F485071
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 898 | 426 | 1796 | 330 |
Family's Representative Sequence
| Representative Sequence | 3300009147|Ga0114129_10359091|Ga0114129_103590912 |
| Length | 389 |
| Sequence | LSATNHGNSKGRSVAASEIAATFDAALQAGGAAPANFAPIARFAYERTDCCGANSRAFRVMAKLRFSIAIGDYDRTRPLLDGRVQIDGVDPVFMTLSPEEIFFRAFRSQEFDICELSMSSFTVKTAHNDCPYVGVPAFVSRAFRHTSIYVRTDRVRAPAGLKGKKVGLPEYQLTACVWARAILEDDHGVKPADIHWVRGGIEEAGRPEKITLKLPPGVRLDNAPEGKTISQLLADGAIDGFIAPRPPTLDRAKHPNIGWLFADPTAAAKDYFKRTGIFPIMHMTGVRRELAERHPWLPAAVLKALEQSKALTLKNLGDTSATKVTLPFVEEQLKAARELMGEDFWSYGVAPNRKVLETFLRHHHAQGLSPRLVAVEEMFHPGTLESFKL |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 2 | 3300000043 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere | Metagenome | Rhizosphere |
| 3 | 3300001976 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 | Metagenome | Rhizosphere |
| 4 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 5 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 6 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 7 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 8 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 9 | 3300002073 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 | Metagenome | Rhizosphere |
| 10 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 11 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 12 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 13 | 3300002126 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 | Metagenome | Rhizosphere |
| 14 | 3300002155 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 | Metagenome | Rhizosphere |
| 15 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 16 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 17 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 18 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 19 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 20 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 21 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 22 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 23 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 24 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 25 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 26 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 27 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 29 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 30 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 33 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 35 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 36 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 37 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 39 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 40 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 41 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 43 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 50 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 53 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 54 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 56 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 57 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 60 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 61 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 66 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 67 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 68 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 70 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 71 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 72 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 74 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 75 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 78 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 79 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 80 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 81 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 82 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 83 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 84 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 85 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 86 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 87 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 88 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 89 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 90 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 91 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 92 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 93 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 94 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 95 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 96 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 97 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 98 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 99 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 100 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 101 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 102 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 103 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 104 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 106 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 107 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 108 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 109 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 110 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 111 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 112 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 113 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 115 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 116 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 117 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 118 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 119 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 121 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 122 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 123 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 124 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 125 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 126 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 127 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 128 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 129 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 130 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 131 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 134 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 135 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 136 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 137 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 138 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 139 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 140 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 141 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 142 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 143 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 144 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 145 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 146 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 147 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 148 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 149 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 150 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 151 | 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 153 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 154 | 3300025290 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 156 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 157 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 158 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 159 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 160 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300027617 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 225 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 228 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 230 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 234 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 235 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 236 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 237 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 238 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 239 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 240 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 241 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 242 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 243 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 244 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 245 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 246 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 247 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 248 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 249 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 250 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 251 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 252 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 253 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 254 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 255 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 256 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 257 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 258 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 259 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 260 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 261 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 262 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 263 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 264 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 265 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 266 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 267 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 268 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 269 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 270 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 271 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 272 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 273 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 274 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 275 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 276 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 277 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 278 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 279 | 3300038742 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 | Metagenome | Unclassified |
| 280 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 281 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 282 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 283 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 284 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 285 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 286 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 345 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 346 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 347 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 348 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 349 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 350 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 351 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 352 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 353 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 354 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 355 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 356 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 357 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 358 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 359 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 360 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 361 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 362 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 363 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 364 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 365 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 366 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 367 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 368 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 369 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 370 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 371 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 372 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 373 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 374 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 375 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 376 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 377 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 378 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 379 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 380 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 381 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 382 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 383 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 384 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 385 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 386 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 387 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 388 | 3300049778 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control | Metagenome | Rhizosphere |
| 389 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 390 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 391 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 392 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 393 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 394 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 395 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 396 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 397 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 398 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 399 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 400 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 401 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 402 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 403 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 404 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 405 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 406 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 407 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 408 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 409 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 410 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 411 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 412 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 413 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 414 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 415 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 416 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 417 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 418 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 419 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 420 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 421 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 422 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 423 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 424 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 425 | 2643221547 | Pseudolabrys sp. Root1462 | Isolate | Unclassified |
| 426 | 2837678835 | Jiella endophytica CBS5Q-3 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.78 |
| Metatranscriptomes | 0 |
| Isolates | 0.22 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 4.9 |
| Nodule | 0.22 |
| Rhizoplane | 7.35 |
| Rhizosphere | 85.63 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 3.01 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0114129_10359091 | 3300009147 | Bacteria | 1928 |
| 2 | ARcpr5yngRDRAFT_c000210 | 3300000043 | Bacteria | 9009 |
| 3 | JGI24752J21851_1001364 | 3300001976 | Bacteria | 3298 |
| 4 | JGI24746J21847_1000091 | 3300001977 | Bacteria | 9974 |
| 5 | JGI24739J22299_10001085 | 3300001989 | Bacteria | 10126 |
| 6 | JGI24737J22298_10000945 | 3300001990 | Bacteria | 10309 |
| 7 | JGI24737J22298_10059255 | 3300001990 | Bacteria | 1154 |
| 8 | JGI24743J22301_10003780 | 3300001991 | Bacteria | 2419 |
| 9 | JGI24743J22301_10008026 | 3300001991 | Bacteria | 1842 |
| 10 | JGI24750J21931_1000009 | 3300002070 | Bacteria | 22897 |
| 11 | JGI24750J21931_1003333 | 3300002070 | Unclassified | 1925 |
| 12 | JGI24750J21931_1003424 | 3300002070 | Unclassified | 1900 |
| 13 | JGI24745J21846_1000043 | 3300002073 | Bacteria | 8500 |
| 14 | JGI24748J21848_1002279 | 3300002074 | Bacteria | 2153 |
| 15 | JGI24738J21930_10000069 | 3300002075 | Bacteria | 21758 |
| 16 | JGI24749J21850_1001500 | 3300002076 | Bacteria | 3302 |
| 17 | JGI24035J26624_1000336 | 3300002126 | Bacteria | 4390 |
| 18 | JGI24033J26618_1003700 | 3300002155 | Bacteria | 1622 |
| 19 | JGI24034J26672_10000258 | 3300002239 | Bacteria | 6974 |
| 20 | JGI24742J22300_10000041 | 3300002244 | Bacteria | 18966 |
| 21 | JGI24742J22300_10000607 | 3300002244 | Bacteria | 5391 |
| 22 | JGI24751J29686_10002673 | 3300002459 | Bacteria | 3590 |
| 23 | JGI25406J46586_10012414 | 3300003203 | Bacteria | 3697 |
| 24 | JGI25153J46596_10000010 | 3300003215 | Bacteria | 337769 |
| 25 | JGI25404J52841_10000199 | 3300003659 | Bacteria | 7152 |
| 26 | Ga0055534_1000063 | 3300003784 | Bacteria | 81542 |
| 27 | Ga0055528_1000070 | 3300003790 | Bacteria | 81542 |
| 28 | Ga0055540_1005204 | 3300003792 | Bacteria | 5565 |
| 29 | Ga0055531_10000406 | 3300003794 | Bacteria | 41415 |
| 30 | Ga0065712_10092257 | 3300005290 | Bacteria | 2338 |
| 31 | Ga0065715_10089103 | 3300005293 | Bacteria | 14332 |
| 32 | Ga0070676_10000036 | 3300005328 | Bacteria | 40368 |
| 33 | Ga0070676_10164156 | 3300005328 | Bacteria | 1432 |
| 34 | Ga0070683_100000898 | 3300005329 | Bacteria | 22112 |
| 35 | Ga0070683_100119955 | 3300005329 | Bacteria | 2484 |
| 36 | Ga0070690_100000402 | 3300005330 | Bacteria | 21886 |
| 37 | Ga0070690_100025638 | 3300005330 | Bacteria | 3631 |
| 38 | Ga0070670_100087762 | 3300005331 | Bacteria | 2673 |
| 39 | Ga0070677_10000124 | 3300005333 | Bacteria | 25567 |
| 40 | Ga0068869_100000087 | 3300005334 | Bacteria | 42211 |
| 41 | Ga0068869_100113414 | 3300005334 | Unclassified | 2064 |
| 42 | Ga0070666_10004335 | 3300005335 | Bacteria | 8635 |
| 43 | Ga0070666_10039271 | 3300005335 | Bacteria | 3154 |
| 44 | Ga0070680_100001046 | 3300005336 | Bacteria | 19811 |
| 45 | Ga0070680_100027578 | 3300005336 | Bacteria | 4548 |
| 46 | Ga0070680_100346512 | 3300005336 | Bacteria | 1263 |
| 47 | Ga0070682_100000341 | 3300005337 | Bacteria | 32124 |
| 48 | Ga0068868_100007302 | 3300005338 | Bacteria | 7862 |
| 49 | Ga0068868_100116455 | 3300005338 | Bacteria | 2176 |
| 50 | Ga0070660_100002798 | 3300005339 | Bacteria | 11989 |
| 51 | Ga0070660_100072025 | 3300005339 | Unclassified | 2699 |
| 52 | Ga0070689_100001365 | 3300005340 | Bacteria | 15504 |
| 53 | Ga0070689_100089519 | 3300005340 | Bacteria | 2424 |
| 54 | Ga0070689_100095645 | 3300005340 | Bacteria | 2346 |
| 55 | Ga0070689_100107712 | 3300005340 | Bacteria | 2213 |
| 56 | Ga0070691_10005903 | 3300005341 | Bacteria | 5587 |
| 57 | Ga0070687_100000339 | 3300005343 | Bacteria | 15932 |
| 58 | Ga0070687_100169404 | 3300005343 | Bacteria | 1298 |
| 59 | Ga0070661_100000017 | 3300005344 | Bacteria | 153232 |
| 60 | Ga0070692_10000018 | 3300005345 | Bacteria | 33825 |
| 61 | Ga0070692_10020333 | 3300005345 | Bacteria | 3219 |
| 62 | Ga0070668_100001356 | 3300005347 | Bacteria | 17522 |
| 63 | Ga0070668_100022599 | 3300005347 | Bacteria | 4756 |
| 64 | Ga0070669_100000217 | 3300005353 | Bacteria | 47833 |
| 65 | Ga0070669_100010139 | 3300005353 | Bacteria | 6701 |
| 66 | Ga0070675_100000088 | 3300005354 | Bacteria | 53698 |
| 67 | Ga0070675_100154113 | 3300005354 | Bacteria | 1972 |
| 68 | Ga0070671_100001697 | 3300005355 | Bacteria | 16710 |
| 69 | Ga0070671_100002748 | 3300005355 | Bacteria | 13664 |
| 70 | Ga0070671_100090950 | 3300005355 | Bacteria | 2555 |
| 71 | Ga0070671_100103130 | 3300005355 | Bacteria | 2393 |
| 72 | Ga0070674_100001565 | 3300005356 | Bacteria | 12257 |
| 73 | Ga0070673_100000239 | 3300005364 | Bacteria | 27611 |
| 74 | Ga0070673_100085592 | 3300005364 | Unclassified | 2567 |
| 75 | Ga0070688_100000084 | 3300005365 | Bacteria | 47194 |
| 76 | Ga0070688_100005224 | 3300005365 | Bacteria | 6819 |
| 77 | Ga0070688_100007541 | 3300005365 | Bacteria | 5872 |
| 78 | Ga0070659_100001069 | 3300005366 | Bacteria | 20041 |
| 79 | Ga0070659_100102280 | 3300005366 | Bacteria | 2306 |
| 80 | Ga0070667_100006312 | 3300005367 | Bacteria | 9850 |
| 81 | Ga0070667_100050860 | 3300005367 | Bacteria | 3492 |
| 82 | Ga0070667_100155391 | 3300005367 | Bacteria | 2012 |
| 83 | Ga0070703_10002012 | 3300005406 | Bacteria | 5947 |
| 84 | Ga0070709_10040697 | 3300005434 | Bacteria | 2859 |
| 85 | Ga0070709_10269662 | 3300005434 | Bacteria | 1233 |
| 86 | Ga0070714_100024644 | 3300005435 | Bacteria | 4957 |
| 87 | Ga0070714_100042480 | 3300005435 | Bacteria | 3841 |
| 88 | Ga0070713_100004591 | 3300005436 | Bacteria | 9304 |
| 89 | Ga0070713_100024720 | 3300005436 | Bacteria | 4685 |
| 90 | Ga0070713_100062022 | 3300005436 | Bacteria | 3130 |
| 91 | Ga0070713_100184933 | 3300005436 | Bacteria | 1875 |
| 92 | Ga0070701_10000061 | 3300005438 | Bacteria | 28962 |
| 93 | Ga0070711_100155658 | 3300005439 | Bacteria | 1728 |
| 94 | Ga0070711_100381713 | 3300005439 | Bacteria | 1140 |
| 95 | Ga0070705_100000425 | 3300005440 | Bacteria | 24231 |
| 96 | Ga0070705_100119391 | 3300005440 | Unclassified | 1700 |
| 97 | Ga0070700_100000430 | 3300005441 | Bacteria | 21259 |
| 98 | Ga0070700_100001942 | 3300005441 | Bacteria | 10475 |
| 99 | Ga0070694_100000401 | 3300005444 | Bacteria | 23534 |
| 100 | Ga0070708_100217808 | 3300005445 | Bacteria | 1790 |
| 101 | Ga0070663_100000713 | 3300005455 | Bacteria | 17941 |
| 102 | Ga0070663_100022243 | 3300005455 | Bacteria | 4235 |
| 103 | Ga0070678_100000053 | 3300005456 | Bacteria | 40418 |
| 104 | Ga0070662_100000284 | 3300005457 | Bacteria | 30040 |
| 105 | Ga0070662_100018792 | 3300005457 | Bacteria | 4681 |
| 106 | Ga0070662_100057181 | 3300005457 | Bacteria | 2833 |
| 107 | Ga0070681_10000493 | 3300005458 | Bacteria | 32198 |
| 108 | Ga0070681_10062755 | 3300005458 | Bacteria | 3689 |
| 109 | Ga0070681_10461698 | 3300005458 | Unclassified | 1182 |
| 110 | Ga0068867_100000503 | 3300005459 | Bacteria | 26056 |
| 111 | Ga0068867_100008910 | 3300005459 | Bacteria | 7080 |
| 112 | Ga0068867_100020401 | 3300005459 | Bacteria | 4722 |
| 113 | Ga0068867_100028314 | 3300005459 | Bacteria | 4034 |
| 114 | Ga0070685_10001195 | 3300005466 | Bacteria | 13859 |
| 115 | Ga0070699_100027166 | 3300005518 | Bacteria | 4937 |
| 116 | Ga0070679_100000679 | 3300005530 | Bacteria | 29087 |
| 117 | Ga0070679_100004801 | 3300005530 | Bacteria | 12466 |
| 118 | Ga0070679_100166547 | 3300005530 | Bacteria | 2177 |
| 119 | Ga0070684_100000144 | 3300005535 | Bacteria | 47665 |
| 120 | Ga0068853_100068798 | 3300005539 | Bacteria | 3079 |
| 121 | Ga0068853_100129992 | 3300005539 | Unclassified | 2254 |
| 122 | Ga0068853_100314702 | 3300005539 | Bacteria | 1450 |
| 123 | Ga0070672_100000014 | 3300005543 | Bacteria | 72627 |
| 124 | Ga0070672_100005008 | 3300005543 | Bacteria | 8731 |
| 125 | Ga0070672_100040524 | 3300005543 | Bacteria | 3574 |
| 126 | Ga0070672_100088038 | 3300005543 | Bacteria | 2500 |
| 127 | Ga0070686_100000899 | 3300005544 | Bacteria | 17300 |
| 128 | Ga0070686_100017839 | 3300005544 | Bacteria | 4154 |
| 129 | Ga0070695_100002430 | 3300005545 | Bacteria | 10707 |
| 130 | Ga0070696_100010312 | 3300005546 | Bacteria | 6258 |
| 131 | Ga0070696_100056349 | 3300005546 | Bacteria | 2741 |
| 132 | Ga0070693_100000686 | 3300005547 | Bacteria | 15001 |
| 133 | Ga0070693_100037772 | 3300005547 | Bacteria | 2695 |
| 134 | Ga0070665_100071240 | 3300005548 | Bacteria | 3482 |
| 135 | Ga0070665_100379443 | 3300005548 | Bacteria | 1421 |
| 136 | Ga0070704_100000593 | 3300005549 | Bacteria | 17367 |
| 137 | Ga0068855_100008091 | 3300005563 | Bacteria | 12704 |
| 138 | Ga0068855_100069346 | 3300005563 | Bacteria | 4103 |
| 139 | Ga0068855_100396996 | 3300005563 | Bacteria | 1512 |
| 140 | Ga0070664_100004463 | 3300005564 | Bacteria | 11235 |
| 141 | Ga0070664_100032419 | 3300005564 | Bacteria | 4370 |
| 142 | Ga0070664_100074850 | 3300005564 | Bacteria | 2907 |
| 143 | Ga0070664_100086090 | 3300005564 | Bacteria | 2715 |
| 144 | Ga0068857_100001474 | 3300005577 | Bacteria | 18724 |
| 145 | Ga0068854_100000168 | 3300005578 | Bacteria | 44522 |
| 146 | Ga0068854_100083231 | 3300005578 | Bacteria | 2366 |
| 147 | Ga0068856_100000932 | 3300005614 | Bacteria | 31354 |
| 148 | Ga0068856_100067589 | 3300005614 | Bacteria | 3532 |
| 149 | Ga0070702_100000047 | 3300005615 | Bacteria | 33510 |
| 150 | Ga0070702_100028282 | 3300005615 | Bacteria | 3037 |
| 151 | Ga0068852_100001577 | 3300005616 | Bacteria | 15493 |
| 152 | Ga0068859_100005578 | 3300005617 | Bacteria | 12818 |
| 153 | Ga0068859_100044635 | 3300005617 | Bacteria | 4453 |
| 154 | Ga0068859_100079439 | 3300005617 | Bacteria | 3321 |
| 155 | Ga0068864_100000507 | 3300005618 | Bacteria | 33520 |
| 156 | Ga0068864_100022018 | 3300005618 | Bacteria | 5342 |
| 157 | Ga0068864_100052253 | 3300005618 | Bacteria | 3521 |
| 158 | Ga0068866_10002442 | 3300005718 | Bacteria | 7669 |
| 159 | Ga0068866_10019232 | 3300005718 | Bacteria | 3104 |
| 160 | Ga0068861_100000315 | 3300005719 | Bacteria | 27094 |
| 161 | Ga0068861_100003730 | 3300005719 | Bacteria | 10161 |
| 162 | Ga0068870_10000002 | 3300005840 | Bacteria | 91107 |
| 163 | Ga0068870_10022401 | 3300005840 | Bacteria | 3104 |
| 164 | Ga0068863_100000981 | 3300005841 | Bacteria | 28643 |
| 165 | Ga0068858_100000356 | 3300005842 | Bacteria | 48189 |
| 166 | Ga0068858_100049336 | 3300005842 | Bacteria | 3898 |
| 167 | Ga0068860_100000747 | 3300005843 | Bacteria | 36976 |
| 168 | Ga0068860_100018552 | 3300005843 | Bacteria | 6767 |
| 169 | Ga0068860_100022098 | 3300005843 | Bacteria | 6158 |
| 170 | Ga0068862_100000671 | 3300005844 | Bacteria | 35004 |
| 171 | Ga0068862_100011911 | 3300005844 | Bacteria | 7183 |
| 172 | Ga0068862_100043290 | 3300005844 | Bacteria | 3838 |
| 173 | Ga0081455_10000276 | 3300005937 | Bacteria | 68055 |
| 174 | Ga0081455_10011354 | 3300005937 | Bacteria | 8956 |
| 175 | Ga0081455_10025859 | 3300005937 | Bacteria | 5410 |
| 176 | Ga0081540_1000017 | 3300005983 | Bacteria | 164991 |
| 177 | Ga0081540_1000045 | 3300005983 | Bacteria | 134124 |
| 178 | Ga0081540_1097669 | 3300005983 | Bacteria | 1274 |
| 179 | Ga0081539_10005839 | 3300005985 | Bacteria | 12218 |
| 180 | Ga0070717_10034636 | 3300006028 | Bacteria | 4083 |
| 181 | Ga0070717_10047826 | 3300006028 | Bacteria | 3506 |
| 182 | Ga0070717_10131680 | 3300006028 | Bacteria | 2151 |
| 183 | Ga0070717_10198870 | 3300006028 | Bacteria | 1755 |
| 184 | Ga0075365_10013475 | 3300006038 | Bacteria | 4893 |
| 185 | Ga0075365_10027459 | 3300006038 | Bacteria | 3622 |
| 186 | Ga0070715_10005699 | 3300006163 | Bacteria | 4176 |
| 187 | Ga0070715_10027950 | 3300006163 | Bacteria | 2257 |
| 188 | Ga0070715_10037741 | 3300006163 | Bacteria | 2001 |
| 189 | Ga0070716_100012210 | 3300006173 | Bacteria | 4348 |
| 190 | Ga0070716_100266304 | 3300006173 | Bacteria | 1175 |
| 191 | Ga0070712_100001956 | 3300006175 | Bacteria | 12621 |
| 192 | Ga0070712_100012254 | 3300006175 | Bacteria | 5451 |
| 193 | Ga0070712_100279792 | 3300006175 | Bacteria | 1343 |
| 194 | Ga0075367_10040600 | 3300006178 | Bacteria | 2717 |
| 195 | Ga0075367_10081021 | 3300006178 | Bacteria | 1964 |
| 196 | Ga0097621_100000144 | 3300006237 | Bacteria | 43169 |
| 197 | Ga0097621_100135418 | 3300006237 | Unclassified | 2100 |
| 198 | Ga0075370_10002905 | 3300006353 | Bacteria | 8044 |
| 199 | Ga0068871_100000110 | 3300006358 | Bacteria | 49756 |
| 200 | Ga0075428_100152716 | 3300006844 | Bacteria | 2508 |
| 201 | Ga0075428_100165283 | 3300006844 | Bacteria | 2401 |
| 202 | Ga0075428_100179820 | 3300006844 | Bacteria | 2290 |
| 203 | Ga0075428_100188735 | 3300006844 | Bacteria | 2230 |
| 204 | Ga0075428_100443187 | 3300006844 | Bacteria | 1391 |
| 205 | Ga0075430_100002679 | 3300006846 | Bacteria | 14868 |
| 206 | Ga0075430_100089430 | 3300006846 | Bacteria | 2576 |
| 207 | Ga0075431_100000111 | 3300006847 | Bacteria | 52069 |
| 208 | Ga0075431_100034269 | 3300006847 | Bacteria | 5231 |
| 209 | Ga0075431_100044271 | 3300006847 | Bacteria | 4591 |
| 210 | Ga0075431_100078188 | 3300006847 | Bacteria | 3415 |
| 211 | Ga0075431_100224539 | 3300006847 | Bacteria | 1915 |
| 212 | Ga0075431_100228971 | 3300006847 | Bacteria | 1894 |
| 213 | Ga0075433_10032425 | 3300006852 | Bacteria | 4475 |
| 214 | Ga0075434_100000084 | 3300006871 | Bacteria | 50928 |
| 215 | Ga0075434_100001952 | 3300006871 | Bacteria | 17878 |
| 216 | Ga0075434_100195945 | 3300006871 | Bacteria | 2040 |
| 217 | Ga0075434_100489400 | 3300006871 | Bacteria | 1251 |
| 218 | Ga0068865_100000066 | 3300006881 | Bacteria | 54564 |
| 219 | Ga0068865_100008038 | 3300006881 | Bacteria | 6512 |
| 220 | Ga0068865_100027772 | 3300006881 | Bacteria | 3741 |
| 221 | Ga0097620_100005578 | 3300006931 | Bacteria | 12818 |
| 222 | Ga0097620_100044641 | 3300006931 | Bacteria | 4453 |
| 223 | Ga0097620_100079438 | 3300006931 | Bacteria | 3321 |
| 224 | Ga0099826_10000077 | 3300006948 | Bacteria | 51489 |
| 225 | Ga0075435_100078463 | 3300007076 | Unclassified | 2708 |
| 226 | Ga0075435_100152365 | 3300007076 | Bacteria | 1944 |
| 227 | Ga0099794_10007547 | 3300007265 | Bacteria | 4474 |
| 228 | Ga0105250_10023051 | 3300009092 | Bacteria | 2508 |
| 229 | Ga0105240_10032085 | 3300009093 | Bacteria | 6803 |
| 230 | Ga0111539_10000652 | 3300009094 | Bacteria | 44828 |
| 231 | Ga0111539_10111721 | 3300009094 | Bacteria | 3206 |
| 232 | Ga0111539_10143686 | 3300009094 | Bacteria | 2793 |
| 233 | Ga0111539_10198207 | 3300009094 | Bacteria | 2342 |
| 234 | Ga0111539_10411744 | 3300009094 | Bacteria | 1575 |
| 235 | Ga0105245_10000287 | 3300009098 | Bacteria | 48204 |
| 236 | Ga0105245_10055067 | 3300009098 | Bacteria | 3572 |
| 237 | Ga0105245_10126618 | 3300009098 | Bacteria | 2392 |
| 238 | Ga0105245_10145675 | 3300009098 | Bacteria | 2235 |
| 239 | Ga0105247_10001223 | 3300009101 | Bacteria | 19057 |
| 240 | Ga0114129_10029477 | 3300009147 | Bacteria | 7774 |
| 241 | Ga0114129_10077932 | 3300009147 | Bacteria | 4609 |
| 242 | Ga0114129_10144969 | 3300009147 | Bacteria | 3253 |
| 243 | Ga0114129_10385262 | 3300009147 | Bacteria | 1851 |
| 244 | Ga0105243_10000106 | 3300009148 | Bacteria | 95432 |
| 245 | Ga0105243_10000695 | 3300009148 | Bacteria | 32613 |
| 246 | Ga0105243_10034179 | 3300009148 | Bacteria | 3934 |
| 247 | Ga0105243_10047868 | 3300009148 | Bacteria | 3369 |
| 248 | Ga0105241_10000204 | 3300009174 | Bacteria | 44532 |
| 249 | Ga0105242_10000792 | 3300009176 | Bacteria | 24525 |
| 250 | Ga0105242_10211282 | 3300009176 | Bacteria | 1730 |
| 251 | Ga0105242_10285383 | 3300009176 | Bacteria | 1501 |
| 252 | Ga0105248_10002487 | 3300009177 | Bacteria | 20479 |
| 253 | Ga0105248_10186540 | 3300009177 | Bacteria | 2337 |
| 254 | Ga0105248_10195515 | 3300009177 | Bacteria | 2279 |
| 255 | Ga0105237_10002795 | 3300009545 | Bacteria | 21203 |
| 256 | Ga0105237_10234589 | 3300009545 | Bacteria | 1836 |
| 257 | Ga0105238_10023825 | 3300009551 | Bacteria | 6240 |
| 258 | Ga0105238_10072072 | 3300009551 | Bacteria | 3451 |
| 259 | Ga0105238_10312433 | 3300009551 | Bacteria | 1557 |
| 260 | Ga0105249_10000279 | 3300009553 | Bacteria | 53594 |
| 261 | Ga0105249_10014648 | 3300009553 | Bacteria | 6932 |
| 262 | Ga0105249_10044279 | 3300009553 | Bacteria | 4047 |
| 263 | Ga0105239_10001686 | 3300010375 | Bacteria | 29130 |
| 264 | Ga0105239_10083023 | 3300010375 | Bacteria | 3528 |
| 265 | Ga0105239_10179323 | 3300010375 | Bacteria | 2370 |
| 266 | Ga0105239_10302120 | 3300010375 | Bacteria | 1802 |
| 267 | Ga0105239_10480059 | 3300010375 | Bacteria | 1412 |
| 268 | Ga0105246_10000095 | 3300011119 | Bacteria | 38417 |
| 269 | Ga0157373_10184590 | 3300013100 | Bacteria | 1469 |
| 270 | Ga0157371_10009056 | 3300013102 | Bacteria | 7871 |
| 271 | Ga0157370_10010506 | 3300013104 | Bacteria | 9750 |
| 272 | Ga0157369_10150782 | 3300013105 | Bacteria | 2457 |
| 273 | Ga0157374_10001348 | 3300013296 | Bacteria | 20895 |
| 274 | Ga0157378_10000631 | 3300013297 | Bacteria | 33043 |
| 275 | Ga0157378_10007666 | 3300013297 | Bacteria | 9421 |
| 276 | Ga0157378_10344212 | 3300013297 | Bacteria | 1455 |
| 277 | Ga0157378_10401672 | 3300013297 | Bacteria | 1350 |
| 278 | Ga0163162_10000850 | 3300013306 | Bacteria | 28391 |
| 279 | Ga0163162_10005487 | 3300013306 | Bacteria | 12255 |
| 280 | Ga0163162_10350730 | 3300013306 | Bacteria | 1608 |
| 281 | Ga0157372_10047887 | 3300013307 | Bacteria | 4751 |
| 282 | Ga0157375_10000135 | 3300013308 | Bacteria | 73281 |
| 283 | Ga0157375_10108044 | 3300013308 | Bacteria | 2876 |
| 284 | Ga0163163_10065736 | 3300014325 | Bacteria | 3601 |
| 285 | Ga0163163_10095849 | 3300014325 | Bacteria | 2987 |
| 286 | Ga0157380_10000052 | 3300014326 | Bacteria | 67030 |
| 287 | Ga0157380_10032855 | 3300014326 | Bacteria | 3993 |
| 288 | Ga0157380_10100558 | 3300014326 | Bacteria | 2407 |
| 289 | Ga0157380_10309385 | 3300014326 | Bacteria | 1459 |
| 290 | Ga0157380_10320735 | 3300014326 | Bacteria | 1436 |
| 291 | Ga0182008_10034200 | 3300014497 | Bacteria | 2549 |
| 292 | Ga0157377_10000076 | 3300014745 | Bacteria | 75835 |
| 293 | Ga0157379_10000060 | 3300014968 | Bacteria | 69312 |
| 294 | Ga0157379_10098958 | 3300014968 | Unclassified | 2618 |
| 295 | Ga0157379_10113953 | 3300014968 | Bacteria | 2430 |
| 296 | Ga0157376_10000141 | 3300014969 | Bacteria | 49288 |
| 297 | Ga0157376_10061915 | 3300014969 | Bacteria | 3147 |
| 298 | Ga0157376_10232853 | 3300014969 | Bacteria | 1712 |
| 299 | Ga0163161_10006630 | 3300017792 | Bacteria | 8017 |
| 300 | Ga0163161_10018879 | 3300017792 | Bacteria | 4833 |
| 301 | Ga0163161_10054737 | 3300017792 | Bacteria | 2896 |
| 302 | Ga0163161_10192464 | 3300017792 | Bacteria | 1569 |
| 303 | Ga0213872_10060315 | 3300021361 | Bacteria | 1716 |
| 304 | Ga0213876_10032765 | 3300021384 | Bacteria | 2740 |
| 305 | Ga0213875_10002544 | 3300021388 | Bacteria | 10884 |
| 306 | Ga0209565_1000130 | 3300025263 | Bacteria | 108121 |
| 307 | Ga0207666_1000005 | 3300025271 | Bacteria | 54011 |
| 308 | Ga0209455_1002615 | 3300025272 | Bacteria | 6843 |
| 309 | Ga0209673_1000106 | 3300025273 | Bacteria | 185426 |
| 310 | Ga0209673_1019334 | 3300025273 | Bacteria | 2449 |
| 311 | Ga0207673_1000002 | 3300025290 | Bacteria | 18299 |
| 312 | Ga0209675_1000058 | 3300025291 | Bacteria | 185426 |
| 313 | Ga0209025_1004721 | 3300025294 | Bacteria | 11622 |
| 314 | Ga0209758_1000033 | 3300025297 | Bacteria | 469998 |
| 315 | Ga0209051_1000059 | 3300025303 | Bacteria | 260307 |
| 316 | Ga0209257_1000022 | 3300025304 | Bacteria | 765258 |
| 317 | Ga0207697_10000011 | 3300025315 | Bacteria | 65035 |
| 318 | Ga0207653_10023402 | 3300025885 | Bacteria | 1967 |
| 319 | Ga0207682_10000051 | 3300025893 | Bacteria | 49249 |
| 320 | Ga0207682_10000572 | 3300025893 | Bacteria | 17018 |
| 321 | Ga0207682_10018113 | 3300025893 | Bacteria | 2751 |
| 322 | Ga0207692_10103603 | 3300025898 | Unclassified | 1567 |
| 323 | Ga0207692_10110724 | 3300025898 | Bacteria | 1522 |
| 324 | Ga0207642_10000229 | 3300025899 | Bacteria | 16538 |
| 325 | Ga0207642_10084277 | 3300025899 | Unclassified | 1552 |
| 326 | Ga0207710_10090826 | 3300025900 | Bacteria | 1429 |
| 327 | Ga0207688_10000001 | 3300025901 | Bacteria | 107505 |
| 328 | Ga0207688_10008121 | 3300025901 | Bacteria | 5704 |
| 329 | Ga0207680_10009743 | 3300025903 | Bacteria | 4779 |
| 330 | Ga0207647_10012355 | 3300025904 | Bacteria | 5944 |
| 331 | Ga0207647_10071943 | 3300025904 | Unclassified | 2086 |
| 332 | Ga0207645_10000121 | 3300025907 | Bacteria | 58999 |
| 333 | Ga0207645_10065556 | 3300025907 | Bacteria | 2321 |
| 334 | Ga0207643_10000009 | 3300025908 | Bacteria | 160496 |
| 335 | Ga0207643_10014436 | 3300025908 | Bacteria | 4290 |
| 336 | Ga0207684_10024320 | 3300025910 | Bacteria | 5165 |
| 337 | Ga0207654_10000271 | 3300025911 | Bacteria | 31641 |
| 338 | Ga0207707_10000840 | 3300025912 | Bacteria | 30189 |
| 339 | Ga0207707_10002707 | 3300025912 | Bacteria | 15840 |
| 340 | Ga0207707_10008018 | 3300025912 | Bacteria | 9172 |
| 341 | Ga0207695_10014787 | 3300025913 | Bacteria | 9221 |
| 342 | Ga0207671_10030003 | 3300025914 | Bacteria | 4057 |
| 343 | Ga0207693_10001099 | 3300025915 | Bacteria | 24306 |
| 344 | Ga0207693_10011118 | 3300025915 | Bacteria | 7292 |
| 345 | Ga0207693_10011491 | 3300025915 | Bacteria | 7162 |
| 346 | Ga0207693_10028715 | 3300025915 | Bacteria | 4396 |
| 347 | Ga0207663_10033490 | 3300025916 | Bacteria | 3061 |
| 348 | Ga0207663_10096716 | 3300025916 | Bacteria | 1973 |
| 349 | Ga0207663_10192185 | 3300025916 | Bacteria | 1466 |
| 350 | Ga0207660_10000426 | 3300025917 | Bacteria | 27755 |
| 351 | Ga0207660_10059281 | 3300025917 | Bacteria | 2747 |
| 352 | Ga0207662_10000120 | 3300025918 | Bacteria | 37721 |
| 353 | Ga0207662_10077363 | 3300025918 | Bacteria | 2024 |
| 354 | Ga0207657_10002826 | 3300025919 | Bacteria | 18663 |
| 355 | Ga0207657_10015306 | 3300025919 | Bacteria | 7436 |
| 356 | Ga0207649_10000052 | 3300025920 | Bacteria | 106800 |
| 357 | Ga0207652_10000508 | 3300025921 | Bacteria | 39568 |
| 358 | Ga0207652_10001947 | 3300025921 | Bacteria | 17863 |
| 359 | Ga0207681_10000035 | 3300025923 | Bacteria | 161792 |
| 360 | Ga0207681_10007048 | 3300025923 | Bacteria | 6899 |
| 361 | Ga0207681_10077900 | 3300025923 | Bacteria | 2332 |
| 362 | Ga0207681_10252913 | 3300025923 | Bacteria | 1376 |
| 363 | Ga0207694_10015924 | 3300025924 | Bacteria | 5674 |
| 364 | Ga0207694_10248109 | 3300025924 | Bacteria | 1456 |
| 365 | Ga0207650_10000843 | 3300025925 | Bacteria | 23231 |
| 366 | Ga0207650_10009149 | 3300025925 | Bacteria | 6770 |
| 367 | Ga0207650_10012334 | 3300025925 | Bacteria | 5899 |
| 368 | Ga0207650_10021202 | 3300025925 | Bacteria | 4594 |
| 369 | Ga0207659_10000027 | 3300025926 | Bacteria | 135454 |
| 370 | Ga0207659_10020909 | 3300025926 | Bacteria | 4334 |
| 371 | Ga0207659_10188571 | 3300025926 | Bacteria | 1639 |
| 372 | Ga0207659_10474635 | 3300025926 | Bacteria | 1056 |
| 373 | Ga0207687_10000231 | 3300025927 | Bacteria | 38087 |
| 374 | Ga0207687_10190400 | 3300025927 | Unclassified | 1596 |
| 375 | Ga0207687_10260149 | 3300025927 | Bacteria | 1383 |
| 376 | Ga0207700_10020618 | 3300025928 | Bacteria | 4481 |
| 377 | Ga0207700_10025902 | 3300025928 | Bacteria | 4082 |
| 378 | Ga0207700_10278847 | 3300025928 | Bacteria | 1437 |
| 379 | Ga0207700_10325538 | 3300025928 | Bacteria | 1333 |
| 380 | Ga0207664_10139319 | 3300025929 | Bacteria | 2050 |
| 381 | Ga0207664_10141841 | 3300025929 | Bacteria | 2033 |
| 382 | Ga0207664_10440803 | 3300025929 | Bacteria | 1162 |
| 383 | Ga0207644_10003468 | 3300025931 | Bacteria | 10194 |
| 384 | Ga0207644_10221320 | 3300025931 | Bacteria | 1500 |
| 385 | Ga0207690_10000056 | 3300025932 | Bacteria | 101387 |
| 386 | Ga0207706_10000261 | 3300025933 | Bacteria | 57530 |
| 387 | Ga0207706_10003407 | 3300025933 | Bacteria | 15186 |
| 388 | Ga0207706_10024331 | 3300025933 | Bacteria | 5429 |
| 389 | Ga0207706_10142727 | 3300025933 | Bacteria | 2106 |
| 390 | Ga0207706_10342861 | 3300025933 | Bacteria | 1299 |
| 391 | Ga0207686_10000171 | 3300025934 | Bacteria | 49624 |
| 392 | Ga0207709_10000077 | 3300025935 | Bacteria | 169923 |
| 393 | Ga0207709_10000087 | 3300025935 | Bacteria | 155019 |
| 394 | Ga0207670_10000169 | 3300025936 | Bacteria | 43470 |
| 395 | Ga0207670_10050322 | 3300025936 | Bacteria | 2792 |
| 396 | Ga0207670_10065016 | 3300025936 | Bacteria | 2502 |
| 397 | Ga0207670_10067928 | 3300025936 | Bacteria | 2454 |
| 398 | Ga0207669_10003221 | 3300025937 | Bacteria | 7054 |
| 399 | Ga0207669_10012052 | 3300025937 | Bacteria | 4235 |
| 400 | Ga0207704_10000134 | 3300025938 | Bacteria | 40098 |
| 401 | Ga0207704_10029498 | 3300025938 | Bacteria | 3060 |
| 402 | Ga0207704_10059244 | 3300025938 | Bacteria | 2363 |
| 403 | Ga0207704_10433507 | 3300025938 | Bacteria | 1045 |
| 404 | Ga0207665_10003421 | 3300025939 | Bacteria | 10618 |
| 405 | Ga0207665_10006302 | 3300025939 | Bacteria | 7867 |
| 406 | Ga0207665_10089251 | 3300025939 | Bacteria | 2135 |
| 407 | Ga0207665_10094086 | 3300025939 | Bacteria | 2081 |
| 408 | Ga0207665_10122350 | 3300025939 | Bacteria | 1839 |
| 409 | Ga0207691_10000106 | 3300025940 | Bacteria | 74290 |
| 410 | Ga0207691_10005974 | 3300025940 | Bacteria | 11757 |
| 411 | Ga0207691_10008316 | 3300025940 | Bacteria | 9966 |
| 412 | Ga0207691_10044460 | 3300025940 | Bacteria | 4089 |
| 413 | Ga0207691_10104009 | 3300025940 | Bacteria | 2531 |
| 414 | Ga0207711_10002404 | 3300025941 | Bacteria | 16713 |
| 415 | Ga0207711_10025906 | 3300025941 | Bacteria | 4918 |
| 416 | Ga0207711_10098766 | 3300025941 | Bacteria | 2580 |
| 417 | Ga0207689_10000031 | 3300025942 | Bacteria | 97131 |
| 418 | Ga0207689_10018698 | 3300025942 | Bacteria | 5843 |
| 419 | Ga0207661_10000219 | 3300025944 | Bacteria | 37298 |
| 420 | Ga0207679_10000057 | 3300025945 | Bacteria | 104912 |
| 421 | Ga0207679_10066812 | 3300025945 | Bacteria | 2696 |
| 422 | Ga0207667_10012319 | 3300025949 | Bacteria | 9863 |
| 423 | Ga0207667_10046913 | 3300025949 | Bacteria | 4574 |
| 424 | Ga0207651_10000136 | 3300025960 | Bacteria | 31931 |
| 425 | Ga0207651_10022623 | 3300025960 | Bacteria | 3848 |
| 426 | Ga0207651_10077383 | 3300025960 | Bacteria | 2381 |
| 427 | Ga0207651_10317111 | 3300025960 | Bacteria | 1302 |
| 428 | Ga0207712_10000176 | 3300025961 | Bacteria | 66116 |
| 429 | Ga0207712_10022814 | 3300025961 | Bacteria | 4125 |
| 430 | Ga0207712_10069108 | 3300025961 | Bacteria | 2534 |
| 431 | Ga0207668_10000191 | 3300025972 | Bacteria | 41901 |
| 432 | Ga0207668_10081494 | 3300025972 | Bacteria | 2348 |
| 433 | Ga0207668_10298009 | 3300025972 | Bacteria | 1329 |
| 434 | Ga0207640_10000126 | 3300025981 | Bacteria | 58432 |
| 435 | Ga0207640_10031868 | 3300025981 | Bacteria | 3263 |
| 436 | Ga0207640_10302018 | 3300025981 | Bacteria | 1267 |
| 437 | Ga0207658_10001331 | 3300025986 | Bacteria | 19354 |
| 438 | Ga0207658_10027609 | 3300025986 | Bacteria | 3990 |
| 439 | Ga0207658_10322764 | 3300025986 | Bacteria | 1337 |
| 440 | Ga0207677_10043870 | 3300026023 | Bacteria | 2976 |
| 441 | Ga0207703_10000662 | 3300026035 | Bacteria | 34434 |
| 442 | Ga0207703_10036692 | 3300026035 | Bacteria | 3902 |
| 443 | Ga0207703_10041853 | 3300026035 | Bacteria | 3673 |
| 444 | Ga0207639_10004863 | 3300026041 | Bacteria | 9047 |
| 445 | Ga0207639_10078616 | 3300026041 | Bacteria | 2604 |
| 446 | Ga0207639_10271977 | 3300026041 | Bacteria | 1486 |
| 447 | Ga0207678_10000137 | 3300026067 | Bacteria | 60700 |
| 448 | Ga0207678_10105288 | 3300026067 | Unclassified | 2407 |
| 449 | Ga0207708_10000250 | 3300026075 | Bacteria | 42228 |
| 450 | Ga0207708_10002312 | 3300026075 | Bacteria | 14011 |
| 451 | Ga0207702_10001067 | 3300026078 | Bacteria | 28056 |
| 452 | Ga0207702_10176523 | 3300026078 | Unclassified | 1964 |
| 453 | Ga0207641_10011323 | 3300026088 | Bacteria | 7321 |
| 454 | Ga0207648_10000125 | 3300026089 | Bacteria | 75547 |
| 455 | Ga0207648_10003783 | 3300026089 | Bacteria | 15808 |
| 456 | Ga0207648_10004705 | 3300026089 | Bacteria | 13955 |
| 457 | Ga0207648_10032400 | 3300026089 | Bacteria | 4615 |
| 458 | Ga0207648_10048341 | 3300026089 | Bacteria | 3725 |
| 459 | Ga0207676_10000891 | 3300026095 | Bacteria | 23194 |
| 460 | Ga0207676_10040171 | 3300026095 | Bacteria | 3584 |
| 461 | Ga0207676_10088398 | 3300026095 | Bacteria | 2536 |
| 462 | Ga0207674_10000095 | 3300026116 | Bacteria | 99278 |
| 463 | Ga0207674_10164549 | 3300026116 | Bacteria | 2172 |
| 464 | Ga0207675_100000140 | 3300026118 | Bacteria | 62058 |
| 465 | Ga0207675_100001910 | 3300026118 | Bacteria | 20784 |
| 466 | Ga0207675_100015760 | 3300026118 | Bacteria | 7048 |
| 467 | Ga0207675_100097245 | 3300026118 | Bacteria | 2772 |
| 468 | Ga0207683_10000178 | 3300026121 | Bacteria | 54648 |
| 469 | Ga0207683_10005574 | 3300026121 | Bacteria | 10789 |
| 470 | Ga0207683_10053138 | 3300026121 | Bacteria | 3551 |
| 471 | Ga0207683_10114796 | 3300026121 | Bacteria | 2414 |
| 472 | Ga0207698_10002073 | 3300026142 | Bacteria | 11823 |
| 473 | Ga0210002_1001008 | 3300027617 | Bacteria | 3897 |
| 474 | Ga0209282_1000223 | 3300027666 | Bacteria | 29527 |
| 475 | Ga0209588_1010538 | 3300027671 | Bacteria | 2780 |
| 476 | Ga0209998_10005113 | 3300027717 | Bacteria | 2756 |
| 477 | Ga0209813_10024173 | 3300027866 | Bacteria | 1735 |
| 478 | Ga0209974_10006256 | 3300027876 | Bacteria | 4161 |
| 479 | Ga0207428_10000037 | 3300027907 | Bacteria | 218857 |
| 480 | Ga0207428_10181953 | 3300027907 | Bacteria | 1588 |
| 481 | Ga0268266_10284605 | 3300028379 | Bacteria | 1538 |
| 482 | Ga0268265_10000774 | 3300028380 | Bacteria | 30835 |
| 483 | Ga0268265_10007031 | 3300028380 | Bacteria | 7610 |
| 484 | Ga0268265_10068115 | 3300028380 | Bacteria | 2758 |
| 485 | Ga0268264_10000467 | 3300028381 | Bacteria | 54925 |
| 486 | Ga0268264_10031167 | 3300028381 | Bacteria | 4371 |
| 487 | Ga0265337_1004015 | 3300028556 | Bacteria | 6220 |
| 488 | Ga0307515_10000030 | 3300028794 | Bacteria | 364482 |
| 489 | Ga0307515_10038535 | 3300028794 | Bacteria | 7641 |
| 490 | Ga0265330_10055199 | 3300031235 | Bacteria | 1735 |
| 491 | Ga0265320_10067999 | 3300031240 | Bacteria | 1684 |
| 492 | Ga0265325_10043538 | 3300031241 | Bacteria | 2342 |
| 493 | Ga0265325_10109036 | 3300031241 | Bacteria | 1347 |
| 494 | Ga0265340_10011319 | 3300031247 | Bacteria | 4745 |
| 495 | Ga0265339_10022924 | 3300031249 | Bacteria | 3612 |
| 496 | Ga0265339_10023205 | 3300031249 | Bacteria | 3588 |
| 497 | Ga0265316_10047692 | 3300031344 | Bacteria | 3387 |
| 498 | Ga0265316_10084088 | 3300031344 | Bacteria | 2437 |
| 499 | Ga0307513_10237018 | 3300031456 | Bacteria | 1633 |
| 500 | Ga0265313_10003826 | 3300031595 | Bacteria | 11884 |
| 501 | Ga0265313_10047475 | 3300031595 | Bacteria | 2077 |
| 502 | Ga0265342_10043020 | 3300031712 | Bacteria | 2727 |
| 503 | Ga0307516_10341968 | 3300031730 | Bacteria | 1163 |
| 504 | Ga0307412_10154558 | 3300031911 | Bacteria | 1697 |
| 505 | Ga0373930_0031405 | 3300034816 | Unclassified | 1094 |
| 506 | Ga0373959_0031979 | 3300034820 | Unclassified | 1067 |
| 507 | Ga0373926_0066917 | 3300035083 | Bacteria | 1316 |
| 508 | Ga0373929_0001926 | 3300035085 | Bacteria | 3883 |
| 509 | Ga0373934_0071197 | 3300035086 | Bacteria | 1391 |
| 510 | Ga0373934_0087798 | 3300035086 | Bacteria | 1252 |
| 511 | Ga0373940_0043834 | 3300035088 | Bacteria | 1238 |
| 512 | Ga0373949_0004404 | 3300035090 | Bacteria | 3231 |
| 513 | Ga0373951_0002829 | 3300035091 | Bacteria | 4319 |
| 514 | Ga0373952_0001091 | 3300035092 | Bacteria | 4959 |
| 515 | Ga0373923_0038638 | 3300035111 | Bacteria | 1957 |
| 516 | Ga0373932_0008017 | 3300035112 | Bacteria | 2520 |
| 517 | Ga0373939_0000421 | 3300035114 | Bacteria | 10637 |
| 518 | Ga0373945_0005477 | 3300035116 | Bacteria | 4064 |
| 519 | Ga0373945_0052308 | 3300035116 | Bacteria | 1504 |
| 520 | Ga0373954_0008973 | 3300035118 | Bacteria | 4401 |
| 521 | Ga0373960_0002654 | 3300035121 | Bacteria | 4046 |
| 522 | Ga0373943_0000463 | 3300035170 | Bacteria | 17235 |
| 523 | Ga0373943_0053316 | 3300035170 | Bacteria | 1997 |
| 524 | Ga0373946_0023416 | 3300035171 | Bacteria | 2412 |
| 525 | Ga0373946_0033513 | 3300035171 | Bacteria | 2068 |
| 526 | Ga0373955_0001204 | 3300035172 | Bacteria | 11001 |
| 527 | Ga0373955_0006420 | 3300035172 | Bacteria | 5359 |
| 528 | Ga0373955_0022634 | 3300035172 | Bacteria | 3190 |
| 529 | Ga0373942_0003886 | 3300035207 | Bacteria | 3495 |
| 530 | Ga0373961_0019721 | 3300035241 | Bacteria | 1774 |
| 531 | Ga0373962_0006310 | 3300035242 | Bacteria | 2870 |
| 532 | Ga0373924_0062763 | 3300035410 | Bacteria | 1557 |
| 533 | Ga0373931_0000209 | 3300035691 | Bacteria | 24963 |
| 534 | Ga0373931_0001680 | 3300035691 | Bacteria | 9585 |
| 535 | Ga0373931_0030198 | 3300035691 | Bacteria | 2789 |
| 536 | Ga0373935_0000208 | 3300035692 | Bacteria | 28198 |
| 537 | Ga0373927_0030660 | 3300035695 | Bacteria | 3508 |
| 538 | Ga0373927_0111502 | 3300035695 | Bacteria | 1783 |
| 539 | Ga0373933_0001412 | 3300035724 | Bacteria | 14109 |
| 540 | Ga0373933_0003550 | 3300035724 | Bacteria | 8668 |
| 541 | Ga0373933_0212194 | 3300035724 | Bacteria | 1241 |
| 542 | Ga0373947_0030004 | 3300035725 | Bacteria | 3192 |
| 543 | Ga0373947_0107945 | 3300035725 | Bacteria | 1756 |
| 544 | Ga0373947_0134403 | 3300035725 | Bacteria | 1581 |
| 545 | Ga0373937_0000031 | 3300036401 | Bacteria | 120533 |
| 546 | Ga0373937_0001111 | 3300036401 | Bacteria | 22670 |
| 547 | Ga0373937_0001925 | 3300036401 | Bacteria | 17362 |
| 548 | Ga0373937_0002996 | 3300036401 | Bacteria | 14164 |
| 549 | Ga0373937_0006839 | 3300036401 | Bacteria | 9841 |
| 550 | Ga0373937_0032858 | 3300036401 | Bacteria | 4708 |
| 551 | Ga0373937_0438072 | 3300036401 | Bacteria | 1241 |
| 552 | Ga0373925_0000063 | 3300037068 | Bacteria | 114809 |
| 553 | Ga0373925_0026368 | 3300037068 | Bacteria | 4253 |
| 554 | Ga0373925_0073528 | 3300037068 | Bacteria | 2588 |
| 555 | Ga0373925_0095798 | 3300037068 | Bacteria | 2274 |
| 556 | Ga0373925_0335415 | 3300037068 | Bacteria | 1226 |
| 557 | Ga0395900_0110770 | 3300037418 | Bacteria | 2820 |
| 558 | Ga0395898_0086242 | 3300037466 | Bacteria | 3026 |
| 559 | Ga0395905_0003404 | 3300037471 | Bacteria | 17022 |
| 560 | Ga0395905_0068502 | 3300037471 | Bacteria | 3324 |
| 561 | Ga0395905_0077697 | 3300037471 | Bacteria | 3110 |
| 562 | Ga0395901_0014335 | 3300038443 | Bacteria | 8071 |
| 563 | Ga0400486_28014 | 3300038742 | Unclassified | 1441 |
| 564 | Ga0436365_0085457 | 3300039437 | Bacteria | 1324 |
| 565 | Ga0436365_0248031 | 3300039437 | Bacteria | 1693 |
| 566 | Ga0436365_1651064 | 3300039437 | Bacteria | 4965 |
| 567 | Ga0436361_0365487 | 3300039447 | Bacteria | 7952 |
| 568 | Ga0436363_0767643 | 3300039450 | Unclassified | 1268 |
| 569 | Ga0436363_1104439 | 3300039450 | Bacteria | 1725 |
| 570 | Ga0466972_0011884 | 3300044658 | Bacteria | 4374 |
| 571 | Ga0466961_0160900 | 3300044693 | Bacteria | 1399 |
| 572 | Ga0451576_0000694 | 3300045051 | Bacteria | 68295 |
| 573 | Ga0495592_0000072 | 3300046454 | Bacteria | 91917 |
| 574 | Ga0495592_0029714 | 3300046454 | Bacteria | 4137 |
| 575 | Ga0495592_0107465 | 3300046454 | Bacteria | 1979 |
| 576 | Ga0495592_0165365 | 3300046454 | Bacteria | 1519 |
| 577 | Ga0495590_0042085 | 3300046457 | Bacteria | 1592 |
| 578 | Ga0495591_004866 | 3300046458 | Bacteria | 6398 |
| 579 | Ga0495629_0024763 | 3300046459 | Bacteria | 4272 |
| 580 | Ga0495629_0077142 | 3300046459 | Bacteria | 2326 |
| 581 | Ga0495629_0279651 | 3300046459 | Bacteria | 1145 |
| 582 | Ga0495638_0044798 | 3300046460 | Bacteria | 2786 |
| 583 | Ga0495638_0059669 | 3300046460 | Bacteria | 2361 |
| 584 | Ga0495641_0128111 | 3300046461 | Bacteria | 1133 |
| 585 | Ga0495651_0005951 | 3300046462 | Bacteria | 9307 |
| 586 | Ga0495651_0038801 | 3300046462 | Bacteria | 3709 |
| 587 | Ga0495653_0000020 | 3300046463 | Bacteria | 175274 |
| 588 | Ga0495653_0136608 | 3300046463 | Bacteria | 1729 |
| 589 | Ga0495580_0005811 | 3300046472 | Bacteria | 10127 |
| 590 | Ga0495580_0254547 | 3300046472 | Bacteria | 1202 |
| 591 | Ga0495582_0133708 | 3300046473 | Bacteria | 1402 |
| 592 | Ga0495605_0020042 | 3300046474 | Bacteria | 3558 |
| 593 | Ga0495662_0003193 | 3300046476 | Bacteria | 8278 |
| 594 | Ga0495662_0083589 | 3300046476 | Bacteria | 1554 |
| 595 | Ga0495664_0000006 | 3300046477 | Bacteria | 407031 |
| 596 | Ga0495664_0073411 | 3300046477 | Bacteria | 2045 |
| 597 | Ga0495584_0012887 | 3300046491 | Bacteria | 4268 |
| 598 | Ga0495584_0033883 | 3300046491 | Bacteria | 2584 |
| 599 | Ga0495584_0036680 | 3300046491 | Bacteria | 2476 |
| 600 | Ga0495584_0057658 | 3300046491 | Bacteria | 1954 |
| 601 | Ga0495596_0002466 | 3300046500 | Bacteria | 9944 |
| 602 | Ga0495608_0000002 | 3300046511 | Bacteria | 376403 |
| 603 | Ga0495616_0059163 | 3300046513 | Bacteria | 1885 |
| 604 | Ga0495618_0000017 | 3300046514 | Bacteria | 143326 |
| 605 | Ga0495618_0019326 | 3300046514 | Bacteria | 4190 |
| 606 | Ga0495628_0000004 | 3300046516 | Bacteria | 462184 |
| 607 | Ga0495628_0005223 | 3300046516 | Bacteria | 11398 |
| 608 | Ga0495628_0005226 | 3300046516 | Bacteria | 11394 |
| 609 | Ga0495628_0005631 | 3300046516 | Bacteria | 10965 |
| 610 | Ga0495628_0125278 | 3300046516 | Bacteria | 1969 |
| 611 | Ga0495630_0000832 | 3300046517 | Bacteria | 21777 |
| 612 | Ga0495630_0171870 | 3300046517 | Bacteria | 1651 |
| 613 | Ga0495631_0019159 | 3300046518 | Bacteria | 3211 |
| 614 | Ga0495648_0006327 | 3300046524 | Bacteria | 9685 |
| 615 | Ga0495652_0000007 | 3300046529 | Bacteria | 418163 |
| 616 | Ga0495652_0029416 | 3300046529 | Bacteria | 4827 |
| 617 | Ga0495652_0050815 | 3300046529 | Bacteria | 3543 |
| 618 | Ga0495652_0053314 | 3300046529 | Bacteria | 3447 |
| 619 | Ga0495654_0001084 | 3300046530 | Bacteria | 19844 |
| 620 | Ga0495665_0008869 | 3300046531 | Bacteria | 5456 |
| 621 | Ga0495640_0000004 | 3300046533 | Bacteria | 357515 |
| 622 | Ga0495640_0026084 | 3300046533 | Bacteria | 4229 |
| 623 | Ga0495640_0066732 | 3300046533 | Bacteria | 2426 |
| 624 | Ga0495640_0083344 | 3300046533 | Bacteria | 2122 |
| 625 | Ga0495640_0111475 | 3300046533 | Bacteria | 1788 |
| 626 | Ga0495587_0000002 | 3300046536 | Bacteria | 425485 |
| 627 | Ga0495598_0001493 | 3300046537 | Bacteria | 4652 |
| 628 | Ga0495598_0008909 | 3300046537 | Bacteria | 2351 |
| 629 | Ga0495645_0000008 | 3300046543 | Bacteria | 331530 |
| 630 | Ga0495645_0000124 | 3300046543 | Bacteria | 51967 |
| 631 | Ga0495645_0000848 | 3300046543 | Bacteria | 20818 |
| 632 | Ga0495622_0079263 | 3300046557 | Bacteria | 1512 |
| 633 | Ga0495667_0000010 | 3300046559 | Bacteria | 222698 |
| 634 | Ga0495667_0001817 | 3300046559 | Bacteria | 14166 |
| 635 | Ga0495667_0102670 | 3300046559 | Bacteria | 1849 |
| 636 | Ga0495656_0125314 | 3300046615 | Bacteria | 1217 |
| 637 | Ga0495668_0041709 | 3300046616 | Bacteria | 2556 |
| 638 | Ga0495634_0000603 | 3300046642 | Bacteria | 34766 |
| 639 | Ga0495634_0117222 | 3300046642 | Bacteria | 1707 |
| 640 | Ga0495635_0000004 | 3300046663 | Bacteria | 388068 |
| 641 | Ga0495635_0004141 | 3300046663 | Bacteria | 10053 |
| 642 | Ga0495659_0079113 | 3300046664 | Bacteria | 1245 |
| 643 | Ga0495661_0018260 | 3300046665 | Bacteria | 4617 |
| 644 | Ga0495588_0132881 | 3300046674 | Bacteria | 1313 |
| 645 | Ga0495657_0000051 | 3300046675 | Bacteria | 101587 |
| 646 | Ga0495657_0052535 | 3300046675 | Bacteria | 2731 |
| 647 | Ga0495657_0097334 | 3300046675 | Bacteria | 1879 |
| 648 | Ga0495599_0000003 | 3300046678 | Bacteria | 319085 |
| 649 | Ga0495599_0127788 | 3300046678 | Bacteria | 1579 |
| 650 | Ga0495623_0000009 | 3300046679 | Bacteria | 127758 |
| 651 | Ga0495623_0010252 | 3300046679 | Bacteria | 6064 |
| 652 | Ga0495623_0059406 | 3300046679 | Bacteria | 2401 |
| 653 | Ga0495646_0000001 | 3300046680 | Bacteria | 403396 |
| 654 | Ga0495646_0003279 | 3300046680 | Bacteria | 10074 |
| 655 | Ga0495646_0033837 | 3300046680 | Bacteria | 3177 |
| 656 | Ga0495646_0144783 | 3300046680 | Bacteria | 1326 |
| 657 | Ga0495613_0029535 | 3300046689 | Bacteria | 4076 |
| 658 | Ga0495613_0029978 | 3300046689 | Bacteria | 4042 |
| 659 | Ga0495613_0189867 | 3300046689 | Bacteria | 1452 |
| 660 | Ga0495624_0001622 | 3300046690 | Bacteria | 17246 |
| 661 | Ga0495624_0020968 | 3300046690 | Bacteria | 4340 |
| 662 | Ga0495589_0020066 | 3300046794 | Bacteria | 3418 |
| 663 | Ga0495600_0000008 | 3300046809 | Bacteria | 147902 |
| 664 | Ga0495600_0029311 | 3300046809 | Bacteria | 3563 |
| 665 | Ga0495604_0000003 | 3300047317 | Bacteria | 464246 |
| 666 | Ga0495604_0004786 | 3300047317 | Bacteria | 10728 |
| 667 | Ga0495604_0014838 | 3300047317 | Bacteria | 6213 |
| 668 | Ga0495604_0032541 | 3300047317 | Bacteria | 4132 |
| 669 | Ga0495604_0041343 | 3300047317 | Bacteria | 3616 |
| 670 | Ga0495636_0000443 | 3300047318 | Bacteria | 15349 |
| 671 | Ga0495674_0000021 | 3300047319 | Bacteria | 174056 |
| 672 | Ga0495674_0006553 | 3300047319 | Bacteria | 11171 |
| 673 | Ga0495674_0020868 | 3300047319 | Bacteria | 6065 |
| 674 | Ga0495676_0084151 | 3300047321 | Bacteria | 2401 |
| 675 | Ga0495680_0000505 | 3300047322 | Bacteria | 44019 |
| 676 | Ga0495680_0005562 | 3300047322 | Bacteria | 11828 |
| 677 | Ga0495680_0006777 | 3300047322 | Bacteria | 10581 |
| 678 | Ga0495680_0027535 | 3300047322 | Bacteria | 4668 |
| 679 | Ga0495680_0046543 | 3300047322 | Bacteria | 3420 |
| 680 | Ga0495675_0000145 | 3300047444 | Bacteria | 49514 |
| 681 | Ga0495675_0034908 | 3300047444 | Bacteria | 3212 |
| 682 | Ga0495679_001373 | 3300047446 | Bacteria | 13976 |
| 683 | Ga0495673_0003704 | 3300047469 | Bacteria | 9943 |
| 684 | Ga0495684_0000050 | 3300047471 | Bacteria | 86794 |
| 685 | Ga0495684_0023901 | 3300047471 | Bacteria | 4700 |
| 686 | Ga0495593_0000394 | 3300047673 | Bacteria | 24241 |
| 687 | Ga0495602_0000012 | 3300048088 | Bacteria | 200520 |
| 688 | Ga0495602_0000317 | 3300048088 | Bacteria | 44519 |
| 689 | Ga0495602_0006361 | 3300048088 | Bacteria | 12386 |
| 690 | Ga0495602_0197747 | 3300048088 | Bacteria | 1536 |
| 691 | Ga0495602_0209196 | 3300048088 | Bacteria | 1482 |
| 692 | Ga0495614_0033632 | 3300048089 | Bacteria | 2205 |
| 693 | Ga0496100_0000713 | 3300048903 | Bacteria | 15859 |
| 694 | Ga0496100_0021515 | 3300048903 | Bacteria | 3885 |
| 695 | Ga0496100_0039028 | 3300048903 | Bacteria | 3013 |
| 696 | Ga0496100_0105555 | 3300048903 | Bacteria | 1948 |
| 697 | Ga0496101_0000151 | 3300048904 | Bacteria | 59751 |
| 698 | Ga0496101_0053207 | 3300048904 | Bacteria | 2920 |
| 699 | Ga0496101_0068340 | 3300048904 | Bacteria | 2597 |
| 700 | Ga0496101_0092486 | 3300048904 | Bacteria | 2252 |
| 701 | Ga0496101_0354099 | 3300048904 | Bacteria | 1154 |
| 702 | Ga0496102_0001766 | 3300048905 | Bacteria | 18797 |
| 703 | Ga0496102_0014247 | 3300048905 | Bacteria | 6908 |
| 704 | Ga0496102_0030592 | 3300048905 | Bacteria | 4819 |
| 705 | Ga0496102_0033326 | 3300048905 | Bacteria | 4628 |
| 706 | Ga0496102_0063292 | 3300048905 | Bacteria | 3387 |
| 707 | Ga0496102_0109511 | 3300048905 | Bacteria | 2574 |
| 708 | Ga0496103_0014888 | 3300048906 | Bacteria | 4623 |
| 709 | Ga0496103_0037448 | 3300048906 | Bacteria | 2972 |
| 710 | Ga0496104_0001328 | 3300048907 | Bacteria | 21352 |
| 711 | Ga0496104_0010143 | 3300048907 | Bacteria | 8410 |
| 712 | Ga0496104_0011872 | 3300048907 | Bacteria | 7820 |
| 713 | Ga0496104_0045144 | 3300048907 | Bacteria | 4143 |
| 714 | Ga0496104_0327072 | 3300048907 | Bacteria | 1446 |
| 715 | Ga0496105_0025422 | 3300048908 | Bacteria | 4819 |
| 716 | Ga0496105_0048560 | 3300048908 | Bacteria | 3503 |
| 717 | Ga0496105_0087730 | 3300048908 | Bacteria | 2570 |
| 718 | Ga0496105_0124479 | 3300048908 | Bacteria | 2125 |
| 719 | Ga0496105_0189003 | 3300048908 | Bacteria | 1685 |
| 720 | Ga0496105_0216401 | 3300048908 | Bacteria | 1560 |
| 721 | Ga0496106_0000347 | 3300048909 | Bacteria | 32770 |
| 722 | Ga0496106_0059754 | 3300048909 | Bacteria | 2888 |
| 723 | Ga0496106_0257297 | 3300048909 | Bacteria | 1396 |
| 724 | Ga0496106_0258989 | 3300048909 | Bacteria | 1392 |
| 725 | Ga0496107_0015881 | 3300048910 | Bacteria | 5281 |
| 726 | Ga0496107_0030383 | 3300048910 | Bacteria | 3850 |
| 727 | Ga0496107_0038857 | 3300048910 | Bacteria | 3413 |
| 728 | Ga0496107_0042490 | 3300048910 | Bacteria | 3264 |
| 729 | Ga0496107_0051416 | 3300048910 | Bacteria | 2972 |
| 730 | Ga0496108_0024520 | 3300048911 | Bacteria | 4967 |
| 731 | Ga0496108_0026329 | 3300048911 | Bacteria | 4796 |
| 732 | Ga0496108_0038656 | 3300048911 | Bacteria | 3975 |
| 733 | Ga0496109_0000186 | 3300048912 | Bacteria | 62084 |
| 734 | Ga0496109_0001505 | 3300048912 | Bacteria | 19383 |
| 735 | Ga0496109_0195403 | 3300048912 | Bacteria | 1901 |
| 736 | Ga0496109_0592142 | 3300048912 | Bacteria | 1045 |
| 737 | Ga0496110_0016390 | 3300048913 | Bacteria | 6187 |
| 738 | Ga0496110_0029751 | 3300048913 | Bacteria | 4704 |
| 739 | Ga0496110_0109535 | 3300048913 | Bacteria | 2480 |
| 740 | Ga0496111_0001144 | 3300048914 | Bacteria | 14723 |
| 741 | Ga0496111_0012872 | 3300048914 | Bacteria | 5676 |
| 742 | Ga0496112_0000562 | 3300048915 | Bacteria | 25481 |
| 743 | Ga0496112_0016331 | 3300048915 | Bacteria | 6952 |
| 744 | Ga0496112_0183743 | 3300048915 | Unclassified | 2054 |
| 745 | Ga0496112_0352226 | 3300048915 | Bacteria | 1415 |
| 746 | Ga0496113_0003414 | 3300048916 | Bacteria | 9506 |
| 747 | Ga0496113_0014517 | 3300048916 | Bacteria | 5377 |
| 748 | Ga0496113_0016184 | 3300048916 | Bacteria | 5147 |
| 749 | Ga0496114_0028628 | 3300048917 | Bacteria | 4573 |
| 750 | Ga0496114_0039543 | 3300048917 | Bacteria | 3902 |
| 751 | Ga0496114_0110317 | 3300048917 | Bacteria | 2356 |
| 752 | Ga0496114_0264075 | 3300048917 | Bacteria | 1516 |
| 753 | Ga0496114_0362821 | 3300048917 | Bacteria | 1281 |
| 754 | Ga0496115_0001282 | 3300048918 | Bacteria | 17986 |
| 755 | Ga0496115_0044847 | 3300048918 | Bacteria | 3529 |
| 756 | Ga0496115_0053583 | 3300048918 | Bacteria | 3237 |
| 757 | Ga0496115_0108426 | 3300048918 | Bacteria | 2280 |
| 758 | Ga0496115_0217034 | 3300048918 | Bacteria | 1579 |
| 759 | Ga0496117_0002111 | 3300048920 | Bacteria | 26142 |
| 760 | Ga0496118_0000120 | 3300048921 | Bacteria | 142952 |
| 761 | Ga0496126_0022883 | 3300048929 | Bacteria | 6067 |
| 762 | Ga0501031_0104705 | 3300049568 | Bacteria | 1846 |
| 763 | Ga0501032_0053314 | 3300049569 | Bacteria | 2724 |
| 764 | Ga0501033_0109639 | 3300049570 | Bacteria | 2010 |
| 765 | Ga0501033_0271081 | 3300049570 | Bacteria | 1200 |
| 766 | Ga0501034_0000247 | 3300049571 | Bacteria | 99828 |
| 767 | Ga0501034_0001290 | 3300049571 | Bacteria | 33888 |
| 768 | Ga0501034_0025699 | 3300049571 | Bacteria | 5997 |
| 769 | Ga0501034_0032911 | 3300049571 | Bacteria | 5264 |
| 770 | Ga0501036_0014726 | 3300049572 | Bacteria | 6522 |
| 771 | Ga0501036_0054523 | 3300049572 | Bacteria | 3386 |
| 772 | Ga0501037_0007246 | 3300049573 | Bacteria | 8103 |
| 773 | Ga0501038_0005386 | 3300049574 | Bacteria | 11891 |
| 774 | Ga0501038_0085276 | 3300049574 | Bacteria | 2656 |
| 775 | Ga0501038_0183617 | 3300049574 | Bacteria | 1686 |
| 776 | Ga0501038_0206722 | 3300049574 | Unclassified | 1573 |
| 777 | Ga0501039_0011082 | 3300049575 | Bacteria | 6870 |
| 778 | Ga0501042_0038139 | 3300049578 | Bacteria | 3412 |
| 779 | Ga0501043_0057508 | 3300049579 | Bacteria | 3053 |
| 780 | Ga0501043_0107739 | 3300049579 | Bacteria | 2188 |
| 781 | Ga0501046_0017800 | 3300049580 | Bacteria | 5927 |
| 782 | Ga0501046_0064490 | 3300049580 | Bacteria | 2859 |
| 783 | Ga0501047_0037239 | 3300049581 | Bacteria | 4703 |
| 784 | Ga0501068_0030261 | 3300049584 | Bacteria | 3210 |
| 785 | Ga0501069_0074346 | 3300049585 | Bacteria | 1906 |
| 786 | Ga0501070_0050130 | 3300049586 | Bacteria | 3466 |
| 787 | Ga0501070_0056658 | 3300049586 | Bacteria | 3249 |
| 788 | Ga0501072_0005240 | 3300049588 | Bacteria | 9870 |
| 789 | Ga0501072_0021992 | 3300049588 | Bacteria | 4947 |
| 790 | Ga0501072_0107559 | 3300049588 | Bacteria | 2219 |
| 791 | Ga0501073_0013722 | 3300049589 | Bacteria | 5893 |
| 792 | Ga0501073_0023679 | 3300049589 | Bacteria | 4407 |
| 793 | Ga0501073_0031954 | 3300049589 | Bacteria | 3755 |
| 794 | Ga0501073_0069280 | 3300049589 | Bacteria | 2458 |
| 795 | Ga0501074_0121149 | 3300049590 | Bacteria | 1871 |
| 796 | Ga0501074_0159178 | 3300049590 | Bacteria | 1613 |
| 797 | Ga0501075_0095335 | 3300049591 | Bacteria | 2258 |
| 798 | Ga0501076_0279329 | 3300049592 | Bacteria | 1368 |
| 799 | Ga0501077_0020002 | 3300049593 | Bacteria | 4236 |
| 800 | Ga0501077_0041031 | 3300049593 | Bacteria | 2947 |
| 801 | Ga0501077_0239293 | 3300049593 | Bacteria | 1154 |
| 802 | Ga0501079_0080385 | 3300049741 | Bacteria | 2520 |
| 803 | Ga0501080_0026529 | 3300049742 | Bacteria | 5382 |
| 804 | Ga0501080_0037101 | 3300049742 | Bacteria | 4550 |
| 805 | Ga0501080_0046053 | 3300049742 | Bacteria | 4062 |
| 806 | Ga0501081_0052073 | 3300049743 | Bacteria | 2824 |
| 807 | Ga0501083_0049717 | 3300049744 | Bacteria | 2826 |
| 808 | Ga0501083_0063708 | 3300049744 | Unclassified | 2458 |
| 809 | Ga0501083_0090317 | 3300049744 | Bacteria | 2023 |
| 810 | Ga0501083_0117859 | 3300049744 | Bacteria | 1742 |
| 811 | Ga0501282_000063 | 3300049778 | Bacteria | 13034 |
| 812 | Ga0501035_0005135 | 3300049822 | Bacteria | 12388 |
| 813 | Ga0501035_0047106 | 3300049822 | Bacteria | 3872 |
| 814 | Ga0501035_0047404 | 3300049822 | Bacteria | 3857 |
| 815 | Ga0501044_0000236 | 3300049823 | Bacteria | 69634 |
| 816 | Ga0501044_0021136 | 3300049823 | Bacteria | 6948 |
| 817 | Ga0501044_0037261 | 3300049823 | Bacteria | 5083 |
| 818 | Ga0501044_0144342 | 3300049823 | Unclassified | 2367 |
| 819 | Ga0501045_0243732 | 3300049824 | Bacteria | 1338 |
| 820 | nmdc:mga03683_11712_c1 | 3300050489 | Bacteria | 3184 |
| 821 | nmdc:mga0yw44_13141_c1 | 3300050492 | Bacteria | 4347 |
| 822 | nmdc:mga0yw44_24616_c1 | 3300050492 | Bacteria | 3410 |
| 823 | nmdc:mga0yw44_7062_c1 | 3300050492 | Bacteria | 5497 |
| 824 | nmdc:mga0yw44_81974_c1 | 3300050492 | Bacteria | 2023 |
| 825 | nmdc:mga06z11_41552_c1 | 3300050494 | Bacteria | 2302 |
| 826 | nmdc:mga04h51_13110_c1 | 3300050495 | Bacteria | 2341 |
| 827 | nmdc:mga07m45_12533_c1 | 3300050496 | Bacteria | 4483 |
| 828 | nmdc:mga07m45_62493_c1 | 3300050496 | Bacteria | 2110 |
| 829 | nmdc:mga05p37_117198_c1 | 3300050507 | Bacteria | 3273 |
| 830 | nmdc:mga05p37_123218_c1 | 3300050507 | Bacteria | 3184 |
| 831 | nmdc:mga05p37_123812_c1 | 3300050507 | Bacteria | 3176 |
| 832 | nmdc:mga05p37_257648_c1 | 3300050507 | Bacteria | 2090 |
| 833 | nmdc:mga05p37_392360_c1 | 3300050507 | Bacteria | 1623 |
| 834 | nmdc:mga05p37_588729_c1 | 3300050507 | Bacteria | 1258 |
| 835 | nmdc:mga09592_244969_c1 | 3300050508 | Bacteria | 1553 |
| 836 | nmdc:mga09592_24564_c1 | 3300050508 | Bacteria | 4984 |
| 837 | nmdc:mga0qj67_100964_c1 | 3300050509 | Bacteria | 2326 |
| 838 | nmdc:mga0qj67_142899_c1 | 3300050509 | Bacteria | 1940 |
| 839 | nmdc:mga0qj67_23674_c1 | 3300050509 | Bacteria | 4725 |
| 840 | nmdc:mga0qj67_2772_c1 | 3300050509 | Bacteria | 12572 |
| 841 | nmdc:mga06r32_104968_c1 | 3300050510 | Bacteria | 2775 |
| 842 | nmdc:mga06r32_115744_c1 | 3300050510 | Bacteria | 2641 |
| 843 | nmdc:mga06r32_1821_c1 | 3300050510 | Bacteria | 19029 |
| 844 | nmdc:mga06r32_53156_c1 | 3300050510 | Bacteria | 3880 |
| 845 | nmdc:mga06r32_5803_c1 | 3300050510 | Bacteria | 11125 |
| 846 | nmdc:mga06r32_62744_c1 | 3300050510 | Bacteria | 3580 |
| 847 | nmdc:mga08y16_165700_c1 | 3300050511 | Bacteria | 2296 |
| 848 | nmdc:mga08y16_311_c1 | 3300050511 | Bacteria | 43954 |
| 849 | nmdc:mga08y16_31237_c1 | 3300050511 | Bacteria | 5603 |
| 850 | nmdc:mga08y16_66768_c1 | 3300050511 | Bacteria | 3754 |
| 851 | nmdc:mga0n895_176753_c1 | 3300050512 | Bacteria | 2166 |
| 852 | nmdc:mga0n895_2121_c1 | 3300050512 | Bacteria | 15312 |
| 853 | nmdc:mga0n895_62_c1 | 3300050512 | Bacteria | 62891 |
| 854 | nmdc:mga0n895_94499_c1 | 3300050512 | Bacteria | 2993 |
| 855 | nmdc:mga0rr50_7331_c2 | 3300050513 | Unclassified | 2710 |
| 856 | nmdc:mga0rr50_99742_c1 | 3300050513 | Bacteria | 2279 |
| 857 | nmdc:mga0a205_11620_c1 | 3300050515 | Bacteria | 8115 |
| 858 | nmdc:mga0a205_211887_c1 | 3300050515 | Bacteria | 1825 |
| 859 | nmdc:mga0a205_2311_c1 | 3300050515 | Bacteria | 12212 |
| 860 | Ga0495601_0000004 | 3300053077 | Bacteria | 449178 |
| 861 | Ga0495601_0000109 | 3300053077 | Bacteria | 45069 |
| 862 | Ga0495601_0001170 | 3300053077 | Bacteria | 14362 |
| 863 | Ga0495601_0016517 | 3300053077 | Bacteria | 4474 |
| 864 | Ga0495612_0000013 | 3300053078 | Bacteria | 198142 |
| 865 | Ga0495612_0000604 | 3300053078 | Bacteria | 14441 |
| 866 | Ga0495612_0000953 | 3300053078 | Bacteria | 11879 |
| 867 | Ga0495612_0040040 | 3300053078 | Bacteria | 1908 |
| 868 | Ga0495655_0021025 | 3300053083 | Bacteria | 1471 |
| 869 | Ga0495595_0000034 | 3300053084 | Bacteria | 82597 |
| 870 | Ga0495595_0000550 | 3300053084 | Bacteria | 14293 |
| 871 | Ga0495595_0002157 | 3300053084 | Bacteria | 7647 |
| 872 | Ga0495595_0121765 | 3300053084 | Bacteria | 1271 |
| 873 | Ga0495619_0000005 | 3300053085 | Bacteria | 418061 |
| 874 | Ga0495619_0000371 | 3300053085 | Bacteria | 30890 |
| 875 | Ga0495619_0002507 | 3300053085 | Bacteria | 12025 |
| 876 | Ga0495619_0009960 | 3300053085 | Bacteria | 5986 |
| 877 | Ga0495619_0018594 | 3300053085 | Bacteria | 4410 |
| 878 | Ga0495619_0169141 | 3300053085 | Bacteria | 1511 |
| 879 | Ga0500578_0013831 | 3300053086 | Bacteria | 5195 |
| 880 | Ga0500643_000631 | 3300053087 | Bacteria | 23701 |
| 881 | Ga0500566_0118922 | 3300053094 | Unclassified | 1427 |
| 882 | Ga0500641_0000421 | 3300053096 | Bacteria | 15552 |
| 883 | Ga0500556_0001437 | 3300053104 | Bacteria | 10138 |
| 884 | Ga0500556_0004310 | 3300053104 | Bacteria | 4058 |
| 885 | Ga0500562_000614 | 3300053108 | Bacteria | 8607 |
| 886 | Ga0500595_002886 | 3300053119 | Bacteria | 8235 |
| 887 | Ga0500642_0050000 | 3300053130 | Bacteria | 1841 |
| 888 | Ga0500658_0017979 | 3300053134 | Bacteria | 2646 |
| 889 | Ga0500559_0000157 | 3300053136 | Bacteria | 53554 |
| 890 | Ga0500616_0022721 | 3300053153 | Bacteria | 3499 |
| 891 | Ga0500622_0148607 | 3300053156 | Bacteria | 1110 |
| 892 | Ga0500645_000448 | 3300053730 | Bacteria | 28215 |
| 893 | Ga0500645_004830 | 3300053730 | Bacteria | 5085 |
| 894 | Ga0501082_0000025 | 3300060353 | Bacteria | 103262 |
| 895 | Ga0501082_0341783 | 3300060353 | Bacteria | 1304 |
| 896 | Ga0530510_0216771 | 3300061734 | Bacteria | 1422 |
| 897 | 2643756889 | 2643221547 | Bacteria | 4740017 |
| 898 | 2837681711 | 2837678835 | Bacteria | 5252418 |
| 899 | Ga0114129_10359091 | |||
| 900 | ARcpr5yngRDRAFT_c000210 | |||
| 901 | JGI24752J21851_1001364 | |||
| 902 | JGI24746J21847_1000091 | |||
| 903 | JGI24739J22299_10001085 | |||
| 904 | JGI24737J22298_10000945 | |||
| 905 | JGI24737J22298_10059255 | |||
| 906 | JGI24743J22301_10003780 | |||
| 907 | JGI24743J22301_10008026 | |||
| 908 | JGI24750J21931_1000009 | |||
| 909 | JGI24750J21931_1003333 | |||
| 910 | JGI24750J21931_1003424 | |||
| 911 | JGI24745J21846_1000043 | |||
| 912 | JGI24748J21848_1002279 | |||
| 913 | JGI24738J21930_10000069 | |||
| 914 | JGI24749J21850_1001500 | |||
| 915 | JGI24035J26624_1000336 | |||
| 916 | JGI24033J26618_1003700 | |||
| 917 | JGI24034J26672_10000258 | |||
| 918 | JGI24742J22300_10000041 | |||
| 919 | JGI24742J22300_10000607 | |||
| 920 | JGI24751J29686_10002673 | |||
| 921 | JGI25406J46586_10012414 | |||
| 922 | JGI25153J46596_10000010 | |||
| 923 | JGI25404J52841_10000199 | |||
| 924 | Ga0055534_1000063 | |||
| 925 | Ga0055528_1000070 | |||
| 926 | Ga0055540_1005204 | |||
| 927 | Ga0055531_10000406 | |||
| 928 | Ga0065712_10092257 | |||
| 929 | Ga0065715_10089103 | |||
| 930 | Ga0070676_10000036 | |||
| 931 | Ga0070676_10164156 | |||
| 932 | Ga0070683_100000898 | |||
| 933 | Ga0070683_100119955 | |||
| 934 | Ga0070690_100000402 | |||
| 935 | Ga0070690_100025638 | |||
| 936 | Ga0070670_100087762 | |||
| 937 | Ga0070677_10000124 | |||
| 938 | Ga0068869_100000087 | |||
| 939 | Ga0068869_100113414 | |||
| 940 | Ga0070666_10004335 | |||
| 941 | Ga0070666_10039271 | |||
| 942 | Ga0070680_100001046 | |||
| 943 | Ga0070680_100027578 | |||
| 944 | Ga0070680_100346512 | |||
| 945 | Ga0070682_100000341 | |||
| 946 | Ga0068868_100007302 | |||
| 947 | Ga0068868_100116455 | |||
| 948 | Ga0070660_100002798 | |||
| 949 | Ga0070660_100072025 | |||
| 950 | Ga0070689_100001365 | |||
| 951 | Ga0070689_100089519 | |||
| 952 | Ga0070689_100095645 | |||
| 953 | Ga0070689_100107712 | |||
| 954 | Ga0070691_10005903 | |||
| 955 | Ga0070687_100000339 | |||
| 956 | Ga0070687_100169404 | |||
| 957 | Ga0070661_100000017 | |||
| 958 | Ga0070692_10000018 | |||
| 959 | Ga0070692_10020333 | |||
| 960 | Ga0070668_100001356 | |||
| 961 | Ga0070668_100022599 | |||
| 962 | Ga0070669_100000217 | |||
| 963 | Ga0070669_100010139 | |||
| 964 | Ga0070675_100000088 | |||
| 965 | Ga0070675_100154113 | |||
| 966 | Ga0070671_100001697 | |||
| 967 | Ga0070671_100002748 | |||
| 968 | Ga0070671_100090950 | |||
| 969 | Ga0070671_100103130 | |||
| 970 | Ga0070674_100001565 | |||
| 971 | Ga0070673_100000239 | |||
| 972 | Ga0070673_100085592 | |||
| 973 | Ga0070688_100000084 | |||
| 974 | Ga0070688_100005224 | |||
| 975 | Ga0070688_100007541 | |||
| 976 | Ga0070659_100001069 | |||
| 977 | Ga0070659_100102280 | |||
| 978 | Ga0070667_100006312 | |||
| 979 | Ga0070667_100050860 | |||
| 980 | Ga0070667_100155391 | |||
| 981 | Ga0070703_10002012 | |||
| 982 | Ga0070709_10040697 | |||
| 983 | Ga0070709_10269662 | |||
| 984 | Ga0070714_100024644 | |||
| 985 | Ga0070714_100042480 | |||
| 986 | Ga0070713_100004591 | |||
| 987 | Ga0070713_100024720 | |||
| 988 | Ga0070713_100062022 | |||
| 989 | Ga0070713_100184933 | |||
| 990 | Ga0070701_10000061 | |||
| 991 | Ga0070711_100155658 | |||
| 992 | Ga0070711_100381713 | |||
| 993 | Ga0070705_100000425 | |||
| 994 | Ga0070705_100119391 | |||
| 995 | Ga0070700_100000430 | |||
| 996 | Ga0070700_100001942 | |||
| 997 | Ga0070694_100000401 | |||
| 998 | Ga0070708_100217808 | |||
| 999 | Ga0070663_100000713 | |||
| 1000 | Ga0070663_100022243 | |||
| 1001 | Ga0070678_100000053 | |||
| 1002 | Ga0070662_100000284 | |||
| 1003 | Ga0070662_100018792 | |||
| 1004 | Ga0070662_100057181 | |||
| 1005 | Ga0070681_10000493 | |||
| 1006 | Ga0070681_10062755 | |||
| 1007 | Ga0070681_10461698 | |||
| 1008 | Ga0068867_100000503 | |||
| 1009 | Ga0068867_100008910 | |||
| 1010 | Ga0068867_100020401 | |||
| 1011 | Ga0068867_100028314 | |||
| 1012 | Ga0070685_10001195 | |||
| 1013 | Ga0070699_100027166 | |||
| 1014 | Ga0070679_100000679 | |||
| 1015 | Ga0070679_100004801 | |||
| 1016 | Ga0070679_100166547 | |||
| 1017 | Ga0070684_100000144 | |||
| 1018 | Ga0068853_100068798 | |||
| 1019 | Ga0068853_100129992 | |||
| 1020 | Ga0068853_100314702 | |||
| 1021 | Ga0070672_100000014 | |||
| 1022 | Ga0070672_100005008 | |||
| 1023 | Ga0070672_100040524 | |||
| 1024 | Ga0070672_100088038 | |||
| 1025 | Ga0070686_100000899 | |||
| 1026 | Ga0070686_100017839 | |||
| 1027 | Ga0070695_100002430 | |||
| 1028 | Ga0070696_100010312 | |||
| 1029 | Ga0070696_100056349 | |||
| 1030 | Ga0070693_100000686 | |||
| 1031 | Ga0070693_100037772 | |||
| 1032 | Ga0070665_100071240 | |||
| 1033 | Ga0070665_100379443 | |||
| 1034 | Ga0070704_100000593 | |||
| 1035 | Ga0068855_100008091 | |||
| 1036 | Ga0068855_100069346 | |||
| 1037 | Ga0068855_100396996 | |||
| 1038 | Ga0070664_100004463 | |||
| 1039 | Ga0070664_100032419 | |||
| 1040 | Ga0070664_100074850 | |||
| 1041 | Ga0070664_100086090 | |||
| 1042 | Ga0068857_100001474 | |||
| 1043 | Ga0068854_100000168 | |||
| 1044 | Ga0068854_100083231 | |||
| 1045 | Ga0068856_100000932 | |||
| 1046 | Ga0068856_100067589 | |||
| 1047 | Ga0070702_100000047 | |||
| 1048 | Ga0070702_100028282 | |||
| 1049 | Ga0068852_100001577 | |||
| 1050 | Ga0068859_100005578 | |||
| 1051 | Ga0068859_100044635 | |||
| 1052 | Ga0068859_100079439 | |||
| 1053 | Ga0068864_100000507 | |||
| 1054 | Ga0068864_100022018 | |||
| 1055 | Ga0068864_100052253 | |||
| 1056 | Ga0068866_10002442 | |||
| 1057 | Ga0068866_10019232 | |||
| 1058 | Ga0068861_100000315 | |||
| 1059 | Ga0068861_100003730 | |||
| 1060 | Ga0068870_10000002 | |||
| 1061 | Ga0068870_10022401 | |||
| 1062 | Ga0068863_100000981 | |||
| 1063 | Ga0068858_100000356 | |||
| 1064 | Ga0068858_100049336 | |||
| 1065 | Ga0068860_100000747 | |||
| 1066 | Ga0068860_100018552 | |||
| 1067 | Ga0068860_100022098 | |||
| 1068 | Ga0068862_100000671 | |||
| 1069 | Ga0068862_100011911 | |||
| 1070 | Ga0068862_100043290 | |||
| 1071 | Ga0081455_10000276 | |||
| 1072 | Ga0081455_10011354 | |||
| 1073 | Ga0081455_10025859 | |||
| 1074 | Ga0081540_1000017 | |||
| 1075 | Ga0081540_1000045 | |||
| 1076 | Ga0081540_1097669 | |||
| 1077 | Ga0081539_10005839 | |||
| 1078 | Ga0070717_10034636 | |||
| 1079 | Ga0070717_10047826 | |||
| 1080 | Ga0070717_10131680 | |||
| 1081 | Ga0070717_10198870 | |||
| 1082 | Ga0075365_10013475 | |||
| 1083 | Ga0075365_10027459 | |||
| 1084 | Ga0070715_10005699 | |||
| 1085 | Ga0070715_10027950 | |||
| 1086 | Ga0070715_10037741 | |||
| 1087 | Ga0070716_100012210 | |||
| 1088 | Ga0070716_100266304 | |||
| 1089 | Ga0070712_100001956 | |||
| 1090 | Ga0070712_100012254 | |||
| 1091 | Ga0070712_100279792 | |||
| 1092 | Ga0075367_10040600 | |||
| 1093 | Ga0075367_10081021 | |||
| 1094 | Ga0097621_100000144 | |||
| 1095 | Ga0097621_100135418 | |||
| 1096 | Ga0075370_10002905 | |||
| 1097 | Ga0068871_100000110 | |||
| 1098 | Ga0075428_100152716 | |||
| 1099 | Ga0075428_100165283 | |||
| 1100 | Ga0075428_100179820 | |||
| 1101 | Ga0075428_100188735 | |||
| 1102 | Ga0075428_100443187 | |||
| 1103 | Ga0075430_100002679 | |||
| 1104 | Ga0075430_100089430 | |||
| 1105 | Ga0075431_100000111 | |||
| 1106 | Ga0075431_100034269 | |||
| 1107 | Ga0075431_100044271 | |||
| 1108 | Ga0075431_100078188 | |||
| 1109 | Ga0075431_100224539 | |||
| 1110 | Ga0075431_100228971 | |||
| 1111 | Ga0075433_10032425 | |||
| 1112 | Ga0075434_100000084 | |||
| 1113 | Ga0075434_100001952 | |||
| 1114 | Ga0075434_100195945 | |||
| 1115 | Ga0075434_100489400 | |||
| 1116 | Ga0068865_100000066 | |||
| 1117 | Ga0068865_100008038 | |||
| 1118 | Ga0068865_100027772 | |||
| 1119 | Ga0097620_100005578 | |||
| 1120 | Ga0097620_100044641 | |||
| 1121 | Ga0097620_100079438 | |||
| 1122 | Ga0099826_10000077 | |||
| 1123 | Ga0075435_100078463 | |||
| 1124 | Ga0075435_100152365 | |||
| 1125 | Ga0099794_10007547 | |||
| 1126 | Ga0105250_10023051 | |||
| 1127 | Ga0105240_10032085 | |||
| 1128 | Ga0111539_10000652 | |||
| 1129 | Ga0111539_10111721 | |||
| 1130 | Ga0111539_10143686 | |||
| 1131 | Ga0111539_10198207 | |||
| 1132 | Ga0111539_10411744 | |||
| 1133 | Ga0105245_10000287 | |||
| 1134 | Ga0105245_10055067 | |||
| 1135 | Ga0105245_10126618 | |||
| 1136 | Ga0105245_10145675 | |||
| 1137 | Ga0105247_10001223 | |||
| 1138 | Ga0114129_10029477 | |||
| 1139 | Ga0114129_10077932 | |||
| 1140 | Ga0114129_10144969 | |||
| 1141 | Ga0114129_10385262 | |||
| 1142 | Ga0105243_10000106 | |||
| 1143 | Ga0105243_10000695 | |||
| 1144 | Ga0105243_10034179 | |||
| 1145 | Ga0105243_10047868 | |||
| 1146 | Ga0105241_10000204 | |||
| 1147 | Ga0105242_10000792 | |||
| 1148 | Ga0105242_10211282 | |||
| 1149 | Ga0105242_10285383 | |||
| 1150 | Ga0105248_10002487 | |||
| 1151 | Ga0105248_10186540 | |||
| 1152 | Ga0105248_10195515 | |||
| 1153 | Ga0105237_10002795 | |||
| 1154 | Ga0105237_10234589 | |||
| 1155 | Ga0105238_10023825 | |||
| 1156 | Ga0105238_10072072 | |||
| 1157 | Ga0105238_10312433 | |||
| 1158 | Ga0105249_10000279 | |||
| 1159 | Ga0105249_10014648 | |||
| 1160 | Ga0105249_10044279 | |||
| 1161 | Ga0105239_10001686 | |||
| 1162 | Ga0105239_10083023 | |||
| 1163 | Ga0105239_10179323 | |||
| 1164 | Ga0105239_10302120 | |||
| 1165 | Ga0105239_10480059 | |||
| 1166 | Ga0105246_10000095 | |||
| 1167 | Ga0157373_10184590 | |||
| 1168 | Ga0157371_10009056 | |||
| 1169 | Ga0157370_10010506 | |||
| 1170 | Ga0157369_10150782 | |||
| 1171 | Ga0157374_10001348 | |||
| 1172 | Ga0157378_10000631 | |||
| 1173 | Ga0157378_10007666 | |||
| 1174 | Ga0157378_10344212 | |||
| 1175 | Ga0157378_10401672 | |||
| 1176 | Ga0163162_10000850 | |||
| 1177 | Ga0163162_10005487 | |||
| 1178 | Ga0163162_10350730 | |||
| 1179 | Ga0157372_10047887 | |||
| 1180 | Ga0157375_10000135 | |||
| 1181 | Ga0157375_10108044 | |||
| 1182 | Ga0163163_10065736 | |||
| 1183 | Ga0163163_10095849 | |||
| 1184 | Ga0157380_10000052 | |||
| 1185 | Ga0157380_10032855 | |||
| 1186 | Ga0157380_10100558 | |||
| 1187 | Ga0157380_10309385 | |||
| 1188 | Ga0157380_10320735 | |||
| 1189 | Ga0182008_10034200 | |||
| 1190 | Ga0157377_10000076 | |||
| 1191 | Ga0157379_10000060 | |||
| 1192 | Ga0157379_10098958 | |||
| 1193 | Ga0157379_10113953 | |||
| 1194 | Ga0157376_10000141 | |||
| 1195 | Ga0157376_10061915 | |||
| 1196 | Ga0157376_10232853 | |||
| 1197 | Ga0163161_10006630 | |||
| 1198 | Ga0163161_10018879 | |||
| 1199 | Ga0163161_10054737 | |||
| 1200 | Ga0163161_10192464 | |||
| 1201 | Ga0213872_10060315 | |||
| 1202 | Ga0213876_10032765 | |||
| 1203 | Ga0213875_10002544 | |||
| 1204 | Ga0209565_1000130 | |||
| 1205 | Ga0207666_1000005 | |||
| 1206 | Ga0209455_1002615 | |||
| 1207 | Ga0209673_1000106 | |||
| 1208 | Ga0209673_1019334 | |||
| 1209 | Ga0207673_1000002 | |||
| 1210 | Ga0209675_1000058 | |||
| 1211 | Ga0209025_1004721 | |||
| 1212 | Ga0209758_1000033 | |||
| 1213 | Ga0209051_1000059 | |||
| 1214 | Ga0209257_1000022 | |||
| 1215 | Ga0207697_10000011 | |||
| 1216 | Ga0207653_10023402 | |||
| 1217 | Ga0207682_10000051 | |||
| 1218 | Ga0207682_10000572 | |||
| 1219 | Ga0207682_10018113 | |||
| 1220 | Ga0207692_10103603 | |||
| 1221 | Ga0207692_10110724 | |||
| 1222 | Ga0207642_10000229 | |||
| 1223 | Ga0207642_10084277 | |||
| 1224 | Ga0207710_10090826 | |||
| 1225 | Ga0207688_10000001 | |||
| 1226 | Ga0207688_10008121 | |||
| 1227 | Ga0207680_10009743 | |||
| 1228 | Ga0207647_10012355 | |||
| 1229 | Ga0207647_10071943 | |||
| 1230 | Ga0207645_10000121 | |||
| 1231 | Ga0207645_10065556 | |||
| 1232 | Ga0207643_10000009 | |||
| 1233 | Ga0207643_10014436 | |||
| 1234 | Ga0207684_10024320 | |||
| 1235 | Ga0207654_10000271 | |||
| 1236 | Ga0207707_10000840 | |||
| 1237 | Ga0207707_10002707 | |||
| 1238 | Ga0207707_10008018 | |||
| 1239 | Ga0207695_10014787 | |||
| 1240 | Ga0207671_10030003 | |||
| 1241 | Ga0207693_10001099 | |||
| 1242 | Ga0207693_10011118 | |||
| 1243 | Ga0207693_10011491 | |||
| 1244 | Ga0207693_10028715 | |||
| 1245 | Ga0207663_10033490 | |||
| 1246 | Ga0207663_10096716 | |||
| 1247 | Ga0207663_10192185 | |||
| 1248 | Ga0207660_10000426 | |||
| 1249 | Ga0207660_10059281 | |||
| 1250 | Ga0207662_10000120 | |||
| 1251 | Ga0207662_10077363 | |||
| 1252 | Ga0207657_10002826 | |||
| 1253 | Ga0207657_10015306 | |||
| 1254 | Ga0207649_10000052 | |||
| 1255 | Ga0207652_10000508 | |||
| 1256 | Ga0207652_10001947 | |||
| 1257 | Ga0207681_10000035 | |||
| 1258 | Ga0207681_10007048 | |||
| 1259 | Ga0207681_10077900 | |||
| 1260 | Ga0207681_10252913 | |||
| 1261 | Ga0207694_10015924 | |||
| 1262 | Ga0207694_10248109 | |||
| 1263 | Ga0207650_10000843 | |||
| 1264 | Ga0207650_10009149 | |||
| 1265 | Ga0207650_10012334 | |||
| 1266 | Ga0207650_10021202 | |||
| 1267 | Ga0207659_10000027 | |||
| 1268 | Ga0207659_10020909 | |||
| 1269 | Ga0207659_10188571 | |||
| 1270 | Ga0207659_10474635 | |||
| 1271 | Ga0207687_10000231 | |||
| 1272 | Ga0207687_10190400 | |||
| 1273 | Ga0207687_10260149 | |||
| 1274 | Ga0207700_10020618 | |||
| 1275 | Ga0207700_10025902 | |||
| 1276 | Ga0207700_10278847 | |||
| 1277 | Ga0207700_10325538 | |||
| 1278 | Ga0207664_10139319 | |||
| 1279 | Ga0207664_10141841 | |||
| 1280 | Ga0207664_10440803 | |||
| 1281 | Ga0207644_10003468 | |||
| 1282 | Ga0207644_10221320 | |||
| 1283 | Ga0207690_10000056 | |||
| 1284 | Ga0207706_10000261 | |||
| 1285 | Ga0207706_10003407 | |||
| 1286 | Ga0207706_10024331 | |||
| 1287 | Ga0207706_10142727 | |||
| 1288 | Ga0207706_10342861 | |||
| 1289 | Ga0207686_10000171 | |||
| 1290 | Ga0207709_10000077 | |||
| 1291 | Ga0207709_10000087 | |||
| 1292 | Ga0207670_10000169 | |||
| 1293 | Ga0207670_10050322 | |||
| 1294 | Ga0207670_10065016 | |||
| 1295 | Ga0207670_10067928 | |||
| 1296 | Ga0207669_10003221 | |||
| 1297 | Ga0207669_10012052 | |||
| 1298 | Ga0207704_10000134 | |||
| 1299 | Ga0207704_10029498 | |||
| 1300 | Ga0207704_10059244 | |||
| 1301 | Ga0207704_10433507 | |||
| 1302 | Ga0207665_10003421 | |||
| 1303 | Ga0207665_10006302 | |||
| 1304 | Ga0207665_10089251 | |||
| 1305 | Ga0207665_10094086 | |||
| 1306 | Ga0207665_10122350 | |||
| 1307 | Ga0207691_10000106 | |||
| 1308 | Ga0207691_10005974 | |||
| 1309 | Ga0207691_10008316 | |||
| 1310 | Ga0207691_10044460 | |||
| 1311 | Ga0207691_10104009 | |||
| 1312 | Ga0207711_10002404 | |||
| 1313 | Ga0207711_10025906 | |||
| 1314 | Ga0207711_10098766 | |||
| 1315 | Ga0207689_10000031 | |||
| 1316 | Ga0207689_10018698 | |||
| 1317 | Ga0207661_10000219 | |||
| 1318 | Ga0207679_10000057 | |||
| 1319 | Ga0207679_10066812 | |||
| 1320 | Ga0207667_10012319 | |||
| 1321 | Ga0207667_10046913 | |||
| 1322 | Ga0207651_10000136 | |||
| 1323 | Ga0207651_10022623 | |||
| 1324 | Ga0207651_10077383 | |||
| 1325 | Ga0207651_10317111 | |||
| 1326 | Ga0207712_10000176 | |||
| 1327 | Ga0207712_10022814 | |||
| 1328 | Ga0207712_10069108 | |||
| 1329 | Ga0207668_10000191 | |||
| 1330 | Ga0207668_10081494 | |||
| 1331 | Ga0207668_10298009 | |||
| 1332 | Ga0207640_10000126 | |||
| 1333 | Ga0207640_10031868 | |||
| 1334 | Ga0207640_10302018 | |||
| 1335 | Ga0207658_10001331 | |||
| 1336 | Ga0207658_10027609 | |||
| 1337 | Ga0207658_10322764 | |||
| 1338 | Ga0207677_10043870 | |||
| 1339 | Ga0207703_10000662 | |||
| 1340 | Ga0207703_10036692 | |||
| 1341 | Ga0207703_10041853 | |||
| 1342 | Ga0207639_10004863 | |||
| 1343 | Ga0207639_10078616 | |||
| 1344 | Ga0207639_10271977 | |||
| 1345 | Ga0207678_10000137 | |||
| 1346 | Ga0207678_10105288 | |||
| 1347 | Ga0207708_10000250 | |||
| 1348 | Ga0207708_10002312 | |||
| 1349 | Ga0207702_10001067 | |||
| 1350 | Ga0207702_10176523 | |||
| 1351 | Ga0207641_10011323 | |||
| 1352 | Ga0207648_10000125 | |||
| 1353 | Ga0207648_10003783 | |||
| 1354 | Ga0207648_10004705 | |||
| 1355 | Ga0207648_10032400 | |||
| 1356 | Ga0207648_10048341 | |||
| 1357 | Ga0207676_10000891 | |||
| 1358 | Ga0207676_10040171 | |||
| 1359 | Ga0207676_10088398 | |||
| 1360 | Ga0207674_10000095 | |||
| 1361 | Ga0207674_10164549 | |||
| 1362 | Ga0207675_100000140 | |||
| 1363 | Ga0207675_100001910 | |||
| 1364 | Ga0207675_100015760 | |||
| 1365 | Ga0207675_100097245 | |||
| 1366 | Ga0207683_10000178 | |||
| 1367 | Ga0207683_10005574 | |||
| 1368 | Ga0207683_10053138 | |||
| 1369 | Ga0207683_10114796 | |||
| 1370 | Ga0207698_10002073 | |||
| 1371 | Ga0210002_1001008 | |||
| 1372 | Ga0209282_1000223 | |||
| 1373 | Ga0209588_1010538 | |||
| 1374 | Ga0209998_10005113 | |||
| 1375 | Ga0209813_10024173 | |||
| 1376 | Ga0209974_10006256 | |||
| 1377 | Ga0207428_10000037 | |||
| 1378 | Ga0207428_10181953 | |||
| 1379 | Ga0268266_10284605 | |||
| 1380 | Ga0268265_10000774 | |||
| 1381 | Ga0268265_10007031 | |||
| 1382 | Ga0268265_10068115 | |||
| 1383 | Ga0268264_10000467 | |||
| 1384 | Ga0268264_10031167 | |||
| 1385 | Ga0265337_1004015 | |||
| 1386 | Ga0307515_10000030 | |||
| 1387 | Ga0307515_10038535 | |||
| 1388 | Ga0265330_10055199 | |||
| 1389 | Ga0265320_10067999 | |||
| 1390 | Ga0265325_10043538 | |||
| 1391 | Ga0265325_10109036 | |||
| 1392 | Ga0265340_10011319 | |||
| 1393 | Ga0265339_10022924 | |||
| 1394 | Ga0265339_10023205 | |||
| 1395 | Ga0265316_10047692 | |||
| 1396 | Ga0265316_10084088 | |||
| 1397 | Ga0307513_10237018 | |||
| 1398 | Ga0265313_10003826 | |||
| 1399 | Ga0265313_10047475 | |||
| 1400 | Ga0265342_10043020 | |||
| 1401 | Ga0307516_10341968 | |||
| 1402 | Ga0307412_10154558 | |||
| 1403 | Ga0373930_0031405 | |||
| 1404 | Ga0373959_0031979 | |||
| 1405 | Ga0373926_0066917 | |||
| 1406 | Ga0373929_0001926 | |||
| 1407 | Ga0373934_0071197 | |||
| 1408 | Ga0373934_0087798 | |||
| 1409 | Ga0373940_0043834 | |||
| 1410 | Ga0373949_0004404 | |||
| 1411 | Ga0373951_0002829 | |||
| 1412 | Ga0373952_0001091 | |||
| 1413 | Ga0373923_0038638 | |||
| 1414 | Ga0373932_0008017 | |||
| 1415 | Ga0373939_0000421 | |||
| 1416 | Ga0373945_0005477 | |||
| 1417 | Ga0373945_0052308 | |||
| 1418 | Ga0373954_0008973 | |||
| 1419 | Ga0373960_0002654 | |||
| 1420 | Ga0373943_0000463 | |||
| 1421 | Ga0373943_0053316 | |||
| 1422 | Ga0373946_0023416 | |||
| 1423 | Ga0373946_0033513 | |||
| 1424 | Ga0373955_0001204 | |||
| 1425 | Ga0373955_0006420 | |||
| 1426 | Ga0373955_0022634 | |||
| 1427 | Ga0373942_0003886 | |||
| 1428 | Ga0373961_0019721 | |||
| 1429 | Ga0373962_0006310 | |||
| 1430 | Ga0373924_0062763 | |||
| 1431 | Ga0373931_0000209 | |||
| 1432 | Ga0373931_0001680 | |||
| 1433 | Ga0373931_0030198 | |||
| 1434 | Ga0373935_0000208 | |||
| 1435 | Ga0373927_0030660 | |||
| 1436 | Ga0373927_0111502 | |||
| 1437 | Ga0373933_0001412 | |||
| 1438 | Ga0373933_0003550 | |||
| 1439 | Ga0373933_0212194 | |||
| 1440 | Ga0373947_0030004 | |||
| 1441 | Ga0373947_0107945 | |||
| 1442 | Ga0373947_0134403 | |||
| 1443 | Ga0373937_0000031 | |||
| 1444 | Ga0373937_0001111 | |||
| 1445 | Ga0373937_0001925 | |||
| 1446 | Ga0373937_0002996 | |||
| 1447 | Ga0373937_0006839 | |||
| 1448 | Ga0373937_0032858 | |||
| 1449 | Ga0373937_0438072 | |||
| 1450 | Ga0373925_0000063 | |||
| 1451 | Ga0373925_0026368 | |||
| 1452 | Ga0373925_0073528 | |||
| 1453 | Ga0373925_0095798 | |||
| 1454 | Ga0373925_0335415 | |||
| 1455 | Ga0395900_0110770 | |||
| 1456 | Ga0395898_0086242 | |||
| 1457 | Ga0395905_0003404 | |||
| 1458 | Ga0395905_0068502 | |||
| 1459 | Ga0395905_0077697 | |||
| 1460 | Ga0395901_0014335 | |||
| 1461 | Ga0400486_28014 | |||
| 1462 | Ga0436365_0085457 | |||
| 1463 | Ga0436365_0248031 | |||
| 1464 | Ga0436365_1651064 | |||
| 1465 | Ga0436361_0365487 | |||
| 1466 | Ga0436363_0767643 | |||
| 1467 | Ga0436363_1104439 | |||
| 1468 | Ga0466972_0011884 | |||
| 1469 | Ga0466961_0160900 | |||
| 1470 | Ga0451576_0000694 | |||
| 1471 | Ga0495592_0000072 | |||
| 1472 | Ga0495592_0029714 | |||
| 1473 | Ga0495592_0107465 | |||
| 1474 | Ga0495592_0165365 | |||
| 1475 | Ga0495590_0042085 | |||
| 1476 | Ga0495591_004866 | |||
| 1477 | Ga0495629_0024763 | |||
| 1478 | Ga0495629_0077142 | |||
| 1479 | Ga0495629_0279651 | |||
| 1480 | Ga0495638_0044798 | |||
| 1481 | Ga0495638_0059669 | |||
| 1482 | Ga0495641_0128111 | |||
| 1483 | Ga0495651_0005951 | |||
| 1484 | Ga0495651_0038801 | |||
| 1485 | Ga0495653_0000020 | |||
| 1486 | Ga0495653_0136608 | |||
| 1487 | Ga0495580_0005811 | |||
| 1488 | Ga0495580_0254547 | |||
| 1489 | Ga0495582_0133708 | |||
| 1490 | Ga0495605_0020042 | |||
| 1491 | Ga0495662_0003193 | |||
| 1492 | Ga0495662_0083589 | |||
| 1493 | Ga0495664_0000006 | |||
| 1494 | Ga0495664_0073411 | |||
| 1495 | Ga0495584_0012887 | |||
| 1496 | Ga0495584_0033883 | |||
| 1497 | Ga0495584_0036680 | |||
| 1498 | Ga0495584_0057658 | |||
| 1499 | Ga0495596_0002466 | |||
| 1500 | Ga0495608_0000002 | |||
| 1501 | Ga0495616_0059163 | |||
| 1502 | Ga0495618_0000017 | |||
| 1503 | Ga0495618_0019326 | |||
| 1504 | Ga0495628_0000004 | |||
| 1505 | Ga0495628_0005223 | |||
| 1506 | Ga0495628_0005226 | |||
| 1507 | Ga0495628_0005631 | |||
| 1508 | Ga0495628_0125278 | |||
| 1509 | Ga0495630_0000832 | |||
| 1510 | Ga0495630_0171870 | |||
| 1511 | Ga0495631_0019159 | |||
| 1512 | Ga0495648_0006327 | |||
| 1513 | Ga0495652_0000007 | |||
| 1514 | Ga0495652_0029416 | |||
| 1515 | Ga0495652_0050815 | |||
| 1516 | Ga0495652_0053314 | |||
| 1517 | Ga0495654_0001084 | |||
| 1518 | Ga0495665_0008869 | |||
| 1519 | Ga0495640_0000004 | |||
| 1520 | Ga0495640_0026084 | |||
| 1521 | Ga0495640_0066732 | |||
| 1522 | Ga0495640_0083344 | |||
| 1523 | Ga0495640_0111475 | |||
| 1524 | Ga0495587_0000002 | |||
| 1525 | Ga0495598_0001493 | |||
| 1526 | Ga0495598_0008909 | |||
| 1527 | Ga0495645_0000008 | |||
| 1528 | Ga0495645_0000124 | |||
| 1529 | Ga0495645_0000848 | |||
| 1530 | Ga0495622_0079263 | |||
| 1531 | Ga0495667_0000010 | |||
| 1532 | Ga0495667_0001817 | |||
| 1533 | Ga0495667_0102670 | |||
| 1534 | Ga0495656_0125314 | |||
| 1535 | Ga0495668_0041709 | |||
| 1536 | Ga0495634_0000603 | |||
| 1537 | Ga0495634_0117222 | |||
| 1538 | Ga0495635_0000004 | |||
| 1539 | Ga0495635_0004141 | |||
| 1540 | Ga0495659_0079113 | |||
| 1541 | Ga0495661_0018260 | |||
| 1542 | Ga0495588_0132881 | |||
| 1543 | Ga0495657_0000051 | |||
| 1544 | Ga0495657_0052535 | |||
| 1545 | Ga0495657_0097334 | |||
| 1546 | Ga0495599_0000003 | |||
| 1547 | Ga0495599_0127788 | |||
| 1548 | Ga0495623_0000009 | |||
| 1549 | Ga0495623_0010252 | |||
| 1550 | Ga0495623_0059406 | |||
| 1551 | Ga0495646_0000001 | |||
| 1552 | Ga0495646_0003279 | |||
| 1553 | Ga0495646_0033837 | |||
| 1554 | Ga0495646_0144783 | |||
| 1555 | Ga0495613_0029535 | |||
| 1556 | Ga0495613_0029978 | |||
| 1557 | Ga0495613_0189867 | |||
| 1558 | Ga0495624_0001622 | |||
| 1559 | Ga0495624_0020968 | |||
| 1560 | Ga0495589_0020066 | |||
| 1561 | Ga0495600_0000008 | |||
| 1562 | Ga0495600_0029311 | |||
| 1563 | Ga0495604_0000003 | |||
| 1564 | Ga0495604_0004786 | |||
| 1565 | Ga0495604_0014838 | |||
| 1566 | Ga0495604_0032541 | |||
| 1567 | Ga0495604_0041343 | |||
| 1568 | Ga0495636_0000443 | |||
| 1569 | Ga0495674_0000021 | |||
| 1570 | Ga0495674_0006553 | |||
| 1571 | Ga0495674_0020868 | |||
| 1572 | Ga0495676_0084151 | |||
| 1573 | Ga0495680_0000505 | |||
| 1574 | Ga0495680_0005562 | |||
| 1575 | Ga0495680_0006777 | |||
| 1576 | Ga0495680_0027535 | |||
| 1577 | Ga0495680_0046543 | |||
| 1578 | Ga0495675_0000145 | |||
| 1579 | Ga0495675_0034908 | |||
| 1580 | Ga0495679_001373 | |||
| 1581 | Ga0495673_0003704 | |||
| 1582 | Ga0495684_0000050 | |||
| 1583 | Ga0495684_0023901 | |||
| 1584 | Ga0495593_0000394 | |||
| 1585 | Ga0495602_0000012 | |||
| 1586 | Ga0495602_0000317 | |||
| 1587 | Ga0495602_0006361 | |||
| 1588 | Ga0495602_0197747 | |||
| 1589 | Ga0495602_0209196 | |||
| 1590 | Ga0495614_0033632 | |||
| 1591 | Ga0496100_0000713 | |||
| 1592 | Ga0496100_0021515 | |||
| 1593 | Ga0496100_0039028 | |||
| 1594 | Ga0496100_0105555 | |||
| 1595 | Ga0496101_0000151 | |||
| 1596 | Ga0496101_0053207 | |||
| 1597 | Ga0496101_0068340 | |||
| 1598 | Ga0496101_0092486 | |||
| 1599 | Ga0496101_0354099 | |||
| 1600 | Ga0496102_0001766 | |||
| 1601 | Ga0496102_0014247 | |||
| 1602 | Ga0496102_0030592 | |||
| 1603 | Ga0496102_0033326 | |||
| 1604 | Ga0496102_0063292 | |||
| 1605 | Ga0496102_0109511 | |||
| 1606 | Ga0496103_0014888 | |||
| 1607 | Ga0496103_0037448 | |||
| 1608 | Ga0496104_0001328 | |||
| 1609 | Ga0496104_0010143 | |||
| 1610 | Ga0496104_0011872 | |||
| 1611 | Ga0496104_0045144 | |||
| 1612 | Ga0496104_0327072 | |||
| 1613 | Ga0496105_0025422 | |||
| 1614 | Ga0496105_0048560 | |||
| 1615 | Ga0496105_0087730 | |||
| 1616 | Ga0496105_0124479 | |||
| 1617 | Ga0496105_0189003 | |||
| 1618 | Ga0496105_0216401 | |||
| 1619 | Ga0496106_0000347 | |||
| 1620 | Ga0496106_0059754 | |||
| 1621 | Ga0496106_0257297 | |||
| 1622 | Ga0496106_0258989 | |||
| 1623 | Ga0496107_0015881 | |||
| 1624 | Ga0496107_0030383 | |||
| 1625 | Ga0496107_0038857 | |||
| 1626 | Ga0496107_0042490 | |||
| 1627 | Ga0496107_0051416 | |||
| 1628 | Ga0496108_0024520 | |||
| 1629 | Ga0496108_0026329 | |||
| 1630 | Ga0496108_0038656 | |||
| 1631 | Ga0496109_0000186 | |||
| 1632 | Ga0496109_0001505 | |||
| 1633 | Ga0496109_0195403 | |||
| 1634 | Ga0496109_0592142 | |||
| 1635 | Ga0496110_0016390 | |||
| 1636 | Ga0496110_0029751 | |||
| 1637 | Ga0496110_0109535 | |||
| 1638 | Ga0496111_0001144 | |||
| 1639 | Ga0496111_0012872 | |||
| 1640 | Ga0496112_0000562 | |||
| 1641 | Ga0496112_0016331 | |||
| 1642 | Ga0496112_0183743 | |||
| 1643 | Ga0496112_0352226 | |||
| 1644 | Ga0496113_0003414 | |||
| 1645 | Ga0496113_0014517 | |||
| 1646 | Ga0496113_0016184 | |||
| 1647 | Ga0496114_0028628 | |||
| 1648 | Ga0496114_0039543 | |||
| 1649 | Ga0496114_0110317 | |||
| 1650 | Ga0496114_0264075 | |||
| 1651 | Ga0496114_0362821 | |||
| 1652 | Ga0496115_0001282 | |||
| 1653 | Ga0496115_0044847 | |||
| 1654 | Ga0496115_0053583 | |||
| 1655 | Ga0496115_0108426 | |||
| 1656 | Ga0496115_0217034 | |||
| 1657 | Ga0496117_0002111 | |||
| 1658 | Ga0496118_0000120 | |||
| 1659 | Ga0496126_0022883 | |||
| 1660 | Ga0501031_0104705 | |||
| 1661 | Ga0501032_0053314 | |||
| 1662 | Ga0501033_0109639 | |||
| 1663 | Ga0501033_0271081 | |||
| 1664 | Ga0501034_0000247 | |||
| 1665 | Ga0501034_0001290 | |||
| 1666 | Ga0501034_0025699 | |||
| 1667 | Ga0501034_0032911 | |||
| 1668 | Ga0501036_0014726 | |||
| 1669 | Ga0501036_0054523 | |||
| 1670 | Ga0501037_0007246 | |||
| 1671 | Ga0501038_0005386 | |||
| 1672 | Ga0501038_0085276 | |||
| 1673 | Ga0501038_0183617 | |||
| 1674 | Ga0501038_0206722 | |||
| 1675 | Ga0501039_0011082 | |||
| 1676 | Ga0501042_0038139 | |||
| 1677 | Ga0501043_0057508 | |||
| 1678 | Ga0501043_0107739 | |||
| 1679 | Ga0501046_0017800 | |||
| 1680 | Ga0501046_0064490 | |||
| 1681 | Ga0501047_0037239 | |||
| 1682 | Ga0501068_0030261 | |||
| 1683 | Ga0501069_0074346 | |||
| 1684 | Ga0501070_0050130 | |||
| 1685 | Ga0501070_0056658 | |||
| 1686 | Ga0501072_0005240 | |||
| 1687 | Ga0501072_0021992 | |||
| 1688 | Ga0501072_0107559 | |||
| 1689 | Ga0501073_0013722 | |||
| 1690 | Ga0501073_0023679 | |||
| 1691 | Ga0501073_0031954 | |||
| 1692 | Ga0501073_0069280 | |||
| 1693 | Ga0501074_0121149 | |||
| 1694 | Ga0501074_0159178 | |||
| 1695 | Ga0501075_0095335 | |||
| 1696 | Ga0501076_0279329 | |||
| 1697 | Ga0501077_0020002 | |||
| 1698 | Ga0501077_0041031 | |||
| 1699 | Ga0501077_0239293 | |||
| 1700 | Ga0501079_0080385 | |||
| 1701 | Ga0501080_0026529 | |||
| 1702 | Ga0501080_0037101 | |||
| 1703 | Ga0501080_0046053 | |||
| 1704 | Ga0501081_0052073 | |||
| 1705 | Ga0501083_0049717 | |||
| 1706 | Ga0501083_0063708 | |||
| 1707 | Ga0501083_0090317 | |||
| 1708 | Ga0501083_0117859 | |||
| 1709 | Ga0501282_000063 | |||
| 1710 | Ga0501035_0005135 | |||
| 1711 | Ga0501035_0047106 | |||
| 1712 | Ga0501035_0047404 | |||
| 1713 | Ga0501044_0000236 | |||
| 1714 | Ga0501044_0021136 | |||
| 1715 | Ga0501044_0037261 | |||
| 1716 | Ga0501044_0144342 | |||
| 1717 | Ga0501045_0243732 | |||
| 1718 | nmdc:mga03683_11712_c1 | |||
| 1719 | nmdc:mga0yw44_13141_c1 | |||
| 1720 | nmdc:mga0yw44_24616_c1 | |||
| 1721 | nmdc:mga0yw44_7062_c1 | |||
| 1722 | nmdc:mga0yw44_81974_c1 | |||
| 1723 | nmdc:mga06z11_41552_c1 | |||
| 1724 | nmdc:mga04h51_13110_c1 | |||
| 1725 | nmdc:mga07m45_12533_c1 | |||
| 1726 | nmdc:mga07m45_62493_c1 | |||
| 1727 | nmdc:mga05p37_117198_c1 | |||
| 1728 | nmdc:mga05p37_123218_c1 | |||
| 1729 | nmdc:mga05p37_123812_c1 | |||
| 1730 | nmdc:mga05p37_257648_c1 | |||
| 1731 | nmdc:mga05p37_392360_c1 | |||
| 1732 | nmdc:mga05p37_588729_c1 | |||
| 1733 | nmdc:mga09592_244969_c1 | |||
| 1734 | nmdc:mga09592_24564_c1 | |||
| 1735 | nmdc:mga0qj67_100964_c1 | |||
| 1736 | nmdc:mga0qj67_142899_c1 | |||
| 1737 | nmdc:mga0qj67_23674_c1 | |||
| 1738 | nmdc:mga0qj67_2772_c1 | |||
| 1739 | nmdc:mga06r32_104968_c1 | |||
| 1740 | nmdc:mga06r32_115744_c1 | |||
| 1741 | nmdc:mga06r32_1821_c1 | |||
| 1742 | nmdc:mga06r32_53156_c1 | |||
| 1743 | nmdc:mga06r32_5803_c1 | |||
| 1744 | nmdc:mga06r32_62744_c1 | |||
| 1745 | nmdc:mga08y16_165700_c1 | |||
| 1746 | nmdc:mga08y16_311_c1 | |||
| 1747 | nmdc:mga08y16_31237_c1 | |||
| 1748 | nmdc:mga08y16_66768_c1 | |||
| 1749 | nmdc:mga0n895_176753_c1 | |||
| 1750 | nmdc:mga0n895_2121_c1 | |||
| 1751 | nmdc:mga0n895_62_c1 | |||
| 1752 | nmdc:mga0n895_94499_c1 | |||
| 1753 | nmdc:mga0rr50_7331_c2 | |||
| 1754 | nmdc:mga0rr50_99742_c1 | |||
| 1755 | nmdc:mga0a205_11620_c1 | |||
| 1756 | nmdc:mga0a205_211887_c1 | |||
| 1757 | nmdc:mga0a205_2311_c1 | |||
| 1758 | Ga0495601_0000004 | |||
| 1759 | Ga0495601_0000109 | |||
| 1760 | Ga0495601_0001170 | |||
| 1761 | Ga0495601_0016517 | |||
| 1762 | Ga0495612_0000013 | |||
| 1763 | Ga0495612_0000604 | |||
| 1764 | Ga0495612_0000953 | |||
| 1765 | Ga0495612_0040040 | |||
| 1766 | Ga0495655_0021025 | |||
| 1767 | Ga0495595_0000034 | |||
| 1768 | Ga0495595_0000550 | |||
| 1769 | Ga0495595_0002157 | |||
| 1770 | Ga0495595_0121765 | |||
| 1771 | Ga0495619_0000005 | |||
| 1772 | Ga0495619_0000371 | |||
| 1773 | Ga0495619_0002507 | |||
| 1774 | Ga0495619_0009960 | |||
| 1775 | Ga0495619_0018594 | |||
| 1776 | Ga0495619_0169141 | |||
| 1777 | Ga0500578_0013831 | |||
| 1778 | Ga0500643_000631 | |||
| 1779 | Ga0500566_0118922 | |||
| 1780 | Ga0500641_0000421 | |||
| 1781 | Ga0500556_0001437 | |||
| 1782 | Ga0500556_0004310 | |||
| 1783 | Ga0500562_000614 | |||
| 1784 | Ga0500595_002886 | |||
| 1785 | Ga0500642_0050000 | |||
| 1786 | Ga0500658_0017979 | |||
| 1787 | Ga0500559_0000157 | |||
| 1788 | Ga0500616_0022721 | |||
| 1789 | Ga0500622_0148607 | |||
| 1790 | Ga0500645_000448 | |||
| 1791 | Ga0500645_004830 | |||
| 1792 | Ga0501082_0000025 | |||
| 1793 | Ga0501082_0341783 | |||
| 1794 | Ga0530510_0216771 | |||
| 1795 | 2643756889 | |||
| 1796 | 2837681711 |
Family Sequences
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1zbm-assembly1.cif.gz_A | x-ray crystal structure of protein af1704 from archaeoglobus fulgidus. northeast structural genomics consortium target gr62a. | 0.6351 | 18 | 319 |
| 1zbm-assembly1.cif.gz_A | x-ray crystal structure of protein af1704 from archaeoglobus fulgidus. northeast structural genomics consortium target gr62a. | 0.6214 | 18 | 319 |
| 2nxo-assembly2.cif.gz_C | crystal structure of protein sco4506 from streptomyces coelicolor, pfam duf178 | 0.6112 | 19 | 325 |
| 2czl-assembly1.cif.gz_A | crystal structure of mqnd (ttha1568), a menaquinone biosynthetic enzyme from thermus thermophilus hb8 (cys11 modified with beta-mercaptoethanol) | 0.6073 | 19 | 331 |
| 2czl-assembly1.cif.gz_A | crystal structure of mqnd (ttha1568), a menaquinone biosynthetic enzyme from thermus thermophilus hb8 (cys11 modified with beta-mercaptoethanol) | 0.6026 | 19 | 331 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3ksxA02 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.7819 | 95 | 195 | 3.40.190.10 |
| af_Q2G1L7_145_252_3.40.190.10 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.7366 | 100 | 196 | 3.40.190.10 |
| 3uifA02 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.6971 | 100 | 194 | 3.40.190.10 |
| 6nioA01 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.6739 | 18 | 69 | 3.40.190.10 |
| 2x7qA01 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.6739 | 18 | 91 | 3.40.190.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A537JJ33-F1-model_v4 | ABC transporter substrate-binding protein | 0.9836 | 14 | 293 |
|
| AF-A0A1B2R3N1-F1-model_v4 | 4,5-dihydroxyphthalate decarboxylase | 0.9823 | 15 | 341 |
|
| AF-A0A1F4E5G7-F1-model_v4 | 4,5-dihydroxyphthalate decarboxylase | 0.9812 | 15 | 339 |
|
| AF-A0A286M9N7-F1-model_v4 | 4,5-dihydroxyphthalate decarboxylase | 0.9811 | 30 | 316 |
|
| AF-A0A3D0RHC1-F1-model_v4 | 4,5-dihydroxyphthalate decarboxylase | 0.9801 | 16 | 264 |
|