300025919 Bacteria 18663
355 Ga0207657_10015306 3300025919 Bacteria 7436
356 Ga0207649_10000052 3300025920 Bacteria 106800
357 Ga0207652_10000508 3300025921 Bacteria 39568
358 Ga0207652_10001947 3300025921 Bacteria 17863
359 Ga0207681_10000035 3300025923 Bacteria 161792
360 Ga0207681_10007048 3300025923 Bacteria 6899
361 Ga0207681_10077900 3300025923 Bacteria 2332
362 Ga0207681_10252913 3300025923 Bacteria 1376
363 Ga0207694_10015924 3300025924 Bacteria 5674
364 Ga0207694_10248109 3300025924 Bacteria 1456
365 Ga0207650_10000843 3300025925 Bacteria 23231
366 Ga0207650_10009149 3300025925 Bacteria 6770
367 Ga0207650_10012334 3300025925 Bacteria 5899
368 Ga0207650_10021202 3300025925 Bacteria 4594
369 Ga0207659_10000027 3300025926 Bacteria 135454
370 Ga0207659_10020909 3300025926 Bacteria 4334
371 Ga0207659_10188571 3300025926 Bacteria 1639
372 Ga0207659_10474635 3300025926 Bacteria 1056
373 Ga0207687_10000231 3300025927 Bacteria 38087
374 Ga0207687_10190400 3300025927 Unclassified 1596
375 Ga0207687_10260149 3300025927 Bacteria 1383
376 Ga0207700_10020618 3300025928 Bacteria 4481
377 Ga0207700_10025902 3300025928 Bacteria 4082
378 Ga0207700_10278847 3300025928 Bacteria 1437
379 Ga0207700_10325538 3300025928 Bacteria 1333
380 Ga0207664_10139319 3300025929 Bacteria 2050
381 Ga0207664_10141841 3300025929 Bacteria 2033
382 Ga0207664_10440803 3300025929 Bacteria 1162
383 Ga0207644_10003468 3300025931 Bacteria 10194
384 Ga0207644_10221320 3300025931 Bacteria 1500
385 Ga0207690_10000056 3300025932 Bacteria 101387
386 Ga0207706_10000261 3300025933 Bacteria 57530
387 Ga0207706_10003407 3300025933 Bacteria 15186
388 Ga0207706_10024331 3300025933 Bacteria 5429
389 Ga0207706_10142727 3300025933 Bacteria 2106
390 Ga0207706_10342861 3300025933 Bacteria 1299
391 Ga0207686_10000171 3300025934 Bacteria 49624
392 Ga0207709_10000077 3300025935 Bacteria 169923
393 Ga0207709_10000087 3300025935 Bacteria 155019
394 Ga0207670_10000169 3300025936 Bacteria 43470
395 Ga0207670_10050322 3300025936 Bacteria 2792
396 Ga0207670_10065016 3300025936 Bacteria 2502
397 Ga0207670_10067928 3300025936 Bacteria 2454
398 Ga0207669_10003221 3300025937 Bacteria 7054
399 Ga0207669_10012052 3300025937 Bacteria 4235
400 Ga0207704_10000134 3300025938 Bacteria 40098
401 Ga0207704_10029498 3300025938 Bacteria 3060
402 Ga0207704_10059244 3300025938 Bacteria 2363
403 Ga0207704_10433507 3300025938 Bacteria 1045
404 Ga0207665_10003421 3300025939 Bacteria 10618
405 Ga0207665_10006302 3300025939 Bacteria 7867
406 Ga0207665_10089251 3300025939 Bacteria 2135
407 Ga0207665_10094086 3300025939 Bacteria 2081
408 Ga0207665_10122350 3300025939 Bacteria 1839
409 Ga0207691_10000106 3300025940 Bacteria 74290
410 Ga0207691_10005974 3300025940 Bacteria 11757
411 Ga0207691_10008316 3300025940 Bacteria 9966
412 Ga0207691_10044460 3300025940 Bacteria 4089
413 Ga0207691_10104009 3300025940 Bacteria 2531
414 Ga0207711_10002404 3300025941 Bacteria 16713
415 Ga0207711_10025906 3300025941 Bacteria 4918
416 Ga0207711_10098766 3300025941 Bacteria 2580
417 Ga0207689_10000031 3300025942 Bacteria 97131
418 Ga0207689_10018698 3300025942 Bacteria 5843
419 Ga0207661_10000219 3300025944 Bacteria 37298
420 Ga0207679_10000057 3300025945 Bacteria 104912
421 Ga0207679_10066812 3300025945 Bacteria 2696
422 Ga0207667_10012319 3300025949 Bacteria 9863
423 Ga0207667_10046913 3300025949 Bacteria 4574
424 Ga0207651_10000136 3300025960 Bacteria 31931
425 Ga0207651_10022623 3300025960 Bacteria 3848
426 Ga0207651_10077383 3300025960 Bacteria 2381
427 Ga0207651_10317111 3300025960 Bacteria 1302
428 Ga0207712_10000176 3300025961 Bacteria 66116
429 Ga0207712_10022814 3300025961 Bacteria 4125
430 Ga0207712_10069108 3300025961 Bacteria 2534
431 Ga0207668_10000191 3300025972 Bacteria 41901
432 Ga0207668_10081494 3300025972 Bacteria 2348
433 Ga0207668_10298009 3300025972 Bacteria 1329
434 Ga0207640_10000126 3300025981 Bacteria 58432
435 Ga0207640_10031868 3300025981 Bacteria 3263
436 Ga0207640_10302018 3300025981 Bacteria 1267
437 Ga0207658_10001331 3300025986 Bacteria 19354
438 Ga0207658_10027609 3300025986 Bacteria 3990
439 Ga0207658_10322764 3300025986 Bacteria 1337
440 Ga0207677_10043870 3300026023 Bacteria 2976
441 Ga0207703_10000662 3300026035 Bacteria 34434
442 Ga0207703_10036692 3300026035 Bacteria 3902
443 Ga0207703_10041853 3300026035 Bacteria 3673
444 Ga0207639_10004863 3300026041 Bacteria 9047
445 Ga0207639_10078616 3300026041 Bacteria 2604
446 Ga0207639_10271977 3300026041 Bacteria 1486
447 Ga0207678_10000137 3300026067 Bacteria 60700
448 Ga0207678_10105288 3300026067 Unclassified 2407
449 Ga0207708_10000250 3300026075 Bacteria 42228
450 Ga0207708_10002312 3300026075 Bacteria 14011
451 Ga0207702_10001067 3300026078 Bacteria 28056
452 Ga0207702_10176523 3300026078 Unclassified 1964
453 Ga0207641_10011323 3300026088 Bacteria 7321
454 Ga0207648_10000125 3300026089 Bacteria 75547
455 Ga0207648_10003783 3300026089 Bacteria 15808
456 Ga0207648_10004705 3300026089 Bacteria 13955
457 Ga0207648_10032400 3300026089 Bacteria 4615
458 Ga0207648_10048341 3300026089 Bacteria 3725
459 Ga0207676_10000891 3300026095 Bacteria 23194
460 Ga0207676_10040171 3300026095 Bacteria 3584
461 Ga0207676_10088398 3300026095 Bacteria 2536
462 Ga0207674_10000095 3300026116 Bacteria 99278
463 Ga0207674_10164549 3300026116 Bacteria 2172
464 Ga0207675_100000140 3300026118 Bacteria 62058
465 Ga0207675_100001910 3300026118 Bacteria 20784
466 Ga0207675_100015760 3300026118 Bacteria 7048
467 Ga0207675_100097245 3300026118 Bacteria 2772
468 Ga0207683_10000178 3300026121 Bacteria 54648
469 Ga0207683_10005574 3300026121 Bacteria 10789
470 Ga0207683_10053138 3300026121 Bacteria 3551
471 Ga0207683_10114796 3300026121 Bacteria 2414
472 Ga0207698_10002073 3300026142 Bacteria 11823
473 Ga0210002_1001008 3300027617 Bacteria 3897
474 Ga0209282_1000223 3300027666 Bacteria 29527
475 Ga0209588_1010538 3300027671 Bacteria 2780
476 Ga0209998_10005113 3300027717 Bacteria 2756
477 Ga0209813_10024173 3300027866 Bacteria 1735
478 Ga0209974_10006256 3300027876 Bacteria 4161
479 Ga0207428_10000037 3300027907 Bacteria 218857
480 Ga0207428_10181953 3300027907 Bacteria 1588
481 Ga0268266_10284605 3300028379 Bacteria 1538
482 Ga0268265_10000774 3300028380 Bacteria 30835
483 Ga0268265_10007031 3300028380 Bacteria 7610
484 Ga0268265_10068115 3300028380 Bacteria 2758
485 Ga0268264_10000467 3300028381 Bacteria 54925
486 Ga0268264_10031167 3300028381 Bacteria 4371
487 Ga0265337_1004015 3300028556 Bacteria 6220
488 Ga0307515_10000030 3300028794 Bacteria 364482
489 Ga0307515_10038535 3300028794 Bacteria 7641
490 Ga0265330_10055199 3300031235 Bacteria 1735
491 Ga0265320_10067999 3300031240 Bacteria 1684
492 Ga0265325_10043538 3300031241 Bacteria 2342
493 Ga0265325_10109036 3300031241 Bacteria 1347
494 Ga0265340_10011319 3300031247 Bacteria 4745
495 Ga0265339_10022924 3300031249 Bacteria 3612
496 Ga0265339_10023205 3300031249 Bacteria 3588
497 Ga0265316_10047692 3300031344 Bacteria 3387
498 Ga0265316_10084088 3300031344 Bacteria 2437
499 Ga0307513_10237018 3300031456 Bacteria 1633
500 Ga0265313_10003826 3300031595 Bacteria 11884
501 Ga0265313_10047475 3300031595 Bacteria 2077
502 Ga0265342_10043020 3300031712 Bacteria 2727
503 Ga0307516_10341968 3300031730 Bacteria 1163
504 Ga0307412_10154558 3300031911 Bacteria 1697
505 Ga0373930_0031405 3300034816 Unclassified 1094
506 Ga0373959_0031979 3300034820 Unclassified 1067
507 Ga0373926_0066917 3300035083 Bacteria 1316
508 Ga0373929_0001926 3300035085 Bacteria 3883
509 Ga0373934_0071197 3300035086 Bacteria 1391
510 Ga0373934_0087798 3300035086 Bacteria 1252
511 Ga0373940_0043834 3300035088 Bacteria 1238
512 Ga0373949_0004404 3300035090 Bacteria 3231
513 Ga0373951_0002829 3300035091 Bacteria 4319
514 Ga0373952_0001091 3300035092 Bacteria 4959
515 Ga0373923_0038638 3300035111 Bacteria 1957
516 Ga0373932_0008017 3300035112 Bacteria 2520
517 Ga0373939_0000421 3300035114 Bacteria 10637
518 Ga0373945_0005477 3300035116 Bacteria 4064
519 Ga0373945_0052308 3300035116 Bacteria 1504
520 Ga0373954_0008973 3300035118 Bacteria 4401
521 Ga0373960_0002654 3300035121 Bacteria 4046
522 Ga0373943_0000463 3300035170 Bacteria 17235
523 Ga0373943_0053316 3300035170 Bacteria 1997
524 Ga0373946_0023416 3300035171 Bacteria 2412
525 Ga0373946_0033513 3300035171 Bacteria 2068
526 Ga0373955_0001204 3300035172 Bacteria 11001
527 Ga0373955_0006420 3300035172 Bacteria 5359
528 Ga0373955_0022634 3300035172 Bacteria 3190
529 Ga0373942_0003886 3300035207 Bacteria 3495
530 Ga0373961_0019721 3300035241 Bacteria 1774
531 Ga0373962_0006310 3300035242 Bacteria 2870
532 Ga0373924_0062763 3300035410 Bacteria 1557
533 Ga0373931_0000209 3300035691 Bacteria 24963
534 Ga0373931_0001680 3300035691 Bacteria 9585
535 Ga0373931_0030198 3300035691 Bacteria 2789
536 Ga0373935_0000208 3300035692 Bacteria 28198
537 Ga0373927_0030660 3300035695 Bacteria 3508
538 Ga0373927_0111502 3300035695 Bacteria 1783
539 Ga0373933_0001412 3300035724 Bacteria 14109
540 Ga0373933_0003550 3300035724 Bacteria 8668
541 Ga0373933_0212194 3300035724 Bacteria 1241
542 Ga0373947_0030004 3300035725 Bacteria 3192
543 Ga0373947_0107945 3300035725 Bacteria 1756
544 Ga0373947_0134403 3300035725 Bacteria 1581
545 Ga0373937_0000031 3300036401 Bacteria 120533
546 Ga0373937_0001111 3300036401 Bacteria 22670
547 Ga0373937_0001925 3300036401 Bacteria 17362
548 Ga0373937_0002996 3300036401 Bacteria 14164
549 Ga0373937_0006839 3300036401 Bacteria 9841
550 Ga0373937_0032858 3300036401 Bacteria 4708
551 Ga0373937_0438072 3300036401 Bacteria 1241
552 Ga0373925_0000063 3300037068 Bacteria 114809
553 Ga0373925_0026368 3300037068 Bacteria 4253
554 Ga0373925_0073528 3300037068 Bacteria 2588
555 Ga0373925_0095798 3300037068 Bacteria 2274
556 Ga0373925_0335415 3300037068 Bacteria 1226
557 Ga0395900_0110770 3300037418 Bacteria 2820
558 Ga0395898_0086242 3300037466 Bacteria 3026
559 Ga0395905_0003404 3300037471 Bacteria 17022
560 Ga0395905_0068502 3300037471 Bacteria 3324
561 Ga0395905_0077697 3300037471 Bacteria 3110
562 Ga0395901_0014335 3300038443 Bacteria 8071
563 Ga0400486_28014 3300038742 Unclassified 1441
564 Ga0436365_0085457 3300039437 Bacteria 1324
565 Ga0436365_0248031 3300039437 Bacteria 1693
566 Ga0436365_1651064 3300039437 Bacteria 4965
567 Ga0436361_0365487 3300039447 Bacteria 7952
568 Ga0436363_0767643 3300039450 Unclassified 1268
569 Ga0436363_1104439 3300039450 Bacteria 1725
570 Ga0466972_0011884 3300044658 Bacteria 4374
571 Ga0466961_0160900 3300044693 Bacteria 1399
572 Ga0451576_0000694 3300045051 Bacteria 68295
573 Ga0495592_0000072 3300046454 Bacteria 91917
574 Ga0495592_0029714 3300046454 Bacteria 4137
575 Ga0495592_0107465 3300046454 Bacteria 1979
576 Ga0495592_0165365 3300046454 Bacteria 1519
577 Ga0495590_0042085 3300046457 Bacteria 1592
578 Ga0495591_004866 3300046458 Bacteria 6398
579 Ga0495629_0024763 3300046459 Bacteria 4272
580 Ga0495629_0077142 3300046459 Bacteria 2326
581 Ga0495629_0279651 3300046459 Bacteria 1145
582 Ga0495638_0044798 3300046460 Bacteria 2786
583 Ga0495638_0059669 3300046460 Bacteria 2361
584 Ga0495641_0128111 3300046461 Bacteria 1133
585 Ga0495651_0005951 3300046462 Bacteria 9307
586 Ga0495651_0038801 3300046462 Bacteria 3709
587 Ga0495653_0000020 3300046463 Bacteria 175274
588 Ga0495653_0136608 3300046463 Bacteria 1729
589 Ga0495580_0005811 3300046472 Bacteria 10127
590 Ga0495580_0254547 3300046472 Bacteria 1202
591 Ga0495582_0133708 3300046473 Bacteria 1402
592 Ga0495605_0020042 3300046474 Bacteria 3558
593 Ga0495662_0003193 3300046476 Bacteria 8278
594 Ga0495662_0083589 3300046476 Bacteria 1554
595 Ga0495664_0000006 3300046477 Bacteria 407031
596 Ga0495664_0073411 3300046477 Bacteria 2045
597 Ga0495584_0012887 3300046491 Bacteria 4268
598 Ga0495584_0033883 3300046491 Bacteria 2584
599 Ga0495584_0036680 3300046491 Bacteria 2476
600 Ga0495584_0057658 3300046491 Bacteria 1954
601 Ga0495596_0002466 3300046500 Bacteria 9944
602 Ga0495608_0000002 3300046511 Bacteria 376403
603 Ga0495616_0059163 3300046513 Bacteria 1885
604 Ga0495618_0000017 3300046514 Bacteria 143326
605 Ga0495618_0019326 3300046514 Bacteria 4190
606 Ga0495628_0000004 3300046516 Bacteria 462184
607 Ga0495628_0005223 3300046516 Bacteria 11398
608 Ga0495628_0005226 3300046516 Bacteria 11394
609 Ga0495628_0005631 3300046516 Bacteria 10965
610 Ga0495628_0125278 3300046516 Bacteria 1969
611 Ga0495630_0000832 3300046517 Bacteria 21777
612 Ga0495630_0171870 3300046517 Bacteria 1651
613 Ga0495631_0019159 3300046518 Bacteria 3211
614 Ga0495648_0006327 3300046524 Bacteria 9685
615 Ga0495652_0000007 3300046529 Bacteria 418163
616 Ga0495652_0029416 3300046529 Bacteria 4827
617 Ga0495652_0050815 3300046529 Bacteria 3543
618 Ga0495652_0053314 3300046529 Bacteria 3447
619 Ga0495654_0001084 3300046530 Bacteria 19844
620 Ga0495665_0008869 3300046531 Bacteria 5456
621 Ga0495640_0000004 3300046533 Bacteria 357515
622 Ga0495640_0026084 3300046533 Bacteria 4229
623 Ga0495640_0066732 3300046533 Bacteria 2426
624 Ga0495640_0083344 3300046533 Bacteria 2122
625 Ga0495640_0111475 3300046533 Bacteria 1788
626 Ga0495587_0000002 3300046536 Bacteria 425485
627 Ga0495598_0001493 3300046537 Bacteria 4652
628 Ga0495598_0008909 3300046537 Bacteria 2351
629 Ga0495645_0000008 3300046543 Bacteria 331530
630 Ga0495645_0000124 3300046543 Bacteria 51967
631 Ga0495645_0000848 3300046543 Bacteria 20818
632 Ga0495622_0079263 3300046557 Bacteria 1512
633 Ga0495667_0000010 3300046559 Bacteria 222698
634 Ga0495667_0001817 3300046559 Bacteria 14166
635 Ga0495667_0102670 3300046559 Bacteria 1849
636 Ga0495656_0125314 3300046615 Bacteria 1217
637 Ga0495668_0041709 3300046616 Bacteria 2556
638 Ga0495634_0000603 3300046642 Bacteria 34766
639 Ga0495634_0117222 3300046642 Bacteria 1707
640 Ga0495635_0000004 3300046663 Bacteria 388068
641 Ga0495635_0004141 3300046663 Bacteria 10053
642 Ga0495659_0079113 3300046664 Bacteria 1245
643 Ga0495661_0018260 3300046665 Bacteria 4617
644 Ga0495588_0132881 3300046674 Bacteria 1313
645 Ga0495657_0000051 3300046675 Bacteria 101587
646 Ga0495657_0052535 3300046675 Bacteria 2731
647 Ga0495657_0097334 3300046675 Bacteria 1879
648 Ga0495599_0000003 3300046678 Bacteria 319085
649 Ga0495599_0127788 3300046678 Bacteria 1579
650 Ga0495623_0000009 3300046679 Bacteria 127758
651 Ga0495623_0010252 3300046679 Bacteria 6064
652 Ga0495623_0059406 3300046679 Bacteria 2401
653 Ga0495646_0000001 3300046680 Bacteria 403396
654 Ga0495646_0003279 3300046680 Bacteria 10074
655 Ga0495646_0033837 3300046680 Bacteria 3177
656 Ga0495646_0144783 3300046680 Bacteria 1326
657 Ga0495613_0029535 3300046689 Bacteria 4076
658 Ga0495613_0029978 3300046689 Bacteria 4042
659 Ga0495613_0189867 3300046689 Bacteria 1452
660 Ga0495624_0001622 3300046690 Bacteria 17246
661 Ga0495624_0020968 3300046690 Bacteria 4340
662 Ga0495589_0020066 3300046794 Bacteria 3418
663 Ga0495600_0000008 3300046809 Bacteria 147902
664 Ga0495600_0029311 3300046809 Bacteria 3563
665 Ga0495604_0000003 3300047317 Bacteria 464246
666 Ga0495604_0004786 3300047317 Bacteria 10728
667 Ga0495604_0014838 3300047317 Bacteria 6213
668 Ga0495604_0032541 3300047317 Bacteria 4132
669 Ga0495604_0041343 3300047317 Bacteria 3616
670 Ga0495636_0000443 3300047318 Bacteria 15349
671 Ga0495674_0000021 3300047319 Bacteria 174056
672 Ga0495674_0006553 3300047319 Bacteria 11171
673 Ga0495674_0020868 3300047319 Bacteria 6065
674 Ga0495676_0084151 3300047321 Bacteria 2401
675 Ga0495680_0000505 3300047322 Bacteria 44019
676 Ga0495680_0005562 3300047322 Bacteria 11828
677 Ga0495680_0006777 3300047322 Bacteria 10581
678 Ga0495680_0027535 3300047322 Bacteria 4668
679 Ga0495680_0046543 3300047322 Bacteria 3420
680 Ga0495675_0000145 3300047444 Bacteria 49514
681 Ga0495675_0034908 3300047444 Bacteria 3212
682 Ga0495679_001373 3300047446 Bacteria 13976
683 Ga0495673_0003704 3300047469 Bacteria 9943
684 Ga0495684_0000050 3300047471 Bacteria 86794
685 Ga0495684_0023901 3300047471 Bacteria 4700
686 Ga0495593_0000394 3300047673 Bacteria 24241
687 Ga0495602_0000012 3300048088 Bacteria 200520
688 Ga0495602_0000317 3300048088 Bacteria 44519
689 Ga0495602_0006361 3300048088 Bacteria 12386
690 Ga0495602_0197747 3300048088 Bacteria 1536
691 Ga0495602_0209196 3300048088 Bacteria 1482
692 Ga0495614_0033632 3300048089 Bacteria 2205
693 Ga0496100_0000713 3300048903 Bacteria 15859
694 Ga0496100_0021515 3300048903 Bacteria 3885
695 Ga0496100_0039028 3300048903 Bacteria 3013
696 Ga0496100_0105555 3300048903 Bacteria 1948
697 Ga0496101_0000151 3300048904 Bacteria 59751
698 Ga0496101_0053207 3300048904 Bacteria 2920
699 Ga0496101_0068340 3300048904 Bacteria 2597
700 Ga0496101_0092486 3300048904 Bacteria 2252
701 Ga0496101_0354099 3300048904 Bacteria 1154
702 Ga0496102_0001766 3300048905 Bacteria 18797
703 Ga0496102_0014247 3300048905 Bacteria 6908
704 Ga0496102_0030592 3300048905 Bacteria 4819
705 Ga0496102_0033326 3300048905 Bacteria 4628
706 Ga0496102_0063292 3300048905 Bacteria 3387
707 Ga0496102_0109511 3300048905 Bacteria 2574
708 Ga0496103_0014888 3300048906 Bacteria 4623
709 Ga0496103_0037448 3300048906 Bacteria 2972
710 Ga0496104_0001328 3300048907 Bacteria 21352
711 Ga0496104_0010143 3300048907 Bacteria 8410
712 Ga0496104_0011872 3300048907 Bacteria 7820
713 Ga0496104_0045144 3300048907 Bacteria 4143
714 Ga0496104_0327072 3300048907 Bacteria 1446
715 Ga0496105_0025422 3300048908 Bacteria 4819
716 Ga0496105_0048560 3300048908 Bacteria 3503
717 Ga0496105_0087730 3300048908 Bacteria 2570
718 Ga0496105_0124479 3300048908 Bacteria 2125
719 Ga0496105_0189003 3300048908 Bacteria 1685
720 Ga0496105_0216401 3300048908 Bacteria 1560
721 Ga0496106_0000347 3300048909 Bacteria 32770
722 Ga0496106_0059754 3300048909 Bacteria 2888
723 Ga0496106_0257297 3300048909 Bacteria 1396
724 Ga0496106_0258989 3300048909 Bacteria 1392
725 Ga0496107_0015881 3300048910 Bacteria 5281
726 Ga0496107_0030383 3300048910 Bacteria 3850
727 Ga0496107_0038857 3300048910 Bacteria 3413
728 Ga0496107_0042490 3300048910 Bacteria 3264
729 Ga0496107_0051416 3300048910 Bacteria 2972
730 Ga0496108_0024520 3300048911 Bacteria 4967
731 Ga0496108_0026329 3300048911 Bacteria 4796
732 Ga0496108_0038656 3300048911 Bacteria 3975
733 Ga0496109_0000186 3300048912 Bacteria 62084
734 Ga0496109_0001505 3300048912 Bacteria 19383
735 Ga0496109_0195403 3300048912 Bacteria 1901
736 Ga0496109_0592142 3300048912 Bacteria 1045
737 Ga0496110_0016390 3300048913 Bacteria 6187
738 Ga0496110_0029751 3300048913 Bacteria 4704
739 Ga0496110_0109535 3300048913 Bacteria 2480
740 Ga0496111_0001144 3300048914 Bacteria 14723
741 Ga0496111_0012872 3300048914 Bacteria 5676
742 Ga0496112_0000562 3300048915 Bacteria 25481
743 Ga0496112_0016331 3300048915 Bacteria 6952
744 Ga0496112_0183743 3300048915 Unclassified 2054
745 Ga0496112_0352226 3300048915 Bacteria 1415
746 Ga0496113_0003414 3300048916 Bacteria 9506
747 Ga0496113_0014517 3300048916 Bacteria 5377
748 Ga0496113_0016184 3300048916 Bacteria 5147
749 Ga0496114_0028628 3300048917 Bacteria 4573
750 Ga0496114_0039543 3300048917 Bacteria 3902
751 Ga0496114_0110317 3300048917 Bacteria 2356
752 Ga0496114_0264075 3300048917 Bacteria 1516
753 Ga0496114_0362821 3300048917 Bacteria 1281
754 Ga0496115_0001282 3300048918 Bacteria 17986
755 Ga0496115_0044847 3300048918 Bacteria 3529
756 Ga0496115_0053583 3300048918 Bacteria 3237
757 Ga0496115_0108426 3300048918 Bacteria 2280
758 Ga0496115_0217034 3300048918 Bacteria 1579
759 Ga0496117_0002111 3300048920 Bacteria 26142
760 Ga0496118_0000120 3300048921 Bacteria 142952
761 Ga0496126_0022883 3300048929 Bacteria 6067
762 Ga0501031_0104705 3300049568 Bacteria 1846
763 Ga0501032_0053314 3300049569 Bacteria 2724
764 Ga0501033_0109639 3300049570 Bacteria 2010
765 Ga0501033_0271081 3300049570 Bacteria 1200
766 Ga0501034_0000247 3300049571 Bacteria 99828
767 Ga0501034_0001290 3300049571 Bacteria 33888
768 Ga0501034_0025699 3300049571 Bacteria 5997
769 Ga0501034_0032911 3300049571 Bacteria 5264
770 Ga0501036_0014726 3300049572 Bacteria 6522
771 Ga0501036_0054523 3300049572 Bacteria 3386
772 Ga0501037_0007246 3300049573 Bacteria 8103
773 Ga0501038_0005386 3300049574 Bacteria 11891
774 Ga0501038_0085276 3300049574 Bacteria 2656
775 Ga0501038_0183617 3300049574 Bacteria 1686
776 Ga0501038_0206722 3300049574 Unclassified 1573
777 Ga0501039_0011082 3300049575 Bacteria 6870
778 Ga0501042_0038139 3300049578 Bacteria 3412
779 Ga0501043_0057508 3300049579 Bacteria 3053
780 Ga0501043_0107739 3300049579 Bacteria 2188
781 Ga0501046_0017800 3300049580 Bacteria 5927
782 Ga0501046_0064490 3300049580 Bacteria 2859
783 Ga0501047_0037239 3300049581 Bacteria 4703
784 Ga0501068_0030261 3300049584 Bacteria 3210
785 Ga0501069_0074346 3300049585 Bacteria 1906
786 Ga0501070_0050130 3300049586 Bacteria 3466
787 Ga0501070_0056658 3300049586 Bacteria 3249
788 Ga0501072_0005240 3300049588 Bacteria 9870
789 Ga0501072_0021992 3300049588 Bacteria 4947
790 Ga0501072_0107559 3300049588 Bacteria 2219
791 Ga0501073_0013722 3300049589 Bacteria 5893
792 Ga0501073_0023679 3300049589 Bacteria 4407
793 Ga0501073_0031954 3300049589 Bacteria 3755
794 Ga0501073_0069280 3300049589 Bacteria 2458
795 Ga0501074_0121149 3300049590 Bacteria 1871
796 Ga0501074_0159178 3300049590 Bacteria 1613
797 Ga0501075_0095335 3300049591 Bacteria 2258
798 Ga0501076_0279329 3300049592 Bacteria 1368
799 Ga0501077_0020002 3300049593 Bacteria 4236
800 Ga0501077_0041031 3300049593 Bacteria 2947
801 Ga0501077_0239293 3300049593 Bacteria 1154
802 Ga0501079_0080385 3300049741 Bacteria 2520
803 Ga0501080_0026529 3300049742 Bacteria 5382
804 Ga0501080_0037101 3300049742 Bacteria 4550
805 Ga0501080_0046053 3300049742 Bacteria 4062
806 Ga0501081_0052073 3300049743 Bacteria 2824
807 Ga0501083_0049717 3300049744 Bacteria 2826
808 Ga0501083_0063708 3300049744 Unclassified 2458
809 Ga0501083_0090317 3300049744 Bacteria 2023
810 Ga0501083_0117859 3300049744 Bacteria 1742
811 Ga0501282_000063 3300049778 Bacteria 13034
812 Ga0501035_0005135 3300049822 Bacteria 12388
813 Ga0501035_0047106 3300049822 Bacteria 3872
814 Ga0501035_0047404 3300049822 Bacteria 3857
815 Ga0501044_0000236 3300049823 Bacteria 69634
816 Ga0501044_0021136 3300049823 Bacteria 6948
817 Ga0501044_0037261 3300049823 Bacteria 5083
818 Ga0501044_0144342 3300049823 Unclassified 2367
819 Ga0501045_0243732 3300049824 Bacteria 1338
820 nmdc:mga03683_11712_c1 3300050489 Bacteria 3184
821 nmdc:mga0yw44_13141_c1 3300050492 Bacteria 4347
822 nmdc:mga0yw44_24616_c1 3300050492 Bacteria 3410
823 nmdc:mga0yw44_7062_c1 3300050492 Bacteria 5497
824 nmdc:mga0yw44_81974_c1 3300050492 Bacteria 2023
825 nmdc:mga06z11_41552_c1 3300050494 Bacteria 2302
826 nmdc:mga04h51_13110_c1 3300050495 Bacteria 2341
827 nmdc:mga07m45_12533_c1 3300050496 Bacteria 4483
828 nmdc:mga07m45_62493_c1 3300050496 Bacteria 2110
829 nmdc:mga05p37_117198_c1 3300050507 Bacteria 3273
830 nmdc:mga05p37_123218_c1 3300050507 Bacteria 3184
831 nmdc:mga05p37_123812_c1 3300050507 Bacteria 3176
832 nmdc:mga05p37_257648_c1 3300050507 Bacteria 2090
833 nmdc:mga05p37_392360_c1 3300050507 Bacteria 1623
834 nmdc:mga05p37_588729_c1 3300050507 Bacteria 1258
835 nmdc:mga09592_244969_c1 3300050508 Bacteria 1553
836 nmdc:mga09592_24564_c1 3300050508 Bacteria 4984
837 nmdc:mga0qj67_100964_c1 3300050509 Bacteria 2326
838 nmdc:mga0qj67_142899_c1 3300050509 Bacteria 1940
839 nmdc:mga0qj67_23674_c1 3300050509 Bacteria 4725
840 nmdc:mga0qj67_2772_c1 3300050509 Bacteria 12572
841 nmdc:mga06r32_104968_c1 3300050510 Bacteria 2775
842 nmdc:mga06r32_115744_c1 3300050510 Bacteria 2641
843 nmdc:mga06r32_1821_c1 3300050510 Bacteria 19029
844 nmdc:mga06r32_53156_c1 3300050510 Bacteria 3880
845 nmdc:mga06r32_5803_c1 3300050510 Bacteria 11125
846 nmdc:mga06r32_62744_c1 3300050510 Bacteria 3580
847 nmdc:mga08y16_165700_c1 3300050511 Bacteria 2296
848 nmdc:mga08y16_311_c1 3300050511 Bacteria 43954
849 nmdc:mga08y16_31237_c1 3300050511 Bacteria 5603
850 nmdc:mga08y16_66768_c1 3300050511 Bacteria 3754
851 nmdc:mga0n895_176753_c1 3300050512 Bacteria 2166
852 nmdc:mga0n895_2121_c1 3300050512 Bacteria 15312
853 nmdc:mga0n895_62_c1 3300050512 Bacteria 62891
854 nmdc:mga0n895_94499_c1 3300050512 Bacteria 2993
855 nmdc:mga0rr50_7331_c2 3300050513 Unclassified 2710
856 nmdc:mga0rr50_99742_c1 3300050513 Bacteria 2279
857 nmdc:mga0a205_11620_c1 3300050515 Bacteria 8115
858 nmdc:mga0a205_211887_c1 3300050515 Bacteria 1825
859 nmdc:mga0a205_2311_c1 3300050515 Bacteria 12212
860 Ga0495601_0000004 3300053077 Bacteria 449178
861 Ga0495601_0000109 3300053077 Bacteria 45069
862 Ga0495601_0001170 3300053077 Bacteria 14362
863 Ga0495601_0016517 3300053077 Bacteria 4474
864 Ga0495612_0000013 3300053078 Bacteria 198142
865 Ga0495612_0000604 3300053078 Bacteria 14441
866 Ga0495612_0000953 3300053078 Bacteria 11879
867 Ga0495612_0040040 3300053078 Bacteria 1908
868 Ga0495655_0021025 3300053083 Bacteria 1471
869 Ga0495595_0000034 3300053084 Bacteria 82597
870 Ga0495595_0000550 3300053084 Bacteria 14293
871 Ga0495595_0002157 3300053084 Bacteria 7647
872 Ga0495595_0121765 3300053084 Bacteria 1271
873 Ga0495619_0000005 3300053085 Bacteria 418061
874 Ga0495619_0000371 3300053085 Bacteria 30890
875 Ga0495619_0002507 3300053085 Bacteria 12025
876 Ga0495619_0009960 3300053085 Bacteria 5986
877 Ga0495619_0018594 3300053085 Bacteria 4410
878 Ga0495619_0169141 3300053085 Bacteria 1511
879 Ga0500578_0013831 3300053086 Bacteria 5195
880 Ga0500643_000631 3300053087 Bacteria 23701
881 Ga0500566_0118922 3300053094 Unclassified 1427
882 Ga0500641_0000421 3300053096 Bacteria 15552
883 Ga0500556_0001437 3300053104 Bacteria 10138
884 Ga0500556_0004310 3300053104 Bacteria 4058
885 Ga0500562_000614 3300053108 Bacteria 8607
886 Ga0500595_002886 3300053119 Bacteria 8235
887 Ga0500642_0050000 3300053130 Bacteria 1841
888 Ga0500658_0017979 3300053134 Bacteria 2646
889 Ga0500559_0000157 3300053136 Bacteria 53554
890 Ga0500616_0022721 3300053153 Bacteria 3499
891 Ga0500622_0148607 3300053156 Bacteria 1110
892 Ga0500645_000448 3300053730 Bacteria 28215
893 Ga0500645_004830 3300053730 Bacteria 5085
894 Ga0501082_0000025 3300060353 Bacteria 103262
895 Ga0501082_0341783 3300060353 Bacteria 1304
896 Ga0530510_0216771 3300061734 Bacteria 1422
897 2643756889 2643221547 Bacteria 4740017
898 2837681711 2837678835 Bacteria 5252418
899 Ga0114129_10359091
900 ARcpr5yngRDRAFT_c000210
901 JGI24752J21851_1001364
902 JGI24746J21847_1000091
903 JGI24739J22299_10001085
904 JGI24737J22298_10000945
905 JGI24737J22298_10059255
906 JGI24743J22301_10003780
907 JGI24743J22301_10008026
908 JGI24750J21931_1000009
909 JGI24750J21931_1003333
910 JGI24750J21931_1003424
911 JGI24745J21846_1000043
912 JGI24748J21848_1002279
913 JGI24738J21930_10000069
914 JGI24749J21850_1001500
915 JGI24035J26624_1000336
916 JGI24033J26618_1003700
917 JGI24034J26672_10000258
918 JGI24742J22300_10000041
919 JGI24742J22300_10000607
920 JGI24751J29686_10002673
921 JGI25406J46586_10012414
922 JGI25153J46596_10000010
923 JGI25404J52841_10000199
924 Ga0055534_1000063
925 Ga0055528_1000070
926 Ga0055540_1005204
927 Ga0055531_10000406
928 Ga0065712_10092257
929 Ga0065715_10089103
930 Ga0070676_10000036
931 Ga0070676_10164156
932 Ga0070683_100000898
933 Ga0070683_100119955
934 Ga0070690_100000402
935 Ga0070690_100025638
936 Ga0070670_100087762
937 Ga0070677_10000124
938 Ga0068869_100000087
939 Ga0068869_100113414
940 Ga0070666_10004335
941 Ga0070666_10039271
942 Ga0070680_100001046
943 Ga0070680_100027578
944 Ga0070680_100346512
945 Ga0070682_100000341
946 Ga0068868_100007302
947 Ga0068868_100116455
948 Ga0070660_100002798
949 Ga0070660_100072025
950 Ga0070689_100001365
951 Ga0070689_100089519
952 Ga0070689_100095645
953 Ga0070689_100107712
954 Ga0070691_10005903
955 Ga0070687_100000339
956 Ga0070687_100169404
957 Ga0070661_100000017
958 Ga0070692_10000018
959 Ga0070692_10020333
960 Ga0070668_100001356
961 Ga0070668_100022599
962 Ga0070669_100000217
963 Ga0070669_100010139
964 Ga0070675_100000088
965 Ga0070675_100154113
966 Ga0070671_100001697
967 Ga0070671_100002748
968 Ga0070671_100090950
969 Ga0070671_100103130
970 Ga0070674_100001565
971 Ga0070673_100000239
972 Ga0070673_100085592
973 Ga0070688_100000084
974 Ga0070688_100005224
975 Ga0070688_100007541
976 Ga0070659_100001069
977 Ga0070659_100102280
978 Ga0070667_100006312
979 Ga0070667_100050860
980 Ga0070667_100155391
981 Ga0070703_10002012
982 Ga0070709_10040697
983 Ga0070709_10269662
984 Ga0070714_100024644
985 Ga0070714_100042480
986 Ga0070713_100004591
987 Ga0070713_100024720
988 Ga0070713_100062022
989 Ga0070713_100184933
990 Ga0070701_10000061
991 Ga0070711_100155658
992 Ga0070711_100381713
993 Ga0070705_100000425
994 Ga0070705_100119391
995 Ga0070700_100000430
996 Ga0070700_100001942
997 Ga0070694_100000401
998 Ga0070708_100217808
999 Ga0070663_100000713
1000 Ga0070663_100022243
1001 Ga0070678_100000053
1002 Ga0070662_100000284
1003 Ga0070662_100018792
1004 Ga0070662_100057181
1005 Ga0070681_10000493
1006 Ga0070681_10062755
1007 Ga0070681_10461698
1008 Ga0068867_100000503
1009 Ga0068867_100008910
1010 Ga0068867_100020401
1011 Ga0068867_100028314
1012 Ga0070685_10001195
1013 Ga0070699_100027166
1014 Ga0070679_100000679
1015 Ga0070679_100004801
1016 Ga0070679_100166547
1017 Ga0070684_100000144
1018 Ga0068853_100068798
1019 Ga0068853_100129992
1020 Ga0068853_100314702
1021 Ga0070672_100000014
1022 Ga0070672_100005008
1023 Ga0070672_100040524
1024 Ga0070672_100088038
1025 Ga0070686_100000899
1026 Ga0070686_100017839
1027 Ga0070695_100002430
1028 Ga0070696_100010312
1029 Ga0070696_100056349
1030 Ga0070693_100000686
1031 Ga0070693_100037772
1032 Ga0070665_100071240
1033 Ga0070665_100379443
1034 Ga0070704_100000593
1035 Ga0068855_100008091
1036 Ga0068855_100069346
1037 Ga0068855_100396996
1038 Ga0070664_100004463
1039 Ga0070664_100032419
1040 Ga0070664_100074850
1041 Ga0070664_100086090
1042 Ga0068857_100001474
1043 Ga0068854_100000168
1044 Ga0068854_100083231
1045 Ga0068856_100000932
1046 Ga0068856_100067589
1047 Ga0070702_100000047
1048 Ga0070702_100028282
1049 Ga0068852_100001577
1050 Ga0068859_100005578
1051 Ga0068859_100044635
1052 Ga0068859_100079439
1053 Ga0068864_100000507
1054 Ga0068864_100022018
1055 Ga0068864_100052253
1056 Ga0068866_10002442
1057 Ga0068866_10019232
1058 Ga0068861_100000315
1059 Ga0068861_100003730
1060 Ga0068870_10000002
1061 Ga0068870_10022401
1062 Ga0068863_100000981
1063 Ga0068858_100000356
1064 Ga0068858_100049336
1065 Ga0068860_100000747
1066 Ga0068860_100018552
1067 Ga0068860_100022098
1068 Ga0068862_100000671
1069 Ga0068862_100011911
1070 Ga0068862_100043290
1071 Ga0081455_10000276
1072 Ga0081455_10011354
1073 Ga0081455_10025859
1074 Ga0081540_1000017
1075 Ga0081540_1000045
1076 Ga0081540_1097669
1077 Ga0081539_10005839
1078 Ga0070717_10034636
1079 Ga0070717_10047826
1080 Ga0070717_10131680
1081 Ga0070717_10198870
1082 Ga0075365_10013475
1083 Ga0075365_10027459
1084 Ga0070715_10005699
1085 Ga0070715_10027950
1086 Ga0070715_10037741
1087 Ga0070716_100012210
1088 Ga0070716_100266304
1089 Ga0070712_100001956
1090 Ga0070712_100012254
1091 Ga0070712_100279792
1092 Ga0075367_10040600
1093 Ga0075367_10081021
1094 Ga0097621_100000144
1095 Ga0097621_100135418
1096 Ga0075370_10002905
1097 Ga0068871_100000110
1098 Ga0075428_100152716
1099 Ga0075428_100165283
1100 Ga0075428_100179820
1101 Ga0075428_100188735
1102 Ga0075428_100443187
1103 Ga0075430_100002679
1104 Ga0075430_100089430
1105 Ga0075431_100000111
1106 Ga0075431_100034269
1107 Ga0075431_100044271
1108 Ga0075431_100078188
1109 Ga0075431_100224539
1110 Ga0075431_100228971
1111 Ga0075433_10032425
1112 Ga0075434_100000084
1113 Ga0075434_100001952
1114 Ga0075434_100195945
1115 Ga0075434_100489400
1116 Ga0068865_100000066
1117 Ga0068865_100008038
1118 Ga0068865_100027772
1119 Ga0097620_100005578
1120 Ga0097620_100044641
1121 Ga0097620_100079438
1122 Ga0099826_10000077
1123 Ga0075435_100078463
1124 Ga0075435_100152365
1125 Ga0099794_10007547
1126 Ga0105250_10023051
1127 Ga0105240_10032085
1128 Ga0111539_10000652
1129 Ga0111539_10111721
1130 Ga0111539_10143686
1131 Ga0111539_10198207
1132 Ga0111539_10411744
1133 Ga0105245_10000287
1134 Ga0105245_10055067
1135 Ga0105245_10126618
1136 Ga0105245_10145675
1137 Ga0105247_10001223
1138 Ga0114129_10029477
1139 Ga0114129_10077932
1140 Ga0114129_10144969
1141 Ga0114129_10385262
1142 Ga0105243_10000106
1143 Ga0105243_10000695
1144 Ga0105243_10034179
1145 Ga0105243_10047868
1146 Ga0105241_10000204
1147 Ga0105242_10000792
1148 Ga0105242_10211282
1149 Ga0105242_10285383
1150 Ga0105248_10002487
1151 Ga0105248_10186540
1152 Ga0105248_10195515
1153 Ga0105237_10002795
1154 Ga0105237_10234589
1155 Ga0105238_10023825
1156 Ga0105238_10072072
1157 Ga0105238_10312433
1158 Ga0105249_10000279
1159 Ga0105249_10014648
1160 Ga0105249_10044279
1161 Ga0105239_10001686
1162 Ga0105239_10083023
1163 Ga0105239_10179323
1164 Ga0105239_10302120
1165 Ga0105239_10480059
1166 Ga0105246_10000095
1167 Ga0157373_10184590
1168 Ga0157371_10009056
1169 Ga0157370_10010506
1170 Ga0157369_10150782
1171 Ga0157374_10001348
1172 Ga0157378_10000631
1173 Ga0157378_10007666
1174 Ga0157378_10344212
1175 Ga0157378_10401672
1176 Ga0163162_10000850
1177 Ga0163162_10005487
1178 Ga0163162_10350730
1179 Ga0157372_10047887
1180 Ga0157375_10000135
1181 Ga0157375_10108044
1182 Ga0163163_10065736
1183 Ga0163163_10095849
1184 Ga0157380_10000052
1185 Ga0157380_10032855
1186 Ga0157380_10100558
1187 Ga0157380_10309385
1188 Ga0157380_10320735
1189 Ga0182008_10034200
1190 Ga0157377_10000076
1191 Ga0157379_10000060
1192 Ga0157379_10098958
1193 Ga0157379_10113953
1194 Ga0157376_10000141
1195 Ga0157376_10061915
1196 Ga0157376_10232853
1197 Ga0163161_10006630
1198 Ga0163161_10018879
1199 Ga0163161_10054737
1200 Ga0163161_10192464
1201 Ga0213872_10060315
1202 Ga0213876_10032765
1203 Ga0213875_10002544
1204 Ga0209565_1000130
1205 Ga0207666_1000005
1206 Ga0209455_1002615
1207 Ga0209673_1000106
1208 Ga0209673_1019334
1209 Ga0207673_1000002
1210 Ga0209675_1000058
1211 Ga0209025_1004721
1212 Ga0209758_1000033
1213 Ga0209051_1000059
1214 Ga0209257_1000022
1215 Ga0207697_10000011
1216 Ga0207653_10023402
1217 Ga0207682_10000051
1218 Ga0207682_10000572
1219 Ga0207682_10018113
1220 Ga0207692_10103603
1221 Ga0207692_10110724
1222 Ga0207642_10000229
1223 Ga0207642_10084277
1224 Ga0207710_10090826
1225 Ga0207688_10000001
1226 Ga0207688_10008121
1227 Ga0207680_10009743
1228 Ga0207647_10012355
1229 Ga0207647_10071943
1230 Ga0207645_10000121
1231 Ga0207645_10065556
1232 Ga0207643_10000009
1233 Ga0207643_10014436
1234 Ga0207684_10024320
1235 Ga0207654_10000271
1236 Ga0207707_10000840
1237 Ga0207707_10002707
1238 Ga0207707_10008018
1239 Ga0207695_10014787
1240 Ga0207671_10030003
1241 Ga0207693_10001099
1242 Ga0207693_10011118
1243 Ga0207693_10011491
1244 Ga0207693_10028715
1245 Ga0207663_10033490
1246 Ga0207663_10096716
1247 Ga0207663_10192185
1248 Ga0207660_10000426
1249 Ga0207660_10059281
1250 Ga0207662_10000120
1251 Ga0207662_10077363
1252 Ga0207657_10002826
1253 Ga0207657_10015306
1254 Ga0207649_10000052
1255 Ga0207652_10000508
1256 Ga0207652_10001947
1257 Ga0207681_10000035
1258 Ga0207681_10007048
1259 Ga0207681_10077900
1260 Ga0207681_10252913
1261 Ga0207694_10015924
1262 Ga0207694_10248109
1263 Ga0207650_10000843
1264 Ga0207650_10009149
1265 Ga0207650_10012334
1266 Ga0207650_10021202
1267 Ga0207659_10000027
1268 Ga0207659_10020909
1269 Ga0207659_10188571
1270 Ga0207659_10474635
1271 Ga0207687_10000231
1272 Ga0207687_10190400
1273 Ga0207687_10260149
1274 Ga0207700_10020618
1275 Ga0207700_10025902
1276 Ga0207700_10278847
1277 Ga0207700_10325538
1278 Ga0207664_10139319
1279 Ga0207664_10141841
1280 Ga0207664_10440803
1281 Ga0207644_10003468
1282 Ga0207644_10221320
1283 Ga0207690_10000056
1284 Ga0207706_10000261
1285 Ga0207706_10003407
1286 Ga0207706_10024331
1287 Ga0207706_10142727
1288 Ga0207706_10342861
1289 Ga0207686_10000171
1290 Ga0207709_10000077
1291 Ga0207709_10000087
1292 Ga0207670_10000169
1293 Ga0207670_10050322
1294 Ga0207670_10065016
1295 Ga0207670_10067928
1296 Ga0207669_10003221
1297 Ga0207669_10012052
1298 Ga0207704_10000134
1299 Ga0207704_10029498
1300 Ga0207704_10059244
1301 Ga0207704_10433507
1302 Ga0207665_10003421
1303 Ga0207665_10006302
1304 Ga0207665_10089251
1305 Ga0207665_10094086
1306 Ga0207665_10122350
1307 Ga0207691_10000106
1308 Ga0207691_10005974
1309 Ga0207691_10008316
1310 Ga0207691_10044460
1311 Ga0207691_10104009
1312 Ga0207711_10002404
1313 Ga0207711_10025906
1314 Ga0207711_10098766
1315 Ga0207689_10000031
1316 Ga0207689_10018698
1317 Ga0207661_10000219
1318 Ga0207679_10000057
1319 Ga0207679_10066812
1320 Ga0207667_10012319
1321 Ga0207667_10046913
1322 Ga0207651_10000136
1323 Ga0207651_10022623
1324 Ga0207651_10077383
1325 Ga0207651_10317111
1326 Ga0207712_10000176
1327 Ga0207712_10022814
1328 Ga0207712_10069108
1329 Ga0207668_10000191
1330 Ga0207668_10081494
1331 Ga0207668_10298009
1332 Ga0207640_10000126
1333 Ga0207640_10031868
1334 Ga0207640_10302018
1335 Ga0207658_10001331
1336 Ga0207658_10027609
1337 Ga0207658_10322764
1338 Ga0207677_10043870
1339 Ga0207703_10000662
1340 Ga0207703_10036692
1341 Ga0207703_10041853
1342 Ga0207639_10004863
1343 Ga0207639_10078616
1344 Ga0207639_10271977
1345 Ga0207678_10000137
1346 Ga0207678_10105288
1347 Ga0207708_10000250
1348 Ga0207708_10002312
1349 Ga0207702_10001067
1350 Ga0207702_10176523
1351 Ga0207641_10011323
1352 Ga0207648_10000125
1353 Ga0207648_10003783
1354 Ga0207648_10004705
1355 Ga0207648_10032400
1356 Ga0207648_10048341
1357 Ga0207676_10000891
1358 Ga0207676_10040171
1359 Ga0207676_10088398
1360 Ga0207674_10000095
1361 Ga0207674_10164549
1362 Ga0207675_100000140
1363 Ga0207675_100001910
1364 Ga0207675_100015760
1365 Ga0207675_100097245
1366 Ga0207683_10000178
1367 Ga0207683_10005574
1368 Ga0207683_10053138
1369 Ga0207683_10114796
1370 Ga0207698_10002073
1371 Ga0210002_1001008
1372 Ga0209282_1000223
1373 Ga0209588_1010538
1374 Ga0209998_10005113
1375 Ga0209813_10024173
1376 Ga0209974_10006256
1377 Ga0207428_10000037
1378 Ga0207428_10181953
1379 Ga0268266_10284605
1380 Ga0268265_10000774
1381 Ga0268265_10007031
1382 Ga0268265_10068115
1383 Ga0268264_10000467
1384 Ga0268264_10031167
1385 Ga0265337_1004015
1386 Ga0307515_10000030
1387 Ga0307515_10038535
1388 Ga0265330_10055199
1389 Ga0265320_10067999
1390 Ga0265325_10043538
1391 Ga0265325_10109036
1392 Ga0265340_10011319
1393 Ga0265339_10022924
1394 Ga0265339_10023205
1395 Ga0265316_10047692
1396 Ga0265316_10084088
1397 Ga0307513_10237018
1398 Ga0265313_10003826
1399 Ga0265313_10047475
1400 Ga0265342_10043020
1401 Ga0307516_10341968
1402 Ga0307412_10154558
1403 Ga0373930_0031405
1404 Ga0373959_0031979
1405 Ga0373926_0066917
1406 Ga0373929_0001926
1407 Ga0373934_0071197
1408 Ga0373934_0087798
1409 Ga0373940_0043834
1410 Ga0373949_0004404
1411 Ga0373951_0002829
1412 Ga0373952_0001091
1413 Ga0373923_0038638
1414 Ga0373932_0008017
1415 Ga0373939_0000421
1416 Ga0373945_0005477
1417 Ga0373945_0052308
1418 Ga0373954_0008973
1419 Ga0373960_0002654
1420 Ga0373943_0000463
1421 Ga0373943_0053316
1422 Ga0373946_0023416
1423 Ga0373946_0033513
1424 Ga0373955_0001204
1425 Ga0373955_0006420
1426 Ga0373955_0022634
1427 Ga0373942_0003886
1428 Ga0373961_0019721
1429 Ga0373962_0006310
1430 Ga0373924_0062763
1431 Ga0373931_0000209
1432 Ga0373931_0001680
1433 Ga0373931_0030198
1434 Ga0373935_0000208
1435 Ga0373927_0030660
1436 Ga0373927_0111502
1437 Ga0373933_0001412
1438 Ga0373933_0003550
1439 Ga0373933_0212194
1440 Ga0373947_0030004
1441 Ga0373947_0107945
1442 Ga0373947_0134403
1443 Ga0373937_0000031
1444 Ga0373937_0001111
1445 Ga0373937_0001925
1446 Ga0373937_0002996
1447 Ga0373937_0006839
1448 Ga0373937_0032858
1449 Ga0373937_0438072
1450 Ga0373925_0000063
1451 Ga0373925_0026368
1452 Ga0373925_0073528
1453 Ga0373925_0095798
1454 Ga0373925_0335415
1455 Ga0395900_0110770
1456 Ga0395898_0086242
1457 Ga0395905_0003404
1458 Ga0395905_0068502
1459 Ga0395905_0077697
1460 Ga0395901_0014335
1461 Ga0400486_28014
1462 Ga0436365_0085457
1463 Ga0436365_0248031
1464 Ga0436365_1651064
1465 Ga0436361_0365487
1466 Ga0436363_0767643
1467 Ga0436363_1104439
1468 Ga0466972_0011884
1469 Ga0466961_0160900
1470 Ga0451576_0000694
1471 Ga0495592_0000072
1472 Ga0495592_0029714
1473 Ga0495592_0107465
1474 Ga0495592_0165365
1475 Ga0495590_0042085
1476 Ga0495591_004866
1477 Ga0495629_0024763
1478 Ga0495629_0077142
1479 Ga0495629_0279651
1480 Ga0495638_0044798
1481 Ga0495638_0059669
1482 Ga0495641_0128111
1483 Ga0495651_0005951
1484 Ga0495651_0038801
1485 Ga0495653_0000020
1486 Ga0495653_0136608
1487 Ga0495580_0005811
1488 Ga0495580_0254547
1489 Ga0495582_0133708
1490 Ga0495605_0020042
1491 Ga0495662_0003193
1492 Ga0495662_0083589
1493 Ga0495664_0000006
1494 Ga0495664_0073411
1495 Ga0495584_0012887
1496 Ga0495584_0033883
1497 Ga0495584_0036680
1498 Ga0495584_0057658
1499 Ga0495596_0002466
1500 Ga0495608_0000002
1501 Ga0495616_0059163
1502 Ga0495618_0000017
1503 Ga0495618_0019326
1504 Ga0495628_0000004
1505 Ga0495628_0005223
1506 Ga0495628_0005226
1507 Ga0495628_0005631
1508 Ga0495628_0125278
1509 Ga0495630_0000832
1510 Ga0495630_0171870
1511 Ga0495631_0019159
1512 Ga0495648_0006327
1513 Ga0495652_0000007
1514 Ga0495652_0029416
1515 Ga0495652_0050815
1516 Ga0495652_0053314
1517 Ga0495654_0001084
1518 Ga0495665_0008869
1519 Ga0495640_0000004
1520 Ga0495640_0026084
1521 Ga0495640_0066732
1522 Ga0495640_0083344
1523 Ga0495640_0111475
1524 Ga0495587_0000002
1525 Ga0495598_0001493
1526 Ga0495598_0008909
1527 Ga0495645_0000008
1528 Ga0495645_0000124
1529 Ga0495645_0000848
1530 Ga0495622_0079263
1531 Ga0495667_0000010
1532 Ga0495667_0001817
1533 Ga0495667_0102670
1534 Ga0495656_0125314
1535 Ga0495668_0041709
1536 Ga0495634_0000603
1537 Ga0495634_0117222
1538 Ga0495635_0000004
1539 Ga0495635_0004141
1540 Ga0495659_0079113
1541 Ga0495661_0018260
1542 Ga0495588_0132881
1543 Ga0495657_0000051
1544 Ga0495657_0052535
1545 Ga0495657_0097334
1546 Ga0495599_0000003
1547 Ga0495599_0127788
1548 Ga0495623_0000009
1549 Ga0495623_0010252
1550 Ga0495623_0059406
1551 Ga0495646_0000001
1552 Ga0495646_0003279
1553 Ga0495646_0033837
1554 Ga0495646_0144783
1555 Ga0495613_0029535
1556 Ga0495613_0029978
1557 Ga0495613_0189867
1558 Ga0495624_0001622
1559 Ga0495624_0020968
1560 Ga0495589_0020066
1561 Ga0495600_0000008
1562 Ga0495600_0029311
1563 Ga0495604_0000003
1564 Ga0495604_0004786
1565 Ga0495604_0014838
1566 Ga0495604_0032541
1567 Ga0495604_0041343
1568 Ga0495636_0000443
1569 Ga0495674_0000021
1570 Ga0495674_0006553
1571 Ga0495674_0020868
1572 Ga0495676_0084151
1573 Ga0495680_0000505
1574 Ga0495680_0005562
1575 Ga0495680_0006777
1576 Ga0495680_0027535
1577 Ga0495680_0046543
1578 Ga0495675_0000145
1579 Ga0495675_0034908
1580 Ga0495679_001373
1581 Ga0495673_0003704
1582 Ga0495684_0000050
1583 Ga0495684_0023901
1584 Ga0495593_0000394
1585 Ga0495602_0000012
1586 Ga0495602_0000317
1587 Ga0495602_0006361
1588 Ga0495602_0197747
1589 Ga0495602_0209196
1590 Ga0495614_0033632
1591 Ga0496100_0000713
1592 Ga0496100_0021515
1593 Ga0496100_0039028
1594 Ga0496100_0105555
1595 Ga0496101_0000151
1596 Ga0496101_0053207
1597 Ga0496101_0068340
1598 Ga0496101_0092486
1599 Ga0496101_0354099
1600 Ga0496102_0001766
1601 Ga0496102_0014247
1602 Ga0496102_0030592
1603 Ga0496102_0033326
1604 Ga0496102_0063292
1605 Ga0496102_0109511
1606 Ga0496103_0014888
1607 Ga0496103_0037448
1608 Ga0496104_0001328
1609 Ga0496104_0010143
1610 Ga0496104_0011872
1611 Ga0496104_0045144
1612 Ga0496104_0327072
1613 Ga0496105_0025422
1614 Ga0496105_0048560
1615 Ga0496105_0087730
1616 Ga0496105_0124479
1617 Ga0496105_0189003
1618 Ga0496105_0216401
1619 Ga0496106_0000347
1620 Ga0496106_0059754
1621 Ga0496106_0257297
1622 Ga0496106_0258989
1623 Ga0496107_0015881
1624 Ga0496107_0030383
1625 Ga0496107_0038857
1626 Ga0496107_0042490
1627 Ga0496107_0051416
1628 Ga0496108_0024520
1629 Ga0496108_0026329
1630 Ga0496108_0038656
1631 Ga0496109_0000186
1632 Ga0496109_0001505
1633 Ga0496109_0195403
1634 Ga0496109_0592142
1635 Ga0496110_0016390
1636 Ga0496110_0029751
1637 Ga0496110_0109535
1638 Ga0496111_0001144
1639 Ga0496111_0012872
1640 Ga0496112_0000562
1641 Ga0496112_0016331
1642 Ga0496112_0183743
1643 Ga0496112_0352226
1644 Ga0496113_0003414
1645 Ga0496113_0014517
1646 Ga0496113_0016184
1647 Ga0496114_0028628
1648 Ga0496114_0039543
1649 Ga0496114_0110317
1650 Ga0496114_0264075
1651 Ga0496114_0362821
1652 Ga0496115_0001282
1653 Ga0496115_0044847
1654 Ga0496115_0053583
1655 Ga0496115_0108426
1656 Ga0496115_0217034
1657 Ga0496117_0002111
1658 Ga0496118_0000120
1659 Ga0496126_0022883
1660 Ga0501031_0104705
1661 Ga0501032_0053314
1662 Ga0501033_0109639
1663 Ga0501033_0271081
1664 Ga0501034_0000247
1665 Ga0501034_0001290
1666 Ga0501034_0025699
1667 Ga0501034_0032911
1668 Ga0501036_0014726
1669 Ga0501036_0054523
1670 Ga0501037_0007246
1671 Ga0501038_0005386
1672 Ga0501038_0085276
1673 Ga0501038_0183617
1674 Ga0501038_0206722
1675 Ga0501039_0011082
1676 Ga0501042_0038139
1677 Ga0501043_0057508
1678 Ga0501043_0107739
1679 Ga0501046_0017800
1680 Ga0501046_0064490
1681 Ga0501047_0037239
1682 Ga0501068_0030261
1683 Ga0501069_0074346
1684 Ga0501070_0050130
1685 Ga0501070_0056658
1686 Ga0501072_0005240
1687 Ga0501072_0021992
1688 Ga0501072_0107559
1689 Ga0501073_0013722
1690 Ga0501073_0023679
1691 Ga0501073_0031954
1692 Ga0501073_0069280
1693 Ga0501074_0121149
1694 Ga0501074_0159178
1695 Ga0501075_0095335
1696 Ga0501076_0279329
1697 Ga0501077_0020002
1698 Ga0501077_0041031
1699 Ga0501077_0239293
1700 Ga0501079_0080385
1701 Ga0501080_0026529
1702 Ga0501080_0037101
1703 Ga0501080_0046053
1704 Ga0501081_0052073
1705 Ga0501083_0049717
1706 Ga0501083_0063708
1707 Ga0501083_0090317
1708 Ga0501083_0117859
1709 Ga0501282_000063
1710 Ga0501035_0005135
1711 Ga0501035_0047106
1712 Ga0501035_0047404
1713 Ga0501044_0000236
1714 Ga0501044_0021136
1715 Ga0501044_0037261
1716 Ga0501044_0144342
1717 Ga0501045_0243732
1718 nmdc:mga03683_11712_c1
1719 nmdc:mga0yw44_13141_c1
1720 nmdc:mga0yw44_24616_c1
1721 nmdc:mga0yw44_7062_c1
1722 nmdc:mga0yw44_81974_c1
1723 nmdc:mga06z11_41552_c1
1724 nmdc:mga04h51_13110_c1
1725 nmdc:mga07m45_12533_c1
1726 nmdc:mga07m45_62493_c1
1727 nmdc:mga05p37_117198_c1
1728 nmdc:mga05p37_123218_c1
1729 nmdc:mga05p37_123812_c1
1730 nmdc:mga05p37_257648_c1
1731 nmdc:mga05p37_392360_c1
1732 nmdc:mga05p37_588729_c1
1733 nmdc:mga09592_244969_c1
1734 nmdc:mga09592_24564_c1
1735 nmdc:mga0qj67_100964_c1
1736 nmdc:mga0qj67_142899_c1
1737 nmdc:mga0qj67_23674_c1
1738 nmdc:mga0qj67_2772_c1
1739 nmdc:mga06r32_104968_c1
1740 nmdc:mga06r32_115744_c1
1741 nmdc:mga06r32_1821_c1
1742 nmdc:mga06r32_53156_c1
1743 nmdc:mga06r32_5803_c1
1744 nmdc:mga06r32_62744_c1
1745 nmdc:mga08y16_165700_c1
1746 nmdc:mga08y16_311_c1
1747 nmdc:mga08y16_31237_c1
1748 nmdc:mga08y16_66768_c1
1749 nmdc:mga0n895_176753_c1
1750 nmdc:mga0n895_2121_c1
1751 nmdc:mga0n895_62_c1
1752 nmdc:mga0n895_94499_c1
1753 nmdc:mga0rr50_7331_c2
1754 nmdc:mga0rr50_99742_c1
1755 nmdc:mga0a205_11620_c1
1756 nmdc:mga0a205_211887_c1
1757 nmdc:mga0a205_2311_c1
1758 Ga0495601_0000004
1759 Ga0495601_0000109
1760 Ga0495601_0001170
1761 Ga0495601_0016517
1762 Ga0495612_0000013
1763 Ga0495612_0000604
1764 Ga0495612_0000953
1765 Ga0495612_0040040
1766 Ga0495655_0021025
1767 Ga0495595_0000034
1768 Ga0495595_0000550
1769 Ga0495595_0002157
1770 Ga0495595_0121765
1771 Ga0495619_0000005
1772 Ga0495619_0000371
1773 Ga0495619_0002507
1774 Ga0495619_0009960
1775 Ga0495619_0018594
1776 Ga0495619_0169141
1777 Ga0500578_0013831
1778 Ga0500643_000631
1779 Ga0500566_0118922
1780 Ga0500641_0000421
1781 Ga0500556_0001437
1782 Ga0500556_0004310
1783 Ga0500562_000614
1784 Ga0500595_002886
1785 Ga0500642_0050000
1786 Ga0500658_0017979
1787 Ga0500559_0000157
1788 Ga0500616_0022721
1789 Ga0500622_0148607
1790 Ga0500645_000448
1791 Ga0500645_004830
1792 Ga0501082_0000025
1793 Ga0501082_0341783
1794 Ga0530510_0216771
1795 2643756889
1796 2837681711

MSA Aligner

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
1zbm-assembly1.cif.gz_A x-ray crystal structure of protein af1704 from archaeoglobus fulgidus. northeast structural genomics consortium target gr62a. 0.6351 18 319
1zbm-assembly1.cif.gz_A x-ray crystal structure of protein af1704 from archaeoglobus fulgidus. northeast structural genomics consortium target gr62a. 0.6214 18 319
2nxo-assembly2.cif.gz_C crystal structure of protein sco4506 from streptomyces coelicolor, pfam duf178 0.6112 19 325
2czl-assembly1.cif.gz_A crystal structure of mqnd (ttha1568), a menaquinone biosynthetic enzyme from thermus thermophilus hb8 (cys11 modified with beta-mercaptoethanol) 0.6073 19 331
2czl-assembly1.cif.gz_A crystal structure of mqnd (ttha1568), a menaquinone biosynthetic enzyme from thermus thermophilus hb8 (cys11 modified with beta-mercaptoethanol) 0.6026 19 331
ID Description Score Start End Superfamily
3ksxA02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.7819 95 195 3.40.190.10
af_Q2G1L7_145_252_3.40.190.10 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.7366 100 196 3.40.190.10
3uifA02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.6971 100 194 3.40.190.10
6nioA01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.6739 18 69 3.40.190.10
2x7qA01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.6739 18 91 3.40.190.10
ID Description Score Start End GO Terms
AF-A0A537JJ33-F1-model_v4 ABC transporter substrate-binding protein 0.9836 14 293
AF-A0A1B2R3N1-F1-model_v4 4,5-dihydroxyphthalate decarboxylase 0.9823 15 341
AF-A0A1F4E5G7-F1-model_v4 4,5-dihydroxyphthalate decarboxylase 0.9812 15 339
AF-A0A286M9N7-F1-model_v4 4,5-dihydroxyphthalate decarboxylase 0.9811 30 316
AF-A0A3D0RHC1-F1-model_v4 4,5-dihydroxyphthalate decarboxylase 0.9801 16 264

Map