F485096
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 899 | 462 | 899 | 88 |
Family's Representative Sequence
| Representative Sequence | 3300005842|Ga0068858_101435914|Ga0068858_1014359142 |
| Length | 107 |
| Sequence | MAHKKGQGSSRNGRDSNPQYLGVKRYGGQTVTGGSIIVRQRGTRFFPGLNVGQGKDDTLFAKIGGVVKFQDRGRHGKYVHILPAEAAAASVAPDASTPSATASESAS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 2 | 2209111006 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 | Metagenome | Rhizosphere |
| 3 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 4 | 3300003347 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM | Metagenome | Rhizosphere |
| 5 | 3300003349 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM | Metagenome | Rhizosphere |
| 6 | 3300003371 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM | Metagenome | Rhizosphere |
| 7 | 3300003379 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM | Metagenome | Rhizosphere |
| 8 | 3300003383 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM | Metagenome | Rhizosphere |
| 9 | 3300003392 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM | Metagenome | Rhizosphere |
| 10 | 3300003397 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM | Metagenome | Rhizosphere |
| 11 | 3300003398 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM | Metagenome | Rhizosphere |
| 12 | 3300003405 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM | Metagenome | Rhizosphere |
| 13 | 3300003502 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM | Metagenome | Rhizosphere |
| 14 | 3300003503 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM | Metagenome | Rhizosphere |
| 15 | 3300003504 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM | Metagenome | Rhizosphere |
| 16 | 3300004801 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 17 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 18 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 19 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 20 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 21 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 24 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 25 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 28 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 30 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 31 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 32 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 34 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 35 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 36 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 45 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 48 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 49 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 50 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 53 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 54 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 59 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 60 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 61 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 62 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 63 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 64 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 66 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 67 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 68 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 69 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 71 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 72 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 76 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 77 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 78 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 79 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 80 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 81 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 82 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 83 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 84 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 85 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 86 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 87 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 88 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 89 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 90 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 91 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 92 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 93 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 94 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 95 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 96 | 3300006194 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 | Metagenome | Rhizosphere |
| 97 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 99 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 100 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 101 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 102 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 103 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 104 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 105 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 106 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 107 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 109 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 110 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 118 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 119 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 120 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 121 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 134 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 135 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 136 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300027252 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300027360 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300027364 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300027378 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300027395 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300027424 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300027462 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300027471 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300027526 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300027552 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300027614 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300027617 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 214 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 218 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 219 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 220 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 221 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 222 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 223 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 224 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 225 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 226 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 227 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 228 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 229 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 230 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 231 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 232 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 233 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 234 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 235 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 236 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 237 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 238 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 239 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 240 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 241 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 242 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 243 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 244 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 245 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 246 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 247 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 248 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 249 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 250 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 251 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 252 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 253 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 254 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 255 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 256 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 257 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 258 | 3300038996 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 | Metagenome | Rhizosphere |
| 259 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 260 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 261 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 262 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 263 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 264 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 265 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 266 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 267 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 268 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 269 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 270 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 271 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 272 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 273 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 274 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 275 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 276 | 3300042009 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 | Metagenome | Rhizosphere |
| 277 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 278 | 3300042011 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 | Metagenome | Rhizosphere |
| 279 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 280 | 3300042013 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 | Metagenome | Rhizosphere |
| 281 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 282 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 283 | 3300042118 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_082316_2156 | Metagenome | Rhizosphere |
| 284 | 3300042133 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 | Metagenome | Rhizosphere |
| 285 | 3300042142 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 | Metagenome | Rhizosphere |
| 286 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 287 | 3300042185 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 | Metagenome | Rhizosphere |
| 288 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 289 | 3300042437 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 | Metagenome | Rhizosphere |
| 290 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 291 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 292 | 3300042532 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 | Metagenome | Rhizosphere |
| 293 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 294 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 295 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 296 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 297 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 298 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 299 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 300 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 301 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 302 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 303 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 336 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 337 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 338 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 339 | 3300049128 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 340 | 3300049129 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 341 | 3300049160 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 342 | 3300049513 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control | Metagenome | Rhizosphere |
| 343 | 3300049514 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought | Metagenome | Rhizosphere |
| 344 | 3300049515 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought | Metagenome | Rhizosphere |
| 345 | 3300049516 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_B_5_drought | Metagenome | Rhizosphere |
| 346 | 3300049517 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control | Metagenome | Rhizosphere |
| 347 | 3300049518 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control | Metagenome | Rhizosphere |
| 348 | 3300049519 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought | Metagenome | Rhizosphere |
| 349 | 3300049520 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought | Metagenome | Rhizosphere |
| 350 | 3300049521 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought | Metagenome | Rhizosphere |
| 351 | 3300049522 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control | Metagenome | Rhizosphere |
| 352 | 3300049523 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control | Metagenome | Rhizosphere |
| 353 | 3300049524 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H21_B_7_control | Metagenome | Rhizosphere |
| 354 | 3300049526 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_B_7_control | Metagenome | Rhizosphere |
| 355 | 3300049527 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 356 | 3300049528 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 357 | 3300049533 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 358 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 359 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 360 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 361 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 362 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 363 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 364 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 365 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 366 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 367 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 368 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 369 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 370 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 371 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 372 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 373 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 374 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 375 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 376 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 377 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 378 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 379 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 380 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 381 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 382 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 383 | 3300049649 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought | Metagenome | Rhizosphere |
| 384 | 3300049650 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought | Metagenome | Rhizosphere |
| 385 | 3300049651 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought | Metagenome | Rhizosphere |
| 386 | 3300049652 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought | Metagenome | Rhizosphere |
| 387 | 3300049653 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control | Metagenome | Rhizosphere |
| 388 | 3300049655 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_B_0_drought | Metagenome | Rhizosphere |
| 389 | 3300049659 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control | Metagenome | Rhizosphere |
| 390 | 3300049660 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control | Metagenome | Rhizosphere |
| 391 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 392 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 393 | 3300049664 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought | Metagenome | Rhizosphere |
| 394 | 3300049665 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought | Metagenome | Rhizosphere |
| 395 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 396 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 397 | 3300049670 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought | Metagenome | Rhizosphere |
| 398 | 3300049672 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought | Metagenome | Rhizosphere |
| 399 | 3300049674 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought | Metagenome | Rhizosphere |
| 400 | 3300049675 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control | Metagenome | Rhizosphere |
| 401 | 3300049677 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control | Metagenome | Rhizosphere |
| 402 | 3300049678 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought | Metagenome | Rhizosphere |
| 403 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 404 | 3300049681 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought | Metagenome | Rhizosphere |
| 405 | 3300049683 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control | Metagenome | Rhizosphere |
| 406 | 3300049684 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_B_3_control | Metagenome | Rhizosphere |
| 407 | 3300049685 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_B_3_control | Metagenome | Rhizosphere |
| 408 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 409 | 3300049688 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought | Metagenome | Rhizosphere |
| 410 | 3300049689 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_A_4_drought | Metagenome | Rhizosphere |
| 411 | 3300049690 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought | Metagenome | Rhizosphere |
| 412 | 3300049703 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control | Metagenome | Rhizosphere |
| 413 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 414 | 3300049706 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control | Metagenome | Rhizosphere |
| 415 | 3300049708 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control | Metagenome | Rhizosphere |
| 416 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 417 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 418 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 419 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 420 | 3300049757 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_B_2_control | Metagenome | Rhizosphere |
| 421 | 3300049761 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control | Metagenome | Rhizosphere |
| 422 | 3300049762 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control | Metagenome | Rhizosphere |
| 423 | 3300049763 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control | Metagenome | Rhizosphere |
| 424 | 3300049766 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought | Metagenome | Rhizosphere |
| 425 | 3300049767 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought | Metagenome | Rhizosphere |
| 426 | 3300049768 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought | Metagenome | Rhizosphere |
| 427 | 3300049769 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought | Metagenome | Rhizosphere |
| 428 | 3300049770 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control | Metagenome | Rhizosphere |
| 429 | 3300049771 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_B_4_control | Metagenome | Rhizosphere |
| 430 | 3300049772 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_B_4_control | Metagenome | Rhizosphere |
| 431 | 3300049773 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_B_4_control | Metagenome | Rhizosphere |
| 432 | 3300049774 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_A_5_drought | Metagenome | Rhizosphere |
| 433 | 3300049775 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought | Metagenome | Rhizosphere |
| 434 | 3300049776 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought | Metagenome | Rhizosphere |
| 435 | 3300049777 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control | Metagenome | Rhizosphere |
| 436 | 3300049778 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control | Metagenome | Rhizosphere |
| 437 | 3300049779 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought | Metagenome | Rhizosphere |
| 438 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 439 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 440 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 441 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 442 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 443 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 444 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 445 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 446 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 447 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 448 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 449 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 450 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 451 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 452 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 453 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 454 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 455 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 456 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 457 | 3300059426 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 458 | 3300059491 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 459 | 3300059647 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 460 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 461 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 462 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.55 |
| Metatranscriptomes | 1.45 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 0.67 |
| Rhizosphere | 98.55 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.78 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL2b_contig_1087855 | 2162886007 | Bacteria | 1484 |
| 2 | 2214806902 | 2209111006 | Unclassified | 694 |
| 3 | JGI24742J22300_10077764 | 3300002244 | Bacteria | 625 |
| 4 | JGI26128J50194_1005255 | 3300003347 | Bacteria | 851 |
| 5 | JGI26129J50193_1011093 | 3300003349 | Bacteria | 658 |
| 6 | JGI26145J50221_1000071 | 3300003371 | Bacteria | 7664 |
| 7 | JGI26142J50222_102611 | 3300003379 | Bacteria | 529 |
| 8 | JGI26140J50224_101891 | 3300003383 | Bacteria | 752 |
| 9 | JGI26134J50242_101155 | 3300003392 | Bacteria | 862 |
| 10 | JGI26133J50247_102041 | 3300003397 | Bacteria | 656 |
| 11 | JGI26130J50248_102899 | 3300003398 | Bacteria | 529 |
| 12 | JGI26132J50249_103969 | 3300003405 | Bacteria | 546 |
| 13 | JGI26143J51219_1006949 | 3300003502 | Bacteria | 585 |
| 14 | JGI26141J51220_1002671 | 3300003503 | Bacteria | 1089 |
| 15 | JGI26138J51218_102793 | 3300003504 | Bacteria | 729 |
| 16 | Ga0058860_11408664 | 3300004801 | Bacteria | 600 |
| 17 | Ga0058860_11878411 | 3300004801 | Unclassified | 513 |
| 18 | Ga0065704_10005524 | 3300005289 | Bacteria | 3904 |
| 19 | Ga0065704_10287312 | 3300005289 | Bacteria | 910 |
| 20 | Ga0065712_10202387 | 3300005290 | Bacteria | 1103 |
| 21 | Ga0065715_10024978 | 3300005293 | Bacteria | 1494 |
| 22 | Ga0065715_10466356 | 3300005293 | Bacteria | 811 |
| 23 | Ga0065715_10703734 | 3300005293 | Bacteria | 651 |
| 24 | Ga0065707_10083722 | 3300005295 | Bacteria | 8385 |
| 25 | Ga0065707_10112291 | 3300005295 | Bacteria | 2366 |
| 26 | Ga0065707_10499672 | 3300005295 | Bacteria | 758 |
| 27 | Ga0070658_10025278 | 3300005327 | Bacteria | 4761 |
| 28 | Ga0070658_10036820 | 3300005327 | Bacteria | 3944 |
| 29 | Ga0070676_10002110 | 3300005328 | Bacteria | 10124 |
| 30 | Ga0070676_10811513 | 3300005328 | Bacteria | 691 |
| 31 | Ga0070683_101520820 | 3300005329 | Bacteria | 643 |
| 32 | Ga0070690_100000128 | 3300005330 | Bacteria | 39293 |
| 33 | Ga0070690_100006058 | 3300005330 | Bacteria | 6841 |
| 34 | Ga0070690_100163496 | 3300005330 | Bacteria | 1527 |
| 35 | Ga0070670_100073412 | 3300005331 | Bacteria | 2938 |
| 36 | Ga0070670_100399030 | 3300005331 | Bacteria | 1214 |
| 37 | Ga0070677_10010132 | 3300005333 | Bacteria | 3215 |
| 38 | Ga0068869_100399586 | 3300005334 | Bacteria | 1130 |
| 39 | Ga0068869_101641377 | 3300005334 | Bacteria | 573 |
| 40 | Ga0070666_10018395 | 3300005335 | Bacteria | 4492 |
| 41 | Ga0070666_10166291 | 3300005335 | Bacteria | 1543 |
| 42 | Ga0070666_10529419 | 3300005335 | Bacteria | 856 |
| 43 | Ga0070666_10665729 | 3300005335 | Bacteria | 762 |
| 44 | Ga0070680_100031316 | 3300005336 | Bacteria | 4276 |
| 45 | Ga0070680_100063420 | 3300005336 | Bacteria | 3027 |
| 46 | Ga0070680_100063732 | 3300005336 | Bacteria | 3020 |
| 47 | Ga0070680_100340015 | 3300005336 | Bacteria | 1275 |
| 48 | Ga0070680_100995570 | 3300005336 | Bacteria | 724 |
| 49 | Ga0070682_100225353 | 3300005337 | Bacteria | 1337 |
| 50 | Ga0070682_100291316 | 3300005337 | Bacteria | 1194 |
| 51 | Ga0070682_101474018 | 3300005337 | Bacteria | 584 |
| 52 | Ga0068868_100077174 | 3300005338 | Bacteria | 2665 |
| 53 | Ga0068868_100175469 | 3300005338 | Bacteria | 1776 |
| 54 | Ga0068868_100439819 | 3300005338 | Bacteria | 1132 |
| 55 | Ga0070660_100001287 | 3300005339 | Bacteria | 17103 |
| 56 | Ga0070660_100085519 | 3300005339 | Bacteria | 2481 |
| 57 | Ga0070660_100850866 | 3300005339 | Bacteria | 768 |
| 58 | Ga0070689_100001472 | 3300005340 | Bacteria | 15018 |
| 59 | Ga0070689_100024154 | 3300005340 | Bacteria | 4558 |
| 60 | Ga0070689_100077278 | 3300005340 | Bacteria | 2609 |
| 61 | Ga0070691_10001906 | 3300005341 | Bacteria | 9146 |
| 62 | Ga0070691_10192469 | 3300005341 | Bacteria | 1068 |
| 63 | Ga0070687_100000578 | 3300005343 | Bacteria | 12195 |
| 64 | Ga0070687_100006792 | 3300005343 | Bacteria | 4719 |
| 65 | Ga0070687_100154346 | 3300005343 | Bacteria | 1351 |
| 66 | Ga0070687_100567546 | 3300005343 | Bacteria | 775 |
| 67 | Ga0070661_100002446 | 3300005344 | Bacteria | 12743 |
| 68 | Ga0070661_100031260 | 3300005344 | Bacteria | 3848 |
| 69 | Ga0070692_10003356 | 3300005345 | Bacteria | 6481 |
| 70 | Ga0070692_11090787 | 3300005345 | Unclassified | 563 |
| 71 | Ga0070668_100012055 | 3300005347 | Bacteria | 6439 |
| 72 | Ga0070669_100036233 | 3300005353 | Bacteria | 3574 |
| 73 | Ga0070669_101072058 | 3300005353 | Bacteria | 693 |
| 74 | Ga0070675_100233695 | 3300005354 | Bacteria | 1604 |
| 75 | Ga0070675_100857891 | 3300005354 | Bacteria | 831 |
| 76 | Ga0070675_101107484 | 3300005354 | Bacteria | 728 |
| 77 | Ga0070671_100069717 | 3300005355 | Bacteria | 2933 |
| 78 | Ga0070671_100402037 | 3300005355 | Bacteria | 1172 |
| 79 | Ga0070674_100000651 | 3300005356 | Bacteria | 17493 |
| 80 | Ga0070674_100013481 | 3300005356 | Bacteria | 5054 |
| 81 | Ga0070674_100525895 | 3300005356 | Bacteria | 989 |
| 82 | Ga0070673_100002548 | 3300005364 | Bacteria | 11116 |
| 83 | Ga0070673_100086154 | 3300005364 | Bacteria | 2559 |
| 84 | Ga0070673_100098879 | 3300005364 | Bacteria | 2399 |
| 85 | Ga0070673_100882084 | 3300005364 | Bacteria | 829 |
| 86 | Ga0070688_100000009 | 3300005365 | Bacteria | 85664 |
| 87 | Ga0070688_100005771 | 3300005365 | Bacteria | 6544 |
| 88 | Ga0070688_100023921 | 3300005365 | Bacteria | 3598 |
| 89 | Ga0070659_100000429 | 3300005366 | Bacteria | 31798 |
| 90 | Ga0070659_100991417 | 3300005366 | Bacteria | 737 |
| 91 | Ga0070667_100032702 | 3300005367 | Bacteria | 4339 |
| 92 | Ga0070667_100471054 | 3300005367 | Bacteria | 1149 |
| 93 | Ga0070703_10115596 | 3300005406 | Bacteria | 966 |
| 94 | Ga0070710_10468495 | 3300005437 | Bacteria | 857 |
| 95 | Ga0070701_10001023 | 3300005438 | Bacteria | 10183 |
| 96 | Ga0070701_10021474 | 3300005438 | Bacteria | 3082 |
| 97 | Ga0070701_10101264 | 3300005438 | Bacteria | 1596 |
| 98 | Ga0070701_10229959 | 3300005438 | Bacteria | 1110 |
| 99 | Ga0070711_101507912 | 3300005439 | Bacteria | 587 |
| 100 | Ga0070705_100003543 | 3300005440 | Bacteria | 7645 |
| 101 | Ga0070705_100055568 | 3300005440 | Bacteria | 2327 |
| 102 | Ga0070705_100260353 | 3300005440 | Bacteria | 1223 |
| 103 | Ga0070705_100785023 | 3300005440 | Bacteria | 756 |
| 104 | Ga0070700_100003185 | 3300005441 | Bacteria | 8430 |
| 105 | Ga0070700_100012179 | 3300005441 | Bacteria | 4790 |
| 106 | Ga0070700_100128047 | 3300005441 | Bacteria | 1710 |
| 107 | Ga0070694_100050947 | 3300005444 | Bacteria | 2793 |
| 108 | Ga0070694_100103928 | 3300005444 | Bacteria | 2013 |
| 109 | Ga0070694_100354468 | 3300005444 | Bacteria | 1137 |
| 110 | Ga0070694_100555906 | 3300005444 | Bacteria | 919 |
| 111 | Ga0070694_100823890 | 3300005444 | Bacteria | 762 |
| 112 | Ga0070708_100032477 | 3300005445 | Bacteria | 4529 |
| 113 | Ga0070708_100150707 | 3300005445 | Bacteria | 2162 |
| 114 | Ga0070708_100182048 | 3300005445 | Bacteria | 1964 |
| 115 | Ga0070708_100189665 | 3300005445 | Bacteria | 1922 |
| 116 | Ga0070708_100902761 | 3300005445 | Bacteria | 829 |
| 117 | Ga0070708_101717164 | 3300005445 | Bacteria | 583 |
| 118 | Ga0070663_100057877 | 3300005455 | Bacteria | 2782 |
| 119 | Ga0070678_100227761 | 3300005456 | Bacteria | 1552 |
| 120 | Ga0070678_101601551 | 3300005456 | Bacteria | 611 |
| 121 | Ga0070662_100000333 | 3300005457 | Bacteria | 28293 |
| 122 | Ga0070662_100869771 | 3300005457 | Bacteria | 768 |
| 123 | Ga0070662_100937181 | 3300005457 | Bacteria | 740 |
| 124 | Ga0070681_10014971 | 3300005458 | Bacteria | 7712 |
| 125 | Ga0070681_10117118 | 3300005458 | Bacteria | 2600 |
| 126 | Ga0068867_100000209 | 3300005459 | Bacteria | 39235 |
| 127 | Ga0068867_100008954 | 3300005459 | Bacteria | 7062 |
| 128 | Ga0068867_100084748 | 3300005459 | Bacteria | 2395 |
| 129 | Ga0068867_102360266 | 3300005459 | Bacteria | 506 |
| 130 | Ga0070685_10000197 | 3300005466 | Bacteria | 40603 |
| 131 | Ga0070685_10024398 | 3300005466 | Bacteria | 3321 |
| 132 | Ga0070706_100006062 | 3300005467 | Bacteria | 11427 |
| 133 | Ga0070706_100022282 | 3300005467 | Bacteria | 5832 |
| 134 | Ga0070706_100071009 | 3300005467 | Bacteria | 3220 |
| 135 | Ga0070706_100160000 | 3300005467 | Bacteria | 2102 |
| 136 | Ga0070706_100241449 | 3300005467 | Bacteria | 1687 |
| 137 | Ga0070707_100000009 | 3300005468 | Bacteria | 166193 |
| 138 | Ga0070707_100000546 | 3300005468 | Bacteria | 37594 |
| 139 | Ga0070707_100013734 | 3300005468 | Bacteria | 7583 |
| 140 | Ga0070707_100045910 | 3300005468 | Bacteria | 4180 |
| 141 | Ga0070707_100160664 | 3300005468 | Bacteria | 2189 |
| 142 | Ga0070698_100022782 | 3300005471 | Bacteria | 6550 |
| 143 | Ga0070698_100065483 | 3300005471 | Bacteria | 3659 |
| 144 | Ga0070698_100108921 | 3300005471 | Bacteria | 2737 |
| 145 | Ga0070698_100321535 | 3300005471 | Bacteria | 1478 |
| 146 | Ga0070698_100338737 | 3300005471 | Bacteria | 1435 |
| 147 | Ga0070698_101297737 | 3300005471 | Bacteria | 678 |
| 148 | Ga0070699_100012688 | 3300005518 | Bacteria | 7267 |
| 149 | Ga0070699_100038839 | 3300005518 | Bacteria | 4121 |
| 150 | Ga0070699_100046180 | 3300005518 | Bacteria | 3769 |
| 151 | Ga0070699_100057826 | 3300005518 | Bacteria | 3358 |
| 152 | Ga0070699_100060393 | 3300005518 | Bacteria | 3285 |
| 153 | Ga0070699_100130500 | 3300005518 | Bacteria | 2215 |
| 154 | Ga0070699_100297150 | 3300005518 | Unclassified | 1449 |
| 155 | Ga0070679_100039709 | 3300005530 | Bacteria | 4678 |
| 156 | Ga0070679_100238006 | 3300005530 | Bacteria | 1779 |
| 157 | Ga0070684_100060682 | 3300005535 | Bacteria | 3309 |
| 158 | Ga0070684_100172658 | 3300005535 | Bacteria | 1964 |
| 159 | Ga0070684_101287682 | 3300005535 | Bacteria | 688 |
| 160 | Ga0070697_100028140 | 3300005536 | Bacteria | 4499 |
| 161 | Ga0070697_100039781 | 3300005536 | Bacteria | 3803 |
| 162 | Ga0070697_100040563 | 3300005536 | Bacteria | 3767 |
| 163 | Ga0070697_100052026 | 3300005536 | Bacteria | 3329 |
| 164 | Ga0070697_100099320 | 3300005536 | Bacteria | 2416 |
| 165 | Ga0070697_100321549 | 3300005536 | Bacteria | 1333 |
| 166 | Ga0070697_100513173 | 3300005536 | Bacteria | 1049 |
| 167 | Ga0068853_101220592 | 3300005539 | Bacteria | 726 |
| 168 | Ga0068853_102461737 | 3300005539 | Bacteria | 504 |
| 169 | Ga0070672_100004622 | 3300005543 | Bacteria | 9017 |
| 170 | Ga0070672_100131393 | 3300005543 | Bacteria | 2058 |
| 171 | Ga0070672_100154074 | 3300005543 | Bacteria | 1903 |
| 172 | Ga0070686_100001153 | 3300005544 | Bacteria | 15105 |
| 173 | Ga0070686_100001810 | 3300005544 | Bacteria | 11925 |
| 174 | Ga0070686_100003735 | 3300005544 | Bacteria | 8366 |
| 175 | Ga0070686_100021825 | 3300005544 | Bacteria | 3811 |
| 176 | Ga0070686_100088889 | 3300005544 | Bacteria | 2063 |
| 177 | Ga0070695_100054066 | 3300005545 | Bacteria | 2583 |
| 178 | Ga0070695_100109564 | 3300005545 | Bacteria | 1872 |
| 179 | Ga0070695_100153038 | 3300005545 | Bacteria | 1611 |
| 180 | Ga0070696_100014740 | 3300005546 | Bacteria | 5244 |
| 181 | Ga0070696_100039493 | 3300005546 | Bacteria | 3259 |
| 182 | Ga0070696_100091065 | 3300005546 | Bacteria | 2171 |
| 183 | Ga0070696_100378972 | 3300005546 | Bacteria | 1102 |
| 184 | Ga0070693_100025178 | 3300005547 | Bacteria | 3200 |
| 185 | Ga0070665_100155586 | 3300005548 | Bacteria | 2288 |
| 186 | Ga0070665_100874118 | 3300005548 | Bacteria | 912 |
| 187 | Ga0070665_101501812 | 3300005548 | Bacteria | 682 |
| 188 | Ga0070704_100016656 | 3300005549 | Bacteria | 4650 |
| 189 | Ga0070704_100167365 | 3300005549 | Bacteria | 1744 |
| 190 | Ga0070704_100347908 | 3300005549 | Bacteria | 1250 |
| 191 | Ga0070704_100964944 | 3300005549 | Bacteria | 770 |
| 192 | Ga0068855_100121259 | 3300005563 | Bacteria | 2992 |
| 193 | Ga0070664_100004699 | 3300005564 | Bacteria | 10954 |
| 194 | Ga0070664_100017106 | 3300005564 | Bacteria | 5951 |
| 195 | Ga0070664_100312780 | 3300005564 | Bacteria | 1422 |
| 196 | Ga0070664_100539742 | 3300005564 | Bacteria | 1078 |
| 197 | Ga0068857_100128798 | 3300005577 | Bacteria | 2282 |
| 198 | Ga0068857_102009636 | 3300005577 | Bacteria | 567 |
| 199 | Ga0068854_100190667 | 3300005578 | Bacteria | 1606 |
| 200 | Ga0070702_100082706 | 3300005615 | Bacteria | 1927 |
| 201 | Ga0070702_100901826 | 3300005615 | Bacteria | 692 |
| 202 | Ga0068852_100141629 | 3300005616 | Bacteria | 2226 |
| 203 | Ga0068852_100721648 | 3300005616 | Bacteria | 1008 |
| 204 | Ga0068859_100001080 | 3300005617 | Bacteria | 27816 |
| 205 | Ga0068859_100125401 | 3300005617 | Bacteria | 2637 |
| 206 | Ga0068859_100309542 | 3300005617 | Bacteria | 1673 |
| 207 | Ga0068864_100017267 | 3300005618 | Bacteria | 6017 |
| 208 | Ga0068866_10028397 | 3300005718 | Bacteria | 2665 |
| 209 | Ga0068866_10062640 | 3300005718 | Bacteria | 1936 |
| 210 | Ga0068866_10129194 | 3300005718 | Bacteria | 1435 |
| 211 | Ga0068861_100129149 | 3300005719 | Bacteria | 2049 |
| 212 | Ga0068861_100189158 | 3300005719 | Bacteria | 1719 |
| 213 | Ga0068861_101260593 | 3300005719 | Bacteria | 717 |
| 214 | Ga0068861_101999900 | 3300005719 | Bacteria | 578 |
| 215 | Ga0068870_10015488 | 3300005840 | Bacteria | 3619 |
| 216 | Ga0068863_101939669 | 3300005841 | Bacteria | 599 |
| 217 | Ga0068858_100124107 | 3300005842 | Bacteria | 2417 |
| 218 | Ga0068858_101307008 | 3300005842 | Bacteria | 714 |
| 219 | Ga0068858_101435914 | 3300005842 | Bacteria | 680 |
| 220 | Ga0068860_100034338 | 3300005843 | Bacteria | 4864 |
| 221 | Ga0068860_100072223 | 3300005843 | Bacteria | 3279 |
| 222 | Ga0068860_100409080 | 3300005843 | Bacteria | 1343 |
| 223 | Ga0068860_100438485 | 3300005843 | Bacteria | 1297 |
| 224 | Ga0068862_100080379 | 3300005844 | Bacteria | 2827 |
| 225 | Ga0081455_10000457 | 3300005937 | Bacteria | 53537 |
| 226 | Ga0070717_10103093 | 3300006028 | Bacteria | 2425 |
| 227 | Ga0075432_10002652 | 3300006058 | Bacteria | 5975 |
| 228 | Ga0070715_10507423 | 3300006163 | Unclassified | 691 |
| 229 | Ga0070715_10750485 | 3300006163 | Bacteria | 588 |
| 230 | Ga0070716_100022519 | 3300006173 | Bacteria | 3331 |
| 231 | Ga0070716_100114975 | 3300006173 | Bacteria | 1674 |
| 232 | Ga0070716_100397840 | 3300006173 | Bacteria | 990 |
| 233 | Ga0075427_10006876 | 3300006194 | Unclassified | 1661 |
| 234 | Ga0097621_100003109 | 3300006237 | Bacteria | 11385 |
| 235 | Ga0097621_100030403 | 3300006237 | Bacteria | 4275 |
| 236 | Ga0068871_100004722 | 3300006358 | Bacteria | 9531 |
| 237 | Ga0068871_100010448 | 3300006358 | Bacteria | 6774 |
| 238 | Ga0068871_100588775 | 3300006358 | Bacteria | 1011 |
| 239 | Ga0068871_101054234 | 3300006358 | Bacteria | 759 |
| 240 | Ga0075428_101316803 | 3300006844 | Bacteria | 759 |
| 241 | Ga0075428_102240597 | 3300006844 | Bacteria | 563 |
| 242 | Ga0075430_100000800 | 3300006846 | Bacteria | 24453 |
| 243 | Ga0075430_100009708 | 3300006846 | Bacteria | 8132 |
| 244 | Ga0075430_100011790 | 3300006846 | Bacteria | 7442 |
| 245 | Ga0075430_100299651 | 3300006846 | Bacteria | 1330 |
| 246 | Ga0075430_100341414 | 3300006846 | Bacteria | 1237 |
| 247 | Ga0075431_100004808 | 3300006847 | Bacteria | 13295 |
| 248 | Ga0075431_100019017 | 3300006847 | Bacteria | 6999 |
| 249 | Ga0075431_100033801 | 3300006847 | Bacteria | 5268 |
| 250 | Ga0075431_100104523 | 3300006847 | Bacteria | 2923 |
| 251 | Ga0075433_10011787 | 3300006852 | Bacteria | 7041 |
| 252 | Ga0075433_10153120 | 3300006852 | Bacteria | 2051 |
| 253 | Ga0075433_10347961 | 3300006852 | Bacteria | 1310 |
| 254 | Ga0075433_11601586 | 3300006852 | Bacteria | 562 |
| 255 | Ga0075434_100038974 | 3300006871 | Bacteria | 4708 |
| 256 | Ga0075434_100209843 | 3300006871 | Bacteria | 1968 |
| 257 | Ga0075434_100907933 | 3300006871 | Bacteria | 896 |
| 258 | Ga0075434_102619501 | 3300006871 | Bacteria | 505 |
| 259 | Ga0075429_100000498 | 3300006880 | Bacteria | 29516 |
| 260 | Ga0075429_100015569 | 3300006880 | Bacteria | 6590 |
| 261 | Ga0075429_100052476 | 3300006880 | Bacteria | 3548 |
| 262 | Ga0075429_100161294 | 3300006880 | Bacteria | 1964 |
| 263 | Ga0075429_100697684 | 3300006880 | Bacteria | 889 |
| 264 | Ga0075429_100970612 | 3300006880 | Bacteria | 743 |
| 265 | Ga0068865_100001653 | 3300006881 | Bacteria | 13064 |
| 266 | Ga0068865_100345777 | 3300006881 | Bacteria | 1203 |
| 267 | Ga0075436_100208425 | 3300006914 | Bacteria | 1385 |
| 268 | Ga0097620_100001080 | 3300006931 | Bacteria | 27816 |
| 269 | Ga0097620_100125408 | 3300006931 | Bacteria | 2637 |
| 270 | Ga0097620_100309513 | 3300006931 | Bacteria | 1673 |
| 271 | Ga0075435_100007648 | 3300007076 | Bacteria | 7717 |
| 272 | Ga0075435_100488466 | 3300007076 | Bacteria | 1064 |
| 273 | Ga0075435_100489426 | 3300007076 | Bacteria | 1063 |
| 274 | Ga0075435_101852796 | 3300007076 | Bacteria | 529 |
| 275 | Ga0099794_10044108 | 3300007265 | Bacteria | 2130 |
| 276 | Ga0111539_10072221 | 3300009094 | Bacteria | 4070 |
| 277 | Ga0111539_13264804 | 3300009094 | Unclassified | 522 |
| 278 | Ga0105245_10004374 | 3300009098 | Bacteria | 12503 |
| 279 | Ga0105245_10484637 | 3300009098 | Bacteria | 1250 |
| 280 | Ga0105245_11946933 | 3300009098 | Bacteria | 641 |
| 281 | Ga0114129_10012324 | 3300009147 | Bacteria | 12166 |
| 282 | Ga0114129_10105393 | 3300009147 | Bacteria | 3897 |
| 283 | Ga0114129_10129962 | 3300009147 | Bacteria | 3460 |
| 284 | Ga0114129_10322375 | 3300009147 | Bacteria | 2054 |
| 285 | Ga0114129_11912634 | 3300009147 | Bacteria | 719 |
| 286 | Ga0114129_12014761 | 3300009147 | Bacteria | 698 |
| 287 | Ga0114129_12485541 | 3300009147 | Unclassified | 619 |
| 288 | Ga0114129_12493535 | 3300009147 | Unclassified | 618 |
| 289 | Ga0105243_10007248 | 3300009148 | Bacteria | 8524 |
| 290 | Ga0105243_10107004 | 3300009148 | Bacteria | 2332 |
| 291 | Ga0105243_11983231 | 3300009148 | Bacteria | 616 |
| 292 | Ga0105241_10170657 | 3300009174 | Bacteria | 1796 |
| 293 | Ga0105241_10368325 | 3300009174 | Bacteria | 1252 |
| 294 | Ga0105242_10006995 | 3300009176 | Bacteria | 8710 |
| 295 | Ga0105242_10021035 | 3300009176 | Bacteria | 5118 |
| 296 | Ga0105242_11108292 | 3300009176 | Bacteria | 806 |
| 297 | Ga0105248_10365102 | 3300009177 | Bacteria | 1625 |
| 298 | Ga0105237_11952752 | 3300009545 | Bacteria | 595 |
| 299 | Ga0105238_12111700 | 3300009551 | Bacteria | 598 |
| 300 | Ga0105239_10025271 | 3300010375 | Bacteria | 6540 |
| 301 | Ga0105246_10002042 | 3300011119 | Bacteria | 12188 |
| 302 | Ga0157371_10844268 | 3300013102 | Bacteria | 692 |
| 303 | Ga0157371_11493232 | 3300013102 | Bacteria | 527 |
| 304 | Ga0157370_11057600 | 3300013104 | Bacteria | 734 |
| 305 | Ga0157369_10143602 | 3300013105 | Bacteria | 2524 |
| 306 | Ga0157374_10050010 | 3300013296 | Bacteria | 3884 |
| 307 | Ga0157374_10073020 | 3300013296 | Bacteria | 3238 |
| 308 | Ga0157374_11938514 | 3300013296 | Bacteria | 615 |
| 309 | Ga0157374_12065493 | 3300013296 | Bacteria | 596 |
| 310 | Ga0157378_10034081 | 3300013297 | Bacteria | 4503 |
| 311 | Ga0157378_10054860 | 3300013297 | Bacteria | 3549 |
| 312 | Ga0157378_10108765 | 3300013297 | Bacteria | 2539 |
| 313 | Ga0157378_10158430 | 3300013297 | Bacteria | 2115 |
| 314 | Ga0163162_10400230 | 3300013306 | Bacteria | 1506 |
| 315 | Ga0157372_12805019 | 3300013307 | Bacteria | 559 |
| 316 | Ga0157372_13001236 | 3300013307 | Bacteria | 539 |
| 317 | Ga0157375_10028798 | 3300013308 | Bacteria | 5213 |
| 318 | Ga0157375_11254923 | 3300013308 | Bacteria | 870 |
| 319 | Ga0157375_11744568 | 3300013308 | Bacteria | 738 |
| 320 | Ga0163163_10246746 | 3300014325 | Bacteria | 1836 |
| 321 | Ga0163163_11273369 | 3300014325 | Bacteria | 798 |
| 322 | Ga0157380_10003854 | 3300014326 | Bacteria | 10339 |
| 323 | Ga0157380_10032243 | 3300014326 | Bacteria | 4029 |
| 324 | Ga0157380_10242008 | 3300014326 | Bacteria | 1627 |
| 325 | Ga0157380_10523612 | 3300014326 | Bacteria | 1157 |
| 326 | Ga0157380_10830964 | 3300014326 | Bacteria | 944 |
| 327 | Ga0157377_10026012 | 3300014745 | Bacteria | 3127 |
| 328 | Ga0157377_10769502 | 3300014745 | Bacteria | 706 |
| 329 | Ga0157379_10219236 | 3300014968 | Bacteria | 1724 |
| 330 | Ga0157379_10614711 | 3300014968 | Bacteria | 1015 |
| 331 | Ga0157379_10679873 | 3300014968 | Unclassified | 965 |
| 332 | Ga0157376_10001862 | 3300014969 | Bacteria | 14060 |
| 333 | Ga0157376_10002625 | 3300014969 | Bacteria | 12226 |
| 334 | Ga0157376_10481382 | 3300014969 | Bacteria | 1216 |
| 335 | Ga0163161_10082723 | 3300017792 | Bacteria | 2366 |
| 336 | Ga0206356_11224672 | 3300020070 | Bacteria | 660 |
| 337 | Ga0207697_10155248 | 3300025315 | Bacteria | 997 |
| 338 | Ga0207653_10083849 | 3300025885 | Bacteria | 1107 |
| 339 | Ga0207682_10034784 | 3300025893 | Bacteria | 2033 |
| 340 | Ga0207642_10038684 | 3300025899 | Bacteria | 2067 |
| 341 | Ga0207710_10659884 | 3300025900 | Bacteria | 548 |
| 342 | Ga0207688_10028580 | 3300025901 | Bacteria | 3068 |
| 343 | Ga0207680_10030317 | 3300025903 | Bacteria | 3049 |
| 344 | Ga0207680_10042948 | 3300025903 | Bacteria | 2648 |
| 345 | Ga0207680_10419713 | 3300025903 | Bacteria | 947 |
| 346 | Ga0207680_11238509 | 3300025903 | Bacteria | 532 |
| 347 | Ga0207647_10245966 | 3300025904 | Bacteria | 1027 |
| 348 | Ga0207685_10106452 | 3300025905 | Bacteria | 1208 |
| 349 | Ga0207685_10167245 | 3300025905 | Bacteria | 1009 |
| 350 | Ga0207685_10461276 | 3300025905 | Bacteria | 662 |
| 351 | Ga0207699_10637505 | 3300025906 | Bacteria | 778 |
| 352 | Ga0207645_10000319 | 3300025907 | Bacteria | 40004 |
| 353 | Ga0207643_10084365 | 3300025908 | Bacteria | 1844 |
| 354 | Ga0207684_10000354 | 3300025910 | Bacteria | 62819 |
| 355 | Ga0207684_10004998 | 3300025910 | Bacteria | 12354 |
| 356 | Ga0207684_10011565 | 3300025910 | Bacteria | 7712 |
| 357 | Ga0207684_10194665 | 3300025910 | Bacteria | 1749 |
| 358 | Ga0207684_10239901 | 3300025910 | Bacteria | 1564 |
| 359 | Ga0207684_10246606 | 3300025910 | Bacteria | 1541 |
| 360 | Ga0207684_10305748 | 3300025910 | Unclassified | 1371 |
| 361 | Ga0207684_10556385 | 3300025910 | Bacteria | 981 |
| 362 | Ga0207654_10926235 | 3300025911 | Bacteria | 632 |
| 363 | Ga0207707_10026688 | 3300025912 | Bacteria | 5048 |
| 364 | Ga0207707_10128513 | 3300025912 | Bacteria | 2216 |
| 365 | Ga0207707_10873013 | 3300025912 | Bacteria | 745 |
| 366 | Ga0207671_10934643 | 3300025914 | Bacteria | 685 |
| 367 | Ga0207663_10174053 | 3300025916 | Bacteria | 1531 |
| 368 | Ga0207663_11740864 | 3300025916 | Bacteria | 501 |
| 369 | Ga0207660_10006168 | 3300025917 | Bacteria | 7783 |
| 370 | Ga0207660_10025604 | 3300025917 | Bacteria | 4007 |
| 371 | Ga0207660_10118004 | 3300025917 | Bacteria | 2006 |
| 372 | Ga0207662_10000281 | 3300025918 | Bacteria | 23576 |
| 373 | Ga0207662_10010315 | 3300025918 | Bacteria | 5157 |
| 374 | Ga0207662_10080299 | 3300025918 | Bacteria | 1989 |
| 375 | Ga0207662_10624426 | 3300025918 | Bacteria | 751 |
| 376 | Ga0207657_10001887 | 3300025919 | Bacteria | 22650 |
| 377 | Ga0207649_10055832 | 3300025920 | Bacteria | 2464 |
| 378 | Ga0207649_10184042 | 3300025920 | Bacteria | 1464 |
| 379 | Ga0207652_10027975 | 3300025921 | Bacteria | 4701 |
| 380 | Ga0207652_10115214 | 3300025921 | Bacteria | 2387 |
| 381 | Ga0207646_10000011 | 3300025922 | Bacteria | 370246 |
| 382 | Ga0207646_10000252 | 3300025922 | Bacteria | 72709 |
| 383 | Ga0207646_10089293 | 3300025922 | Bacteria | 2758 |
| 384 | Ga0207646_10233693 | 3300025922 | Bacteria | 1661 |
| 385 | Ga0207681_10071862 | 3300025923 | Bacteria | 2414 |
| 386 | Ga0207681_10718461 | 3300025923 | Bacteria | 831 |
| 387 | Ga0207681_10969307 | 3300025923 | Bacteria | 713 |
| 388 | Ga0207650_10069245 | 3300025925 | Bacteria | 2651 |
| 389 | Ga0207659_10032437 | 3300025926 | Bacteria | 3585 |
| 390 | Ga0207659_10069014 | 3300025926 | Bacteria | 2573 |
| 391 | Ga0207687_10030538 | 3300025927 | Bacteria | 3634 |
| 392 | Ga0207687_10181887 | 3300025927 | Bacteria | 1629 |
| 393 | Ga0207644_10043162 | 3300025931 | Bacteria | 3199 |
| 394 | Ga0207644_10374307 | 3300025931 | Unclassified | 1161 |
| 395 | Ga0207690_10020246 | 3300025932 | Bacteria | 4107 |
| 396 | Ga0207690_10816009 | 3300025932 | Bacteria | 771 |
| 397 | Ga0207706_10000428 | 3300025933 | Bacteria | 45224 |
| 398 | Ga0207706_10678054 | 3300025933 | Bacteria | 882 |
| 399 | Ga0207686_10009930 | 3300025934 | Bacteria | 5174 |
| 400 | Ga0207686_10035215 | 3300025934 | Bacteria | 3003 |
| 401 | Ga0207686_10332146 | 3300025934 | Bacteria | 1139 |
| 402 | Ga0207709_10152022 | 3300025935 | Bacteria | 1604 |
| 403 | Ga0207670_10000024 | 3300025936 | Bacteria | 143058 |
| 404 | Ga0207670_10016294 | 3300025936 | Bacteria | 4463 |
| 405 | Ga0207670_10363737 | 3300025936 | Bacteria | 1148 |
| 406 | Ga0207669_10002413 | 3300025937 | Bacteria | 7968 |
| 407 | Ga0207669_10049674 | 3300025937 | Bacteria | 2502 |
| 408 | Ga0207704_10039635 | 3300025938 | Bacteria | 2745 |
| 409 | Ga0207704_10269240 | 3300025938 | Bacteria | 1289 |
| 410 | Ga0207665_10032938 | 3300025939 | Bacteria | 3433 |
| 411 | Ga0207665_10036430 | 3300025939 | Bacteria | 3272 |
| 412 | Ga0207691_10000726 | 3300025940 | Bacteria | 32543 |
| 413 | Ga0207691_10044629 | 3300025940 | Bacteria | 4079 |
| 414 | Ga0207691_10063839 | 3300025940 | Bacteria | 3339 |
| 415 | Ga0207711_10301706 | 3300025941 | Bacteria | 1477 |
| 416 | Ga0207711_10340992 | 3300025941 | Bacteria | 1387 |
| 417 | Ga0207711_11455700 | 3300025941 | Bacteria | 628 |
| 418 | Ga0207689_10055849 | 3300025942 | Bacteria | 3249 |
| 419 | Ga0207689_10613735 | 3300025942 | Bacteria | 915 |
| 420 | Ga0207661_10126569 | 3300025944 | Bacteria | 2183 |
| 421 | Ga0207661_11515563 | 3300025944 | Bacteria | 614 |
| 422 | Ga0207679_10001492 | 3300025945 | Bacteria | 14665 |
| 423 | Ga0207679_10007191 | 3300025945 | Bacteria | 7053 |
| 424 | Ga0207679_10113288 | 3300025945 | Bacteria | 2145 |
| 425 | Ga0207679_11546983 | 3300025945 | Bacteria | 608 |
| 426 | Ga0207667_10131926 | 3300025949 | Bacteria | 2573 |
| 427 | Ga0207651_10187581 | 3300025960 | Bacteria | 1646 |
| 428 | Ga0207651_10334824 | 3300025960 | Bacteria | 1270 |
| 429 | Ga0207651_10712446 | 3300025960 | Bacteria | 885 |
| 430 | Ga0207712_10074085 | 3300025961 | Bacteria | 2457 |
| 431 | Ga0207712_10219482 | 3300025961 | Bacteria | 1519 |
| 432 | Ga0207668_10006294 | 3300025972 | Bacteria | 7018 |
| 433 | Ga0207640_10075813 | 3300025981 | Bacteria | 2281 |
| 434 | Ga0207658_10274977 | 3300025986 | Bacteria | 1441 |
| 435 | Ga0207677_10073522 | 3300026023 | Bacteria | 2421 |
| 436 | Ga0207677_10486840 | 3300026023 | Bacteria | 1064 |
| 437 | Ga0207677_11036051 | 3300026023 | Bacteria | 745 |
| 438 | Ga0207703_10364911 | 3300026035 | Bacteria | 1333 |
| 439 | Ga0207639_12030666 | 3300026041 | Bacteria | 536 |
| 440 | Ga0207639_12144677 | 3300026041 | Bacteria | 520 |
| 441 | Ga0207678_10229241 | 3300026067 | Bacteria | 1590 |
| 442 | Ga0207678_11489676 | 3300026067 | Bacteria | 597 |
| 443 | Ga0207708_10000780 | 3300026075 | Bacteria | 24018 |
| 444 | Ga0207708_10001713 | 3300026075 | Bacteria | 16231 |
| 445 | Ga0207708_10139591 | 3300026075 | Bacteria | 1900 |
| 446 | Ga0207702_11877462 | 3300026078 | Bacteria | 590 |
| 447 | Ga0207648_10002186 | 3300026089 | Bacteria | 21222 |
| 448 | Ga0207648_10013209 | 3300026089 | Bacteria | 7694 |
| 449 | Ga0207648_10749583 | 3300026089 | Bacteria | 907 |
| 450 | Ga0207676_10073748 | 3300026095 | Bacteria | 2748 |
| 451 | Ga0207676_10714467 | 3300026095 | Bacteria | 972 |
| 452 | Ga0207674_10025795 | 3300026116 | Bacteria | 6259 |
| 453 | Ga0207674_10188878 | 3300026116 | Bacteria | 2010 |
| 454 | Ga0207675_100162689 | 3300026118 | Bacteria | 2130 |
| 455 | Ga0207675_100247114 | 3300026118 | Bacteria | 1726 |
| 456 | Ga0207675_101565148 | 3300026118 | Bacteria | 680 |
| 457 | Ga0207675_101954660 | 3300026118 | Bacteria | 605 |
| 458 | Ga0207683_10000382 | 3300026121 | Bacteria | 40830 |
| 459 | Ga0207683_10198912 | 3300026121 | Bacteria | 1821 |
| 460 | Ga0207698_10579083 | 3300026142 | Bacteria | 1104 |
| 461 | Ga0209973_1008178 | 3300027252 | Bacteria | 1186 |
| 462 | Ga0209969_1000206 | 3300027360 | Bacteria | 7891 |
| 463 | Ga0209967_1000013 | 3300027364 | Bacteria | 23510 |
| 464 | Ga0209981_1000720 | 3300027378 | Bacteria | 4181 |
| 465 | Ga0209981_1005981 | 3300027378 | Bacteria | 1624 |
| 466 | Ga0209996_1000180 | 3300027395 | Bacteria | 8137 |
| 467 | Ga0209984_1000021 | 3300027424 | Bacteria | 16233 |
| 468 | Ga0210000_1000181 | 3300027462 | Bacteria | 9100 |
| 469 | Ga0209995_1000006 | 3300027471 | Bacteria | 35957 |
| 470 | Ga0209995_1018382 | 3300027471 | Unclassified | 1152 |
| 471 | Ga0209968_1000042 | 3300027526 | Bacteria | 23178 |
| 472 | Ga0209968_1016708 | 3300027526 | Bacteria | 1168 |
| 473 | Ga0209968_1054211 | 3300027526 | Bacteria | 700 |
| 474 | Ga0209999_1000492 | 3300027543 | Bacteria | 6148 |
| 475 | Ga0209999_1063056 | 3300027543 | Bacteria | 707 |
| 476 | Ga0209982_1079918 | 3300027552 | Bacteria | 539 |
| 477 | Ga0209970_1000462 | 3300027614 | Bacteria | 6938 |
| 478 | Ga0209970_1050183 | 3300027614 | Bacteria | 754 |
| 479 | Ga0210002_1000005 | 3300027617 | Bacteria | 37981 |
| 480 | Ga0209983_1001278 | 3300027665 | Bacteria | 5600 |
| 481 | Ga0209983_1077018 | 3300027665 | Bacteria | 746 |
| 482 | Ga0209971_1000482 | 3300027682 | Bacteria | 10560 |
| 483 | Ga0209971_1019563 | 3300027682 | Bacteria | 1608 |
| 484 | Ga0209971_1107834 | 3300027682 | Bacteria | 683 |
| 485 | Ga0209966_1000092 | 3300027695 | Bacteria | 39143 |
| 486 | Ga0209966_1001168 | 3300027695 | Bacteria | 4700 |
| 487 | Ga0209998_10000049 | 3300027717 | Bacteria | 48633 |
| 488 | Ga0209998_10015756 | 3300027717 | Bacteria | 1587 |
| 489 | Ga0209974_10004159 | 3300027876 | Bacteria | 5175 |
| 490 | Ga0209974_10005801 | 3300027876 | Bacteria | 4330 |
| 491 | Ga0209974_10087637 | 3300027876 | Bacteria | 1077 |
| 492 | Ga0209974_10150797 | 3300027876 | Bacteria | 839 |
| 493 | Ga0207428_10001066 | 3300027907 | Bacteria | 30105 |
| 494 | Ga0207428_10056972 | 3300027907 | Bacteria | 3104 |
| 495 | Ga0268266_10308359 | 3300028379 | Bacteria | 1478 |
| 496 | Ga0268266_11340318 | 3300028379 | Bacteria | 691 |
| 497 | Ga0268265_10546336 | 3300028380 | Bacteria | 1099 |
| 498 | Ga0268265_11376484 | 3300028380 | Bacteria | 707 |
| 499 | Ga0268264_10024071 | 3300028381 | Bacteria | 4969 |
| 500 | Ga0268264_10046757 | 3300028381 | Bacteria | 3596 |
| 501 | Ga0268264_10374807 | 3300028381 | Bacteria | 1361 |
| 502 | Ga0265338_10055975 | 3300028800 | Bacteria | 3503 |
| 503 | Ga0307511_10000442 | 3300030521 | Bacteria | 44415 |
| 504 | Ga0265327_10137169 | 3300031251 | Bacteria | 1146 |
| 505 | Ga0265316_10913647 | 3300031344 | Bacteria | 613 |
| 506 | Ga0265316_10962510 | 3300031344 | Unclassified | 595 |
| 507 | Ga0307408_100031691 | 3300031548 | Bacteria | 3682 |
| 508 | Ga0307408_100616472 | 3300031548 | Bacteria | 966 |
| 509 | Ga0307405_10004671 | 3300031731 | Bacteria | 6508 |
| 510 | Ga0307405_10830788 | 3300031731 | Bacteria | 776 |
| 511 | Ga0307405_11467576 | 3300031731 | Bacteria | 598 |
| 512 | Ga0307413_11044500 | 3300031824 | Bacteria | 703 |
| 513 | Ga0307410_10026168 | 3300031852 | Bacteria | 3669 |
| 514 | Ga0307410_10353701 | 3300031852 | Bacteria | 1174 |
| 515 | Ga0307406_10146134 | 3300031901 | Bacteria | 1680 |
| 516 | Ga0307407_10061421 | 3300031903 | Bacteria | 2196 |
| 517 | Ga0307407_11087645 | 3300031903 | Bacteria | 621 |
| 518 | Ga0307412_10012004 | 3300031911 | Bacteria | 5032 |
| 519 | Ga0307412_10546556 | 3300031911 | Bacteria | 972 |
| 520 | Ga0307409_100075929 | 3300031995 | Bacteria | 2693 |
| 521 | Ga0307409_100136108 | 3300031995 | Bacteria | 2108 |
| 522 | Ga0307416_100024445 | 3300032002 | Bacteria | 4410 |
| 523 | Ga0307416_100782578 | 3300032002 | Bacteria | 1049 |
| 524 | Ga0307416_102807870 | 3300032002 | Bacteria | 582 |
| 525 | Ga0307414_10344425 | 3300032004 | Bacteria | 1277 |
| 526 | Ga0307414_11658893 | 3300032004 | Bacteria | 596 |
| 527 | Ga0307411_10003709 | 3300032005 | Bacteria | 7157 |
| 528 | Ga0307411_10016375 | 3300032005 | Bacteria | 4194 |
| 529 | Ga0307415_100038079 | 3300032126 | Bacteria | 3166 |
| 530 | Ga0316593_10161025 | 3300032168 | Bacteria | 820 |
| 531 | Ga0316593_10320698 | 3300032168 | Unclassified | 589 |
| 532 | Ga0373958_0163399 | 3300034819 | Bacteria | 564 |
| 533 | Ga0373926_0045995 | 3300035083 | Bacteria | 1565 |
| 534 | Ga0373929_0193341 | 3300035085 | Bacteria | 567 |
| 535 | Ga0373934_0061495 | 3300035086 | Bacteria | 1496 |
| 536 | Ga0373923_0083806 | 3300035111 | Bacteria | 1386 |
| 537 | Ga0373941_0127870 | 3300035115 | Unclassified | 912 |
| 538 | Ga0373941_0240033 | 3300035115 | Unclassified | 704 |
| 539 | Ga0373945_0110829 | 3300035116 | Bacteria | 1083 |
| 540 | Ga0373945_0134495 | 3300035116 | Bacteria | 993 |
| 541 | Ga0373956_0277813 | 3300035119 | Bacteria | 797 |
| 542 | Ga0373957_0453771 | 3300035120 | Bacteria | 555 |
| 543 | Ga0373960_0085052 | 3300035121 | Bacteria | 1003 |
| 544 | Ga0373960_0103335 | 3300035121 | Bacteria | 926 |
| 545 | Ga0373943_0026835 | 3300035170 | Bacteria | 2702 |
| 546 | Ga0373946_0123635 | 3300035171 | Bacteria | 1184 |
| 547 | Ga0373955_0134329 | 3300035172 | Bacteria | 1446 |
| 548 | Ga0373942_0015789 | 3300035207 | Bacteria | 1845 |
| 549 | Ga0373961_0369439 | 3300035241 | Bacteria | 544 |
| 550 | Ga0373962_0083044 | 3300035242 | Bacteria | 976 |
| 551 | Ga0373924_0368847 | 3300035410 | Bacteria | 640 |
| 552 | Ga0373931_0185987 | 3300035691 | Bacteria | 1233 |
| 553 | Ga0373931_0195960 | 3300035691 | Bacteria | 1204 |
| 554 | Ga0373931_0908606 | 3300035691 | Unclassified | 592 |
| 555 | Ga0373935_0044283 | 3300035692 | Bacteria | 2804 |
| 556 | Ga0373935_0538420 | 3300035692 | Bacteria | 850 |
| 557 | Ga0373927_0035547 | 3300035695 | Bacteria | 3240 |
| 558 | Ga0373933_0032880 | 3300035724 | Bacteria | 3015 |
| 559 | Ga0373947_0026956 | 3300035725 | Bacteria | 3361 |
| 560 | Ga0373947_1063830 | 3300035725 | Bacteria | 552 |
| 561 | Ga0373937_0569003 | 3300036401 | Bacteria | 1076 |
| 562 | Ga0373925_0522369 | 3300037068 | Bacteria | 975 |
| 563 | Ga0242420_049477 | 3300038996 | Bacteria | 819 |
| 564 | Ga0400483_123123 | 3300039062 | Bacteria | 1180 |
| 565 | Ga0400483_261336 | 3300039062 | Bacteria | 1514 |
| 566 | Ga0439438_012686 | 3300041405 | Bacteria | 2573 |
| 567 | Ga0439439_0009813 | 3300041406 | Bacteria | 2284 |
| 568 | Ga0439447_045113 | 3300041407 | Bacteria | 1064 |
| 569 | Ga0439453_0056649 | 3300041408 | Bacteria | 803 |
| 570 | Ga0439461_0011958 | 3300041410 | Bacteria | 1618 |
| 571 | Ga0439466_0027179 | 3300041411 | Bacteria | 1983 |
| 572 | Ga0439465_0261708 | 3300041413 | Bacteria | 642 |
| 573 | Ga0451802_1015304 | 3300041460 | Bacteria | 714 |
| 574 | Ga0451807_1487812 | 3300041486 | Bacteria | 1160 |
| 575 | Ga0451837_0058787 | 3300041494 | Bacteria | 2497 |
| 576 | Ga0451849_0205384 | 3300041505 | Bacteria | 945 |
| 577 | Ga0439431_0013413 | 3300041997 | Bacteria | 1891 |
| 578 | Ga0439433_0081645 | 3300041999 | Bacteria | 787 |
| 579 | Ga0439441_009512 | 3300042001 | Bacteria | 1611 |
| 580 | Ga0439448_0185249 | 3300042005 | Bacteria | 728 |
| 581 | Ga0439432_026350 | 3300042006 | Bacteria | 1903 |
| 582 | Ga0439451_076935 | 3300042009 | Unclassified | 669 |
| 583 | Ga0439452_027821 | 3300042010 | Bacteria | 1416 |
| 584 | Ga0439454_121215 | 3300042011 | Unclassified | 506 |
| 585 | Ga0439455_0081424 | 3300042012 | Unclassified | 880 |
| 586 | Ga0439455_0202149 | 3300042012 | Bacteria | 575 |
| 587 | Ga0439456_061353 | 3300042013 | Bacteria | 827 |
| 588 | Ga0439457_138334 | 3300042014 | Bacteria | 582 |
| 589 | Ga0439462_0051864 | 3300042015 | Bacteria | 1103 |
| 590 | Ga0450914_030353 | 3300042118 | Bacteria | 648 |
| 591 | Ga0450896_052909 | 3300042133 | Bacteria | 650 |
| 592 | Ga0450905_036787 | 3300042142 | Bacteria | 769 |
| 593 | Ga0439446_0031510 | 3300042156 | Bacteria | 1534 |
| 594 | Ga0450909_012392 | 3300042185 | Bacteria | 1250 |
| 595 | Ga0439435_0010610 | 3300042436 | Bacteria | 2192 |
| 596 | Ga0439435_0034881 | 3300042436 | Bacteria | 1385 |
| 597 | Ga0439444_0063208 | 3300042437 | Bacteria | 777 |
| 598 | Ga0439464_0046380 | 3300042439 | Bacteria | 1249 |
| 599 | Ga0439464_0077699 | 3300042439 | Bacteria | 988 |
| 600 | Ga0439464_0274740 | 3300042439 | Unclassified | 547 |
| 601 | Ga0439460_0019928 | 3300042461 | Bacteria | 1820 |
| 602 | Ga0439460_0070169 | 3300042461 | Bacteria | 1084 |
| 603 | Ga0450893_0106676 | 3300042532 | Unclassified | 575 |
| 604 | Ga0451577_0264706 | 3300042876 | Bacteria | 1557 |
| 605 | Ga0451577_0395796 | 3300042876 | Bacteria | 1254 |
| 606 | Ga0451577_1799548 | 3300042876 | Bacteria | 537 |
| 607 | Ga0439440_0256818 | 3300042993 | Unclassified | 534 |
| 608 | Ga0439440_0280681 | 3300042993 | Bacteria | 514 |
| 609 | Ga0453683_0069750 | 3300044673 | Bacteria | 2198 |
| 610 | Ga0453683_0107305 | 3300044673 | Unclassified | 1755 |
| 611 | Ga0453683_0292327 | 3300044673 | Bacteria | 1042 |
| 612 | Ga0466963_0192463 | 3300044694 | Bacteria | 1425 |
| 613 | Ga0453684_0255611 | 3300044712 | Bacteria | 2009 |
| 614 | Ga0453684_0269147 | 3300044712 | Bacteria | 1948 |
| 615 | Ga0453684_0388138 | 3300044712 | Bacteria | 1566 |
| 616 | Ga0453684_0527403 | 3300044712 | Bacteria | 1304 |
| 617 | Ga0453684_0632788 | 3300044712 | Bacteria | 1169 |
| 618 | Ga0453684_0950237 | 3300044712 | Bacteria | 917 |
| 619 | Ga0453684_1171214 | 3300044712 | Bacteria | 808 |
| 620 | Ga0453684_1353995 | 3300044712 | Bacteria | 740 |
| 621 | Ga0466971_0305184 | 3300044719 | Bacteria | 765 |
| 622 | Ga0466957_0112615 | 3300044842 | Bacteria | 1727 |
| 623 | Ga0451576_0010724 | 3300045051 | Bacteria | 10493 |
| 624 | Ga0451576_0334658 | 3300045051 | Bacteria | 1585 |
| 625 | Ga0451576_0585028 | 3300045051 | Bacteria | 1173 |
| 626 | Ga0451576_0793871 | 3300045051 | Bacteria | 994 |
| 627 | Ga0451576_1789170 | 3300045051 | Bacteria | 635 |
| 628 | Ga0451576_1891564 | 3300045051 | Bacteria | 616 |
| 629 | Ga0466958_0390972 | 3300045836 | Bacteria | 897 |
| 630 | Ga0466967_0192171 | 3300045976 | Bacteria | 1930 |
| 631 | Ga0495592_0228274 | 3300046454 | Bacteria | 1241 |
| 632 | Ga0495629_0034132 | 3300046459 | Bacteria | 3597 |
| 633 | Ga0495651_0360859 | 3300046462 | Bacteria | 958 |
| 634 | Ga0495653_0146529 | 3300046463 | Bacteria | 1654 |
| 635 | Ga0495582_0072667 | 3300046473 | Bacteria | 1904 |
| 636 | Ga0495582_0416817 | 3300046473 | Bacteria | 775 |
| 637 | Ga0495639_0455303 | 3300046475 | Bacteria | 650 |
| 638 | Ga0495584_0616316 | 3300046491 | Unclassified | 553 |
| 639 | Ga0495594_0011487 | 3300046499 | Bacteria | 4604 |
| 640 | Ga0495594_0285376 | 3300046499 | Bacteria | 940 |
| 641 | Ga0495594_0546203 | 3300046499 | Bacteria | 657 |
| 642 | Ga0495596_0272862 | 3300046500 | Unclassified | 657 |
| 643 | Ga0495607_0190683 | 3300046501 | Unclassified | 1021 |
| 644 | Ga0495637_0050577 | 3300046520 | Bacteria | 1743 |
| 645 | Ga0495666_0385049 | 3300046526 | Bacteria | 631 |
| 646 | Ga0495609_0139077 | 3300046538 | Unclassified | 1037 |
| 647 | Ga0495621_0153174 | 3300046539 | Bacteria | 908 |
| 648 | Ga0495622_0188528 | 3300046557 | Bacteria | 923 |
| 649 | Ga0495656_0327007 | 3300046615 | Unclassified | 791 |
| 650 | Ga0495634_0411341 | 3300046642 | Bacteria | 802 |
| 651 | Ga0495635_0268224 | 3300046663 | Bacteria | 1148 |
| 652 | Ga0495635_0668671 | 3300046663 | Bacteria | 675 |
| 653 | Ga0495659_0009361 | 3300046664 | Bacteria | 3126 |
| 654 | Ga0495588_0203174 | 3300046674 | Bacteria | 1047 |
| 655 | Ga0495657_0032657 | 3300046675 | Bacteria | 3631 |
| 656 | Ga0495647_0013988 | 3300046681 | Bacteria | 2790 |
| 657 | Ga0495658_0097137 | 3300046683 | Bacteria | 1753 |
| 658 | Ga0495624_0195130 | 3300046690 | Bacteria | 1231 |
| 659 | Ga0495670_0129089 | 3300046691 | Bacteria | 1317 |
| 660 | Ga0495670_0311570 | 3300046691 | Unclassified | 844 |
| 661 | Ga0495589_0174031 | 3300046794 | Unclassified | 1023 |
| 662 | Ga0495600_0121010 | 3300046809 | Bacteria | 1702 |
| 663 | Ga0495581_0030598 | 3300047315 | Bacteria | 3119 |
| 664 | Ga0495604_0140888 | 3300047317 | Bacteria | 1723 |
| 665 | Ga0495636_0530225 | 3300047318 | Bacteria | 571 |
| 666 | Ga0495680_0096615 | 3300047322 | Unclassified | 2206 |
| 667 | Ga0495614_0065681 | 3300048089 | Bacteria | 1561 |
| 668 | Ga0496106_0382029 | 3300048909 | Bacteria | 1132 |
| 669 | Ga0496109_1153059 | 3300048912 | Bacteria | 712 |
| 670 | Ga0496111_0037047 | 3300048914 | Bacteria | 3490 |
| 671 | Ga0496112_1794613 | 3300048915 | Bacteria | 525 |
| 672 | Ga0501308_063994 | 3300049128 | Bacteria | 560 |
| 673 | Ga0501309_040989 | 3300049129 | Bacteria | 708 |
| 674 | Ga0501304_023346 | 3300049160 | Bacteria | 625 |
| 675 | Ga0501290_001203 | 3300049513 | Bacteria | 3630 |
| 676 | Ga0501291_000070 | 3300049514 | Bacteria | 12062 |
| 677 | Ga0501292_000097 | 3300049515 | Bacteria | 15474 |
| 678 | Ga0501293_001129 | 3300049516 | Bacteria | 2000 |
| 679 | Ga0501294_000073 | 3300049517 | Bacteria | 10983 |
| 680 | Ga0501295_000110 | 3300049518 | Bacteria | 8049 |
| 681 | Ga0501296_000001 | 3300049519 | Bacteria | 31185 |
| 682 | Ga0501297_000026 | 3300049520 | Bacteria | 14970 |
| 683 | Ga0501298_005654 | 3300049521 | Bacteria | 2014 |
| 684 | Ga0501298_052086 | 3300049521 | Bacteria | 851 |
| 685 | Ga0501299_000081 | 3300049522 | Bacteria | 10639 |
| 686 | Ga0501299_100089 | 3300049522 | Bacteria | 672 |
| 687 | Ga0501300_000275 | 3300049523 | Bacteria | 7826 |
| 688 | Ga0501301_000256 | 3300049524 | Bacteria | 3096 |
| 689 | Ga0501303_001156 | 3300049526 | Bacteria | 1966 |
| 690 | Ga0501311_102006 | 3300049527 | Bacteria | 509 |
| 691 | Ga0501312_060276 | 3300049528 | Bacteria | 656 |
| 692 | Ga0501317_106748 | 3300049533 | Bacteria | 511 |
| 693 | Ga0501031_0003007 | 3300049568 | Bacteria | 10794 |
| 694 | Ga0501031_0003309 | 3300049568 | Bacteria | 10343 |
| 695 | Ga0501031_0013954 | 3300049568 | Bacteria | 5232 |
| 696 | Ga0501031_0052700 | 3300049568 | Bacteria | 2651 |
| 697 | Ga0501031_0221458 | 3300049568 | Bacteria | 1232 |
| 698 | Ga0501031_0668675 | 3300049568 | Bacteria | 667 |
| 699 | Ga0501032_0011486 | 3300049569 | Bacteria | 6362 |
| 700 | Ga0501032_0022670 | 3300049569 | Bacteria | 4351 |
| 701 | Ga0501032_0275407 | 3300049569 | Bacteria | 1090 |
| 702 | Ga0501033_0189779 | 3300049570 | Bacteria | 1471 |
| 703 | Ga0501033_0926442 | 3300049570 | Bacteria | 585 |
| 704 | Ga0501034_0821894 | 3300049571 | Bacteria | 821 |
| 705 | Ga0501034_1136513 | 3300049571 | Bacteria | 661 |
| 706 | Ga0501036_0001418 | 3300049572 | Bacteria | 18422 |
| 707 | Ga0501036_0072666 | 3300049572 | Bacteria | 2908 |
| 708 | Ga0501036_0106647 | 3300049572 | Bacteria | 2369 |
| 709 | Ga0501036_0177349 | 3300049572 | Bacteria | 1794 |
| 710 | Ga0501036_1699334 | 3300049572 | Bacteria | 509 |
| 711 | Ga0501037_0005978 | 3300049573 | Bacteria | 8889 |
| 712 | Ga0501037_0019840 | 3300049573 | Bacteria | 4960 |
| 713 | Ga0501037_0044493 | 3300049573 | Bacteria | 3260 |
| 714 | Ga0501037_0186277 | 3300049573 | Bacteria | 1471 |
| 715 | Ga0501037_0392312 | 3300049573 | Bacteria | 953 |
| 716 | Ga0501038_0034759 | 3300049574 | Bacteria | 4429 |
| 717 | Ga0501038_0043832 | 3300049574 | Bacteria | 3889 |
| 718 | Ga0501038_0048896 | 3300049574 | Bacteria | 3659 |
| 719 | Ga0501038_0396391 | 3300049574 | Bacteria | 1068 |
| 720 | Ga0501038_1308771 | 3300049574 | Bacteria | 523 |
| 721 | Ga0501039_0010478 | 3300049575 | Bacteria | 7063 |
| 722 | Ga0501039_0020879 | 3300049575 | Bacteria | 5020 |
| 723 | Ga0501039_0043557 | 3300049575 | Bacteria | 3467 |
| 724 | Ga0501039_0220646 | 3300049575 | Bacteria | 1490 |
| 725 | Ga0501039_0268065 | 3300049575 | Bacteria | 1342 |
| 726 | Ga0501039_0558912 | 3300049575 | Bacteria | 898 |
| 727 | Ga0501040_0019056 | 3300049576 | Bacteria | 4561 |
| 728 | Ga0501040_0031341 | 3300049576 | Bacteria | 3593 |
| 729 | Ga0501040_0053014 | 3300049576 | Bacteria | 2777 |
| 730 | Ga0501040_0092978 | 3300049576 | Bacteria | 2097 |
| 731 | Ga0501040_0937441 | 3300049576 | Unclassified | 627 |
| 732 | Ga0501041_0000835 | 3300049577 | Bacteria | 16538 |
| 733 | Ga0501041_0006703 | 3300049577 | Bacteria | 6747 |
| 734 | Ga0501041_0009263 | 3300049577 | Bacteria | 5797 |
| 735 | Ga0501041_0145921 | 3300049577 | Bacteria | 1476 |
| 736 | Ga0501042_0024884 | 3300049578 | Bacteria | 4202 |
| 737 | Ga0501042_0033761 | 3300049578 | Bacteria | 3628 |
| 738 | Ga0501042_0045230 | 3300049578 | Bacteria | 3137 |
| 739 | Ga0501042_0094916 | 3300049578 | Bacteria | 2142 |
| 740 | Ga0501042_0136752 | 3300049578 | Unclassified | 1766 |
| 741 | Ga0501043_0177162 | 3300049579 | Unclassified | 1662 |
| 742 | Ga0501043_0220160 | 3300049579 | Bacteria | 1469 |
| 743 | Ga0501046_0003559 | 3300049580 | Bacteria | 14273 |
| 744 | Ga0501046_0004698 | 3300049580 | Bacteria | 12325 |
| 745 | Ga0501046_0018359 | 3300049580 | Bacteria | 5821 |
| 746 | Ga0501046_0031280 | 3300049580 | Bacteria | 4316 |
| 747 | Ga0501046_0374776 | 3300049580 | Bacteria | 1031 |
| 748 | Ga0501047_0777516 | 3300049581 | Bacteria | 773 |
| 749 | Ga0501048_0000395 | 3300049582 | Bacteria | 30360 |
| 750 | Ga0501048_0075391 | 3300049582 | Bacteria | 2379 |
| 751 | Ga0501048_0127417 | 3300049582 | Bacteria | 1800 |
| 752 | Ga0501048_0535514 | 3300049582 | Bacteria | 840 |
| 753 | Ga0501048_0983013 | 3300049582 | Unclassified | 607 |
| 754 | Ga0501067_0176473 | 3300049583 | Bacteria | 1190 |
| 755 | Ga0501067_0378252 | 3300049583 | Bacteria | 790 |
| 756 | Ga0501068_0240630 | 3300049584 | Bacteria | 1152 |
| 757 | Ga0501068_0360137 | 3300049584 | Bacteria | 935 |
| 758 | Ga0501069_0571397 | 3300049585 | Bacteria | 677 |
| 759 | Ga0501069_0597665 | 3300049585 | Bacteria | 662 |
| 760 | Ga0501069_0612584 | 3300049585 | Bacteria | 654 |
| 761 | Ga0501070_0319362 | 3300049586 | Bacteria | 1263 |
| 762 | Ga0501070_1197593 | 3300049586 | Bacteria | 583 |
| 763 | Ga0501071_0002970 | 3300049587 | Bacteria | 10484 |
| 764 | Ga0501071_0132578 | 3300049587 | Bacteria | 1852 |
| 765 | Ga0501071_0397358 | 3300049587 | Bacteria | 1052 |
| 766 | Ga0501072_0029542 | 3300049588 | Bacteria | 4283 |
| 767 | Ga0501072_0432611 | 3300049588 | Bacteria | 1043 |
| 768 | Ga0501072_0748481 | 3300049588 | Bacteria | 767 |
| 769 | Ga0501073_0479957 | 3300049589 | Bacteria | 860 |
| 770 | Ga0501074_0071057 | 3300049590 | Bacteria | 2502 |
| 771 | Ga0501074_1289703 | 3300049590 | Bacteria | 512 |
| 772 | Ga0501075_0008078 | 3300049591 | Bacteria | 7317 |
| 773 | Ga0501075_0191046 | 3300049591 | Bacteria | 1562 |
| 774 | Ga0501075_0338407 | 3300049591 | Bacteria | 1147 |
| 775 | Ga0501075_0913966 | 3300049591 | Unclassified | 667 |
| 776 | Ga0501075_1390903 | 3300049591 | Bacteria | 531 |
| 777 | Ga0501076_0075708 | 3300049592 | Bacteria | 2698 |
| 778 | Ga0501076_0210650 | 3300049592 | Bacteria | 1588 |
| 779 | Ga0501076_0225491 | 3300049592 | Bacteria | 1531 |
| 780 | Ga0501076_0561520 | 3300049592 | Bacteria | 941 |
| 781 | Ga0501076_0644930 | 3300049592 | Unclassified | 874 |
| 782 | Ga0501198_005747 | 3300049649 | Bacteria | 1752 |
| 783 | Ga0501199_000588 | 3300049650 | Bacteria | 3207 |
| 784 | Ga0501201_010914 | 3300049651 | Bacteria | 893 |
| 785 | Ga0501202_001084 | 3300049652 | Bacteria | 4237 |
| 786 | Ga0501206_000681 | 3300049653 | Bacteria | 4130 |
| 787 | Ga0501208_000033 | 3300049655 | Bacteria | 8087 |
| 788 | Ga0501214_082232 | 3300049659 | Bacteria | 543 |
| 789 | Ga0501216_000248 | 3300049660 | Bacteria | 5996 |
| 790 | Ga0501217_000657 | 3300049661 | Bacteria | 5855 |
| 791 | Ga0501223_100251 | 3300049663 | Bacteria | 596 |
| 792 | Ga0501224_050918 | 3300049664 | Bacteria | 635 |
| 793 | Ga0501227_023381 | 3300049665 | Bacteria | 1436 |
| 794 | Ga0501233_000389 | 3300049668 | Bacteria | 6946 |
| 795 | Ga0501235_000044 | 3300049669 | Bacteria | 19898 |
| 796 | Ga0501236_000030 | 3300049670 | Bacteria | 13822 |
| 797 | Ga0501239_000789 | 3300049672 | Bacteria | 2552 |
| 798 | Ga0501242_005697 | 3300049674 | Bacteria | 1408 |
| 799 | Ga0501243_003599 | 3300049675 | Bacteria | 2305 |
| 800 | Ga0501247_070289 | 3300049677 | Bacteria | 551 |
| 801 | Ga0501248_000573 | 3300049678 | Bacteria | 2056 |
| 802 | Ga0501249_001670 | 3300049679 | Bacteria | 4532 |
| 803 | Ga0501251_003246 | 3300049681 | Bacteria | 1614 |
| 804 | Ga0501253_002203 | 3300049683 | Bacteria | 2158 |
| 805 | Ga0501255_001817 | 3300049684 | Bacteria | 1786 |
| 806 | Ga0501256_000607 | 3300049685 | Bacteria | 2365 |
| 807 | Ga0501257_001093 | 3300049686 | Bacteria | 5495 |
| 808 | Ga0501259_036823 | 3300049688 | Bacteria | 947 |
| 809 | Ga0501260_048832 | 3300049689 | Bacteria | 529 |
| 810 | Ga0501261_000708 | 3300049690 | Bacteria | 4171 |
| 811 | Ga0501219_001018 | 3300049703 | Bacteria | 3259 |
| 812 | Ga0501225_0001524 | 3300049705 | Bacteria | 7272 |
| 813 | Ga0501229_001207 | 3300049706 | Bacteria | 3004 |
| 814 | Ga0501245_001430 | 3300049708 | Bacteria | 3092 |
| 815 | Ga0501079_0193080 | 3300049741 | Bacteria | 1589 |
| 816 | Ga0501080_0607402 | 3300049742 | Bacteria | 970 |
| 817 | Ga0501080_1220989 | 3300049742 | Unclassified | 646 |
| 818 | Ga0501081_0471811 | 3300049743 | Bacteria | 933 |
| 819 | Ga0501081_0486350 | 3300049743 | Bacteria | 919 |
| 820 | Ga0501083_0033924 | 3300049744 | Bacteria | 3492 |
| 821 | Ga0501083_1148339 | 3300049744 | Bacteria | 505 |
| 822 | Ga0501232_000579 | 3300049757 | Bacteria | 2508 |
| 823 | Ga0501264_000260 | 3300049761 | Bacteria | 8360 |
| 824 | Ga0501265_001370 | 3300049762 | Bacteria | 2756 |
| 825 | Ga0501266_000269 | 3300049763 | Bacteria | 6816 |
| 826 | Ga0501269_023202 | 3300049766 | Bacteria | 778 |
| 827 | Ga0501270_002952 | 3300049767 | Bacteria | 1791 |
| 828 | Ga0501271_001541 | 3300049768 | Bacteria | 1991 |
| 829 | Ga0501272_000814 | 3300049769 | Bacteria | 2830 |
| 830 | Ga0501273_000418 | 3300049770 | Bacteria | 3385 |
| 831 | Ga0501274_000464 | 3300049771 | Bacteria | 2857 |
| 832 | Ga0501275_019137 | 3300049772 | Bacteria | 824 |
| 833 | Ga0501276_000272 | 3300049773 | Bacteria | 2993 |
| 834 | Ga0501278_000701 | 3300049774 | Bacteria | 2537 |
| 835 | Ga0501279_002409 | 3300049775 | Bacteria | 2456 |
| 836 | Ga0501280_001221 | 3300049776 | Bacteria | 5015 |
| 837 | Ga0501281_00480 | 3300049777 | Bacteria | 3763 |
| 838 | Ga0501282_001620 | 3300049778 | Bacteria | 2486 |
| 839 | Ga0501283_000031 | 3300049779 | Bacteria | 16683 |
| 840 | Ga0501035_0004145 | 3300049822 | Bacteria | 13774 |
| 841 | Ga0501035_0030679 | 3300049822 | Bacteria | 4900 |
| 842 | Ga0501035_0048549 | 3300049822 | Bacteria | 3807 |
| 843 | Ga0501035_0588486 | 3300049822 | Bacteria | 908 |
| 844 | Ga0501044_0198050 | 3300049823 | Bacteria | 1968 |
| 845 | Ga0501044_0666574 | 3300049823 | Unclassified | 928 |
| 846 | Ga0501044_1444713 | 3300049823 | Bacteria | 553 |
| 847 | Ga0501045_0071010 | 3300049824 | Bacteria | 2562 |
| 848 | Ga0501045_1105664 | 3300049824 | Unclassified | 580 |
| 849 | nmdc:mga05p37_21807_c1 | 3300050507 | Bacteria | 7760 |
| 850 | nmdc:mga05p37_242672_c1 | 3300050507 | Bacteria | 2165 |
| 851 | nmdc:mga05p37_539343_c1 | 3300050507 | Bacteria | 1330 |
| 852 | nmdc:mga05p37_745742_c1 | 3300050507 | Bacteria | 1080 |
| 853 | nmdc:mga05p37_83120_c1 | 3300050507 | Bacteria | 3944 |
| 854 | nmdc:mga09592_141745_c1 | 3300050508 | Bacteria | 2072 |
| 855 | nmdc:mga09592_27143_c1 | 3300050508 | Bacteria | 4751 |
| 856 | nmdc:mga09592_275837_c1 | 3300050508 | Bacteria | 1458 |
| 857 | nmdc:mga09592_71664_c1 | 3300050508 | Bacteria | 2941 |
| 858 | nmdc:mga09592_7623_c1 | 3300050508 | Bacteria | 8802 |
| 859 | nmdc:mga0qj67_10014_c1 | 3300050509 | Bacteria | 7071 |
| 860 | nmdc:mga0qj67_1216_c1 | 3300050509 | Bacteria | 17913 |
| 861 | nmdc:mga0qj67_18859_c1 | 3300050509 | Bacteria | 5263 |
| 862 | nmdc:mga0qj67_73283_c1 | 3300050509 | Bacteria | 2735 |
| 863 | nmdc:mga06r32_12279_c1 | 3300050510 | Bacteria | 7725 |
| 864 | nmdc:mga06r32_31560_c1 | 3300050510 | Bacteria | 4977 |
| 865 | nmdc:mga06r32_84525_c1 | 3300050510 | Bacteria | 3093 |
| 866 | nmdc:mga06r32_9935_c1 | 3300050510 | Bacteria | 8588 |
| 867 | nmdc:mga08y16_49455_c1 | 3300050511 | Bacteria | 4401 |
| 868 | nmdc:mga0n895_157515_c1 | 3300050512 | Bacteria | 2302 |
| 869 | nmdc:mga0n895_2194854_c1 | 3300050512 | Bacteria | 508 |
| 870 | nmdc:mga0n895_2230970_c1 | 3300050512 | Bacteria | 503 |
| 871 | nmdc:mga0rr50_1025642_c1 | 3300050513 | Bacteria | 703 |
| 872 | nmdc:mga0rr50_1300338_c1 | 3300050513 | Bacteria | 617 |
| 873 | nmdc:mga0rr50_195989_c1 | 3300050513 | Bacteria | 1658 |
| 874 | nmdc:mga0rr50_734488_c1 | 3300050513 | Bacteria | 843 |
| 875 | nmdc:mga08x19_219847_c1 | 3300050514 | Bacteria | 1305 |
| 876 | nmdc:mga08x19_343142_c1 | 3300050514 | Bacteria | 1042 |
| 877 | nmdc:mga08x19_85669_c1 | 3300050514 | Bacteria | 2074 |
| 878 | nmdc:mga0a205_20209_c1 | 3300050515 | Bacteria | 6282 |
| 879 | nmdc:mga0a205_479739_c1 | 3300050515 | Bacteria | 1102 |
| 880 | Ga0495601_0008311 | 3300053077 | Bacteria | 6127 |
| 881 | Ga0495612_0172330 | 3300053078 | Bacteria | 948 |
| 882 | Ga0495595_0177233 | 3300053084 | Bacteria | 1056 |
| 883 | Ga0495619_0146839 | 3300053085 | Bacteria | 1626 |
| 884 | Ga0495619_0157571 | 3300053085 | Bacteria | 1567 |
| 885 | Ga0501084_0185142 | 3300054114 | Bacteria | 1757 |
| 886 | Ga0501084_0451151 | 3300054114 | Bacteria | 1087 |
| 887 | Ga0501084_1592657 | 3300054114 | Bacteria | 546 |
| 888 | Ga0590071_043061 | 3300059421 | Bacteria | 1088 |
| 889 | Ga0590075_003561 | 3300059424 | Bacteria | 3694 |
| 890 | Ga0590077_077776 | 3300059426 | Bacteria | 762 |
| 891 | Ga0587070_093484 | 3300059491 | Bacteria | 680 |
| 892 | Ga0587079_123978 | 3300059647 | Bacteria | 642 |
| 893 | Ga0501082_0036974 | 3300060353 | Bacteria | 4206 |
| 894 | Ga0501082_1024111 | 3300060353 | Bacteria | 722 |
| 895 | Ga0466962_0304612 | 3300061719 | Bacteria | 789 |
| 896 | Ga0530510_0024573 | 3300061734 | Bacteria | 4301 |
| 897 | Ga0530510_0340977 | 3300061734 | Bacteria | 1125 |
| 898 | Ga0530510_0423946 | 3300061734 | Unclassified | 1004 |
| 899 | Ga0530510_0717799 | 3300061734 | Bacteria | 762 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005327 | Ga0070658_10025278 | Ga0070658_100252782 | 79 |
| 2 | 3300005366 | Ga0070659_100991417 | Ga0070659_1009914171 | 79 |
| 3 | 3300031251 | Ga0265327_10137169 | Ga0265327_101371691 | 80 |
| 4 | 3300005539 | Ga0068853_101220592 | Ga0068853_1012205922 | 82 |
| 5 | 3300026041 | Ga0207639_12144677 | Ga0207639_121446772 | 82 |
| 6 | 3300026116 | Ga0207674_10188878 | Ga0207674_101888782 | 82 |
| 7 | 3300028800 | Ga0265338_10055975 | Ga0265338_100559751 | 82 |
| 8 | 3300005353 | Ga0070669_101072058 | Ga0070669_1010720582 | 83 |
| 9 | 3300006173 | Ga0070716_100397840 | Ga0070716_1003978402 | 83 |
| 10 | 3300025923 | Ga0207681_10969307 | Ga0207681_109693071 | 83 |
| 11 | 3300025939 | Ga0207665_10036430 | Ga0207665_100364302 | 83 |
| 12 | 3300048914 | Ga0496111_0037047 | Ga0496111_0037047_527_790 | 83 |
| 13 | 3300049572 | Ga0501036_1699334 | Ga0501036_1699334_10_285 | 83 |
| 14 | 3300049585 | Ga0501069_0597665 | Ga0501069_0597665_244_519 | 83 |
| 15 | 3300061734 | Ga0530510_0340977 | Ga0530510_0340977_548_835 | 83 |
| 16 | 3300005843 | Ga0068860_100072223 | Ga0068860_1000722234 | 84 |
| 17 | 3300026095 | Ga0207676_10714467 | Ga0207676_107144671 | 84 |
| 18 | 3300028381 | Ga0268264_10024071 | Ga0268264_100240714 | 84 |
| 19 | 3300005327 | Ga0070658_10036820 | Ga0070658_100368202 | 85 |
| 20 | 3300005339 | Ga0070660_100001287 | Ga0070660_1000012873 | 85 |
| 21 | 3300005356 | Ga0070674_100525895 | Ga0070674_1005258952 | 85 |
| 22 | 3300005457 | Ga0070662_100869771 | Ga0070662_1008697711 | 85 |
| 23 | 3300005564 | Ga0070664_100539742 | Ga0070664_1005397422 | 85 |
| 24 | 3300005616 | Ga0068852_100721648 | Ga0068852_1007216482 | 85 |
| 25 | 3300005718 | Ga0068866_10129194 | Ga0068866_101291943 | 85 |
| 26 | 3300005842 | Ga0068858_101307008 | Ga0068858_1013070082 | 85 |
| 27 | 3300006852 | Ga0075433_11601586 | Ga0075433_116015862 | 85 |
| 28 | 3300006871 | Ga0075434_102619501 | Ga0075434_1026195012 | 85 |
| 29 | 3300006880 | Ga0075429_100970612 | Ga0075429_1009706122 | 85 |
| 30 | 3300009098 | Ga0105245_10484637 | Ga0105245_104846373 | 85 |
| 31 | 3300009148 | Ga0105243_10107004 | Ga0105243_101070043 | 85 |
| 32 | 3300009176 | Ga0105242_11108292 | Ga0105242_111082922 | 85 |
| 33 | 3300009177 | Ga0105248_10365102 | Ga0105248_103651021 | 85 |
| 34 | 3300013308 | Ga0157375_11744568 | Ga0157375_117445682 | 85 |
| 35 | 3300014325 | Ga0163163_10246746 | Ga0163163_102467463 | 85 |
| 36 | 3300014325 | Ga0163163_11273369 | Ga0163163_112733692 | 85 |
| 37 | 3300014326 | Ga0157380_10523612 | Ga0157380_105236122 | 85 |
| 38 | 3300014968 | Ga0157379_10614711 | Ga0157379_106147113 | 85 |
| 39 | 3300046539 | Ga0495621_0153174 | Ga0495621_0153174_481_756 | 85 |
| 40 | 3300005335 | Ga0070666_10166291 | Ga0070666_101662912 | 86 |
| 41 | 3300005335 | Ga0070666_10665729 | Ga0070666_106657291 | 86 |
| 42 | 3300005440 | Ga0070705_100785023 | Ga0070705_1007850231 | 86 |
| 43 | 3300005471 | Ga0070698_100108921 | Ga0070698_1001089212 | 86 |
| 44 | 3300005577 | Ga0068857_102009636 | Ga0068857_1020096362 | 86 |
| 45 | 3300005719 | Ga0068861_100189158 | Ga0068861_1001891582 | 86 |
| 46 | 3300006847 | Ga0075431_100004808 | Ga0075431_10000480811 | 86 |
| 47 | 3300006852 | Ga0075433_10153120 | Ga0075433_101531202 | 86 |
| 48 | 3300006880 | Ga0075429_100161294 | Ga0075429_1001612943 | 86 |
| 49 | 3300007076 | Ga0075435_100488466 | Ga0075435_1004884662 | 86 |
| 50 | 3300017792 | Ga0163161_10082723 | Ga0163161_100827232 | 86 |
| 51 | 3300025903 | Ga0207680_10042948 | Ga0207680_100429484 | 86 |
| 52 | 3300025944 | Ga0207661_11515563 | Ga0207661_115155632 | 86 |
| 53 | 3300025945 | Ga0207679_11546983 | Ga0207679_115469832 | 86 |
| 54 | 3300025961 | Ga0207712_10219482 | Ga0207712_102194821 | 86 |
| 55 | 3300026078 | Ga0207702_11877462 | Ga0207702_118774621 | 86 |
| 56 | 3300026118 | Ga0207675_100247114 | Ga0207675_1002471143 | 86 |
| 57 | 3300027907 | Ga0207428_10056972 | Ga0207428_100569724 | 86 |
| 58 | 3300030521 | Ga0307511_10000442 | Ga0307511_1000044239 | 86 |
| 59 | 3300031344 | Ga0265316_10962510 | Ga0265316_109625101 | 86 |
| 60 | 3300032168 | Ga0316593_10161025 | Ga0316593_101610251 | 86 |
| 61 | 3300032168 | Ga0316593_10320698 | Ga0316593_103206982 | 86 |
| 62 | 3300041460 | Ga0451802_1015304 | Ga0451802_1015304_239_544 | 86 |
| 63 | 3300041486 | Ga0451807_1487812 | Ga0451807_1487812_802_1104 | 86 |
| 64 | 3300041494 | Ga0451837_0058787 | Ga0451837_0058787_1742_2038 | 86 |
| 65 | 3300041505 | Ga0451849_0205384 | Ga0451849_0205384_349_651 | 86 |
| 66 | 3300044712 | Ga0453684_1353995 | Ga0453684_1353995_373_657 | 86 |
| 67 | 3300044719 | Ga0466971_0305184 | Ga0466971_0305184_28_294 | 86 |
| 68 | 3300044842 | Ga0466957_0112615 | Ga0466957_0112615_822_1088 | 86 |
| 69 | 3300045051 | Ga0451576_1789170 | Ga0451576_1789170_305_586 | 86 |
| 70 | 3300045836 | Ga0466958_0390972 | Ga0466958_0390972_580_846 | 86 |
| 71 | 3300049588 | Ga0501072_0432611 | Ga0501072_0432611_727_1005 | 86 |
| 72 | 3300049591 | Ga0501075_1390903 | Ga0501075_1390903_43_321 | 86 |
| 73 | 3300050507 | nmdc:mga05p37_539343_c1 | nmdc:mga05p37_539343_c1_316_600 | 86 |
| 74 | 3300050507 | nmdc:mga05p37_745742_c1 | nmdc:mga05p37_745742_c1_49_336 | 86 |
| 75 | 3300050508 | nmdc:mga09592_275837_c1 | nmdc:mga09592_275837_c1_1075_1380 | 86 |
| 76 | 3300050508 | nmdc:mga09592_71664_c1 | nmdc:mga09592_71664_c1_1728_2015 | 86 |
| 77 | 3300050510 | nmdc:mga06r32_9935_c1 | nmdc:mga06r32_9935_c1_6216_6503 | 86 |
| 78 | 3300054114 | Ga0501084_1592657 | Ga0501084_1592657_76_354 | 86 |
| 79 | 3300059647 | Ga0587079_123978 | Ga0587079_123978_249_521 | 86 |
| 80 | 3300061719 | Ga0466962_0304612 | Ga0466962_0304612_72_338 | 86 |
| 81 | 2162886007 | SwRhRL2b_contig_1087855 | SwRhRL2b_0646.00005750 | 87 |
| 82 | 2209111006 | 2214806902 | 2213838361 | 87 |
| 83 | 3300002244 | JGI24742J22300_10077764 | JGI24742J22300_100777642 | 87 |
| 84 | 3300003347 | JGI26128J50194_1005255 | JGI26128J50194_10052552 | 87 |
| 85 | 3300003349 | JGI26129J50193_1011093 | JGI26129J50193_10110932 | 87 |
| 86 | 3300003371 | JGI26145J50221_1000071 | JGI26145J50221_10000714 | 87 |
| 87 | 3300003379 | JGI26142J50222_102611 | JGI26142J50222_1026111 | 87 |
| 88 | 3300003383 | JGI26140J50224_101891 | JGI26140J50224_1018912 | 87 |
| 89 | 3300003392 | JGI26134J50242_101155 | JGI26134J50242_1011551 | 87 |
| 90 | 3300003397 | JGI26133J50247_102041 | JGI26133J50247_1020411 | 87 |
| 91 | 3300003398 | JGI26130J50248_102899 | JGI26130J50248_1028992 | 87 |
| 92 | 3300003405 | JGI26132J50249_103969 | JGI26132J50249_1039691 | 87 |
| 93 | 3300003502 | JGI26143J51219_1006949 | JGI26143J51219_10069491 | 87 |
| 94 | 3300003503 | JGI26141J51220_1002671 | JGI26141J51220_10026712 | 87 |
| 95 | 3300003504 | JGI26138J51218_102793 | JGI26138J51218_1027931 | 87 |
| 96 | 3300004801 | Ga0058860_11408664 | Ga0058860_114086642 | 87 |
| 97 | 3300004801 | Ga0058860_11878411 | Ga0058860_118784112 | 87 |
| 98 | 3300005289 | Ga0065704_10005524 | Ga0065704_100055246 | 87 |
| 99 | 3300005289 | Ga0065704_10287312 | Ga0065704_102873121 | 87 |
| 100 | 3300005290 | Ga0065712_10202387 | Ga0065712_102023872 | 87 |
| 101 | 3300005293 | Ga0065715_10024978 | Ga0065715_100249782 | 87 |
| 102 | 3300005293 | Ga0065715_10466356 | Ga0065715_104663561 | 87 |
| 103 | 3300005293 | Ga0065715_10703734 | Ga0065715_107037341 | 87 |
| 104 | 3300005295 | Ga0065707_10083722 | Ga0065707_100837222 | 87 |
| 105 | 3300005295 | Ga0065707_10112291 | Ga0065707_101122912 | 87 |
| 106 | 3300005295 | Ga0065707_10499672 | Ga0065707_104996721 | 87 |
| 107 | 3300005328 | Ga0070676_10002110 | Ga0070676_100021101 | 87 |
| 108 | 3300005328 | Ga0070676_10811513 | Ga0070676_108115132 | 87 |
| 109 | 3300005329 | Ga0070683_101520820 | Ga0070683_1015208201 | 87 |
| 110 | 3300005330 | Ga0070690_100000128 | Ga0070690_1000001288 | 87 |
| 111 | 3300005330 | Ga0070690_100006058 | Ga0070690_1000060582 | 87 |
| 112 | 3300005330 | Ga0070690_100163496 | Ga0070690_1001634961 | 87 |
| 113 | 3300005331 | Ga0070670_100073412 | Ga0070670_1000734122 | 87 |
| 114 | 3300005331 | Ga0070670_100399030 | Ga0070670_1003990302 | 87 |
| 115 | 3300005333 | Ga0070677_10010132 | Ga0070677_100101322 | 87 |
| 116 | 3300005334 | Ga0068869_100399586 | Ga0068869_1003995861 | 87 |
| 117 | 3300005334 | Ga0068869_101641377 | Ga0068869_1016413772 | 87 |
| 118 | 3300005335 | Ga0070666_10018395 | Ga0070666_100183954 | 87 |
| 119 | 3300005335 | Ga0070666_10529419 | Ga0070666_105294192 | 87 |
| 120 | 3300005336 | Ga0070680_100031316 | Ga0070680_1000313163 | 87 |
| 121 | 3300005336 | Ga0070680_100063420 | Ga0070680_1000634204 | 87 |
| 122 | 3300005336 | Ga0070680_100063732 | Ga0070680_1000637322 | 87 |
| 123 | 3300005336 | Ga0070680_100340015 | Ga0070680_1003400151 | 87 |
| 124 | 3300005336 | Ga0070680_100995570 | Ga0070680_1009955701 | 87 |
| 125 | 3300005337 | Ga0070682_100225353 | Ga0070682_1002253532 | 87 |
| 126 | 3300005337 | Ga0070682_100291316 | Ga0070682_1002913162 | 87 |
| 127 | 3300005337 | Ga0070682_101474018 | Ga0070682_1014740182 | 87 |
| 128 | 3300005338 | Ga0068868_100077174 | Ga0068868_1000771742 | 87 |
| 129 | 3300005338 | Ga0068868_100175469 | Ga0068868_1001754694 | 87 |
| 130 | 3300005338 | Ga0068868_100439819 | Ga0068868_1004398192 | 87 |
| 131 | 3300005339 | Ga0070660_100085519 | Ga0070660_1000855191 | 87 |
| 132 | 3300005339 | Ga0070660_100850866 | Ga0070660_1008508662 | 87 |
| 133 | 3300005340 | Ga0070689_100001472 | Ga0070689_10000147210 | 87 |
| 134 | 3300005340 | Ga0070689_100024154 | Ga0070689_1000241542 | 87 |
| 135 | 3300005340 | Ga0070689_100077278 | Ga0070689_1000772783 | 87 |
| 136 | 3300005341 | Ga0070691_10001906 | Ga0070691_100019069 | 87 |
| 137 | 3300005341 | Ga0070691_10192469 | Ga0070691_101924692 | 87 |
| 138 | 3300005343 | Ga0070687_100000578 | Ga0070687_1000005788 | 87 |
| 139 | 3300005343 | Ga0070687_100006792 | Ga0070687_1000067922 | 87 |
| 140 | 3300005343 | Ga0070687_100154346 | Ga0070687_1001543462 | 87 |
| 141 | 3300005343 | Ga0070687_100567546 | Ga0070687_1005675462 | 87 |
| 142 | 3300005344 | Ga0070661_100002446 | Ga0070661_1000024467 | 87 |
| 143 | 3300005344 | Ga0070661_100031260 | Ga0070661_1000312604 | 87 |
| 144 | 3300005345 | Ga0070692_10003356 | Ga0070692_100033565 | 87 |
| 145 | 3300005345 | Ga0070692_11090787 | Ga0070692_110907872 | 87 |
| 146 | 3300005347 | Ga0070668_100012055 | Ga0070668_1000120551 | 87 |
| 147 | 3300005353 | Ga0070669_100036233 | Ga0070669_1000362333 | 87 |
| 148 | 3300005354 | Ga0070675_100233695 | Ga0070675_1002336951 | 87 |
| 149 | 3300005354 | Ga0070675_100857891 | Ga0070675_1008578911 | 87 |
| 150 | 3300005354 | Ga0070675_101107484 | Ga0070675_1011074841 | 87 |
| 151 | 3300005355 | Ga0070671_100069717 | Ga0070671_1000697173 | 87 |
| 152 | 3300005355 | Ga0070671_100402037 | Ga0070671_1004020372 | 87 |
| 153 | 3300005356 | Ga0070674_100000651 | Ga0070674_10000065112 | 87 |
| 154 | 3300005356 | Ga0070674_100013481 | Ga0070674_1000134813 | 87 |
| 155 | 3300005364 | Ga0070673_100002548 | Ga0070673_1000025484 | 87 |
| 156 | 3300005364 | Ga0070673_100086154 | Ga0070673_1000861541 | 87 |
| 157 | 3300005364 | Ga0070673_100098879 | Ga0070673_1000988792 | 87 |
| 158 | 3300005364 | Ga0070673_100882084 | Ga0070673_1008820842 | 87 |
| 159 | 3300005365 | Ga0070688_100000009 | Ga0070688_10000000965 | 87 |
| 160 | 3300005365 | Ga0070688_100005771 | Ga0070688_1000057719 | 87 |
| 161 | 3300005365 | Ga0070688_100023921 | Ga0070688_1000239212 | 87 |
| 162 | 3300005366 | Ga0070659_100000429 | Ga0070659_10000042927 | 87 |
| 163 | 3300005367 | Ga0070667_100032702 | Ga0070667_1000327025 | 87 |
| 164 | 3300005367 | Ga0070667_100471054 | Ga0070667_1004710542 | 87 |
| 165 | 3300005406 | Ga0070703_10115596 | Ga0070703_101155962 | 87 |
| 166 | 3300005437 | Ga0070710_10468495 | Ga0070710_104684952 | 87 |
| 167 | 3300005438 | Ga0070701_10001023 | Ga0070701_100010238 | 87 |
| 168 | 3300005438 | Ga0070701_10021474 | Ga0070701_100214742 | 87 |
| 169 | 3300005438 | Ga0070701_10101264 | Ga0070701_101012642 | 87 |
| 170 | 3300005438 | Ga0070701_10229959 | Ga0070701_102299593 | 87 |
| 171 | 3300005439 | Ga0070711_101507912 | Ga0070711_1015079121 | 87 |
| 172 | 3300005440 | Ga0070705_100003543 | Ga0070705_1000035433 | 87 |
| 173 | 3300005440 | Ga0070705_100055568 | Ga0070705_1000555682 | 87 |
| 174 | 3300005440 | Ga0070705_100260353 | Ga0070705_1002603532 | 87 |
| 175 | 3300005441 | Ga0070700_100003185 | Ga0070700_1000031857 | 87 |
| 176 | 3300005441 | Ga0070700_100012179 | Ga0070700_1000121792 | 87 |
| 177 | 3300005441 | Ga0070700_100128047 | Ga0070700_1001280473 | 87 |
| 178 | 3300005444 | Ga0070694_100050947 | Ga0070694_1000509475 | 87 |
| 179 | 3300005444 | Ga0070694_100103928 | Ga0070694_1001039284 | 87 |
| 180 | 3300005444 | Ga0070694_100354468 | Ga0070694_1003544682 | 87 |
| 181 | 3300005444 | Ga0070694_100555906 | Ga0070694_1005559061 | 87 |
| 182 | 3300005444 | Ga0070694_100823890 | Ga0070694_1008238901 | 87 |
| 183 | 3300005445 | Ga0070708_100032477 | Ga0070708_1000324773 | 87 |
| 184 | 3300005445 | Ga0070708_100150707 | Ga0070708_1001507073 | 87 |
| 185 | 3300005445 | Ga0070708_100182048 | Ga0070708_1001820484 | 87 |
| 186 | 3300005445 | Ga0070708_100189665 | Ga0070708_1001896654 | 87 |
| 187 | 3300005445 | Ga0070708_100902761 | Ga0070708_1009027612 | 87 |
| 188 | 3300005445 | Ga0070708_101717164 | Ga0070708_1017171642 | 87 |
| 189 | 3300005455 | Ga0070663_100057877 | Ga0070663_1000578776 | 87 |
| 190 | 3300005456 | Ga0070678_100227761 | Ga0070678_1002277612 | 87 |
| 191 | 3300005456 | Ga0070678_101601551 | Ga0070678_1016015511 | 87 |
| 192 | 3300005457 | Ga0070662_100000333 | Ga0070662_10000033326 | 87 |
| 193 | 3300005457 | Ga0070662_100937181 | Ga0070662_1009371812 | 87 |
| 194 | 3300005458 | Ga0070681_10014971 | Ga0070681_100149717 | 87 |
| 195 | 3300005458 | Ga0070681_10117118 | Ga0070681_101171185 | 87 |
| 196 | 3300005459 | Ga0068867_100000209 | Ga0068867_10000020928 | 87 |
| 197 | 3300005459 | Ga0068867_100008954 | Ga0068867_10000895410 | 87 |
| 198 | 3300005459 | Ga0068867_100084748 | Ga0068867_1000847483 | 87 |
| 199 | 3300005459 | Ga0068867_102360266 | Ga0068867_1023602661 | 87 |
| 200 | 3300005466 | Ga0070685_10000197 | Ga0070685_1000019730 | 87 |
| 201 | 3300005466 | Ga0070685_10024398 | Ga0070685_100243984 | 87 |
| 202 | 3300005467 | Ga0070706_100006062 | Ga0070706_10000606212 | 87 |
| 203 | 3300005467 | Ga0070706_100022282 | Ga0070706_1000222824 | 87 |
| 204 | 3300005467 | Ga0070706_100071009 | Ga0070706_1000710095 | 87 |
| 205 | 3300005467 | Ga0070706_100160000 | Ga0070706_1001600003 | 87 |
| 206 | 3300005467 | Ga0070706_100241449 | Ga0070706_1002414492 | 87 |
| 207 | 3300005468 | Ga0070707_100000009 | Ga0070707_100000009135 | 87 |
| 208 | 3300005468 | Ga0070707_100000546 | Ga0070707_10000054629 | 87 |
| 209 | 3300005468 | Ga0070707_100013734 | Ga0070707_1000137343 | 87 |
| 210 | 3300005468 | Ga0070707_100045910 | Ga0070707_1000459102 | 87 |
| 211 | 3300005468 | Ga0070707_100160664 | Ga0070707_1001606642 | 87 |
| 212 | 3300005471 | Ga0070698_100022782 | Ga0070698_1000227825 | 87 |
| 213 | 3300005471 | Ga0070698_100065483 | Ga0070698_1000654832 | 87 |
| 214 | 3300005471 | Ga0070698_100321535 | Ga0070698_1003215352 | 87 |
| 215 | 3300005471 | Ga0070698_100338737 | Ga0070698_1003387372 | 87 |
| 216 | 3300005471 | Ga0070698_101297737 | Ga0070698_1012977372 | 87 |
| 217 | 3300005518 | Ga0070699_100012688 | Ga0070699_1000126884 | 87 |
| 218 | 3300005518 | Ga0070699_100038839 | Ga0070699_1000388393 | 87 |
| 219 | 3300005518 | Ga0070699_100046180 | Ga0070699_1000461804 | 87 |
| 220 | 3300005518 | Ga0070699_100057826 | Ga0070699_1000578263 | 87 |
| 221 | 3300005518 | Ga0070699_100060393 | Ga0070699_1000603933 | 87 |
| 222 | 3300005518 | Ga0070699_100130500 | Ga0070699_1001305002 | 87 |
| 223 | 3300005518 | Ga0070699_100297150 | Ga0070699_1002971502 | 87 |
| 224 | 3300005530 | Ga0070679_100039709 | Ga0070679_1000397094 | 87 |
| 225 | 3300005530 | Ga0070679_100238006 | Ga0070679_1002380062 | 87 |
| 226 | 3300005535 | Ga0070684_100060682 | Ga0070684_1000606825 | 87 |
| 227 | 3300005535 | Ga0070684_100172658 | Ga0070684_1001726581 | 87 |
| 228 | 3300005535 | Ga0070684_101287682 | Ga0070684_1012876822 | 87 |
| 229 | 3300005536 | Ga0070697_100028140 | Ga0070697_1000281405 | 87 |
| 230 | 3300005536 | Ga0070697_100039781 | Ga0070697_1000397815 | 87 |
| 231 | 3300005536 | Ga0070697_100040563 | Ga0070697_1000405634 | 87 |
| 232 | 3300005536 | Ga0070697_100052026 | Ga0070697_1000520261 | 87 |
| 233 | 3300005536 | Ga0070697_100099320 | Ga0070697_1000993203 | 87 |
| 234 | 3300005536 | Ga0070697_100321549 | Ga0070697_1003215492 | 87 |
| 235 | 3300005536 | Ga0070697_100513173 | Ga0070697_1005131732 | 87 |
| 236 | 3300005539 | Ga0068853_102461737 | Ga0068853_1024617372 | 87 |
| 237 | 3300005543 | Ga0070672_100004622 | Ga0070672_1000046226 | 87 |
| 238 | 3300005543 | Ga0070672_100131393 | Ga0070672_1001313932 | 87 |
| 239 | 3300005543 | Ga0070672_100154074 | Ga0070672_1001540743 | 87 |
| 240 | 3300005544 | Ga0070686_100001153 | Ga0070686_1000011534 | 87 |
| 241 | 3300005544 | Ga0070686_100001810 | Ga0070686_1000018108 | 87 |
| 242 | 3300005544 | Ga0070686_100003735 | Ga0070686_1000037353 | 87 |
| 243 | 3300005544 | Ga0070686_100021825 | Ga0070686_1000218252 | 87 |
| 244 | 3300005544 | Ga0070686_100088889 | Ga0070686_1000888892 | 87 |
| 245 | 3300005545 | Ga0070695_100054066 | Ga0070695_1000540664 | 87 |
| 246 | 3300005545 | Ga0070695_100109564 | Ga0070695_1001095642 | 87 |
| 247 | 3300005545 | Ga0070695_100153038 | Ga0070695_1001530382 | 87 |
| 248 | 3300005546 | Ga0070696_100014740 | Ga0070696_1000147404 | 87 |
| 249 | 3300005546 | Ga0070696_100039493 | Ga0070696_1000394934 | 87 |
| 250 | 3300005546 | Ga0070696_100091065 | Ga0070696_1000910652 | 87 |
| 251 | 3300005546 | Ga0070696_100378972 | Ga0070696_1003789723 | 87 |
| 252 | 3300005547 | Ga0070693_100025178 | Ga0070693_1000251784 | 87 |
| 253 | 3300005548 | Ga0070665_100155586 | Ga0070665_1001555862 | 87 |
| 254 | 3300005548 | Ga0070665_100874118 | Ga0070665_1008741182 | 87 |
| 255 | 3300005548 | Ga0070665_101501812 | Ga0070665_1015018121 | 87 |
| 256 | 3300005549 | Ga0070704_100016656 | Ga0070704_1000166564 | 87 |
| 257 | 3300005549 | Ga0070704_100167365 | Ga0070704_1001673652 | 87 |
| 258 | 3300005549 | Ga0070704_100347908 | Ga0070704_1003479081 | 87 |
| 259 | 3300005549 | Ga0070704_100964944 | Ga0070704_1009649442 | 87 |
| 260 | 3300005563 | Ga0068855_100121259 | Ga0068855_1001212593 | 87 |
| 261 | 3300005564 | Ga0070664_100004699 | Ga0070664_1000046999 | 87 |
| 262 | 3300005564 | Ga0070664_100017106 | Ga0070664_1000171062 | 87 |
| 263 | 3300005564 | Ga0070664_100312780 | Ga0070664_1003127803 | 87 |
| 264 | 3300005577 | Ga0068857_100128798 | Ga0068857_1001287982 | 87 |
| 265 | 3300005578 | Ga0068854_100190667 | Ga0068854_1001906672 | 87 |
| 266 | 3300005615 | Ga0070702_100082706 | Ga0070702_1000827061 | 87 |
| 267 | 3300005615 | Ga0070702_100901826 | Ga0070702_1009018261 | 87 |
| 268 | 3300005616 | Ga0068852_100141629 | Ga0068852_1001416294 | 87 |
| 269 | 3300005617 | Ga0068859_100001080 | Ga0068859_10000108031 | 87 |
| 270 | 3300005617 | Ga0068859_100125401 | Ga0068859_1001254015 | 87 |
| 271 | 3300005617 | Ga0068859_100309542 | Ga0068859_1003095422 | 87 |
| 272 | 3300005618 | Ga0068864_100017267 | Ga0068864_1000172676 | 87 |
| 273 | 3300005718 | Ga0068866_10028397 | Ga0068866_100283973 | 87 |
| 274 | 3300005718 | Ga0068866_10062640 | Ga0068866_100626402 | 87 |
| 275 | 3300005719 | Ga0068861_100129149 | Ga0068861_1001291493 | 87 |
| 276 | 3300005719 | Ga0068861_101260593 | Ga0068861_1012605932 | 87 |
| 277 | 3300005719 | Ga0068861_101999900 | Ga0068861_1019999001 | 87 |
| 278 | 3300005840 | Ga0068870_10015488 | Ga0068870_100154887 | 87 |
| 279 | 3300005841 | Ga0068863_101939669 | Ga0068863_1019396692 | 87 |
| 280 | 3300005842 | Ga0068858_100124107 | Ga0068858_1001241073 | 87 |
| 281 | 3300005842 | Ga0068858_101435914 | Ga0068858_1014359142 | 87 |
| 282 | 3300005843 | Ga0068860_100034338 | Ga0068860_1000343386 | 87 |
| 283 | 3300005843 | Ga0068860_100409080 | Ga0068860_1004090802 | 87 |
| 284 | 3300005843 | Ga0068860_100438485 | Ga0068860_1004384852 | 87 |
| 285 | 3300005844 | Ga0068862_100080379 | Ga0068862_1000803792 | 87 |
| 286 | 3300005937 | Ga0081455_10000457 | Ga0081455_1000045738 | 87 |
| 287 | 3300006028 | Ga0070717_10103093 | Ga0070717_101030934 | 87 |
| 288 | 3300006058 | Ga0075432_10002652 | Ga0075432_100026527 | 87 |
| 289 | 3300006163 | Ga0070715_10507423 | Ga0070715_105074232 | 87 |
| 290 | 3300006163 | Ga0070715_10750485 | Ga0070715_107504852 | 87 |
| 291 | 3300006173 | Ga0070716_100022519 | Ga0070716_1000225192 | 87 |
| 292 | 3300006173 | Ga0070716_100114975 | Ga0070716_1001149752 | 87 |
| 293 | 3300006194 | Ga0075427_10006876 | Ga0075427_100068762 | 87 |
| 294 | 3300006237 | Ga0097621_100003109 | Ga0097621_1000031097 | 87 |
| 295 | 3300006237 | Ga0097621_100030403 | Ga0097621_1000304033 | 87 |
| 296 | 3300006358 | Ga0068871_100004722 | Ga0068871_1000047222 | 87 |
| 297 | 3300006358 | Ga0068871_100010448 | Ga0068871_1000104482 | 87 |
| 298 | 3300006358 | Ga0068871_100588775 | Ga0068871_1005887752 | 87 |
| 299 | 3300006358 | Ga0068871_101054234 | Ga0068871_1010542342 | 87 |
| 300 | 3300006844 | Ga0075428_101316803 | Ga0075428_1013168032 | 87 |
| 301 | 3300006844 | Ga0075428_102240597 | Ga0075428_1022405972 | 87 |
| 302 | 3300006846 | Ga0075430_100000800 | Ga0075430_10000080022 | 87 |
| 303 | 3300006846 | Ga0075430_100009708 | Ga0075430_1000097083 | 87 |
| 304 | 3300006846 | Ga0075430_100011790 | Ga0075430_1000117907 | 87 |
| 305 | 3300006846 | Ga0075430_100299651 | Ga0075430_1002996513 | 87 |
| 306 | 3300006846 | Ga0075430_100341414 | Ga0075430_1003414142 | 87 |
| 307 | 3300006847 | Ga0075431_100019017 | Ga0075431_1000190178 | 87 |
| 308 | 3300006847 | Ga0075431_100033801 | Ga0075431_1000338015 | 87 |
| 309 | 3300006847 | Ga0075431_100104523 | Ga0075431_1001045232 | 87 |
| 310 | 3300006852 | Ga0075433_10011787 | Ga0075433_100117877 | 87 |
| 311 | 3300006852 | Ga0075433_10347961 | Ga0075433_103479612 | 87 |
| 312 | 3300006871 | Ga0075434_100038974 | Ga0075434_1000389744 | 87 |
| 313 | 3300006871 | Ga0075434_100209843 | Ga0075434_1002098432 | 87 |
| 314 | 3300006871 | Ga0075434_100907933 | Ga0075434_1009079332 | 87 |
| 315 | 3300006880 | Ga0075429_100000498 | Ga0075429_1000004989 | 87 |
| 316 | 3300006880 | Ga0075429_100015569 | Ga0075429_1000155692 | 87 |
| 317 | 3300006880 | Ga0075429_100052476 | Ga0075429_1000524763 | 87 |
| 318 | 3300006880 | Ga0075429_100697684 | Ga0075429_1006976842 | 87 |
| 319 | 3300006881 | Ga0068865_100001653 | Ga0068865_1000016539 | 87 |
| 320 | 3300006881 | Ga0068865_100345777 | Ga0068865_1003457772 | 87 |
| 321 | 3300006914 | Ga0075436_100208425 | Ga0075436_1002084252 | 87 |
| 322 | 3300006931 | Ga0097620_100001080 | Ga0097620_1000010808 | 87 |
| 323 | 3300006931 | Ga0097620_100125408 | Ga0097620_1001254085 | 87 |
| 324 | 3300006931 | Ga0097620_100309513 | Ga0097620_1003095132 | 87 |
| 325 | 3300007076 | Ga0075435_100007648 | Ga0075435_1000076483 | 87 |
| 326 | 3300007076 | Ga0075435_100489426 | Ga0075435_1004894262 | 87 |
| 327 | 3300007076 | Ga0075435_101852796 | Ga0075435_1018527961 | 87 |
| 328 | 3300007265 | Ga0099794_10044108 | Ga0099794_100441082 | 87 |
| 329 | 3300009094 | Ga0111539_10072221 | Ga0111539_100722211 | 87 |
| 330 | 3300009094 | Ga0111539_13264804 | Ga0111539_132648042 | 87 |
| 331 | 3300009098 | Ga0105245_10004374 | Ga0105245_100043748 | 87 |
| 332 | 3300009098 | Ga0105245_11946933 | Ga0105245_119469331 | 87 |
| 333 | 3300009147 | Ga0114129_10012324 | Ga0114129_100123244 | 87 |
| 334 | 3300009147 | Ga0114129_10105393 | Ga0114129_101053933 | 87 |
| 335 | 3300009147 | Ga0114129_10129962 | Ga0114129_101299624 | 87 |
| 336 | 3300009147 | Ga0114129_10322375 | Ga0114129_103223753 | 87 |
| 337 | 3300009147 | Ga0114129_11912634 | Ga0114129_119126341 | 87 |
| 338 | 3300009147 | Ga0114129_12014761 | Ga0114129_120147612 | 87 |
| 339 | 3300009147 | Ga0114129_12485541 | Ga0114129_124855412 | 87 |
| 340 | 3300009147 | Ga0114129_12493535 | Ga0114129_124935352 | 87 |
| 341 | 3300009148 | Ga0105243_10007248 | Ga0105243_100072487 | 87 |
| 342 | 3300009148 | Ga0105243_11983231 | Ga0105243_119832312 | 87 |
| 343 | 3300009174 | Ga0105241_10170657 | Ga0105241_101706573 | 87 |
| 344 | 3300009174 | Ga0105241_10368325 | Ga0105241_103683252 | 87 |
| 345 | 3300009176 | Ga0105242_10006995 | Ga0105242_100069953 | 87 |
| 346 | 3300009176 | Ga0105242_10021035 | Ga0105242_100210355 | 87 |
| 347 | 3300009545 | Ga0105237_11952752 | Ga0105237_119527522 | 87 |
| 348 | 3300009551 | Ga0105238_12111700 | Ga0105238_121117001 | 87 |
| 349 | 3300010375 | Ga0105239_10025271 | Ga0105239_100252712 | 87 |
| 350 | 3300011119 | Ga0105246_10002042 | Ga0105246_100020429 | 87 |
| 351 | 3300013102 | Ga0157371_10844268 | Ga0157371_108442681 | 87 |
| 352 | 3300013102 | Ga0157371_11493232 | Ga0157371_114932322 | 87 |
| 353 | 3300013104 | Ga0157370_11057600 | Ga0157370_110576002 | 87 |
| 354 | 3300013105 | Ga0157369_10143602 | Ga0157369_101436024 | 87 |
| 355 | 3300013296 | Ga0157374_10050010 | Ga0157374_100500103 | 87 |
| 356 | 3300013296 | Ga0157374_10073020 | Ga0157374_100730203 | 87 |
| 357 | 3300013296 | Ga0157374_11938514 | Ga0157374_119385142 | 87 |
| 358 | 3300013296 | Ga0157374_12065493 | Ga0157374_120654931 | 87 |
| 359 | 3300013297 | Ga0157378_10034081 | Ga0157378_100340812 | 87 |
| 360 | 3300013297 | Ga0157378_10054860 | Ga0157378_100548606 | 87 |
| 361 | 3300013297 | Ga0157378_10108765 | Ga0157378_101087655 | 87 |
| 362 | 3300013297 | Ga0157378_10158430 | Ga0157378_101584302 | 87 |
| 363 | 3300013306 | Ga0163162_10400230 | Ga0163162_104002302 | 87 |
| 364 | 3300013307 | Ga0157372_12805019 | Ga0157372_128050192 | 87 |
| 365 | 3300013307 | Ga0157372_13001236 | Ga0157372_130012361 | 87 |
| 366 | 3300013308 | Ga0157375_10028798 | Ga0157375_100287986 | 87 |
| 367 | 3300013308 | Ga0157375_11254923 | Ga0157375_112549232 | 87 |
| 368 | 3300014326 | Ga0157380_10003854 | Ga0157380_1000385410 | 87 |
| 369 | 3300014326 | Ga0157380_10032243 | Ga0157380_100322435 | 87 |
| 370 | 3300014326 | Ga0157380_10242008 | Ga0157380_102420082 | 87 |
| 371 | 3300014326 | Ga0157380_10830964 | Ga0157380_108309642 | 87 |
| 372 | 3300014745 | Ga0157377_10026012 | Ga0157377_100260124 | 87 |
| 373 | 3300014745 | Ga0157377_10769502 | Ga0157377_107695022 | 87 |
| 374 | 3300014968 | Ga0157379_10219236 | Ga0157379_102192362 | 87 |
| 375 | 3300014968 | Ga0157379_10679873 | Ga0157379_106798732 | 87 |
| 376 | 3300014969 | Ga0157376_10001862 | Ga0157376_1000186214 | 87 |
| 377 | 3300014969 | Ga0157376_10002625 | Ga0157376_100026257 | 87 |
| 378 | 3300014969 | Ga0157376_10481382 | Ga0157376_104813822 | 87 |
| 379 | 3300020070 | Ga0206356_11224672 | Ga0206356_112246722 | 87 |
| 380 | 3300025315 | Ga0207697_10155248 | Ga0207697_101552482 | 87 |
| 381 | 3300025885 | Ga0207653_10083849 | Ga0207653_100838492 | 87 |
| 382 | 3300025893 | Ga0207682_10034784 | Ga0207682_100347842 | 87 |
| 383 | 3300025899 | Ga0207642_10038684 | Ga0207642_100386842 | 87 |
| 384 | 3300025900 | Ga0207710_10659884 | Ga0207710_106598842 | 87 |
| 385 | 3300025901 | Ga0207688_10028580 | Ga0207688_100285804 | 87 |
| 386 | 3300025903 | Ga0207680_10030317 | Ga0207680_100303173 | 87 |
| 387 | 3300025903 | Ga0207680_10419713 | Ga0207680_104197132 | 87 |
| 388 | 3300025903 | Ga0207680_11238509 | Ga0207680_112385091 | 87 |
| 389 | 3300025904 | Ga0207647_10245966 | Ga0207647_102459661 | 87 |
| 390 | 3300025905 | Ga0207685_10106452 | Ga0207685_101064523 | 87 |
| 391 | 3300025905 | Ga0207685_10167245 | Ga0207685_101672451 | 87 |
| 392 | 3300025905 | Ga0207685_10461276 | Ga0207685_104612761 | 87 |
| 393 | 3300025906 | Ga0207699_10637505 | Ga0207699_106375052 | 87 |
| 394 | 3300025907 | Ga0207645_10000319 | Ga0207645_1000031917 | 87 |
| 395 | 3300025908 | Ga0207643_10084365 | Ga0207643_100843652 | 87 |
| 396 | 3300025910 | Ga0207684_10000354 | Ga0207684_1000035411 | 87 |
| 397 | 3300025910 | Ga0207684_10004998 | Ga0207684_100049985 | 87 |
| 398 | 3300025910 | Ga0207684_10011565 | Ga0207684_100115657 | 87 |
| 399 | 3300025910 | Ga0207684_10194665 | Ga0207684_101946652 | 87 |
| 400 | 3300025910 | Ga0207684_10239901 | Ga0207684_102399013 | 87 |
| 401 | 3300025910 | Ga0207684_10246606 | Ga0207684_102466062 | 87 |
| 402 | 3300025910 | Ga0207684_10305748 | Ga0207684_103057482 | 87 |
| 403 | 3300025910 | Ga0207684_10556385 | Ga0207684_105563852 | 87 |
| 404 | 3300025911 | Ga0207654_10926235 | Ga0207654_109262351 | 87 |
| 405 | 3300025912 | Ga0207707_10026688 | Ga0207707_100266884 | 87 |
| 406 | 3300025912 | Ga0207707_10128513 | Ga0207707_101285131 | 87 |
| 407 | 3300025912 | Ga0207707_10873013 | Ga0207707_108730132 | 87 |
| 408 | 3300025914 | Ga0207671_10934643 | Ga0207671_109346431 | 87 |
| 409 | 3300025916 | Ga0207663_10174053 | Ga0207663_101740533 | 87 |
| 410 | 3300025916 | Ga0207663_11740864 | Ga0207663_117408641 | 87 |
| 411 | 3300025917 | Ga0207660_10006168 | Ga0207660_100061689 | 87 |
| 412 | 3300025917 | Ga0207660_10025604 | Ga0207660_100256043 | 87 |
| 413 | 3300025917 | Ga0207660_10118004 | Ga0207660_101180042 | 87 |
| 414 | 3300025918 | Ga0207662_10000281 | Ga0207662_1000028119 | 87 |
| 415 | 3300025918 | Ga0207662_10010315 | Ga0207662_100103158 | 87 |
| 416 | 3300025918 | Ga0207662_10080299 | Ga0207662_100802992 | 87 |
| 417 | 3300025918 | Ga0207662_10624426 | Ga0207662_106244262 | 87 |
| 418 | 3300025919 | Ga0207657_10001887 | Ga0207657_1000188716 | 87 |
| 419 | 3300025920 | Ga0207649_10055832 | Ga0207649_100558323 | 87 |
| 420 | 3300025920 | Ga0207649_10184042 | Ga0207649_101840422 | 87 |
| 421 | 3300025921 | Ga0207652_10027975 | Ga0207652_100279755 | 87 |
| 422 | 3300025921 | Ga0207652_10115214 | Ga0207652_101152143 | 87 |
| 423 | 3300025922 | Ga0207646_10000011 | Ga0207646_10000011155 | 87 |
| 424 | 3300025922 | Ga0207646_10000252 | Ga0207646_1000025265 | 87 |
| 425 | 3300025922 | Ga0207646_10089293 | Ga0207646_100892932 | 87 |
| 426 | 3300025922 | Ga0207646_10233693 | Ga0207646_102336932 | 87 |
| 427 | 3300025923 | Ga0207681_10071862 | Ga0207681_100718623 | 87 |
| 428 | 3300025923 | Ga0207681_10718461 | Ga0207681_107184611 | 87 |
| 429 | 3300025925 | Ga0207650_10069245 | Ga0207650_100692453 | 87 |
| 430 | 3300025926 | Ga0207659_10032437 | Ga0207659_100324371 | 87 |
| 431 | 3300025926 | Ga0207659_10069014 | Ga0207659_100690143 | 87 |
| 432 | 3300025927 | Ga0207687_10030538 | Ga0207687_100305384 | 87 |
| 433 | 3300025927 | Ga0207687_10181887 | Ga0207687_101818872 | 87 |
| 434 | 3300025931 | Ga0207644_10043162 | Ga0207644_100431622 | 87 |
| 435 | 3300025931 | Ga0207644_10374307 | Ga0207644_103743073 | 87 |
| 436 | 3300025932 | Ga0207690_10020246 | Ga0207690_100202467 | 87 |
| 437 | 3300025932 | Ga0207690_10816009 | Ga0207690_108160091 | 87 |
| 438 | 3300025933 | Ga0207706_10000428 | Ga0207706_1000042830 | 87 |
| 439 | 3300025933 | Ga0207706_10678054 | Ga0207706_106780542 | 87 |
| 440 | 3300025934 | Ga0207686_10009930 | Ga0207686_100099304 | 87 |
| 441 | 3300025934 | Ga0207686_10035215 | Ga0207686_100352152 | 87 |
| 442 | 3300025934 | Ga0207686_10332146 | Ga0207686_103321462 | 87 |
| 443 | 3300025935 | Ga0207709_10152022 | Ga0207709_101520223 | 87 |
| 444 | 3300025936 | Ga0207670_10000024 | Ga0207670_10000024111 | 87 |
| 445 | 3300025936 | Ga0207670_10016294 | Ga0207670_100162942 | 87 |
| 446 | 3300025936 | Ga0207670_10363737 | Ga0207670_103637372 | 87 |
| 447 | 3300025937 | Ga0207669_10002413 | Ga0207669_100024139 | 87 |
| 448 | 3300025937 | Ga0207669_10049674 | Ga0207669_100496742 | 87 |
| 449 | 3300025938 | Ga0207704_10039635 | Ga0207704_100396353 | 87 |
| 450 | 3300025938 | Ga0207704_10269240 | Ga0207704_102692403 | 87 |
| 451 | 3300025939 | Ga0207665_10032938 | Ga0207665_100329383 | 87 |
| 452 | 3300025940 | Ga0207691_10000726 | Ga0207691_100007269 | 87 |
| 453 | 3300025940 | Ga0207691_10044629 | Ga0207691_100446293 | 87 |
| 454 | 3300025940 | Ga0207691_10063839 | Ga0207691_100638393 | 87 |
| 455 | 3300025941 | Ga0207711_10301706 | Ga0207711_103017062 | 87 |
| 456 | 3300025941 | Ga0207711_10340992 | Ga0207711_103409922 | 87 |
| 457 | 3300025941 | Ga0207711_11455700 | Ga0207711_114557001 | 87 |
| 458 | 3300025942 | Ga0207689_10055849 | Ga0207689_100558494 | 87 |
| 459 | 3300025942 | Ga0207689_10613735 | Ga0207689_106137353 | 87 |
| 460 | 3300025944 | Ga0207661_10126569 | Ga0207661_101265692 | 87 |
| 461 | 3300025945 | Ga0207679_10001492 | Ga0207679_1000149213 | 87 |
| 462 | 3300025945 | Ga0207679_10007191 | Ga0207679_100071919 | 87 |
| 463 | 3300025945 | Ga0207679_10113288 | Ga0207679_101132883 | 87 |
| 464 | 3300025949 | Ga0207667_10131926 | Ga0207667_101319262 | 87 |
| 465 | 3300025960 | Ga0207651_10187581 | Ga0207651_101875812 | 87 |
| 466 | 3300025960 | Ga0207651_10334824 | Ga0207651_103348242 | 87 |
| 467 | 3300025960 | Ga0207651_10712446 | Ga0207651_107124462 | 87 |
| 468 | 3300025961 | Ga0207712_10074085 | Ga0207712_100740854 | 87 |
| 469 | 3300025972 | Ga0207668_10006294 | Ga0207668_100062942 | 87 |
| 470 | 3300025981 | Ga0207640_10075813 | Ga0207640_100758132 | 87 |
| 471 | 3300025986 | Ga0207658_10274977 | Ga0207658_102749774 | 87 |
| 472 | 3300026023 | Ga0207677_10073522 | Ga0207677_100735223 | 87 |
| 473 | 3300026023 | Ga0207677_10486840 | Ga0207677_104868402 | 87 |
| 474 | 3300026023 | Ga0207677_11036051 | Ga0207677_110360512 | 87 |
| 475 | 3300026035 | Ga0207703_10364911 | Ga0207703_103649113 | 87 |
| 476 | 3300026041 | Ga0207639_12030666 | Ga0207639_120306662 | 87 |
| 477 | 3300026067 | Ga0207678_10229241 | Ga0207678_102292412 | 87 |
| 478 | 3300026067 | Ga0207678_11489676 | Ga0207678_114896761 | 87 |
| 479 | 3300026075 | Ga0207708_10000780 | Ga0207708_1000078029 | 87 |
| 480 | 3300026075 | Ga0207708_10001713 | Ga0207708_1000171310 | 87 |
| 481 | 3300026075 | Ga0207708_10139591 | Ga0207708_101395914 | 87 |
| 482 | 3300026089 | Ga0207648_10002186 | Ga0207648_1000218618 | 87 |
| 483 | 3300026089 | Ga0207648_10013209 | Ga0207648_1001320910 | 87 |
| 484 | 3300026089 | Ga0207648_10749583 | Ga0207648_107495831 | 87 |
| 485 | 3300026095 | Ga0207676_10073748 | Ga0207676_100737483 | 87 |
| 486 | 3300026116 | Ga0207674_10025795 | Ga0207674_100257953 | 87 |
| 487 | 3300026118 | Ga0207675_100162689 | Ga0207675_1001626893 | 87 |
| 488 | 3300026118 | Ga0207675_101565148 | Ga0207675_1015651482 | 87 |
| 489 | 3300026118 | Ga0207675_101954660 | Ga0207675_1019546602 | 87 |
| 490 | 3300026121 | Ga0207683_10000382 | Ga0207683_1000038218 | 87 |
| 491 | 3300026121 | Ga0207683_10198912 | Ga0207683_101989123 | 87 |
| 492 | 3300026142 | Ga0207698_10579083 | Ga0207698_105790833 | 87 |
| 493 | 3300027252 | Ga0209973_1008178 | Ga0209973_10081782 | 87 |
| 494 | 3300027360 | Ga0209969_1000206 | Ga0209969_10002069 | 87 |
| 495 | 3300027364 | Ga0209967_1000013 | Ga0209967_100001324 | 87 |
| 496 | 3300027378 | Ga0209981_1000720 | Ga0209981_10007203 | 87 |
| 497 | 3300027378 | Ga0209981_1005981 | Ga0209981_10059812 | 87 |
| 498 | 3300027395 | Ga0209996_1000180 | Ga0209996_10001807 | 87 |
| 499 | 3300027424 | Ga0209984_1000021 | Ga0209984_100002111 | 87 |
| 500 | 3300027462 | Ga0210000_1000181 | Ga0210000_10001814 | 87 |
| 501 | 3300027471 | Ga0209995_1000006 | Ga0209995_100000635 | 87 |
| 502 | 3300027471 | Ga0209995_1018382 | Ga0209995_10183821 | 87 |
| 503 | 3300027526 | Ga0209968_1000042 | Ga0209968_100004217 | 87 |
| 504 | 3300027526 | Ga0209968_1016708 | Ga0209968_10167083 | 87 |
| 505 | 3300027526 | Ga0209968_1054211 | Ga0209968_10542112 | 87 |
| 506 | 3300027543 | Ga0209999_1000492 | Ga0209999_10004926 | 87 |
| 507 | 3300027543 | Ga0209999_1063056 | Ga0209999_10630562 | 87 |
| 508 | 3300027552 | Ga0209982_1079918 | Ga0209982_10799181 | 87 |
| 509 | 3300027614 | Ga0209970_1000462 | Ga0209970_10004624 | 87 |
| 510 | 3300027614 | Ga0209970_1050183 | Ga0209970_10501832 | 87 |
| 511 | 3300027617 | Ga0210002_1000005 | Ga0210002_100000530 | 87 |
| 512 | 3300027665 | Ga0209983_1001278 | Ga0209983_10012786 | 87 |
| 513 | 3300027665 | Ga0209983_1077018 | Ga0209983_10770182 | 87 |
| 514 | 3300027682 | Ga0209971_1000482 | Ga0209971_10004828 | 87 |
| 515 | 3300027682 | Ga0209971_1019563 | Ga0209971_10195632 | 87 |
| 516 | 3300027682 | Ga0209971_1107834 | Ga0209971_11078342 | 87 |
| 517 | 3300027695 | Ga0209966_1000092 | Ga0209966_100009228 | 87 |
| 518 | 3300027695 | Ga0209966_1001168 | Ga0209966_10011686 | 87 |
| 519 | 3300027717 | Ga0209998_10000049 | Ga0209998_1000004913 | 87 |
| 520 | 3300027717 | Ga0209998_10015756 | Ga0209998_100157564 | 87 |
| 521 | 3300027876 | Ga0209974_10004159 | Ga0209974_100041592 | 87 |
| 522 | 3300027876 | Ga0209974_10005801 | Ga0209974_100058016 | 87 |
| 523 | 3300027876 | Ga0209974_10087637 | Ga0209974_100876372 | 87 |
| 524 | 3300027876 | Ga0209974_10150797 | Ga0209974_101507972 | 87 |
| 525 | 3300027907 | Ga0207428_10001066 | Ga0207428_100010669 | 87 |
| 526 | 3300028379 | Ga0268266_10308359 | Ga0268266_103083593 | 87 |
| 527 | 3300028379 | Ga0268266_11340318 | Ga0268266_113403181 | 87 |
| 528 | 3300028380 | Ga0268265_10546336 | Ga0268265_105463362 | 87 |
| 529 | 3300028380 | Ga0268265_11376484 | Ga0268265_113764842 | 87 |
| 530 | 3300028381 | Ga0268264_10046757 | Ga0268264_100467576 | 87 |
| 531 | 3300028381 | Ga0268264_10374807 | Ga0268264_103748072 | 87 |
| 532 | 3300031344 | Ga0265316_10913647 | Ga0265316_109136471 | 87 |
| 533 | 3300031548 | Ga0307408_100031691 | Ga0307408_1000316912 | 87 |
| 534 | 3300031548 | Ga0307408_100616472 | Ga0307408_1006164721 | 87 |
| 535 | 3300031731 | Ga0307405_10004671 | Ga0307405_100046713 | 87 |
| 536 | 3300031731 | Ga0307405_10830788 | Ga0307405_108307882 | 87 |
| 537 | 3300031731 | Ga0307405_11467576 | Ga0307405_114675761 | 87 |
| 538 | 3300031824 | Ga0307413_11044500 | Ga0307413_110445002 | 87 |
| 539 | 3300031852 | Ga0307410_10026168 | Ga0307410_100261683 | 87 |
| 540 | 3300031852 | Ga0307410_10353701 | Ga0307410_103537013 | 87 |
| 541 | 3300031901 | Ga0307406_10146134 | Ga0307406_101461344 | 87 |
| 542 | 3300031903 | Ga0307407_10061421 | Ga0307407_100614212 | 87 |
| 543 | 3300031903 | Ga0307407_11087645 | Ga0307407_110876452 | 87 |
| 544 | 3300031911 | Ga0307412_10012004 | Ga0307412_100120042 | 87 |
| 545 | 3300031911 | Ga0307412_10546556 | Ga0307412_105465562 | 87 |
| 546 | 3300031995 | Ga0307409_100075929 | Ga0307409_1000759293 | 87 |
| 547 | 3300031995 | Ga0307409_100136108 | Ga0307409_1001361084 | 87 |
| 548 | 3300032002 | Ga0307416_100024445 | Ga0307416_1000244453 | 87 |
| 549 | 3300032002 | Ga0307416_100782578 | Ga0307416_1007825781 | 87 |
| 550 | 3300032002 | Ga0307416_102807870 | Ga0307416_1028078702 | 87 |
| 551 | 3300032004 | Ga0307414_10344425 | Ga0307414_103444251 | 87 |
| 552 | 3300032004 | Ga0307414_11658893 | Ga0307414_116588932 | 87 |
| 553 | 3300032005 | Ga0307411_10003709 | Ga0307411_100037093 | 87 |
| 554 | 3300032005 | Ga0307411_10016375 | Ga0307411_100163753 | 87 |
| 555 | 3300032126 | Ga0307415_100038079 | Ga0307415_1000380794 | 87 |
| 556 | 3300034819 | Ga0373958_0163399 | Ga0373958_0163399_281_544 | 87 |
| 557 | 3300035083 | Ga0373926_0045995 | Ga0373926_0045995_548_811 | 87 |
| 558 | 3300035085 | Ga0373929_0193341 | Ga0373929_0193341_211_474 | 87 |
| 559 | 3300035086 | Ga0373934_0061495 | Ga0373934_0061495_1050_1313 | 87 |
| 560 | 3300035111 | Ga0373923_0083806 | Ga0373923_0083806_876_1139 | 87 |
| 561 | 3300035115 | Ga0373941_0127870 | Ga0373941_0127870_83_346 | 87 |
| 562 | 3300035115 | Ga0373941_0240033 | Ga0373941_0240033_112_375 | 87 |
| 563 | 3300035116 | Ga0373945_0110829 | Ga0373945_0110829_674_937 | 87 |
| 564 | 3300035116 | Ga0373945_0134495 | Ga0373945_0134495_564_827 | 87 |
| 565 | 3300035119 | Ga0373956_0277813 | Ga0373956_0277813_104_367 | 87 |
| 566 | 3300035120 | Ga0373957_0453771 | Ga0373957_0453771_70_333 | 87 |
| 567 | 3300035121 | Ga0373960_0085052 | Ga0373960_0085052_719_982 | 87 |
| 568 | 3300035121 | Ga0373960_0103335 | Ga0373960_0103335_222_485 | 87 |
| 569 | 3300035170 | Ga0373943_0026835 | Ga0373943_0026835_1718_1981 | 87 |
| 570 | 3300035171 | Ga0373946_0123635 | Ga0373946_0123635_640_903 | 87 |
| 571 | 3300035172 | Ga0373955_0134329 | Ga0373955_0134329_547_810 | 87 |
| 572 | 3300035207 | Ga0373942_0015789 | Ga0373942_0015789_1073_1336 | 87 |
| 573 | 3300035241 | Ga0373961_0369439 | Ga0373961_0369439_76_339 | 87 |
| 574 | 3300035242 | Ga0373962_0083044 | Ga0373962_0083044_263_526 | 87 |
| 575 | 3300035410 | Ga0373924_0368847 | Ga0373924_0368847_204_467 | 87 |
| 576 | 3300035691 | Ga0373931_0185987 | Ga0373931_0185987_326_589 | 87 |
| 577 | 3300035691 | Ga0373931_0195960 | Ga0373931_0195960_19_282 | 87 |
| 578 | 3300035691 | Ga0373931_0908606 | Ga0373931_0908606_172_435 | 87 |
| 579 | 3300035692 | Ga0373935_0044283 | Ga0373935_0044283_1287_1550 | 87 |
| 580 | 3300035692 | Ga0373935_0538420 | Ga0373935_0538420_257_520 | 87 |
| 581 | 3300035695 | Ga0373927_0035547 | Ga0373927_0035547_958_1221 | 87 |
| 582 | 3300035724 | Ga0373933_0032880 | Ga0373933_0032880_575_838 | 87 |
| 583 | 3300035725 | Ga0373947_0026956 | Ga0373947_0026956_1601_1864 | 87 |
| 584 | 3300035725 | Ga0373947_1063830 | Ga0373947_1063830_22_285 | 87 |
| 585 | 3300036401 | Ga0373937_0569003 | Ga0373937_0569003_379_642 | 87 |
| 586 | 3300037068 | Ga0373925_0522369 | Ga0373925_0522369_485_748 | 87 |
| 587 | 3300038996 | Ga0242420_049477 | Ga0242420_049477_56_319 | 87 |
| 588 | 3300039062 | Ga0400483_123123 | Ga0400483_123123_475_750 | 87 |
| 589 | 3300039062 | Ga0400483_261336 | Ga0400483_261336_274_549 | 87 |
| 590 | 3300041405 | Ga0439438_012686 | Ga0439438_012686_1398_1661 | 87 |
| 591 | 3300041406 | Ga0439439_0009813 | Ga0439439_0009813_1295_1558 | 87 |
| 592 | 3300041407 | Ga0439447_045113 | Ga0439447_045113_630_893 | 87 |
| 593 | 3300041408 | Ga0439453_0056649 | Ga0439453_0056649_176_439 | 87 |
| 594 | 3300041410 | Ga0439461_0011958 | Ga0439461_0011958_660_923 | 87 |
| 595 | 3300041411 | Ga0439466_0027179 | Ga0439466_0027179_433_696 | 87 |
| 596 | 3300041413 | Ga0439465_0261708 | Ga0439465_0261708_117_380 | 87 |
| 597 | 3300041997 | Ga0439431_0013413 | Ga0439431_0013413_858_1121 | 87 |
| 598 | 3300041999 | Ga0439433_0081645 | Ga0439433_0081645_319_582 | 87 |
| 599 | 3300042001 | Ga0439441_009512 | Ga0439441_009512_468_731 | 87 |
| 600 | 3300042005 | Ga0439448_0185249 | Ga0439448_0185249_233_496 | 87 |
| 601 | 3300042006 | Ga0439432_026350 | Ga0439432_026350_1615_1878 | 87 |
| 602 | 3300042009 | Ga0439451_076935 | Ga0439451_076935_105_368 | 87 |
| 603 | 3300042010 | Ga0439452_027821 | Ga0439452_027821_1020_1283 | 87 |
| 604 | 3300042011 | Ga0439454_121215 | Ga0439454_121215_107_370 | 87 |
| 605 | 3300042012 | Ga0439455_0081424 | Ga0439455_0081424_493_756 | 87 |
| 606 | 3300042012 | Ga0439455_0202149 | Ga0439455_0202149_238_501 | 87 |
| 607 | 3300042013 | Ga0439456_061353 | Ga0439456_061353_387_650 | 87 |
| 608 | 3300042014 | Ga0439457_138334 | Ga0439457_138334_107_370 | 87 |
| 609 | 3300042015 | Ga0439462_0051864 | Ga0439462_0051864_689_952 | 87 |
| 610 | 3300042118 | Ga0450914_030353 | Ga0450914_030353_317_580 | 87 |
| 611 | 3300042133 | Ga0450896_052909 | Ga0450896_052909_91_354 | 87 |
| 612 | 3300042142 | Ga0450905_036787 | Ga0450905_036787_229_492 | 87 |
| 613 | 3300042156 | Ga0439446_0031510 | Ga0439446_0031510_71_334 | 87 |
| 614 | 3300042185 | Ga0450909_012392 | Ga0450909_012392_338_601 | 87 |
| 615 | 3300042436 | Ga0439435_0010610 | Ga0439435_0010610_1190_1453 | 87 |
| 616 | 3300042436 | Ga0439435_0034881 | Ga0439435_0034881_227_490 | 87 |
| 617 | 3300042437 | Ga0439444_0063208 | Ga0439444_0063208_183_446 | 87 |
| 618 | 3300042439 | Ga0439464_0046380 | Ga0439464_0046380_167_430 | 87 |
| 619 | 3300042439 | Ga0439464_0077699 | Ga0439464_0077699_193_456 | 87 |
| 620 | 3300042439 | Ga0439464_0274740 | Ga0439464_0274740_107_370 | 87 |
| 621 | 3300042461 | Ga0439460_0019928 | Ga0439460_0019928_1440_1703 | 87 |
| 622 | 3300042461 | Ga0439460_0070169 | Ga0439460_0070169_272_535 | 87 |
| 623 | 3300042532 | Ga0450893_0106676 | Ga0450893_0106676_86_349 | 87 |
| 624 | 3300042876 | Ga0451577_0264706 | Ga0451577_0264706_219_482 | 87 |
| 625 | 3300042876 | Ga0451577_0395796 | Ga0451577_0395796_113_376 | 87 |
| 626 | 3300042876 | Ga0451577_1799548 | Ga0451577_1799548_131_406 | 87 |
| 627 | 3300042993 | Ga0439440_0256818 | Ga0439440_0256818_197_460 | 87 |
| 628 | 3300042993 | Ga0439440_0280681 | Ga0439440_0280681_131_394 | 87 |
| 629 | 3300044673 | Ga0453683_0069750 | Ga0453683_0069750_663_935 | 87 |
| 630 | 3300044673 | Ga0453683_0107305 | Ga0453683_0107305_1299_1580 | 87 |
| 631 | 3300044673 | Ga0453683_0292327 | Ga0453683_0292327_335_598 | 87 |
| 632 | 3300044694 | Ga0466963_0192463 | Ga0466963_0192463_510_773 | 87 |
| 633 | 3300044712 | Ga0453684_0255611 | Ga0453684_0255611_1556_1831 | 87 |
| 634 | 3300044712 | Ga0453684_0269147 | Ga0453684_0269147_1630_1893 | 87 |
| 635 | 3300044712 | Ga0453684_0388138 | Ga0453684_0388138_855_1118 | 87 |
| 636 | 3300044712 | Ga0453684_0527403 | Ga0453684_0527403_504_767 | 87 |
| 637 | 3300044712 | Ga0453684_0632788 | Ga0453684_0632788_498_761 | 87 |
| 638 | 3300044712 | Ga0453684_0950237 | Ga0453684_0950237_418_684 | 87 |
| 639 | 3300044712 | Ga0453684_1171214 | Ga0453684_1171214_514_777 | 87 |
| 640 | 3300045051 | Ga0451576_0010724 | Ga0451576_0010724_8974_9237 | 87 |
| 641 | 3300045051 | Ga0451576_0334658 | Ga0451576_0334658_697_960 | 87 |
| 642 | 3300045051 | Ga0451576_0585028 | Ga0451576_0585028_279_542 | 87 |
| 643 | 3300045051 | Ga0451576_0793871 | Ga0451576_0793871_685_948 | 87 |
| 644 | 3300045051 | Ga0451576_1891564 | Ga0451576_1891564_160_423 | 87 |
| 645 | 3300045976 | Ga0466967_0192171 | Ga0466967_0192171_288_551 | 87 |
| 646 | 3300046454 | Ga0495592_0228274 | Ga0495592_0228274_40_303 | 87 |
| 647 | 3300046459 | Ga0495629_0034132 | Ga0495629_0034132_611_874 | 87 |
| 648 | 3300046462 | Ga0495651_0360859 | Ga0495651_0360859_580_843 | 87 |
| 649 | 3300046463 | Ga0495653_0146529 | Ga0495653_0146529_574_837 | 87 |
| 650 | 3300046473 | Ga0495582_0072667 | Ga0495582_0072667_751_1014 | 87 |
| 651 | 3300046473 | Ga0495582_0416817 | Ga0495582_0416817_106_369 | 87 |
| 652 | 3300046475 | Ga0495639_0455303 | Ga0495639_0455303_231_494 | 87 |
| 653 | 3300046491 | Ga0495584_0616316 | Ga0495584_0616316_247_510 | 87 |
| 654 | 3300046499 | Ga0495594_0011487 | Ga0495594_0011487_367_630 | 87 |
| 655 | 3300046499 | Ga0495594_0285376 | Ga0495594_0285376_314_577 | 87 |
| 656 | 3300046499 | Ga0495594_0546203 | Ga0495594_0546203_179_442 | 87 |
| 657 | 3300046500 | Ga0495596_0272862 | Ga0495596_0272862_83_346 | 87 |
| 658 | 3300046501 | Ga0495607_0190683 | Ga0495607_0190683_542_805 | 87 |
| 659 | 3300046520 | Ga0495637_0050577 | Ga0495637_0050577_1451_1714 | 87 |
| 660 | 3300046526 | Ga0495666_0385049 | Ga0495666_0385049_140_403 | 87 |
| 661 | 3300046538 | Ga0495609_0139077 | Ga0495609_0139077_231_494 | 87 |
| 662 | 3300046557 | Ga0495622_0188528 | Ga0495622_0188528_176_439 | 87 |
| 663 | 3300046615 | Ga0495656_0327007 | Ga0495656_0327007_63_326 | 87 |
| 664 | 3300046642 | Ga0495634_0411341 | Ga0495634_0411341_51_314 | 87 |
| 665 | 3300046663 | Ga0495635_0268224 | Ga0495635_0268224_313_576 | 87 |
| 666 | 3300046663 | Ga0495635_0668671 | Ga0495635_0668671_200_463 | 87 |
| 667 | 3300046664 | Ga0495659_0009361 | Ga0495659_0009361_2230_2493 | 87 |
| 668 | 3300046674 | Ga0495588_0203174 | Ga0495588_0203174_307_570 | 87 |
| 669 | 3300046675 | Ga0495657_0032657 | Ga0495657_0032657_2605_2868 | 87 |
| 670 | 3300046681 | Ga0495647_0013988 | Ga0495647_0013988_648_911 | 87 |
| 671 | 3300046683 | Ga0495658_0097137 | Ga0495658_0097137_1278_1541 | 87 |
| 672 | 3300046690 | Ga0495624_0195130 | Ga0495624_0195130_20_283 | 87 |
| 673 | 3300046691 | Ga0495670_0129089 | Ga0495670_0129089_522_785 | 87 |
| 674 | 3300046691 | Ga0495670_0311570 | Ga0495670_0311570_142_405 | 87 |
| 675 | 3300046794 | Ga0495589_0174031 | Ga0495589_0174031_503_766 | 87 |
| 676 | 3300046809 | Ga0495600_0121010 | Ga0495600_0121010_1257_1520 | 87 |
| 677 | 3300047315 | Ga0495581_0030598 | Ga0495581_0030598_255_518 | 87 |
| 678 | 3300047317 | Ga0495604_0140888 | Ga0495604_0140888_1098_1361 | 87 |
| 679 | 3300047318 | Ga0495636_0530225 | Ga0495636_0530225_212_475 | 87 |
| 680 | 3300047322 | Ga0495680_0096615 | Ga0495680_0096615_1650_1913 | 87 |
| 681 | 3300048089 | Ga0495614_0065681 | Ga0495614_0065681_574_837 | 87 |
| 682 | 3300048909 | Ga0496106_0382029 | Ga0496106_0382029_805_1068 | 87 |
| 683 | 3300048912 | Ga0496109_1153059 | Ga0496109_1153059_328_591 | 87 |
| 684 | 3300048915 | Ga0496112_1794613 | Ga0496112_1794613_137_400 | 87 |
| 685 | 3300049128 | Ga0501308_063994 | Ga0501308_063994_18_290 | 87 |
| 686 | 3300049129 | Ga0501309_040989 | Ga0501309_040989_77_340 | 87 |
| 687 | 3300049160 | Ga0501304_023346 | Ga0501304_023346_347_610 | 87 |
| 688 | 3300049513 | Ga0501290_001203 | Ga0501290_001203_455_718 | 87 |
| 689 | 3300049514 | Ga0501291_000070 | Ga0501291_000070_9687_9950 | 87 |
| 690 | 3300049515 | Ga0501292_000097 | Ga0501292_000097_10116_10379 | 87 |
| 691 | 3300049516 | Ga0501293_001129 | Ga0501293_001129_455_718 | 87 |
| 692 | 3300049517 | Ga0501294_000073 | Ga0501294_000073_4889_5152 | 87 |
| 693 | 3300049518 | Ga0501295_000110 | Ga0501295_000110_5886_6149 | 87 |
| 694 | 3300049519 | Ga0501296_000001 | Ga0501296_000001_18107_18370 | 87 |
| 695 | 3300049520 | Ga0501297_000026 | Ga0501297_000026_12702_12965 | 87 |
| 696 | 3300049521 | Ga0501298_005654 | Ga0501298_005654_466_729 | 87 |
| 697 | 3300049521 | Ga0501298_052086 | Ga0501298_052086_505_768 | 87 |
| 698 | 3300049522 | Ga0501299_000081 | Ga0501299_000081_1887_2150 | 87 |
| 699 | 3300049522 | Ga0501299_100089 | Ga0501299_100089_342_605 | 87 |
| 700 | 3300049523 | Ga0501300_000275 | Ga0501300_000275_4919_5182 | 87 |
| 701 | 3300049524 | Ga0501301_000256 | Ga0501301_000256_160_423 | 87 |
| 702 | 3300049526 | Ga0501303_001156 | Ga0501303_001156_19_282 | 87 |
| 703 | 3300049527 | Ga0501311_102006 | Ga0501311_102006_16_288 | 87 |
| 704 | 3300049528 | Ga0501312_060276 | Ga0501312_060276_20_283 | 87 |
| 705 | 3300049533 | Ga0501317_106748 | Ga0501317_106748_18_290 | 87 |
| 706 | 3300049568 | Ga0501031_0003007 | Ga0501031_0003007_3898_4161 | 87 |
| 707 | 3300049568 | Ga0501031_0003309 | Ga0501031_0003309_2950_3213 | 87 |
| 708 | 3300049568 | Ga0501031_0013954 | Ga0501031_0013954_3188_3451 | 87 |
| 709 | 3300049568 | Ga0501031_0052700 | Ga0501031_0052700_176_439 | 87 |
| 710 | 3300049568 | Ga0501031_0221458 | Ga0501031_0221458_536_799 | 87 |
| 711 | 3300049568 | Ga0501031_0668675 | Ga0501031_0668675_331_594 | 87 |
| 712 | 3300049569 | Ga0501032_0011486 | Ga0501032_0011486_2555_2818 | 87 |
| 713 | 3300049569 | Ga0501032_0022670 | Ga0501032_0022670_2047_2310 | 87 |
| 714 | 3300049569 | Ga0501032_0275407 | Ga0501032_0275407_603_866 | 87 |
| 715 | 3300049570 | Ga0501033_0189779 | Ga0501033_0189779_640_903 | 87 |
| 716 | 3300049570 | Ga0501033_0926442 | Ga0501033_0926442_48_311 | 87 |
| 717 | 3300049571 | Ga0501034_0821894 | Ga0501034_0821894_174_437 | 87 |
| 718 | 3300049571 | Ga0501034_1136513 | Ga0501034_1136513_182_445 | 87 |
| 719 | 3300049572 | Ga0501036_0001418 | Ga0501036_0001418_17774_18037 | 87 |
| 720 | 3300049572 | Ga0501036_0072666 | Ga0501036_0072666_2487_2750 | 87 |
| 721 | 3300049572 | Ga0501036_0106647 | Ga0501036_0106647_984_1247 | 87 |
| 722 | 3300049572 | Ga0501036_0177349 | Ga0501036_0177349_1030_1293 | 87 |
| 723 | 3300049573 | Ga0501037_0005978 | Ga0501037_0005978_863_1126 | 87 |
| 724 | 3300049573 | Ga0501037_0019840 | Ga0501037_0019840_4683_4946 | 87 |
| 725 | 3300049573 | Ga0501037_0044493 | Ga0501037_0044493_1997_2260 | 87 |
| 726 | 3300049573 | Ga0501037_0186277 | Ga0501037_0186277_423_686 | 87 |
| 727 | 3300049573 | Ga0501037_0392312 | Ga0501037_0392312_531_794 | 87 |
| 728 | 3300049574 | Ga0501038_0034759 | Ga0501038_0034759_1721_1984 | 87 |
| 729 | 3300049574 | Ga0501038_0043832 | Ga0501038_0043832_2644_2907 | 87 |
| 730 | 3300049574 | Ga0501038_0048896 | Ga0501038_0048896_214_477 | 87 |
| 731 | 3300049574 | Ga0501038_0396391 | Ga0501038_0396391_648_911 | 87 |
| 732 | 3300049574 | Ga0501038_1308771 | Ga0501038_1308771_98_361 | 87 |
| 733 | 3300049575 | Ga0501039_0010478 | Ga0501039_0010478_1397_1660 | 87 |
| 734 | 3300049575 | Ga0501039_0020879 | Ga0501039_0020879_1598_1861 | 87 |
| 735 | 3300049575 | Ga0501039_0043557 | Ga0501039_0043557_1099_1362 | 87 |
| 736 | 3300049575 | Ga0501039_0220646 | Ga0501039_0220646_221_484 | 87 |
| 737 | 3300049575 | Ga0501039_0268065 | Ga0501039_0268065_742_1005 | 87 |
| 738 | 3300049575 | Ga0501039_0558912 | Ga0501039_0558912_425_688 | 87 |
| 739 | 3300049576 | Ga0501040_0019056 | Ga0501040_0019056_1904_2167 | 87 |
| 740 | 3300049576 | Ga0501040_0031341 | Ga0501040_0031341_1069_1332 | 87 |
| 741 | 3300049576 | Ga0501040_0053014 | Ga0501040_0053014_2144_2407 | 87 |
| 742 | 3300049576 | Ga0501040_0092978 | Ga0501040_0092978_189_452 | 87 |
| 743 | 3300049576 | Ga0501040_0937441 | Ga0501040_0937441_227_490 | 87 |
| 744 | 3300049577 | Ga0501041_0000835 | Ga0501041_0000835_3078_3341 | 87 |
| 745 | 3300049577 | Ga0501041_0006703 | Ga0501041_0006703_3150_3413 | 87 |
| 746 | 3300049577 | Ga0501041_0009263 | Ga0501041_0009263_4092_4355 | 87 |
| 747 | 3300049577 | Ga0501041_0145921 | Ga0501041_0145921_387_650 | 87 |
| 748 | 3300049578 | Ga0501042_0024884 | Ga0501042_0024884_2203_2466 | 87 |
| 749 | 3300049578 | Ga0501042_0033761 | Ga0501042_0033761_1742_2005 | 87 |
| 750 | 3300049578 | Ga0501042_0045230 | Ga0501042_0045230_2245_2508 | 87 |
| 751 | 3300049578 | Ga0501042_0094916 | Ga0501042_0094916_1597_1860 | 87 |
| 752 | 3300049578 | Ga0501042_0136752 | Ga0501042_0136752_619_882 | 87 |
| 753 | 3300049579 | Ga0501043_0177162 | Ga0501043_0177162_935_1198 | 87 |
| 754 | 3300049579 | Ga0501043_0220160 | Ga0501043_0220160_773_1036 | 87 |
| 755 | 3300049580 | Ga0501046_0003559 | Ga0501046_0003559_9951_10214 | 87 |
| 756 | 3300049580 | Ga0501046_0004698 | Ga0501046_0004698_9423_9686 | 87 |
| 757 | 3300049580 | Ga0501046_0018359 | Ga0501046_0018359_43_306 | 87 |
| 758 | 3300049580 | Ga0501046_0031280 | Ga0501046_0031280_3434_3697 | 87 |
| 759 | 3300049580 | Ga0501046_0374776 | Ga0501046_0374776_347_616 | 87 |
| 760 | 3300049581 | Ga0501047_0777516 | Ga0501047_0777516_421_684 | 87 |
| 761 | 3300049582 | Ga0501048_0000395 | Ga0501048_0000395_4884_5147 | 87 |
| 762 | 3300049582 | Ga0501048_0075391 | Ga0501048_0075391_118_381 | 87 |
| 763 | 3300049582 | Ga0501048_0127417 | Ga0501048_0127417_111_374 | 87 |
| 764 | 3300049582 | Ga0501048_0535514 | Ga0501048_0535514_46_309 | 87 |
| 765 | 3300049582 | Ga0501048_0983013 | Ga0501048_0983013_293_556 | 87 |
| 766 | 3300049583 | Ga0501067_0176473 | Ga0501067_0176473_17_280 | 87 |
| 767 | 3300049583 | Ga0501067_0378252 | Ga0501067_0378252_449_712 | 87 |
| 768 | 3300049584 | Ga0501068_0240630 | Ga0501068_0240630_565_828 | 87 |
| 769 | 3300049584 | Ga0501068_0360137 | Ga0501068_0360137_558_821 | 87 |
| 770 | 3300049585 | Ga0501069_0571397 | Ga0501069_0571397_156_419 | 87 |
| 771 | 3300049585 | Ga0501069_0612584 | Ga0501069_0612584_87_350 | 87 |
| 772 | 3300049586 | Ga0501070_0319362 | Ga0501070_0319362_31_294 | 87 |
| 773 | 3300049586 | Ga0501070_1197593 | Ga0501070_1197593_29_292 | 87 |
| 774 | 3300049587 | Ga0501071_0002970 | Ga0501071_0002970_8930_9193 | 87 |
| 775 | 3300049587 | Ga0501071_0132578 | Ga0501071_0132578_500_763 | 87 |
| 776 | 3300049587 | Ga0501071_0397358 | Ga0501071_0397358_246_509 | 87 |
| 777 | 3300049588 | Ga0501072_0029542 | Ga0501072_0029542_1681_1944 | 87 |
| 778 | 3300049588 | Ga0501072_0748481 | Ga0501072_0748481_261_524 | 87 |
| 779 | 3300049589 | Ga0501073_0479957 | Ga0501073_0479957_133_396 | 87 |
| 780 | 3300049590 | Ga0501074_0071057 | Ga0501074_0071057_2028_2291 | 87 |
| 781 | 3300049590 | Ga0501074_1289703 | Ga0501074_1289703_154_417 | 87 |
| 782 | 3300049591 | Ga0501075_0008078 | Ga0501075_0008078_2478_2741 | 87 |
| 783 | 3300049591 | Ga0501075_0191046 | Ga0501075_0191046_267_536 | 87 |
| 784 | 3300049591 | Ga0501075_0338407 | Ga0501075_0338407_402_665 | 87 |
| 785 | 3300049591 | Ga0501075_0913966 | Ga0501075_0913966_256_519 | 87 |
| 786 | 3300049592 | Ga0501076_0075708 | Ga0501076_0075708_1474_1737 | 87 |
| 787 | 3300049592 | Ga0501076_0210650 | Ga0501076_0210650_660_923 | 87 |
| 788 | 3300049592 | Ga0501076_0225491 | Ga0501076_0225491_314_577 | 87 |
| 789 | 3300049592 | Ga0501076_0561520 | Ga0501076_0561520_324_593 | 87 |
| 790 | 3300049592 | Ga0501076_0644930 | Ga0501076_0644930_282_545 | 87 |
| 791 | 3300049649 | Ga0501198_005747 | Ga0501198_005747_1434_1697 | 87 |
| 792 | 3300049650 | Ga0501199_000588 | Ga0501199_000588_2439_2702 | 87 |
| 793 | 3300049651 | Ga0501201_010914 | Ga0501201_010914_159_422 | 87 |
| 794 | 3300049652 | Ga0501202_001084 | Ga0501202_001084_1014_1277 | 87 |
| 795 | 3300049653 | Ga0501206_000681 | Ga0501206_000681_3255_3518 | 87 |
| 796 | 3300049655 | Ga0501208_000033 | Ga0501208_000033_1956_2219 | 87 |
| 797 | 3300049659 | Ga0501214_082232 | Ga0501214_082232_76_339 | 87 |
| 798 | 3300049660 | Ga0501216_000248 | Ga0501216_000248_3207_3470 | 87 |
| 799 | 3300049661 | Ga0501217_000657 | Ga0501217_000657_691_954 | 87 |
| 800 | 3300049663 | Ga0501223_100251 | Ga0501223_100251_171_434 | 87 |
| 801 | 3300049664 | Ga0501224_050918 | Ga0501224_050918_211_474 | 87 |
| 802 | 3300049665 | Ga0501227_023381 | Ga0501227_023381_164_427 | 87 |
| 803 | 3300049668 | Ga0501233_000389 | Ga0501233_000389_1135_1398 | 87 |
| 804 | 3300049669 | Ga0501235_000044 | Ga0501235_000044_12920_13183 | 87 |
| 805 | 3300049670 | Ga0501236_000030 | Ga0501236_000030_1416_1679 | 87 |
| 806 | 3300049672 | Ga0501239_000789 | Ga0501239_000789_405_668 | 87 |
| 807 | 3300049674 | Ga0501242_005697 | Ga0501242_005697_1022_1285 | 87 |
| 808 | 3300049675 | Ga0501243_003599 | Ga0501243_003599_1616_1879 | 87 |
| 809 | 3300049677 | Ga0501247_070289 | Ga0501247_070289_66_329 | 87 |
| 810 | 3300049678 | Ga0501248_000573 | Ga0501248_000573_1629_1892 | 87 |
| 811 | 3300049679 | Ga0501249_001670 | Ga0501249_001670_2763_3026 | 87 |
| 812 | 3300049681 | Ga0501251_003246 | Ga0501251_003246_159_422 | 87 |
| 813 | 3300049683 | Ga0501253_002203 | Ga0501253_002203_1424_1687 | 87 |
| 814 | 3300049684 | Ga0501255_001817 | Ga0501255_001817_107_370 | 87 |
| 815 | 3300049685 | Ga0501256_000607 | Ga0501256_000607_22_285 | 87 |
| 816 | 3300049686 | Ga0501257_001093 | Ga0501257_001093_130_393 | 87 |
| 817 | 3300049688 | Ga0501259_036823 | Ga0501259_036823_160_423 | 87 |
| 818 | 3300049689 | Ga0501260_048832 | Ga0501260_048832_179_442 | 87 |
| 819 | 3300049690 | Ga0501261_000708 | Ga0501261_000708_249_512 | 87 |
| 820 | 3300049703 | Ga0501219_001018 | Ga0501219_001018_2078_2341 | 87 |
| 821 | 3300049705 | Ga0501225_0001524 | Ga0501225_0001524_2003_2266 | 87 |
| 822 | 3300049706 | Ga0501229_001207 | Ga0501229_001207_903_1166 | 87 |
| 823 | 3300049708 | Ga0501245_001430 | Ga0501245_001430_2003_2266 | 87 |
| 824 | 3300049741 | Ga0501079_0193080 | Ga0501079_0193080_880_1149 | 87 |
| 825 | 3300049742 | Ga0501080_0607402 | Ga0501080_0607402_285_548 | 87 |
| 826 | 3300049742 | Ga0501080_1220989 | Ga0501080_1220989_243_506 | 87 |
| 827 | 3300049743 | Ga0501081_0471811 | Ga0501081_0471811_74_337 | 87 |
| 828 | 3300049743 | Ga0501081_0486350 | Ga0501081_0486350_527_790 | 87 |
| 829 | 3300049744 | Ga0501083_0033924 | Ga0501083_0033924_2345_2608 | 87 |
| 830 | 3300049744 | Ga0501083_1148339 | Ga0501083_1148339_93_362 | 87 |
| 831 | 3300049757 | Ga0501232_000579 | Ga0501232_000579_2223_2486 | 87 |
| 832 | 3300049761 | Ga0501264_000260 | Ga0501264_000260_4576_4839 | 87 |
| 833 | 3300049762 | Ga0501265_001370 | Ga0501265_001370_2144_2407 | 87 |
| 834 | 3300049763 | Ga0501266_000269 | Ga0501266_000269_1199_1462 | 87 |
| 835 | 3300049766 | Ga0501269_023202 | Ga0501269_023202_437_700 | 87 |
| 836 | 3300049767 | Ga0501270_002952 | Ga0501270_002952_1263_1526 | 87 |
| 837 | 3300049768 | Ga0501271_001541 | Ga0501271_001541_217_480 | 87 |
| 838 | 3300049769 | Ga0501272_000814 | Ga0501272_000814_490_753 | 87 |
| 839 | 3300049770 | Ga0501273_000418 | Ga0501273_000418_314_577 | 87 |
| 840 | 3300049771 | Ga0501274_000464 | Ga0501274_000464_604_867 | 87 |
| 841 | 3300049772 | Ga0501275_019137 | Ga0501275_019137_162_425 | 87 |
| 842 | 3300049773 | Ga0501276_000272 | Ga0501276_000272_144_407 | 87 |
| 843 | 3300049774 | Ga0501278_000701 | Ga0501278_000701_263_526 | 87 |
| 844 | 3300049775 | Ga0501279_002409 | Ga0501279_002409_2021_2284 | 87 |
| 845 | 3300049776 | Ga0501280_001221 | Ga0501280_001221_223_486 | 87 |
| 846 | 3300049777 | Ga0501281_00480 | Ga0501281_00480_2080_2343 | 87 |
| 847 | 3300049778 | Ga0501282_001620 | Ga0501282_001620_2014_2277 | 87 |
| 848 | 3300049779 | Ga0501283_000031 | Ga0501283_000031_14698_14961 | 87 |
| 849 | 3300049822 | Ga0501035_0004145 | Ga0501035_0004145_341_604 | 87 |
| 850 | 3300049822 | Ga0501035_0030679 | Ga0501035_0030679_4465_4728 | 87 |
| 851 | 3300049822 | Ga0501035_0048549 | Ga0501035_0048549_1697_1960 | 87 |
| 852 | 3300049822 | Ga0501035_0588486 | Ga0501035_0588486_46_309 | 87 |
| 853 | 3300049823 | Ga0501044_0198050 | Ga0501044_0198050_1391_1654 | 87 |
| 854 | 3300049823 | Ga0501044_0666574 | Ga0501044_0666574_347_610 | 87 |
| 855 | 3300049823 | Ga0501044_1444713 | Ga0501044_1444713_99_362 | 87 |
| 856 | 3300049824 | Ga0501045_0071010 | Ga0501045_0071010_379_642 | 87 |
| 857 | 3300049824 | Ga0501045_1105664 | Ga0501045_1105664_137_400 | 87 |
| 858 | 3300050507 | nmdc:mga05p37_21807_c1 | nmdc:mga05p37_21807_c1_3751_4014 | 87 |
| 859 | 3300050507 | nmdc:mga05p37_242672_c1 | nmdc:mga05p37_242672_c1_739_1002 | 87 |
| 860 | 3300050507 | nmdc:mga05p37_83120_c1 | nmdc:mga05p37_83120_c1_1560_1823 | 87 |
| 861 | 3300050508 | nmdc:mga09592_141745_c1 | nmdc:mga09592_141745_c1_1086_1358 | 87 |
| 862 | 3300050508 | nmdc:mga09592_27143_c1 | nmdc:mga09592_27143_c1_3364_3627 | 87 |
| 863 | 3300050508 | nmdc:mga09592_7623_c1 | nmdc:mga09592_7623_c1_4052_4315 | 87 |
| 864 | 3300050509 | nmdc:mga0qj67_10014_c1 | nmdc:mga0qj67_10014_c1_4811_5083 | 87 |
| 865 | 3300050509 | nmdc:mga0qj67_1216_c1 | nmdc:mga0qj67_1216_c1_10170_10433 | 87 |
| 866 | 3300050509 | nmdc:mga0qj67_18859_c1 | nmdc:mga0qj67_18859_c1_1141_1404 | 87 |
| 867 | 3300050509 | nmdc:mga0qj67_73283_c1 | nmdc:mga0qj67_73283_c1_342_605 | 87 |
| 868 | 3300050510 | nmdc:mga06r32_12279_c1 | nmdc:mga06r32_12279_c1_2145_2408 | 87 |
| 869 | 3300050510 | nmdc:mga06r32_31560_c1 | nmdc:mga06r32_31560_c1_2241_2513 | 87 |
| 870 | 3300050510 | nmdc:mga06r32_84525_c1 | nmdc:mga06r32_84525_c1_1801_2064 | 87 |
| 871 | 3300050511 | nmdc:mga08y16_49455_c1 | nmdc:mga08y16_49455_c1_3857_4120 | 87 |
| 872 | 3300050512 | nmdc:mga0n895_157515_c1 | nmdc:mga0n895_157515_c1_1290_1553 | 87 |
| 873 | 3300050512 | nmdc:mga0n895_2194854_c1 | nmdc:mga0n895_2194854_c1_15_278 | 87 |
| 874 | 3300050512 | nmdc:mga0n895_2230970_c1 | nmdc:mga0n895_2230970_c1_180_443 | 87 |
| 875 | 3300050513 | nmdc:mga0rr50_1025642_c1 | nmdc:mga0rr50_1025642_c1_356_619 | 87 |
| 876 | 3300050513 | nmdc:mga0rr50_1300338_c1 | nmdc:mga0rr50_1300338_c1_42_305 | 87 |
| 877 | 3300050513 | nmdc:mga0rr50_195989_c1 | nmdc:mga0rr50_195989_c1_793_1056 | 87 |
| 878 | 3300050513 | nmdc:mga0rr50_734488_c1 | nmdc:mga0rr50_734488_c1_551_814 | 87 |
| 879 | 3300050514 | nmdc:mga08x19_219847_c1 | nmdc:mga08x19_219847_c1_596_859 | 87 |
| 880 | 3300050514 | nmdc:mga08x19_343142_c1 | nmdc:mga08x19_343142_c1_552_815 | 87 |
| 881 | 3300050514 | nmdc:mga08x19_85669_c1 | nmdc:mga08x19_85669_c1_211_474 | 87 |
| 882 | 3300050515 | nmdc:mga0a205_20209_c1 | nmdc:mga0a205_20209_c1_5867_6130 | 87 |
| 883 | 3300050515 | nmdc:mga0a205_479739_c1 | nmdc:mga0a205_479739_c1_540_803 | 87 |
| 884 | 3300053077 | Ga0495601_0008311 | Ga0495601_0008311_3027_3290 | 87 |
| 885 | 3300053078 | Ga0495612_0172330 | Ga0495612_0172330_497_760 | 87 |
| 886 | 3300053084 | Ga0495595_0177233 | Ga0495595_0177233_353_616 | 87 |
| 887 | 3300053085 | Ga0495619_0146839 | Ga0495619_0146839_827_1090 | 87 |
| 888 | 3300053085 | Ga0495619_0157571 | Ga0495619_0157571_236_499 | 87 |
| 889 | 3300054114 | Ga0501084_0185142 | Ga0501084_0185142_908_1171 | 87 |
| 890 | 3300054114 | Ga0501084_0451151 | Ga0501084_0451151_353_622 | 87 |
| 891 | 3300059421 | Ga0590071_043061 | Ga0590071_043061_90_353 | 87 |
| 892 | 3300059424 | Ga0590075_003561 | Ga0590075_003561_3413_3676 | 87 |
| 893 | 3300059426 | Ga0590077_077776 | Ga0590077_077776_320_583 | 87 |
| 894 | 3300059491 | Ga0587070_093484 | Ga0587070_093484_34_315 | 87 |
| 895 | 3300060353 | Ga0501082_0036974 | Ga0501082_0036974_2371_2634 | 87 |
| 896 | 3300060353 | Ga0501082_1024111 | Ga0501082_1024111_356_625 | 87 |
| 897 | 3300061734 | Ga0530510_0024573 | Ga0530510_0024573_1610_1873 | 87 |
| 898 | 3300061734 | Ga0530510_0423946 | Ga0530510_0423946_501_764 | 87 |
| 899 | 3300061734 | Ga0530510_0717799 | Ga0530510_0717799_54_323 | 87 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1v8q-assembly1.cif.gz_A | crystal structure of ribosomal protein l27 from thermus thermophilus hb8 | 0.9336 | 21 | 84 |
| 3j6b-assembly1.cif.gz_R | structure of the yeast mitochondrial large ribosomal subunit | 0.9312 | 21 | 81 |
| 7sae-assembly1.cif.gz_V | 44sr70p class1 ribosomal particle | 0.9238 | 21 | 83 |
| 8c94-assembly1.cif.gz_W | cryo-em captures early ribosome assembly in action | 0.9076 | 21 | 83 |
| 8c8z-assembly1.cif.gz_W | cryo-em captures early ribosome assembly in action | 0.9059 | 21 | 83 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1v8qA00 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain | 0.9336 | 21 | 84 | 2.40.50.100 |
| 1v8qA00 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain | 0.8934 | 21 | 84 | 2.40.50.100 |
| af_Q8IBQ2_8_59_2.40.50.100 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain | 0.8707 | 29 | 81 | 2.40.50.100 |
| af_Q9Y3B2_6_56_2.40.50.100 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain | 0.8692 | 29 | 81 | 2.40.50.100 |
| af_Q9Y3B2_6_56_2.40.50.100 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain | 0.854 | 29 | 81 | 2.40.50.100 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A068NYA2-F1-model_v4 | Large ribosomal subunit protein bL27 (50S ribosomal protein L27) | 0.9587 | 21 | 87 |
GO:0003735
GO:0006412 GO:0022625 |
| AF-A0A2S6T0A6-F1-model_v4 | Large ribosomal subunit protein bL27 (50S ribosomal protein L27) | 0.9483 | 21 | 83 |
GO:0003735
GO:0005840 GO:0006412 GO:1990904 |
| AF-A0A1V5VQS4-F1-model_v4 | Large ribosomal subunit protein bL27 (50S ribosomal protein L27) | 0.9391 | 21 | 81 |
GO:0003735
GO:0005840 GO:0006412 GO:1990904 |
| AF-A0A420Z9C1-F1-model_v4 | Large ribosomal subunit protein bL27 (50S ribosomal protein L27) | 0.939 | 21 | 83 |
GO:0003735
GO:0005840 GO:0006412 GO:1990904 |
| AF-A0A3D3VUF3-F1-model_v4 | Large ribosomal subunit protein bL27 (50S ribosomal protein L27) | 0.9361 | 23 | 85 |
GO:0003735
GO:0006412 GO:0022625 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar