F485096

General Info

Members Datasets Scaffolds Average Seq Length
899 462 899 88

Family's Representative Sequence

Representative Sequence 3300005842|Ga0068858_101435914|Ga0068858_1014359142
Length 107
Sequence MAHKKGQGSSRNGRDSNPQYLGVKRYGGQTVTGGSIIVRQRGTRFFPGLNVGQGKDDTLFAKIGGVVKFQDRGRHGKYVHILPAEAAAASVAPDASTPSATASESAS

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2209111006 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 Metagenome Rhizosphere
3 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
4 3300003347 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM Metagenome Rhizosphere
5 3300003349 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM Metagenome Rhizosphere
6 3300003371 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM Metagenome Rhizosphere
7 3300003379 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM Metagenome Rhizosphere
8 3300003383 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM Metagenome Rhizosphere
9 3300003392 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM Metagenome Rhizosphere
10 3300003397 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM Metagenome Rhizosphere
11 3300003398 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM Metagenome Rhizosphere
12 3300003405 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM Metagenome Rhizosphere
13 3300003502 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM Metagenome Rhizosphere
14 3300003503 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM Metagenome Rhizosphere
15 3300003504 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM Metagenome Rhizosphere
16 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
17 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
18 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
19 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
20 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
21 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
22 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
23 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
24 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
25 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
26 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
27 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
28 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
29 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
30 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
31 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
32 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
33 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
34 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
35 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
36 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
37 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
38 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
39 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
40 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
41 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
42 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
43 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
44 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
45 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
46 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
47 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
48 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
49 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
50 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
51 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
52 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
53 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
54 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
55 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
56 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
57 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
58 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
59 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
60 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
61 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
62 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
63 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
64 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
65 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
66 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
67 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
68 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
69 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
70 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
71 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
72 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
73 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
74 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
75 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
76 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
77 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
78 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
79 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
80 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
81 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
82 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
83 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
84 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
85 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
86 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
87 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
88 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
89 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
90 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
91 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
92 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
93 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
94 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
95 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
96 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
97 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
98 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
99 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
100 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
101 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
102 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
103 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
104 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
105 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
106 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
107 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
108 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
109 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
110 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
111 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
112 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
113 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
114 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
115 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
116 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
117 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
118 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
119 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
120 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
121 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
122 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
123 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
124 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
125 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
126 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
127 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
128 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
129 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
130 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
131 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
132 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
133 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
134 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
135 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
136 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300027252 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) Metagenome Rhizosphere
196 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
197 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
198 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
199 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
200 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
201 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
202 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
203 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
204 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
205 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
206 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
207 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
208 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
209 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
210 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
211 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
212 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
213 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
214 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
216 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
217 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
218 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
219 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
220 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
221 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
222 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
223 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
224 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
225 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
226 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
227 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
228 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
229 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
230 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
231 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
232 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
233 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
234 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
235 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
236 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
237 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
238 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
239 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
240 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
241 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
242 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
243 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
244 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
245 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
246 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
247 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
248 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
249 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
250 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
251 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
252 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
253 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
254 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
255 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
256 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
257 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
258 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
259 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
260 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
261 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
262 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
263 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
264 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
265 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
266 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
267 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
268 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
269 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
270 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
271 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
272 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
273 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
274 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
275 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
276 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
277 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
278 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
279 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
280 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
281 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
282 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
283 3300042118 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_082316_2156 Metagenome Rhizosphere
284 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
285 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
286 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
287 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
288 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
289 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
290 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
291 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
292 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
293 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
294 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
295 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
296 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
297 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
298 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
299 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
300 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
301 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
302 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
303 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
304 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
305 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
306 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
307 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
308 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
309 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
310 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
311 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
312 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
313 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
314 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
315 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
316 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
317 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
318 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
319 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
320 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
321 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
322 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
323 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
324 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
325 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
326 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
327 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
328 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
329 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
330 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
331 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
332 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
333 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
334 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
335 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
336 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
337 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
338 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
339 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
340 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
341 3300049160 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
342 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
343 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
344 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
345 3300049516 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_B_5_drought Metagenome Rhizosphere
346 3300049517 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control Metagenome Rhizosphere
347 3300049518 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control Metagenome Rhizosphere
348 3300049519 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought Metagenome Rhizosphere
349 3300049520 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought Metagenome Rhizosphere
350 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
351 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
352 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
353 3300049524 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H21_B_7_control Metagenome Rhizosphere
354 3300049526 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_B_7_control Metagenome Rhizosphere
355 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
356 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
357 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
358 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
359 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
360 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
361 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
362 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
363 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
364 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
365 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
366 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
367 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
368 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
369 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
370 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
371 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
372 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
373 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
374 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
375 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
376 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
377 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
378 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
379 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
380 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
381 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
382 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
383 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
384 3300049650 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought Metagenome Rhizosphere
385 3300049651 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought Metagenome Rhizosphere
386 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
387 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
388 3300049655 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_B_0_drought Metagenome Rhizosphere
389 3300049659 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control Metagenome Rhizosphere
390 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
391 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
392 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
393 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
394 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
395 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
396 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
397 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
398 3300049672 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought Metagenome Rhizosphere
399 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
400 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
401 3300049677 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control Metagenome Rhizosphere
402 3300049678 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought Metagenome Rhizosphere
403 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
404 3300049681 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought Metagenome Rhizosphere
405 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
406 3300049684 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_B_3_control Metagenome Rhizosphere
407 3300049685 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_B_3_control Metagenome Rhizosphere
408 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
409 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
410 3300049689 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_A_4_drought Metagenome Rhizosphere
411 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
412 3300049703 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control Metagenome Rhizosphere
413 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
414 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
415 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
416 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
417 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
418 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
419 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
420 3300049757 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_B_2_control Metagenome Rhizosphere
421 3300049761 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control Metagenome Rhizosphere
422 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
423 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
424 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
425 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
426 3300049768 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought Metagenome Rhizosphere
427 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
428 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
429 3300049771 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_B_4_control Metagenome Rhizosphere
430 3300049772 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_B_4_control Metagenome Rhizosphere
431 3300049773 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_B_4_control Metagenome Rhizosphere
432 3300049774 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_A_5_drought Metagenome Rhizosphere
433 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
434 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
435 3300049777 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control Metagenome Rhizosphere
436 3300049778 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control Metagenome Rhizosphere
437 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
438 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
439 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
440 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
441 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
442 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
443 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
444 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
445 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
446 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
447 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
448 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
449 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
450 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
451 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
452 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
453 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
454 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
455 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
456 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
457 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
458 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
459 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
460 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
461 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
462 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.55
Metatranscriptomes 1.45
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.67
Rhizosphere 98.55
Stem 0
Stem Tuber 0
Unclassified 0.78

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_1087855 2162886007 Bacteria 1484
2 2214806902 2209111006 Unclassified 694
3 JGI24742J22300_10077764 3300002244 Bacteria 625
4 JGI26128J50194_1005255 3300003347 Bacteria 851
5 JGI26129J50193_1011093 3300003349 Bacteria 658
6 JGI26145J50221_1000071 3300003371 Bacteria 7664
7 JGI26142J50222_102611 3300003379 Bacteria 529
8 JGI26140J50224_101891 3300003383 Bacteria 752
9 JGI26134J50242_101155 3300003392 Bacteria 862
10 JGI26133J50247_102041 3300003397 Bacteria 656
11 JGI26130J50248_102899 3300003398 Bacteria 529
12 JGI26132J50249_103969 3300003405 Bacteria 546
13 JGI26143J51219_1006949 3300003502 Bacteria 585
14 JGI26141J51220_1002671 3300003503 Bacteria 1089
15 JGI26138J51218_102793 3300003504 Bacteria 729
16 Ga0058860_11408664 3300004801 Bacteria 600
17 Ga0058860_11878411 3300004801 Unclassified 513
18 Ga0065704_10005524 3300005289 Bacteria 3904
19 Ga0065704_10287312 3300005289 Bacteria 910
20 Ga0065712_10202387 3300005290 Bacteria 1103
21 Ga0065715_10024978 3300005293 Bacteria 1494
22 Ga0065715_10466356 3300005293 Bacteria 811
23 Ga0065715_10703734 3300005293 Bacteria 651
24 Ga0065707_10083722 3300005295 Bacteria 8385
25 Ga0065707_10112291 3300005295 Bacteria 2366
26 Ga0065707_10499672 3300005295 Bacteria 758
27 Ga0070658_10025278 3300005327 Bacteria 4761
28 Ga0070658_10036820 3300005327 Bacteria 3944
29 Ga0070676_10002110 3300005328 Bacteria 10124
30 Ga0070676_10811513 3300005328 Bacteria 691
31 Ga0070683_101520820 3300005329 Bacteria 643
32 Ga0070690_100000128 3300005330 Bacteria 39293
33 Ga0070690_100006058 3300005330 Bacteria 6841
34 Ga0070690_100163496 3300005330 Bacteria 1527
35 Ga0070670_100073412 3300005331 Bacteria 2938
36 Ga0070670_100399030 3300005331 Bacteria 1214
37 Ga0070677_10010132 3300005333 Bacteria 3215
38 Ga0068869_100399586 3300005334 Bacteria 1130
39 Ga0068869_101641377 3300005334 Bacteria 573
40 Ga0070666_10018395 3300005335 Bacteria 4492
41 Ga0070666_10166291 3300005335 Bacteria 1543
42 Ga0070666_10529419 3300005335 Bacteria 856
43 Ga0070666_10665729 3300005335 Bacteria 762
44 Ga0070680_100031316 3300005336 Bacteria 4276
45 Ga0070680_100063420 3300005336 Bacteria 3027
46 Ga0070680_100063732 3300005336 Bacteria 3020
47 Ga0070680_100340015 3300005336 Bacteria 1275
48 Ga0070680_100995570 3300005336 Bacteria 724
49 Ga0070682_100225353 3300005337 Bacteria 1337
50 Ga0070682_100291316 3300005337 Bacteria 1194
51 Ga0070682_101474018 3300005337 Bacteria 584
52 Ga0068868_100077174 3300005338 Bacteria 2665
53 Ga0068868_100175469 3300005338 Bacteria 1776
54 Ga0068868_100439819 3300005338 Bacteria 1132
55 Ga0070660_100001287 3300005339 Bacteria 17103
56 Ga0070660_100085519 3300005339 Bacteria 2481
57 Ga0070660_100850866 3300005339 Bacteria 768
58 Ga0070689_100001472 3300005340 Bacteria 15018
59 Ga0070689_100024154 3300005340 Bacteria 4558
60 Ga0070689_100077278 3300005340 Bacteria 2609
61 Ga0070691_10001906 3300005341 Bacteria 9146
62 Ga0070691_10192469 3300005341 Bacteria 1068
63 Ga0070687_100000578 3300005343 Bacteria 12195
64 Ga0070687_100006792 3300005343 Bacteria 4719
65 Ga0070687_100154346 3300005343 Bacteria 1351
66 Ga0070687_100567546 3300005343 Bacteria 775
67 Ga0070661_100002446 3300005344 Bacteria 12743
68 Ga0070661_100031260 3300005344 Bacteria 3848
69 Ga0070692_10003356 3300005345 Bacteria 6481
70 Ga0070692_11090787 3300005345 Unclassified 563
71 Ga0070668_100012055 3300005347 Bacteria 6439
72 Ga0070669_100036233 3300005353 Bacteria 3574
73 Ga0070669_101072058 3300005353 Bacteria 693
74 Ga0070675_100233695 3300005354 Bacteria 1604
75 Ga0070675_100857891 3300005354 Bacteria 831
76 Ga0070675_101107484 3300005354 Bacteria 728
77 Ga0070671_100069717 3300005355 Bacteria 2933
78 Ga0070671_100402037 3300005355 Bacteria 1172
79 Ga0070674_100000651 3300005356 Bacteria 17493
80 Ga0070674_100013481 3300005356 Bacteria 5054
81 Ga0070674_100525895 3300005356 Bacteria 989
82 Ga0070673_100002548 3300005364 Bacteria 11116
83 Ga0070673_100086154 3300005364 Bacteria 2559
84 Ga0070673_100098879 3300005364 Bacteria 2399
85 Ga0070673_100882084 3300005364 Bacteria 829
86 Ga0070688_100000009 3300005365 Bacteria 85664
87 Ga0070688_100005771 3300005365 Bacteria 6544
88 Ga0070688_100023921 3300005365 Bacteria 3598
89 Ga0070659_100000429 3300005366 Bacteria 31798
90 Ga0070659_100991417 3300005366 Bacteria 737
91 Ga0070667_100032702 3300005367 Bacteria 4339
92 Ga0070667_100471054 3300005367 Bacteria 1149
93 Ga0070703_10115596 3300005406 Bacteria 966
94 Ga0070710_10468495 3300005437 Bacteria 857
95 Ga0070701_10001023 3300005438 Bacteria 10183
96 Ga0070701_10021474 3300005438 Bacteria 3082
97 Ga0070701_10101264 3300005438 Bacteria 1596
98 Ga0070701_10229959 3300005438 Bacteria 1110
99 Ga0070711_101507912 3300005439 Bacteria 587
100 Ga0070705_100003543 3300005440 Bacteria 7645
101 Ga0070705_100055568 3300005440 Bacteria 2327
102 Ga0070705_100260353 3300005440 Bacteria 1223
103 Ga0070705_100785023 3300005440 Bacteria 756
104 Ga0070700_100003185 3300005441 Bacteria 8430
105 Ga0070700_100012179 3300005441 Bacteria 4790
106 Ga0070700_100128047 3300005441 Bacteria 1710
107 Ga0070694_100050947 3300005444 Bacteria 2793
108 Ga0070694_100103928 3300005444 Bacteria 2013
109 Ga0070694_100354468 3300005444 Bacteria 1137
110 Ga0070694_100555906 3300005444 Bacteria 919
111 Ga0070694_100823890 3300005444 Bacteria 762
112 Ga0070708_100032477 3300005445 Bacteria 4529
113 Ga0070708_100150707 3300005445 Bacteria 2162
114 Ga0070708_100182048 3300005445 Bacteria 1964
115 Ga0070708_100189665 3300005445 Bacteria 1922
116 Ga0070708_100902761 3300005445 Bacteria 829
117 Ga0070708_101717164 3300005445 Bacteria 583
118 Ga0070663_100057877 3300005455 Bacteria 2782
119 Ga0070678_100227761 3300005456 Bacteria 1552
120 Ga0070678_101601551 3300005456 Bacteria 611
121 Ga0070662_100000333 3300005457 Bacteria 28293
122 Ga0070662_100869771 3300005457 Bacteria 768
123 Ga0070662_100937181 3300005457 Bacteria 740
124 Ga0070681_10014971 3300005458 Bacteria 7712
125 Ga0070681_10117118 3300005458 Bacteria 2600
126 Ga0068867_100000209 3300005459 Bacteria 39235
127 Ga0068867_100008954 3300005459 Bacteria 7062
128 Ga0068867_100084748 3300005459 Bacteria 2395
129 Ga0068867_102360266 3300005459 Bacteria 506
130 Ga0070685_10000197 3300005466 Bacteria 40603
131 Ga0070685_10024398 3300005466 Bacteria 3321
132 Ga0070706_100006062 3300005467 Bacteria 11427
133 Ga0070706_100022282 3300005467 Bacteria 5832
134 Ga0070706_100071009 3300005467 Bacteria 3220
135 Ga0070706_100160000 3300005467 Bacteria 2102
136 Ga0070706_100241449 3300005467 Bacteria 1687
137 Ga0070707_100000009 3300005468 Bacteria 166193
138 Ga0070707_100000546 3300005468 Bacteria 37594
139 Ga0070707_100013734 3300005468 Bacteria 7583
140 Ga0070707_100045910 3300005468 Bacteria 4180
141 Ga0070707_100160664 3300005468 Bacteria 2189
142 Ga0070698_100022782 3300005471 Bacteria 6550
143 Ga0070698_100065483 3300005471 Bacteria 3659
144 Ga0070698_100108921 3300005471 Bacteria 2737
145 Ga0070698_100321535 3300005471 Bacteria 1478
146 Ga0070698_100338737 3300005471 Bacteria 1435
147 Ga0070698_101297737 3300005471 Bacteria 678
148 Ga0070699_100012688 3300005518 Bacteria 7267
149 Ga0070699_100038839 3300005518 Bacteria 4121
150 Ga0070699_100046180 3300005518 Bacteria 3769
151 Ga0070699_100057826 3300005518 Bacteria 3358
152 Ga0070699_100060393 3300005518 Bacteria 3285
153 Ga0070699_100130500 3300005518 Bacteria 2215
154 Ga0070699_100297150 3300005518 Unclassified 1449
155 Ga0070679_100039709 3300005530 Bacteria 4678
156 Ga0070679_100238006 3300005530 Bacteria 1779
157 Ga0070684_100060682 3300005535 Bacteria 3309
158 Ga0070684_100172658 3300005535 Bacteria 1964
159 Ga0070684_101287682 3300005535 Bacteria 688
160 Ga0070697_100028140 3300005536 Bacteria 4499
161 Ga0070697_100039781 3300005536 Bacteria 3803
162 Ga0070697_100040563 3300005536 Bacteria 3767
163 Ga0070697_100052026 3300005536 Bacteria 3329
164 Ga0070697_100099320 3300005536 Bacteria 2416
165 Ga0070697_100321549 3300005536 Bacteria 1333
166 Ga0070697_100513173 3300005536 Bacteria 1049
167 Ga0068853_101220592 3300005539 Bacteria 726
168 Ga0068853_102461737 3300005539 Bacteria 504
169 Ga0070672_100004622 3300005543 Bacteria 9017
170 Ga0070672_100131393 3300005543 Bacteria 2058
171 Ga0070672_100154074 3300005543 Bacteria 1903
172 Ga0070686_100001153 3300005544 Bacteria 15105
173 Ga0070686_100001810 3300005544 Bacteria 11925
174 Ga0070686_100003735 3300005544 Bacteria 8366
175 Ga0070686_100021825 3300005544 Bacteria 3811
176 Ga0070686_100088889 3300005544 Bacteria 2063
177 Ga0070695_100054066 3300005545 Bacteria 2583
178 Ga0070695_100109564 3300005545 Bacteria 1872
179 Ga0070695_100153038 3300005545 Bacteria 1611
180 Ga0070696_100014740 3300005546 Bacteria 5244
181 Ga0070696_100039493 3300005546 Bacteria 3259
182 Ga0070696_100091065 3300005546 Bacteria 2171
183 Ga0070696_100378972 3300005546 Bacteria 1102
184 Ga0070693_100025178 3300005547 Bacteria 3200
185 Ga0070665_100155586 3300005548 Bacteria 2288
186 Ga0070665_100874118 3300005548 Bacteria 912
187 Ga0070665_101501812 3300005548 Bacteria 682
188 Ga0070704_100016656 3300005549 Bacteria 4650
189 Ga0070704_100167365 3300005549 Bacteria 1744
190 Ga0070704_100347908 3300005549 Bacteria 1250
191 Ga0070704_100964944 3300005549 Bacteria 770
192 Ga0068855_100121259 3300005563 Bacteria 2992
193 Ga0070664_100004699 3300005564 Bacteria 10954
194 Ga0070664_100017106 3300005564 Bacteria 5951
195 Ga0070664_100312780 3300005564 Bacteria 1422
196 Ga0070664_100539742 3300005564 Bacteria 1078
197 Ga0068857_100128798 3300005577 Bacteria 2282
198 Ga0068857_102009636 3300005577 Bacteria 567
199 Ga0068854_100190667 3300005578 Bacteria 1606
200 Ga0070702_100082706 3300005615 Bacteria 1927
201 Ga0070702_100901826 3300005615 Bacteria 692
202 Ga0068852_100141629 3300005616 Bacteria 2226
203 Ga0068852_100721648 3300005616 Bacteria 1008
204 Ga0068859_100001080 3300005617 Bacteria 27816
205 Ga0068859_100125401 3300005617 Bacteria 2637
206 Ga0068859_100309542 3300005617 Bacteria 1673
207 Ga0068864_100017267 3300005618 Bacteria 6017
208 Ga0068866_10028397 3300005718 Bacteria 2665
209 Ga0068866_10062640 3300005718 Bacteria 1936
210 Ga0068866_10129194 3300005718 Bacteria 1435
211 Ga0068861_100129149 3300005719 Bacteria 2049
212 Ga0068861_100189158 3300005719 Bacteria 1719
213 Ga0068861_101260593 3300005719 Bacteria 717
214 Ga0068861_101999900 3300005719 Bacteria 578
215 Ga0068870_10015488 3300005840 Bacteria 3619
216 Ga0068863_101939669 3300005841 Bacteria 599
217 Ga0068858_100124107 3300005842 Bacteria 2417
218 Ga0068858_101307008 3300005842 Bacteria 714
219 Ga0068858_101435914 3300005842 Bacteria 680
220 Ga0068860_100034338 3300005843 Bacteria 4864
221 Ga0068860_100072223 3300005843 Bacteria 3279
222 Ga0068860_100409080 3300005843 Bacteria 1343
223 Ga0068860_100438485 3300005843 Bacteria 1297
224 Ga0068862_100080379 3300005844 Bacteria 2827
225 Ga0081455_10000457 3300005937 Bacteria 53537
226 Ga0070717_10103093 3300006028 Bacteria 2425
227 Ga0075432_10002652 3300006058 Bacteria 5975
228 Ga0070715_10507423 3300006163 Unclassified 691
229 Ga0070715_10750485 3300006163 Bacteria 588
230 Ga0070716_100022519 3300006173 Bacteria 3331
231 Ga0070716_100114975 3300006173 Bacteria 1674
232 Ga0070716_100397840 3300006173 Bacteria 990
233 Ga0075427_10006876 3300006194 Unclassified 1661
234 Ga0097621_100003109 3300006237 Bacteria 11385
235 Ga0097621_100030403 3300006237 Bacteria 4275
236 Ga0068871_100004722 3300006358 Bacteria 9531
237 Ga0068871_100010448 3300006358 Bacteria 6774
238 Ga0068871_100588775 3300006358 Bacteria 1011
239 Ga0068871_101054234 3300006358 Bacteria 759
240 Ga0075428_101316803 3300006844 Bacteria 759
241 Ga0075428_102240597 3300006844 Bacteria 563
242 Ga0075430_100000800 3300006846 Bacteria 24453
243 Ga0075430_100009708 3300006846 Bacteria 8132
244 Ga0075430_100011790 3300006846 Bacteria 7442
245 Ga0075430_100299651 3300006846 Bacteria 1330
246 Ga0075430_100341414 3300006846 Bacteria 1237
247 Ga0075431_100004808 3300006847 Bacteria 13295
248 Ga0075431_100019017 3300006847 Bacteria 6999
249 Ga0075431_100033801 3300006847 Bacteria 5268
250 Ga0075431_100104523 3300006847 Bacteria 2923
251 Ga0075433_10011787 3300006852 Bacteria 7041
252 Ga0075433_10153120 3300006852 Bacteria 2051
253 Ga0075433_10347961 3300006852 Bacteria 1310
254 Ga0075433_11601586 3300006852 Bacteria 562
255 Ga0075434_100038974 3300006871 Bacteria 4708
256 Ga0075434_100209843 3300006871 Bacteria 1968
257 Ga0075434_100907933 3300006871 Bacteria 896
258 Ga0075434_102619501 3300006871 Bacteria 505
259 Ga0075429_100000498 3300006880 Bacteria 29516
260 Ga0075429_100015569 3300006880 Bacteria 6590
261 Ga0075429_100052476 3300006880 Bacteria 3548
262 Ga0075429_100161294 3300006880 Bacteria 1964
263 Ga0075429_100697684 3300006880 Bacteria 889
264 Ga0075429_100970612 3300006880 Bacteria 743
265 Ga0068865_100001653 3300006881 Bacteria 13064
266 Ga0068865_100345777 3300006881 Bacteria 1203
267 Ga0075436_100208425 3300006914 Bacteria 1385
268 Ga0097620_100001080 3300006931 Bacteria 27816
269 Ga0097620_100125408 3300006931 Bacteria 2637
270 Ga0097620_100309513 3300006931 Bacteria 1673
271 Ga0075435_100007648 3300007076 Bacteria 7717
272 Ga0075435_100488466 3300007076 Bacteria 1064
273 Ga0075435_100489426 3300007076 Bacteria 1063
274 Ga0075435_101852796 3300007076 Bacteria 529
275 Ga0099794_10044108 3300007265 Bacteria 2130
276 Ga0111539_10072221 3300009094 Bacteria 4070
277 Ga0111539_13264804 3300009094 Unclassified 522
278 Ga0105245_10004374 3300009098 Bacteria 12503
279 Ga0105245_10484637 3300009098 Bacteria 1250
280 Ga0105245_11946933 3300009098 Bacteria 641
281 Ga0114129_10012324 3300009147 Bacteria 12166
282 Ga0114129_10105393 3300009147 Bacteria 3897
283 Ga0114129_10129962 3300009147 Bacteria 3460
284 Ga0114129_10322375 3300009147 Bacteria 2054
285 Ga0114129_11912634 3300009147 Bacteria 719
286 Ga0114129_12014761 3300009147 Bacteria 698
287 Ga0114129_12485541 3300009147 Unclassified 619
288 Ga0114129_12493535 3300009147 Unclassified 618
289 Ga0105243_10007248 3300009148 Bacteria 8524
290 Ga0105243_10107004 3300009148 Bacteria 2332
291 Ga0105243_11983231 3300009148 Bacteria 616
292 Ga0105241_10170657 3300009174 Bacteria 1796
293 Ga0105241_10368325 3300009174 Bacteria 1252
294 Ga0105242_10006995 3300009176 Bacteria 8710
295 Ga0105242_10021035 3300009176 Bacteria 5118
296 Ga0105242_11108292 3300009176 Bacteria 806
297 Ga0105248_10365102 3300009177 Bacteria 1625
298 Ga0105237_11952752 3300009545 Bacteria 595
299 Ga0105238_12111700 3300009551 Bacteria 598
300 Ga0105239_10025271 3300010375 Bacteria 6540
301 Ga0105246_10002042 3300011119 Bacteria 12188
302 Ga0157371_10844268 3300013102 Bacteria 692
303 Ga0157371_11493232 3300013102 Bacteria 527
304 Ga0157370_11057600 3300013104 Bacteria 734
305 Ga0157369_10143602 3300013105 Bacteria 2524
306 Ga0157374_10050010 3300013296 Bacteria 3884
307 Ga0157374_10073020 3300013296 Bacteria 3238
308 Ga0157374_11938514 3300013296 Bacteria 615
309 Ga0157374_12065493 3300013296 Bacteria 596
310 Ga0157378_10034081 3300013297 Bacteria 4503
311 Ga0157378_10054860 3300013297 Bacteria 3549
312 Ga0157378_10108765 3300013297 Bacteria 2539
313 Ga0157378_10158430 3300013297 Bacteria 2115
314 Ga0163162_10400230 3300013306 Bacteria 1506
315 Ga0157372_12805019 3300013307 Bacteria 559
316 Ga0157372_13001236 3300013307 Bacteria 539
317 Ga0157375_10028798 3300013308 Bacteria 5213
318 Ga0157375_11254923 3300013308 Bacteria 870
319 Ga0157375_11744568 3300013308 Bacteria 738
320 Ga0163163_10246746 3300014325 Bacteria 1836
321 Ga0163163_11273369 3300014325 Bacteria 798
322 Ga0157380_10003854 3300014326 Bacteria 10339
323 Ga0157380_10032243 3300014326 Bacteria 4029
324 Ga0157380_10242008 3300014326 Bacteria 1627
325 Ga0157380_10523612 3300014326 Bacteria 1157
326 Ga0157380_10830964 3300014326 Bacteria 944
327 Ga0157377_10026012 3300014745 Bacteria 3127
328 Ga0157377_10769502 3300014745 Bacteria 706
329 Ga0157379_10219236 3300014968 Bacteria 1724
330 Ga0157379_10614711 3300014968 Bacteria 1015
331 Ga0157379_10679873 3300014968 Unclassified 965
332 Ga0157376_10001862 3300014969 Bacteria 14060
333 Ga0157376_10002625 3300014969 Bacteria 12226
334 Ga0157376_10481382 3300014969 Bacteria 1216
335 Ga0163161_10082723 3300017792 Bacteria 2366
336 Ga0206356_11224672 3300020070 Bacteria 660
337 Ga0207697_10155248 3300025315 Bacteria 997
338 Ga0207653_10083849 3300025885 Bacteria 1107
339 Ga0207682_10034784 3300025893 Bacteria 2033
340 Ga0207642_10038684 3300025899 Bacteria 2067
341 Ga0207710_10659884 3300025900 Bacteria 548
342 Ga0207688_10028580 3300025901 Bacteria 3068
343 Ga0207680_10030317 3300025903 Bacteria 3049
344 Ga0207680_10042948 3300025903 Bacteria 2648
345 Ga0207680_10419713 3300025903 Bacteria 947
346 Ga0207680_11238509 3300025903 Bacteria 532
347 Ga0207647_10245966 3300025904 Bacteria 1027
348 Ga0207685_10106452 3300025905 Bacteria 1208
349 Ga0207685_10167245 3300025905 Bacteria 1009
350 Ga0207685_10461276 3300025905 Bacteria 662
351 Ga0207699_10637505 3300025906 Bacteria 778
352 Ga0207645_10000319 3300025907 Bacteria 40004
353 Ga0207643_10084365 3300025908 Bacteria 1844
354 Ga0207684_10000354 3300025910 Bacteria 62819
355 Ga0207684_10004998 3300025910 Bacteria 12354
356 Ga0207684_10011565 3300025910 Bacteria 7712
357 Ga0207684_10194665 3300025910 Bacteria 1749
358 Ga0207684_10239901 3300025910 Bacteria 1564
359 Ga0207684_10246606 3300025910 Bacteria 1541
360 Ga0207684_10305748 3300025910 Unclassified 1371
361 Ga0207684_10556385 3300025910 Bacteria 981
362 Ga0207654_10926235 3300025911 Bacteria 632
363 Ga0207707_10026688 3300025912 Bacteria 5048
364 Ga0207707_10128513 3300025912 Bacteria 2216
365 Ga0207707_10873013 3300025912 Bacteria 745
366 Ga0207671_10934643 3300025914 Bacteria 685
367 Ga0207663_10174053 3300025916 Bacteria 1531
368 Ga0207663_11740864 3300025916 Bacteria 501
369 Ga0207660_10006168 3300025917 Bacteria 7783
370 Ga0207660_10025604 3300025917 Bacteria 4007
371 Ga0207660_10118004 3300025917 Bacteria 2006
372 Ga0207662_10000281 3300025918 Bacteria 23576
373 Ga0207662_10010315 3300025918 Bacteria 5157
374 Ga0207662_10080299 3300025918 Bacteria 1989
375 Ga0207662_10624426 3300025918 Bacteria 751
376 Ga0207657_10001887 3300025919 Bacteria 22650
377 Ga0207649_10055832 3300025920 Bacteria 2464
378 Ga0207649_10184042 3300025920 Bacteria 1464
379 Ga0207652_10027975 3300025921 Bacteria 4701
380 Ga0207652_10115214 3300025921 Bacteria 2387
381 Ga0207646_10000011 3300025922 Bacteria 370246
382 Ga0207646_10000252 3300025922 Bacteria 72709
383 Ga0207646_10089293 3300025922 Bacteria 2758
384 Ga0207646_10233693 3300025922 Bacteria 1661
385 Ga0207681_10071862 3300025923 Bacteria 2414
386 Ga0207681_10718461 3300025923 Bacteria 831
387 Ga0207681_10969307 3300025923 Bacteria 713
388 Ga0207650_10069245 3300025925 Bacteria 2651
389 Ga0207659_10032437 3300025926 Bacteria 3585
390 Ga0207659_10069014 3300025926 Bacteria 2573
391 Ga0207687_10030538 3300025927 Bacteria 3634
392 Ga0207687_10181887 3300025927 Bacteria 1629
393 Ga0207644_10043162 3300025931 Bacteria 3199
394 Ga0207644_10374307 3300025931 Unclassified 1161
395 Ga0207690_10020246 3300025932 Bacteria 4107
396 Ga0207690_10816009 3300025932 Bacteria 771
397 Ga0207706_10000428 3300025933 Bacteria 45224
398 Ga0207706_10678054 3300025933 Bacteria 882
399 Ga0207686_10009930 3300025934 Bacteria 5174
400 Ga0207686_10035215 3300025934 Bacteria 3003
401 Ga0207686_10332146 3300025934 Bacteria 1139
402 Ga0207709_10152022 3300025935 Bacteria 1604
403 Ga0207670_10000024 3300025936 Bacteria 143058
404 Ga0207670_10016294 3300025936 Bacteria 4463
405 Ga0207670_10363737 3300025936 Bacteria 1148
406 Ga0207669_10002413 3300025937 Bacteria 7968
407 Ga0207669_10049674 3300025937 Bacteria 2502
408 Ga0207704_10039635 3300025938 Bacteria 2745
409 Ga0207704_10269240 3300025938 Bacteria 1289
410 Ga0207665_10032938 3300025939 Bacteria 3433
411 Ga0207665_10036430 3300025939 Bacteria 3272
412 Ga0207691_10000726 3300025940 Bacteria 32543
413 Ga0207691_10044629 3300025940 Bacteria 4079
414 Ga0207691_10063839 3300025940 Bacteria 3339
415 Ga0207711_10301706 3300025941 Bacteria 1477
416 Ga0207711_10340992 3300025941 Bacteria 1387
417 Ga0207711_11455700 3300025941 Bacteria 628
418 Ga0207689_10055849 3300025942 Bacteria 3249
419 Ga0207689_10613735 3300025942 Bacteria 915
420 Ga0207661_10126569 3300025944 Bacteria 2183
421 Ga0207661_11515563 3300025944 Bacteria 614
422 Ga0207679_10001492 3300025945 Bacteria 14665
423 Ga0207679_10007191 3300025945 Bacteria 7053
424 Ga0207679_10113288 3300025945 Bacteria 2145
425 Ga0207679_11546983 3300025945 Bacteria 608
426 Ga0207667_10131926 3300025949 Bacteria 2573
427 Ga0207651_10187581 3300025960 Bacteria 1646
428 Ga0207651_10334824 3300025960 Bacteria 1270
429 Ga0207651_10712446 3300025960 Bacteria 885
430 Ga0207712_10074085 3300025961 Bacteria 2457
431 Ga0207712_10219482 3300025961 Bacteria 1519
432 Ga0207668_10006294 3300025972 Bacteria 7018
433 Ga0207640_10075813 3300025981 Bacteria 2281
434 Ga0207658_10274977 3300025986 Bacteria 1441
435 Ga0207677_10073522 3300026023 Bacteria 2421
436 Ga0207677_10486840 3300026023 Bacteria 1064
437 Ga0207677_11036051 3300026023 Bacteria 745
438 Ga0207703_10364911 3300026035 Bacteria 1333
439 Ga0207639_12030666 3300026041 Bacteria 536
440 Ga0207639_12144677 3300026041 Bacteria 520
441 Ga0207678_10229241 3300026067 Bacteria 1590
442 Ga0207678_11489676 3300026067 Bacteria 597
443 Ga0207708_10000780 3300026075 Bacteria 24018
444 Ga0207708_10001713 3300026075 Bacteria 16231
445 Ga0207708_10139591 3300026075 Bacteria 1900
446 Ga0207702_11877462 3300026078 Bacteria 590
447 Ga0207648_10002186 3300026089 Bacteria 21222
448 Ga0207648_10013209 3300026089 Bacteria 7694
449 Ga0207648_10749583 3300026089 Bacteria 907
450 Ga0207676_10073748 3300026095 Bacteria 2748
451 Ga0207676_10714467 3300026095 Bacteria 972
452 Ga0207674_10025795 3300026116 Bacteria 6259
453 Ga0207674_10188878 3300026116 Bacteria 2010
454 Ga0207675_100162689 3300026118 Bacteria 2130
455 Ga0207675_100247114 3300026118 Bacteria 1726
456 Ga0207675_101565148 3300026118 Bacteria 680
457 Ga0207675_101954660 3300026118 Bacteria 605
458 Ga0207683_10000382 3300026121 Bacteria 40830
459 Ga0207683_10198912 3300026121 Bacteria 1821
460 Ga0207698_10579083 3300026142 Bacteria 1104
461 Ga0209973_1008178 3300027252 Bacteria 1186
462 Ga0209969_1000206 3300027360 Bacteria 7891
463 Ga0209967_1000013 3300027364 Bacteria 23510
464 Ga0209981_1000720 3300027378 Bacteria 4181
465 Ga0209981_1005981 3300027378 Bacteria 1624
466 Ga0209996_1000180 3300027395 Bacteria 8137
467 Ga0209984_1000021 3300027424 Bacteria 16233
468 Ga0210000_1000181 3300027462 Bacteria 9100
469 Ga0209995_1000006 3300027471 Bacteria 35957
470 Ga0209995_1018382 3300027471 Unclassified 1152
471 Ga0209968_1000042 3300027526 Bacteria 23178
472 Ga0209968_1016708 3300027526 Bacteria 1168
473 Ga0209968_1054211 3300027526 Bacteria 700
474 Ga0209999_1000492 3300027543 Bacteria 6148
475 Ga0209999_1063056 3300027543 Bacteria 707
476 Ga0209982_1079918 3300027552 Bacteria 539
477 Ga0209970_1000462 3300027614 Bacteria 6938
478 Ga0209970_1050183 3300027614 Bacteria 754
479 Ga0210002_1000005 3300027617 Bacteria 37981
480 Ga0209983_1001278 3300027665 Bacteria 5600
481 Ga0209983_1077018 3300027665 Bacteria 746
482 Ga0209971_1000482 3300027682 Bacteria 10560
483 Ga0209971_1019563 3300027682 Bacteria 1608
484 Ga0209971_1107834 3300027682 Bacteria 683
485 Ga0209966_1000092 3300027695 Bacteria 39143
486 Ga0209966_1001168 3300027695 Bacteria 4700
487 Ga0209998_10000049 3300027717 Bacteria 48633
488 Ga0209998_10015756 3300027717 Bacteria 1587
489 Ga0209974_10004159 3300027876 Bacteria 5175
490 Ga0209974_10005801 3300027876 Bacteria 4330
491 Ga0209974_10087637 3300027876 Bacteria 1077
492 Ga0209974_10150797 3300027876 Bacteria 839
493 Ga0207428_10001066 3300027907 Bacteria 30105
494 Ga0207428_10056972 3300027907 Bacteria 3104
495 Ga0268266_10308359 3300028379 Bacteria 1478
496 Ga0268266_11340318 3300028379 Bacteria 691
497 Ga0268265_10546336 3300028380 Bacteria 1099
498 Ga0268265_11376484 3300028380 Bacteria 707
499 Ga0268264_10024071 3300028381 Bacteria 4969
500 Ga0268264_10046757 3300028381 Bacteria 3596
501 Ga0268264_10374807 3300028381 Bacteria 1361
502 Ga0265338_10055975 3300028800 Bacteria 3503
503 Ga0307511_10000442 3300030521 Bacteria 44415
504 Ga0265327_10137169 3300031251 Bacteria 1146
505 Ga0265316_10913647 3300031344 Bacteria 613
506 Ga0265316_10962510 3300031344 Unclassified 595
507 Ga0307408_100031691 3300031548 Bacteria 3682
508 Ga0307408_100616472 3300031548 Bacteria 966
509 Ga0307405_10004671 3300031731 Bacteria 6508
510 Ga0307405_10830788 3300031731 Bacteria 776
511 Ga0307405_11467576 3300031731 Bacteria 598
512 Ga0307413_11044500 3300031824 Bacteria 703
513 Ga0307410_10026168 3300031852 Bacteria 3669
514 Ga0307410_10353701 3300031852 Bacteria 1174
515 Ga0307406_10146134 3300031901 Bacteria 1680
516 Ga0307407_10061421 3300031903 Bacteria 2196
517 Ga0307407_11087645 3300031903 Bacteria 621
518 Ga0307412_10012004 3300031911 Bacteria 5032
519 Ga0307412_10546556 3300031911 Bacteria 972
520 Ga0307409_100075929 3300031995 Bacteria 2693
521 Ga0307409_100136108 3300031995 Bacteria 2108
522 Ga0307416_100024445 3300032002 Bacteria 4410
523 Ga0307416_100782578 3300032002 Bacteria 1049
524 Ga0307416_102807870 3300032002 Bacteria 582
525 Ga0307414_10344425 3300032004 Bacteria 1277
526 Ga0307414_11658893 3300032004 Bacteria 596
527 Ga0307411_10003709 3300032005 Bacteria 7157
528 Ga0307411_10016375 3300032005 Bacteria 4194
529 Ga0307415_100038079 3300032126 Bacteria 3166
530 Ga0316593_10161025 3300032168 Bacteria 820
531 Ga0316593_10320698 3300032168 Unclassified 589
532 Ga0373958_0163399 3300034819 Bacteria 564
533 Ga0373926_0045995 3300035083 Bacteria 1565
534 Ga0373929_0193341 3300035085 Bacteria 567
535 Ga0373934_0061495 3300035086 Bacteria 1496
536 Ga0373923_0083806 3300035111 Bacteria 1386
537 Ga0373941_0127870 3300035115 Unclassified 912
538 Ga0373941_0240033 3300035115 Unclassified 704
539 Ga0373945_0110829 3300035116 Bacteria 1083
540 Ga0373945_0134495 3300035116 Bacteria 993
541 Ga0373956_0277813 3300035119 Bacteria 797
542 Ga0373957_0453771 3300035120 Bacteria 555
543 Ga0373960_0085052 3300035121 Bacteria 1003
544 Ga0373960_0103335 3300035121 Bacteria 926
545 Ga0373943_0026835 3300035170 Bacteria 2702
546 Ga0373946_0123635 3300035171 Bacteria 1184
547 Ga0373955_0134329 3300035172 Bacteria 1446
548 Ga0373942_0015789 3300035207 Bacteria 1845
549 Ga0373961_0369439 3300035241 Bacteria 544
550 Ga0373962_0083044 3300035242 Bacteria 976
551 Ga0373924_0368847 3300035410 Bacteria 640
552 Ga0373931_0185987 3300035691 Bacteria 1233
553 Ga0373931_0195960 3300035691 Bacteria 1204
554 Ga0373931_0908606 3300035691 Unclassified 592
555 Ga0373935_0044283 3300035692 Bacteria 2804
556 Ga0373935_0538420 3300035692 Bacteria 850
557 Ga0373927_0035547 3300035695 Bacteria 3240
558 Ga0373933_0032880 3300035724 Bacteria 3015
559 Ga0373947_0026956 3300035725 Bacteria 3361
560 Ga0373947_1063830 3300035725 Bacteria 552
561 Ga0373937_0569003 3300036401 Bacteria 1076
562 Ga0373925_0522369 3300037068 Bacteria 975
563 Ga0242420_049477 3300038996 Bacteria 819
564 Ga0400483_123123 3300039062 Bacteria 1180
565 Ga0400483_261336 3300039062 Bacteria 1514
566 Ga0439438_012686 3300041405 Bacteria 2573
567 Ga0439439_0009813 3300041406 Bacteria 2284
568 Ga0439447_045113 3300041407 Bacteria 1064
569 Ga0439453_0056649 3300041408 Bacteria 803
570 Ga0439461_0011958 3300041410 Bacteria 1618
571 Ga0439466_0027179 3300041411 Bacteria 1983
572 Ga0439465_0261708 3300041413 Bacteria 642
573 Ga0451802_1015304 3300041460 Bacteria 714
574 Ga0451807_1487812 3300041486 Bacteria 1160
575 Ga0451837_0058787 3300041494 Bacteria 2497
576 Ga0451849_0205384 3300041505 Bacteria 945
577 Ga0439431_0013413 3300041997 Bacteria 1891
578 Ga0439433_0081645 3300041999 Bacteria 787
579 Ga0439441_009512 3300042001 Bacteria 1611
580 Ga0439448_0185249 3300042005 Bacteria 728
581 Ga0439432_026350 3300042006 Bacteria 1903
582 Ga0439451_076935 3300042009 Unclassified 669
583 Ga0439452_027821 3300042010 Bacteria 1416
584 Ga0439454_121215 3300042011 Unclassified 506
585 Ga0439455_0081424 3300042012 Unclassified 880
586 Ga0439455_0202149 3300042012 Bacteria 575
587 Ga0439456_061353 3300042013 Bacteria 827
588 Ga0439457_138334 3300042014 Bacteria 582
589 Ga0439462_0051864 3300042015 Bacteria 1103
590 Ga0450914_030353 3300042118 Bacteria 648
591 Ga0450896_052909 3300042133 Bacteria 650
592 Ga0450905_036787 3300042142 Bacteria 769
593 Ga0439446_0031510 3300042156 Bacteria 1534
594 Ga0450909_012392 3300042185 Bacteria 1250
595 Ga0439435_0010610 3300042436 Bacteria 2192
596 Ga0439435_0034881 3300042436 Bacteria 1385
597 Ga0439444_0063208 3300042437 Bacteria 777
598 Ga0439464_0046380 3300042439 Bacteria 1249
599 Ga0439464_0077699 3300042439 Bacteria 988
600 Ga0439464_0274740 3300042439 Unclassified 547
601 Ga0439460_0019928 3300042461 Bacteria 1820
602 Ga0439460_0070169 3300042461 Bacteria 1084
603 Ga0450893_0106676 3300042532 Unclassified 575
604 Ga0451577_0264706 3300042876 Bacteria 1557
605 Ga0451577_0395796 3300042876 Bacteria 1254
606 Ga0451577_1799548 3300042876 Bacteria 537
607 Ga0439440_0256818 3300042993 Unclassified 534
608 Ga0439440_0280681 3300042993 Bacteria 514
609 Ga0453683_0069750 3300044673 Bacteria 2198
610 Ga0453683_0107305 3300044673 Unclassified 1755
611 Ga0453683_0292327 3300044673 Bacteria 1042
612 Ga0466963_0192463 3300044694 Bacteria 1425
613 Ga0453684_0255611 3300044712 Bacteria 2009
614 Ga0453684_0269147 3300044712 Bacteria 1948
615 Ga0453684_0388138 3300044712 Bacteria 1566
616 Ga0453684_0527403 3300044712 Bacteria 1304
617 Ga0453684_0632788 3300044712 Bacteria 1169
618 Ga0453684_0950237 3300044712 Bacteria 917
619 Ga0453684_1171214 3300044712 Bacteria 808
620 Ga0453684_1353995 3300044712 Bacteria 740
621 Ga0466971_0305184 3300044719 Bacteria 765
622 Ga0466957_0112615 3300044842 Bacteria 1727
623 Ga0451576_0010724 3300045051 Bacteria 10493
624 Ga0451576_0334658 3300045051 Bacteria 1585
625 Ga0451576_0585028 3300045051 Bacteria 1173
626 Ga0451576_0793871 3300045051 Bacteria 994
627 Ga0451576_1789170 3300045051 Bacteria 635
628 Ga0451576_1891564 3300045051 Bacteria 616
629 Ga0466958_0390972 3300045836 Bacteria 897
630 Ga0466967_0192171 3300045976 Bacteria 1930
631 Ga0495592_0228274 3300046454 Bacteria 1241
632 Ga0495629_0034132 3300046459 Bacteria 3597
633 Ga0495651_0360859 3300046462 Bacteria 958
634 Ga0495653_0146529 3300046463 Bacteria 1654
635 Ga0495582_0072667 3300046473 Bacteria 1904
636 Ga0495582_0416817 3300046473 Bacteria 775
637 Ga0495639_0455303 3300046475 Bacteria 650
638 Ga0495584_0616316 3300046491 Unclassified 553
639 Ga0495594_0011487 3300046499 Bacteria 4604
640 Ga0495594_0285376 3300046499 Bacteria 940
641 Ga0495594_0546203 3300046499 Bacteria 657
642 Ga0495596_0272862 3300046500 Unclassified 657
643 Ga0495607_0190683 3300046501 Unclassified 1021
644 Ga0495637_0050577 3300046520 Bacteria 1743
645 Ga0495666_0385049 3300046526 Bacteria 631
646 Ga0495609_0139077 3300046538 Unclassified 1037
647 Ga0495621_0153174 3300046539 Bacteria 908
648 Ga0495622_0188528 3300046557 Bacteria 923
649 Ga0495656_0327007 3300046615 Unclassified 791
650 Ga0495634_0411341 3300046642 Bacteria 802
651 Ga0495635_0268224 3300046663 Bacteria 1148
652 Ga0495635_0668671 3300046663 Bacteria 675
653 Ga0495659_0009361 3300046664 Bacteria 3126
654 Ga0495588_0203174 3300046674 Bacteria 1047
655 Ga0495657_0032657 3300046675 Bacteria 3631
656 Ga0495647_0013988 3300046681 Bacteria 2790
657 Ga0495658_0097137 3300046683 Bacteria 1753
658 Ga0495624_0195130 3300046690 Bacteria 1231
659 Ga0495670_0129089 3300046691 Bacteria 1317
660 Ga0495670_0311570 3300046691 Unclassified 844
661 Ga0495589_0174031 3300046794 Unclassified 1023
662 Ga0495600_0121010 3300046809 Bacteria 1702
663 Ga0495581_0030598 3300047315 Bacteria 3119
664 Ga0495604_0140888 3300047317 Bacteria 1723
665 Ga0495636_0530225 3300047318 Bacteria 571
666 Ga0495680_0096615 3300047322 Unclassified 2206
667 Ga0495614_0065681 3300048089 Bacteria 1561
668 Ga0496106_0382029 3300048909 Bacteria 1132
669 Ga0496109_1153059 3300048912 Bacteria 712
670 Ga0496111_0037047 3300048914 Bacteria 3490
671 Ga0496112_1794613 3300048915 Bacteria 525
672 Ga0501308_063994 3300049128 Bacteria 560
673 Ga0501309_040989 3300049129 Bacteria 708
674 Ga0501304_023346 3300049160 Bacteria 625
675 Ga0501290_001203 3300049513 Bacteria 3630
676 Ga0501291_000070 3300049514 Bacteria 12062
677 Ga0501292_000097 3300049515 Bacteria 15474
678 Ga0501293_001129 3300049516 Bacteria 2000
679 Ga0501294_000073 3300049517 Bacteria 10983
680 Ga0501295_000110 3300049518 Bacteria 8049
681 Ga0501296_000001 3300049519 Bacteria 31185
682 Ga0501297_000026 3300049520 Bacteria 14970
683 Ga0501298_005654 3300049521 Bacteria 2014
684 Ga0501298_052086 3300049521 Bacteria 851
685 Ga0501299_000081 3300049522 Bacteria 10639
686 Ga0501299_100089 3300049522 Bacteria 672
687 Ga0501300_000275 3300049523 Bacteria 7826
688 Ga0501301_000256 3300049524 Bacteria 3096
689 Ga0501303_001156 3300049526 Bacteria 1966
690 Ga0501311_102006 3300049527 Bacteria 509
691 Ga0501312_060276 3300049528 Bacteria 656
692 Ga0501317_106748 3300049533 Bacteria 511
693 Ga0501031_0003007 3300049568 Bacteria 10794
694 Ga0501031_0003309 3300049568 Bacteria 10343
695 Ga0501031_0013954 3300049568 Bacteria 5232
696 Ga0501031_0052700 3300049568 Bacteria 2651
697 Ga0501031_0221458 3300049568 Bacteria 1232
698 Ga0501031_0668675 3300049568 Bacteria 667
699 Ga0501032_0011486 3300049569 Bacteria 6362
700 Ga0501032_0022670 3300049569 Bacteria 4351
701 Ga0501032_0275407 3300049569 Bacteria 1090
702 Ga0501033_0189779 3300049570 Bacteria 1471
703 Ga0501033_0926442 3300049570 Bacteria 585
704 Ga0501034_0821894 3300049571 Bacteria 821
705 Ga0501034_1136513 3300049571 Bacteria 661
706 Ga0501036_0001418 3300049572 Bacteria 18422
707 Ga0501036_0072666 3300049572 Bacteria 2908
708 Ga0501036_0106647 3300049572 Bacteria 2369
709 Ga0501036_0177349 3300049572 Bacteria 1794
710 Ga0501036_1699334 3300049572 Bacteria 509
711 Ga0501037_0005978 3300049573 Bacteria 8889
712 Ga0501037_0019840 3300049573 Bacteria 4960
713 Ga0501037_0044493 3300049573 Bacteria 3260
714 Ga0501037_0186277 3300049573 Bacteria 1471
715 Ga0501037_0392312 3300049573 Bacteria 953
716 Ga0501038_0034759 3300049574 Bacteria 4429
717 Ga0501038_0043832 3300049574 Bacteria 3889
718 Ga0501038_0048896 3300049574 Bacteria 3659
719 Ga0501038_0396391 3300049574 Bacteria 1068
720 Ga0501038_1308771 3300049574 Bacteria 523
721 Ga0501039_0010478 3300049575 Bacteria 7063
722 Ga0501039_0020879 3300049575 Bacteria 5020
723 Ga0501039_0043557 3300049575 Bacteria 3467
724 Ga0501039_0220646 3300049575 Bacteria 1490
725 Ga0501039_0268065 3300049575 Bacteria 1342
726 Ga0501039_0558912 3300049575 Bacteria 898
727 Ga0501040_0019056 3300049576 Bacteria 4561
728 Ga0501040_0031341 3300049576 Bacteria 3593
729 Ga0501040_0053014 3300049576 Bacteria 2777
730 Ga0501040_0092978 3300049576 Bacteria 2097
731 Ga0501040_0937441 3300049576 Unclassified 627
732 Ga0501041_0000835 3300049577 Bacteria 16538
733 Ga0501041_0006703 3300049577 Bacteria 6747
734 Ga0501041_0009263 3300049577 Bacteria 5797
735 Ga0501041_0145921 3300049577 Bacteria 1476
736 Ga0501042_0024884 3300049578 Bacteria 4202
737 Ga0501042_0033761 3300049578 Bacteria 3628
738 Ga0501042_0045230 3300049578 Bacteria 3137
739 Ga0501042_0094916 3300049578 Bacteria 2142
740 Ga0501042_0136752 3300049578 Unclassified 1766
741 Ga0501043_0177162 3300049579 Unclassified 1662
742 Ga0501043_0220160 3300049579 Bacteria 1469
743 Ga0501046_0003559 3300049580 Bacteria 14273
744 Ga0501046_0004698 3300049580 Bacteria 12325
745 Ga0501046_0018359 3300049580 Bacteria 5821
746 Ga0501046_0031280 3300049580 Bacteria 4316
747 Ga0501046_0374776 3300049580 Bacteria 1031
748 Ga0501047_0777516 3300049581 Bacteria 773
749 Ga0501048_0000395 3300049582 Bacteria 30360
750 Ga0501048_0075391 3300049582 Bacteria 2379
751 Ga0501048_0127417 3300049582 Bacteria 1800
752 Ga0501048_0535514 3300049582 Bacteria 840
753 Ga0501048_0983013 3300049582 Unclassified 607
754 Ga0501067_0176473 3300049583 Bacteria 1190
755 Ga0501067_0378252 3300049583 Bacteria 790
756 Ga0501068_0240630 3300049584 Bacteria 1152
757 Ga0501068_0360137 3300049584 Bacteria 935
758 Ga0501069_0571397 3300049585 Bacteria 677
759 Ga0501069_0597665 3300049585 Bacteria 662
760 Ga0501069_0612584 3300049585 Bacteria 654
761 Ga0501070_0319362 3300049586 Bacteria 1263
762 Ga0501070_1197593 3300049586 Bacteria 583
763 Ga0501071_0002970 3300049587 Bacteria 10484
764 Ga0501071_0132578 3300049587 Bacteria 1852
765 Ga0501071_0397358 3300049587 Bacteria 1052
766 Ga0501072_0029542 3300049588 Bacteria 4283
767 Ga0501072_0432611 3300049588 Bacteria 1043
768 Ga0501072_0748481 3300049588 Bacteria 767
769 Ga0501073_0479957 3300049589 Bacteria 860
770 Ga0501074_0071057 3300049590 Bacteria 2502
771 Ga0501074_1289703 3300049590 Bacteria 512
772 Ga0501075_0008078 3300049591 Bacteria 7317
773 Ga0501075_0191046 3300049591 Bacteria 1562
774 Ga0501075_0338407 3300049591 Bacteria 1147
775 Ga0501075_0913966 3300049591 Unclassified 667
776 Ga0501075_1390903 3300049591 Bacteria 531
777 Ga0501076_0075708 3300049592 Bacteria 2698
778 Ga0501076_0210650 3300049592 Bacteria 1588
779 Ga0501076_0225491 3300049592 Bacteria 1531
780 Ga0501076_0561520 3300049592 Bacteria 941
781 Ga0501076_0644930 3300049592 Unclassified 874
782 Ga0501198_005747 3300049649 Bacteria 1752
783 Ga0501199_000588 3300049650 Bacteria 3207
784 Ga0501201_010914 3300049651 Bacteria 893
785 Ga0501202_001084 3300049652 Bacteria 4237
786 Ga0501206_000681 3300049653 Bacteria 4130
787 Ga0501208_000033 3300049655 Bacteria 8087
788 Ga0501214_082232 3300049659 Bacteria 543
789 Ga0501216_000248 3300049660 Bacteria 5996
790 Ga0501217_000657 3300049661 Bacteria 5855
791 Ga0501223_100251 3300049663 Bacteria 596
792 Ga0501224_050918 3300049664 Bacteria 635
793 Ga0501227_023381 3300049665 Bacteria 1436
794 Ga0501233_000389 3300049668 Bacteria 6946
795 Ga0501235_000044 3300049669 Bacteria 19898
796 Ga0501236_000030 3300049670 Bacteria 13822
797 Ga0501239_000789 3300049672 Bacteria 2552
798 Ga0501242_005697 3300049674 Bacteria 1408
799 Ga0501243_003599 3300049675 Bacteria 2305
800 Ga0501247_070289 3300049677 Bacteria 551
801 Ga0501248_000573 3300049678 Bacteria 2056
802 Ga0501249_001670 3300049679 Bacteria 4532
803 Ga0501251_003246 3300049681 Bacteria 1614
804 Ga0501253_002203 3300049683 Bacteria 2158
805 Ga0501255_001817 3300049684 Bacteria 1786
806 Ga0501256_000607 3300049685 Bacteria 2365
807 Ga0501257_001093 3300049686 Bacteria 5495
808 Ga0501259_036823 3300049688 Bacteria 947
809 Ga0501260_048832 3300049689 Bacteria 529
810 Ga0501261_000708 3300049690 Bacteria 4171
811 Ga0501219_001018 3300049703 Bacteria 3259
812 Ga0501225_0001524 3300049705 Bacteria 7272
813 Ga0501229_001207 3300049706 Bacteria 3004
814 Ga0501245_001430 3300049708 Bacteria 3092
815 Ga0501079_0193080 3300049741 Bacteria 1589
816 Ga0501080_0607402 3300049742 Bacteria 970
817 Ga0501080_1220989 3300049742 Unclassified 646
818 Ga0501081_0471811 3300049743 Bacteria 933
819 Ga0501081_0486350 3300049743 Bacteria 919
820 Ga0501083_0033924 3300049744 Bacteria 3492
821 Ga0501083_1148339 3300049744 Bacteria 505
822 Ga0501232_000579 3300049757 Bacteria 2508
823 Ga0501264_000260 3300049761 Bacteria 8360
824 Ga0501265_001370 3300049762 Bacteria 2756
825 Ga0501266_000269 3300049763 Bacteria 6816
826 Ga0501269_023202 3300049766 Bacteria 778
827 Ga0501270_002952 3300049767 Bacteria 1791
828 Ga0501271_001541 3300049768 Bacteria 1991
829 Ga0501272_000814 3300049769 Bacteria 2830
830 Ga0501273_000418 3300049770 Bacteria 3385
831 Ga0501274_000464 3300049771 Bacteria 2857
832 Ga0501275_019137 3300049772 Bacteria 824
833 Ga0501276_000272 3300049773 Bacteria 2993
834 Ga0501278_000701 3300049774 Bacteria 2537
835 Ga0501279_002409 3300049775 Bacteria 2456
836 Ga0501280_001221 3300049776 Bacteria 5015
837 Ga0501281_00480 3300049777 Bacteria 3763
838 Ga0501282_001620 3300049778 Bacteria 2486
839 Ga0501283_000031 3300049779 Bacteria 16683
840 Ga0501035_0004145 3300049822 Bacteria 13774
841 Ga0501035_0030679 3300049822 Bacteria 4900
842 Ga0501035_0048549 3300049822 Bacteria 3807
843 Ga0501035_0588486 3300049822 Bacteria 908
844 Ga0501044_0198050 3300049823 Bacteria 1968
845 Ga0501044_0666574 3300049823 Unclassified 928
846 Ga0501044_1444713 3300049823 Bacteria 553
847 Ga0501045_0071010 3300049824 Bacteria 2562
848 Ga0501045_1105664 3300049824 Unclassified 580
849 nmdc:mga05p37_21807_c1 3300050507 Bacteria 7760
850 nmdc:mga05p37_242672_c1 3300050507 Bacteria 2165
851 nmdc:mga05p37_539343_c1 3300050507 Bacteria 1330
852 nmdc:mga05p37_745742_c1 3300050507 Bacteria 1080
853 nmdc:mga05p37_83120_c1 3300050507 Bacteria 3944
854 nmdc:mga09592_141745_c1 3300050508 Bacteria 2072
855 nmdc:mga09592_27143_c1 3300050508 Bacteria 4751
856 nmdc:mga09592_275837_c1 3300050508 Bacteria 1458
857 nmdc:mga09592_71664_c1 3300050508 Bacteria 2941
858 nmdc:mga09592_7623_c1 3300050508 Bacteria 8802
859 nmdc:mga0qj67_10014_c1 3300050509 Bacteria 7071
860 nmdc:mga0qj67_1216_c1 3300050509 Bacteria 17913
861 nmdc:mga0qj67_18859_c1 3300050509 Bacteria 5263
862 nmdc:mga0qj67_73283_c1 3300050509 Bacteria 2735
863 nmdc:mga06r32_12279_c1 3300050510 Bacteria 7725
864 nmdc:mga06r32_31560_c1 3300050510 Bacteria 4977
865 nmdc:mga06r32_84525_c1 3300050510 Bacteria 3093
866 nmdc:mga06r32_9935_c1 3300050510 Bacteria 8588
867 nmdc:mga08y16_49455_c1 3300050511 Bacteria 4401
868 nmdc:mga0n895_157515_c1 3300050512 Bacteria 2302
869 nmdc:mga0n895_2194854_c1 3300050512 Bacteria 508
870 nmdc:mga0n895_2230970_c1 3300050512 Bacteria 503
871 nmdc:mga0rr50_1025642_c1 3300050513 Bacteria 703
872 nmdc:mga0rr50_1300338_c1 3300050513 Bacteria 617
873 nmdc:mga0rr50_195989_c1 3300050513 Bacteria 1658
874 nmdc:mga0rr50_734488_c1 3300050513 Bacteria 843
875 nmdc:mga08x19_219847_c1 3300050514 Bacteria 1305
876 nmdc:mga08x19_343142_c1 3300050514 Bacteria 1042
877 nmdc:mga08x19_85669_c1 3300050514 Bacteria 2074
878 nmdc:mga0a205_20209_c1 3300050515 Bacteria 6282
879 nmdc:mga0a205_479739_c1 3300050515 Bacteria 1102
880 Ga0495601_0008311 3300053077 Bacteria 6127
881 Ga0495612_0172330 3300053078 Bacteria 948
882 Ga0495595_0177233 3300053084 Bacteria 1056
883 Ga0495619_0146839 3300053085 Bacteria 1626
884 Ga0495619_0157571 3300053085 Bacteria 1567
885 Ga0501084_0185142 3300054114 Bacteria 1757
886 Ga0501084_0451151 3300054114 Bacteria 1087
887 Ga0501084_1592657 3300054114 Bacteria 546
888 Ga0590071_043061 3300059421 Bacteria 1088
889 Ga0590075_003561 3300059424 Bacteria 3694
890 Ga0590077_077776 3300059426 Bacteria 762
891 Ga0587070_093484 3300059491 Bacteria 680
892 Ga0587079_123978 3300059647 Bacteria 642
893 Ga0501082_0036974 3300060353 Bacteria 4206
894 Ga0501082_1024111 3300060353 Bacteria 722
895 Ga0466962_0304612 3300061719 Bacteria 789
896 Ga0530510_0024573 3300061734 Bacteria 4301
897 Ga0530510_0340977 3300061734 Bacteria 1125
898 Ga0530510_0423946 3300061734 Unclassified 1004
899 Ga0530510_0717799 3300061734 Bacteria 762

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005327 Ga0070658_10025278 Ga0070658_100252782 79
2 3300005366 Ga0070659_100991417 Ga0070659_1009914171 79
3 3300031251 Ga0265327_10137169 Ga0265327_101371691 80
4 3300005539 Ga0068853_101220592 Ga0068853_1012205922 82
5 3300026041 Ga0207639_12144677 Ga0207639_121446772 82
6 3300026116 Ga0207674_10188878 Ga0207674_101888782 82
7 3300028800 Ga0265338_10055975 Ga0265338_100559751 82
8 3300005353 Ga0070669_101072058 Ga0070669_1010720582 83
9 3300006173 Ga0070716_100397840 Ga0070716_1003978402 83
10 3300025923 Ga0207681_10969307 Ga0207681_109693071 83
11 3300025939 Ga0207665_10036430 Ga0207665_100364302 83
12 3300048914 Ga0496111_0037047 Ga0496111_0037047_527_790 83
13 3300049572 Ga0501036_1699334 Ga0501036_1699334_10_285 83
14 3300049585 Ga0501069_0597665 Ga0501069_0597665_244_519 83
15 3300061734 Ga0530510_0340977 Ga0530510_0340977_548_835 83
16 3300005843 Ga0068860_100072223 Ga0068860_1000722234 84
17 3300026095 Ga0207676_10714467 Ga0207676_107144671 84
18 3300028381 Ga0268264_10024071 Ga0268264_100240714 84
19 3300005327 Ga0070658_10036820 Ga0070658_100368202 85
20 3300005339 Ga0070660_100001287 Ga0070660_1000012873 85
21 3300005356 Ga0070674_100525895 Ga0070674_1005258952 85
22 3300005457 Ga0070662_100869771 Ga0070662_1008697711 85
23 3300005564 Ga0070664_100539742 Ga0070664_1005397422 85
24 3300005616 Ga0068852_100721648 Ga0068852_1007216482 85
25 3300005718 Ga0068866_10129194 Ga0068866_101291943 85
26 3300005842 Ga0068858_101307008 Ga0068858_1013070082 85
27 3300006852 Ga0075433_11601586 Ga0075433_116015862 85
28 3300006871 Ga0075434_102619501 Ga0075434_1026195012 85
29 3300006880 Ga0075429_100970612 Ga0075429_1009706122 85
30 3300009098 Ga0105245_10484637 Ga0105245_104846373 85
31 3300009148 Ga0105243_10107004 Ga0105243_101070043 85
32 3300009176 Ga0105242_11108292 Ga0105242_111082922 85
33 3300009177 Ga0105248_10365102 Ga0105248_103651021 85
34 3300013308 Ga0157375_11744568 Ga0157375_117445682 85
35 3300014325 Ga0163163_10246746 Ga0163163_102467463 85
36 3300014325 Ga0163163_11273369 Ga0163163_112733692 85
37 3300014326 Ga0157380_10523612 Ga0157380_105236122 85
38 3300014968 Ga0157379_10614711 Ga0157379_106147113 85
39 3300046539 Ga0495621_0153174 Ga0495621_0153174_481_756 85
40 3300005335 Ga0070666_10166291 Ga0070666_101662912 86
41 3300005335 Ga0070666_10665729 Ga0070666_106657291 86
42 3300005440 Ga0070705_100785023 Ga0070705_1007850231 86
43 3300005471 Ga0070698_100108921 Ga0070698_1001089212 86
44 3300005577 Ga0068857_102009636 Ga0068857_1020096362 86
45 3300005719 Ga0068861_100189158 Ga0068861_1001891582 86
46 3300006847 Ga0075431_100004808 Ga0075431_10000480811 86
47 3300006852 Ga0075433_10153120 Ga0075433_101531202 86
48 3300006880 Ga0075429_100161294 Ga0075429_1001612943 86
49 3300007076 Ga0075435_100488466 Ga0075435_1004884662 86
50 3300017792 Ga0163161_10082723 Ga0163161_100827232 86
51 3300025903 Ga0207680_10042948 Ga0207680_100429484 86
52 3300025944 Ga0207661_11515563 Ga0207661_115155632 86
53 3300025945 Ga0207679_11546983 Ga0207679_115469832 86
54 3300025961 Ga0207712_10219482 Ga0207712_102194821 86
55 3300026078 Ga0207702_11877462 Ga0207702_118774621 86
56 3300026118 Ga0207675_100247114 Ga0207675_1002471143 86
57 3300027907 Ga0207428_10056972 Ga0207428_100569724 86
58 3300030521 Ga0307511_10000442 Ga0307511_1000044239 86
59 3300031344 Ga0265316_10962510 Ga0265316_109625101 86
60 3300032168 Ga0316593_10161025 Ga0316593_101610251 86
61 3300032168 Ga0316593_10320698 Ga0316593_103206982 86
62 3300041460 Ga0451802_1015304 Ga0451802_1015304_239_544 86
63 3300041486 Ga0451807_1487812 Ga0451807_1487812_802_1104 86
64 3300041494 Ga0451837_0058787 Ga0451837_0058787_1742_2038 86
65 3300041505 Ga0451849_0205384 Ga0451849_0205384_349_651 86
66 3300044712 Ga0453684_1353995 Ga0453684_1353995_373_657 86
67 3300044719 Ga0466971_0305184 Ga0466971_0305184_28_294 86
68 3300044842 Ga0466957_0112615 Ga0466957_0112615_822_1088 86
69 3300045051 Ga0451576_1789170 Ga0451576_1789170_305_586 86
70 3300045836 Ga0466958_0390972 Ga0466958_0390972_580_846 86
71 3300049588 Ga0501072_0432611 Ga0501072_0432611_727_1005 86
72 3300049591 Ga0501075_1390903 Ga0501075_1390903_43_321 86
73 3300050507 nmdc:mga05p37_539343_c1 nmdc:mga05p37_539343_c1_316_600 86
74 3300050507 nmdc:mga05p37_745742_c1 nmdc:mga05p37_745742_c1_49_336 86
75 3300050508 nmdc:mga09592_275837_c1 nmdc:mga09592_275837_c1_1075_1380 86
76 3300050508 nmdc:mga09592_71664_c1 nmdc:mga09592_71664_c1_1728_2015 86
77 3300050510 nmdc:mga06r32_9935_c1 nmdc:mga06r32_9935_c1_6216_6503 86
78 3300054114 Ga0501084_1592657 Ga0501084_1592657_76_354 86
79 3300059647 Ga0587079_123978 Ga0587079_123978_249_521 86
80 3300061719 Ga0466962_0304612 Ga0466962_0304612_72_338 86
81 2162886007 SwRhRL2b_contig_1087855 SwRhRL2b_0646.00005750 87
82 2209111006 2214806902 2213838361 87
83 3300002244 JGI24742J22300_10077764 JGI24742J22300_100777642 87
84 3300003347 JGI26128J50194_1005255 JGI26128J50194_10052552 87
85 3300003349 JGI26129J50193_1011093 JGI26129J50193_10110932 87
86 3300003371 JGI26145J50221_1000071 JGI26145J50221_10000714 87
87 3300003379 JGI26142J50222_102611 JGI26142J50222_1026111 87
88 3300003383 JGI26140J50224_101891 JGI26140J50224_1018912 87
89 3300003392 JGI26134J50242_101155 JGI26134J50242_1011551 87
90 3300003397 JGI26133J50247_102041 JGI26133J50247_1020411 87
91 3300003398 JGI26130J50248_102899 JGI26130J50248_1028992 87
92 3300003405 JGI26132J50249_103969 JGI26132J50249_1039691 87
93 3300003502 JGI26143J51219_1006949 JGI26143J51219_10069491 87
94 3300003503 JGI26141J51220_1002671 JGI26141J51220_10026712 87
95 3300003504 JGI26138J51218_102793 JGI26138J51218_1027931 87
96 3300004801 Ga0058860_11408664 Ga0058860_114086642 87
97 3300004801 Ga0058860_11878411 Ga0058860_118784112 87
98 3300005289 Ga0065704_10005524 Ga0065704_100055246 87
99 3300005289 Ga0065704_10287312 Ga0065704_102873121 87
100 3300005290 Ga0065712_10202387 Ga0065712_102023872 87
101 3300005293 Ga0065715_10024978 Ga0065715_100249782 87
102 3300005293 Ga0065715_10466356 Ga0065715_104663561 87
103 3300005293 Ga0065715_10703734 Ga0065715_107037341 87
104 3300005295 Ga0065707_10083722 Ga0065707_100837222 87
105 3300005295 Ga0065707_10112291 Ga0065707_101122912 87
106 3300005295 Ga0065707_10499672 Ga0065707_104996721 87
107 3300005328 Ga0070676_10002110 Ga0070676_100021101 87
108 3300005328 Ga0070676_10811513 Ga0070676_108115132 87
109 3300005329 Ga0070683_101520820 Ga0070683_1015208201 87
110 3300005330 Ga0070690_100000128 Ga0070690_1000001288 87
111 3300005330 Ga0070690_100006058 Ga0070690_1000060582 87
112 3300005330 Ga0070690_100163496 Ga0070690_1001634961 87
113 3300005331 Ga0070670_100073412 Ga0070670_1000734122 87
114 3300005331 Ga0070670_100399030 Ga0070670_1003990302 87
115 3300005333 Ga0070677_10010132 Ga0070677_100101322 87
116 3300005334 Ga0068869_100399586 Ga0068869_1003995861 87
117 3300005334 Ga0068869_101641377 Ga0068869_1016413772 87
118 3300005335 Ga0070666_10018395 Ga0070666_100183954 87
119 3300005335 Ga0070666_10529419 Ga0070666_105294192 87
120 3300005336 Ga0070680_100031316 Ga0070680_1000313163 87
121 3300005336 Ga0070680_100063420 Ga0070680_1000634204 87
122 3300005336 Ga0070680_100063732 Ga0070680_1000637322 87
123 3300005336 Ga0070680_100340015 Ga0070680_1003400151 87
124 3300005336 Ga0070680_100995570 Ga0070680_1009955701 87
125 3300005337 Ga0070682_100225353 Ga0070682_1002253532 87
126 3300005337 Ga0070682_100291316 Ga0070682_1002913162 87
127 3300005337 Ga0070682_101474018 Ga0070682_1014740182 87
128 3300005338 Ga0068868_100077174 Ga0068868_1000771742 87
129 3300005338 Ga0068868_100175469 Ga0068868_1001754694 87
130 3300005338 Ga0068868_100439819 Ga0068868_1004398192 87
131 3300005339 Ga0070660_100085519 Ga0070660_1000855191 87
132 3300005339 Ga0070660_100850866 Ga0070660_1008508662 87
133 3300005340 Ga0070689_100001472 Ga0070689_10000147210 87
134 3300005340 Ga0070689_100024154 Ga0070689_1000241542 87
135 3300005340 Ga0070689_100077278 Ga0070689_1000772783 87
136 3300005341 Ga0070691_10001906 Ga0070691_100019069 87
137 3300005341 Ga0070691_10192469 Ga0070691_101924692 87
138 3300005343 Ga0070687_100000578 Ga0070687_1000005788 87
139 3300005343 Ga0070687_100006792 Ga0070687_1000067922 87
140 3300005343 Ga0070687_100154346 Ga0070687_1001543462 87
141 3300005343 Ga0070687_100567546 Ga0070687_1005675462 87
142 3300005344 Ga0070661_100002446 Ga0070661_1000024467 87
143 3300005344 Ga0070661_100031260 Ga0070661_1000312604 87
144 3300005345 Ga0070692_10003356 Ga0070692_100033565 87
145 3300005345 Ga0070692_11090787 Ga0070692_110907872 87
146 3300005347 Ga0070668_100012055 Ga0070668_1000120551 87
147 3300005353 Ga0070669_100036233 Ga0070669_1000362333 87
148 3300005354 Ga0070675_100233695 Ga0070675_1002336951 87
149 3300005354 Ga0070675_100857891 Ga0070675_1008578911 87
150 3300005354 Ga0070675_101107484 Ga0070675_1011074841 87
151 3300005355 Ga0070671_100069717 Ga0070671_1000697173 87
152 3300005355 Ga0070671_100402037 Ga0070671_1004020372 87
153 3300005356 Ga0070674_100000651 Ga0070674_10000065112 87
154 3300005356 Ga0070674_100013481 Ga0070674_1000134813 87
155 3300005364 Ga0070673_100002548 Ga0070673_1000025484 87
156 3300005364 Ga0070673_100086154 Ga0070673_1000861541 87
157 3300005364 Ga0070673_100098879 Ga0070673_1000988792 87
158 3300005364 Ga0070673_100882084 Ga0070673_1008820842 87
159 3300005365 Ga0070688_100000009 Ga0070688_10000000965 87
160 3300005365 Ga0070688_100005771 Ga0070688_1000057719 87
161 3300005365 Ga0070688_100023921 Ga0070688_1000239212 87
162 3300005366 Ga0070659_100000429 Ga0070659_10000042927 87
163 3300005367 Ga0070667_100032702 Ga0070667_1000327025 87
164 3300005367 Ga0070667_100471054 Ga0070667_1004710542 87
165 3300005406 Ga0070703_10115596 Ga0070703_101155962 87
166 3300005437 Ga0070710_10468495 Ga0070710_104684952 87
167 3300005438 Ga0070701_10001023 Ga0070701_100010238 87
168 3300005438 Ga0070701_10021474 Ga0070701_100214742 87
169 3300005438 Ga0070701_10101264 Ga0070701_101012642 87
170 3300005438 Ga0070701_10229959 Ga0070701_102299593 87
171 3300005439 Ga0070711_101507912 Ga0070711_1015079121 87
172 3300005440 Ga0070705_100003543 Ga0070705_1000035433 87
173 3300005440 Ga0070705_100055568 Ga0070705_1000555682 87
174 3300005440 Ga0070705_100260353 Ga0070705_1002603532 87
175 3300005441 Ga0070700_100003185 Ga0070700_1000031857 87
176 3300005441 Ga0070700_100012179 Ga0070700_1000121792 87
177 3300005441 Ga0070700_100128047 Ga0070700_1001280473 87
178 3300005444 Ga0070694_100050947 Ga0070694_1000509475 87
179 3300005444 Ga0070694_100103928 Ga0070694_1001039284 87
180 3300005444 Ga0070694_100354468 Ga0070694_1003544682 87
181 3300005444 Ga0070694_100555906 Ga0070694_1005559061 87
182 3300005444 Ga0070694_100823890 Ga0070694_1008238901 87
183 3300005445 Ga0070708_100032477 Ga0070708_1000324773 87
184 3300005445 Ga0070708_100150707 Ga0070708_1001507073 87
185 3300005445 Ga0070708_100182048 Ga0070708_1001820484 87
186 3300005445 Ga0070708_100189665 Ga0070708_1001896654 87
187 3300005445 Ga0070708_100902761 Ga0070708_1009027612 87
188 3300005445 Ga0070708_101717164 Ga0070708_1017171642 87
189 3300005455 Ga0070663_100057877 Ga0070663_1000578776 87
190 3300005456 Ga0070678_100227761 Ga0070678_1002277612 87
191 3300005456 Ga0070678_101601551 Ga0070678_1016015511 87
192 3300005457 Ga0070662_100000333 Ga0070662_10000033326 87
193 3300005457 Ga0070662_100937181 Ga0070662_1009371812 87
194 3300005458 Ga0070681_10014971 Ga0070681_100149717 87
195 3300005458 Ga0070681_10117118 Ga0070681_101171185 87
196 3300005459 Ga0068867_100000209 Ga0068867_10000020928 87
197 3300005459 Ga0068867_100008954 Ga0068867_10000895410 87
198 3300005459 Ga0068867_100084748 Ga0068867_1000847483 87
199 3300005459 Ga0068867_102360266 Ga0068867_1023602661 87
200 3300005466 Ga0070685_10000197 Ga0070685_1000019730 87
201 3300005466 Ga0070685_10024398 Ga0070685_100243984 87
202 3300005467 Ga0070706_100006062 Ga0070706_10000606212 87
203 3300005467 Ga0070706_100022282 Ga0070706_1000222824 87
204 3300005467 Ga0070706_100071009 Ga0070706_1000710095 87
205 3300005467 Ga0070706_100160000 Ga0070706_1001600003 87
206 3300005467 Ga0070706_100241449 Ga0070706_1002414492 87
207 3300005468 Ga0070707_100000009 Ga0070707_100000009135 87
208 3300005468 Ga0070707_100000546 Ga0070707_10000054629 87
209 3300005468 Ga0070707_100013734 Ga0070707_1000137343 87
210 3300005468 Ga0070707_100045910 Ga0070707_1000459102 87
211 3300005468 Ga0070707_100160664 Ga0070707_1001606642 87
212 3300005471 Ga0070698_100022782 Ga0070698_1000227825 87
213 3300005471 Ga0070698_100065483 Ga0070698_1000654832 87
214 3300005471 Ga0070698_100321535 Ga0070698_1003215352 87
215 3300005471 Ga0070698_100338737 Ga0070698_1003387372 87
216 3300005471 Ga0070698_101297737 Ga0070698_1012977372 87
217 3300005518 Ga0070699_100012688 Ga0070699_1000126884 87
218 3300005518 Ga0070699_100038839 Ga0070699_1000388393 87
219 3300005518 Ga0070699_100046180 Ga0070699_1000461804 87
220 3300005518 Ga0070699_100057826 Ga0070699_1000578263 87
221 3300005518 Ga0070699_100060393 Ga0070699_1000603933 87
222 3300005518 Ga0070699_100130500 Ga0070699_1001305002 87
223 3300005518 Ga0070699_100297150 Ga0070699_1002971502 87
224 3300005530 Ga0070679_100039709 Ga0070679_1000397094 87
225 3300005530 Ga0070679_100238006 Ga0070679_1002380062 87
226 3300005535 Ga0070684_100060682 Ga0070684_1000606825 87
227 3300005535 Ga0070684_100172658 Ga0070684_1001726581 87
228 3300005535 Ga0070684_101287682 Ga0070684_1012876822 87
229 3300005536 Ga0070697_100028140 Ga0070697_1000281405 87
230 3300005536 Ga0070697_100039781 Ga0070697_1000397815 87
231 3300005536 Ga0070697_100040563 Ga0070697_1000405634 87
232 3300005536 Ga0070697_100052026 Ga0070697_1000520261 87
233 3300005536 Ga0070697_100099320 Ga0070697_1000993203 87
234 3300005536 Ga0070697_100321549 Ga0070697_1003215492 87
235 3300005536 Ga0070697_100513173 Ga0070697_1005131732 87
236 3300005539 Ga0068853_102461737 Ga0068853_1024617372 87
237 3300005543 Ga0070672_100004622 Ga0070672_1000046226 87
238 3300005543 Ga0070672_100131393 Ga0070672_1001313932 87
239 3300005543 Ga0070672_100154074 Ga0070672_1001540743 87
240 3300005544 Ga0070686_100001153 Ga0070686_1000011534 87
241 3300005544 Ga0070686_100001810 Ga0070686_1000018108 87
242 3300005544 Ga0070686_100003735 Ga0070686_1000037353 87
243 3300005544 Ga0070686_100021825 Ga0070686_1000218252 87
244 3300005544 Ga0070686_100088889 Ga0070686_1000888892 87
245 3300005545 Ga0070695_100054066 Ga0070695_1000540664 87
246 3300005545 Ga0070695_100109564 Ga0070695_1001095642 87
247 3300005545 Ga0070695_100153038 Ga0070695_1001530382 87
248 3300005546 Ga0070696_100014740 Ga0070696_1000147404 87
249 3300005546 Ga0070696_100039493 Ga0070696_1000394934 87
250 3300005546 Ga0070696_100091065 Ga0070696_1000910652 87
251 3300005546 Ga0070696_100378972 Ga0070696_1003789723 87
252 3300005547 Ga0070693_100025178 Ga0070693_1000251784 87
253 3300005548 Ga0070665_100155586 Ga0070665_1001555862 87
254 3300005548 Ga0070665_100874118 Ga0070665_1008741182 87
255 3300005548 Ga0070665_101501812 Ga0070665_1015018121 87
256 3300005549 Ga0070704_100016656 Ga0070704_1000166564 87
257 3300005549 Ga0070704_100167365 Ga0070704_1001673652 87
258 3300005549 Ga0070704_100347908 Ga0070704_1003479081 87
259 3300005549 Ga0070704_100964944 Ga0070704_1009649442 87
260 3300005563 Ga0068855_100121259 Ga0068855_1001212593 87
261 3300005564 Ga0070664_100004699 Ga0070664_1000046999 87
262 3300005564 Ga0070664_100017106 Ga0070664_1000171062 87
263 3300005564 Ga0070664_100312780 Ga0070664_1003127803 87
264 3300005577 Ga0068857_100128798 Ga0068857_1001287982 87
265 3300005578 Ga0068854_100190667 Ga0068854_1001906672 87
266 3300005615 Ga0070702_100082706 Ga0070702_1000827061 87
267 3300005615 Ga0070702_100901826 Ga0070702_1009018261 87
268 3300005616 Ga0068852_100141629 Ga0068852_1001416294 87
269 3300005617 Ga0068859_100001080 Ga0068859_10000108031 87
270 3300005617 Ga0068859_100125401 Ga0068859_1001254015 87
271 3300005617 Ga0068859_100309542 Ga0068859_1003095422 87
272 3300005618 Ga0068864_100017267 Ga0068864_1000172676 87
273 3300005718 Ga0068866_10028397 Ga0068866_100283973 87
274 3300005718 Ga0068866_10062640 Ga0068866_100626402 87
275 3300005719 Ga0068861_100129149 Ga0068861_1001291493 87
276 3300005719 Ga0068861_101260593 Ga0068861_1012605932 87
277 3300005719 Ga0068861_101999900 Ga0068861_1019999001 87
278 3300005840 Ga0068870_10015488 Ga0068870_100154887 87
279 3300005841 Ga0068863_101939669 Ga0068863_1019396692 87
280 3300005842 Ga0068858_100124107 Ga0068858_1001241073 87
281 3300005842 Ga0068858_101435914 Ga0068858_1014359142 87
282 3300005843 Ga0068860_100034338 Ga0068860_1000343386 87
283 3300005843 Ga0068860_100409080 Ga0068860_1004090802 87
284 3300005843 Ga0068860_100438485 Ga0068860_1004384852 87
285 3300005844 Ga0068862_100080379 Ga0068862_1000803792 87
286 3300005937 Ga0081455_10000457 Ga0081455_1000045738 87
287 3300006028 Ga0070717_10103093 Ga0070717_101030934 87
288 3300006058 Ga0075432_10002652 Ga0075432_100026527 87
289 3300006163 Ga0070715_10507423 Ga0070715_105074232 87
290 3300006163 Ga0070715_10750485 Ga0070715_107504852 87
291 3300006173 Ga0070716_100022519 Ga0070716_1000225192 87
292 3300006173 Ga0070716_100114975 Ga0070716_1001149752 87
293 3300006194 Ga0075427_10006876 Ga0075427_100068762 87
294 3300006237 Ga0097621_100003109 Ga0097621_1000031097 87
295 3300006237 Ga0097621_100030403 Ga0097621_1000304033 87
296 3300006358 Ga0068871_100004722 Ga0068871_1000047222 87
297 3300006358 Ga0068871_100010448 Ga0068871_1000104482 87
298 3300006358 Ga0068871_100588775 Ga0068871_1005887752 87
299 3300006358 Ga0068871_101054234 Ga0068871_1010542342 87
300 3300006844 Ga0075428_101316803 Ga0075428_1013168032 87
301 3300006844 Ga0075428_102240597 Ga0075428_1022405972 87
302 3300006846 Ga0075430_100000800 Ga0075430_10000080022 87
303 3300006846 Ga0075430_100009708 Ga0075430_1000097083 87
304 3300006846 Ga0075430_100011790 Ga0075430_1000117907 87
305 3300006846 Ga0075430_100299651 Ga0075430_1002996513 87
306 3300006846 Ga0075430_100341414 Ga0075430_1003414142 87
307 3300006847 Ga0075431_100019017 Ga0075431_1000190178 87
308 3300006847 Ga0075431_100033801 Ga0075431_1000338015 87
309 3300006847 Ga0075431_100104523 Ga0075431_1001045232 87
310 3300006852 Ga0075433_10011787 Ga0075433_100117877 87
311 3300006852 Ga0075433_10347961 Ga0075433_103479612 87
312 3300006871 Ga0075434_100038974 Ga0075434_1000389744 87
313 3300006871 Ga0075434_100209843 Ga0075434_1002098432 87
314 3300006871 Ga0075434_100907933 Ga0075434_1009079332 87
315 3300006880 Ga0075429_100000498 Ga0075429_1000004989 87
316 3300006880 Ga0075429_100015569 Ga0075429_1000155692 87
317 3300006880 Ga0075429_100052476 Ga0075429_1000524763 87
318 3300006880 Ga0075429_100697684 Ga0075429_1006976842 87
319 3300006881 Ga0068865_100001653 Ga0068865_1000016539 87
320 3300006881 Ga0068865_100345777 Ga0068865_1003457772 87
321 3300006914 Ga0075436_100208425 Ga0075436_1002084252 87
322 3300006931 Ga0097620_100001080 Ga0097620_1000010808 87
323 3300006931 Ga0097620_100125408 Ga0097620_1001254085 87
324 3300006931 Ga0097620_100309513 Ga0097620_1003095132 87
325 3300007076 Ga0075435_100007648 Ga0075435_1000076483 87
326 3300007076 Ga0075435_100489426 Ga0075435_1004894262 87
327 3300007076 Ga0075435_101852796 Ga0075435_1018527961 87
328 3300007265 Ga0099794_10044108 Ga0099794_100441082 87
329 3300009094 Ga0111539_10072221 Ga0111539_100722211 87
330 3300009094 Ga0111539_13264804 Ga0111539_132648042 87
331 3300009098 Ga0105245_10004374 Ga0105245_100043748 87
332 3300009098 Ga0105245_11946933 Ga0105245_119469331 87
333 3300009147 Ga0114129_10012324 Ga0114129_100123244 87
334 3300009147 Ga0114129_10105393 Ga0114129_101053933 87
335 3300009147 Ga0114129_10129962 Ga0114129_101299624 87
336 3300009147 Ga0114129_10322375 Ga0114129_103223753 87
337 3300009147 Ga0114129_11912634 Ga0114129_119126341 87
338 3300009147 Ga0114129_12014761 Ga0114129_120147612 87
339 3300009147 Ga0114129_12485541 Ga0114129_124855412 87
340 3300009147 Ga0114129_12493535 Ga0114129_124935352 87
341 3300009148 Ga0105243_10007248 Ga0105243_100072487 87
342 3300009148 Ga0105243_11983231 Ga0105243_119832312 87
343 3300009174 Ga0105241_10170657 Ga0105241_101706573 87
344 3300009174 Ga0105241_10368325 Ga0105241_103683252 87
345 3300009176 Ga0105242_10006995 Ga0105242_100069953 87
346 3300009176 Ga0105242_10021035 Ga0105242_100210355 87
347 3300009545 Ga0105237_11952752 Ga0105237_119527522 87
348 3300009551 Ga0105238_12111700 Ga0105238_121117001 87
349 3300010375 Ga0105239_10025271 Ga0105239_100252712 87
350 3300011119 Ga0105246_10002042 Ga0105246_100020429 87
351 3300013102 Ga0157371_10844268 Ga0157371_108442681 87
352 3300013102 Ga0157371_11493232 Ga0157371_114932322 87
353 3300013104 Ga0157370_11057600 Ga0157370_110576002 87
354 3300013105 Ga0157369_10143602 Ga0157369_101436024 87
355 3300013296 Ga0157374_10050010 Ga0157374_100500103 87
356 3300013296 Ga0157374_10073020 Ga0157374_100730203 87
357 3300013296 Ga0157374_11938514 Ga0157374_119385142 87
358 3300013296 Ga0157374_12065493 Ga0157374_120654931 87
359 3300013297 Ga0157378_10034081 Ga0157378_100340812 87
360 3300013297 Ga0157378_10054860 Ga0157378_100548606 87
361 3300013297 Ga0157378_10108765 Ga0157378_101087655 87
362 3300013297 Ga0157378_10158430 Ga0157378_101584302 87
363 3300013306 Ga0163162_10400230 Ga0163162_104002302 87
364 3300013307 Ga0157372_12805019 Ga0157372_128050192 87
365 3300013307 Ga0157372_13001236 Ga0157372_130012361 87
366 3300013308 Ga0157375_10028798 Ga0157375_100287986 87
367 3300013308 Ga0157375_11254923 Ga0157375_112549232 87
368 3300014326 Ga0157380_10003854 Ga0157380_1000385410 87
369 3300014326 Ga0157380_10032243 Ga0157380_100322435 87
370 3300014326 Ga0157380_10242008 Ga0157380_102420082 87
371 3300014326 Ga0157380_10830964 Ga0157380_108309642 87
372 3300014745 Ga0157377_10026012 Ga0157377_100260124 87
373 3300014745 Ga0157377_10769502 Ga0157377_107695022 87
374 3300014968 Ga0157379_10219236 Ga0157379_102192362 87
375 3300014968 Ga0157379_10679873 Ga0157379_106798732 87
376 3300014969 Ga0157376_10001862 Ga0157376_1000186214 87
377 3300014969 Ga0157376_10002625 Ga0157376_100026257 87
378 3300014969 Ga0157376_10481382 Ga0157376_104813822 87
379 3300020070 Ga0206356_11224672 Ga0206356_112246722 87
380 3300025315 Ga0207697_10155248 Ga0207697_101552482 87
381 3300025885 Ga0207653_10083849 Ga0207653_100838492 87
382 3300025893 Ga0207682_10034784 Ga0207682_100347842 87
383 3300025899 Ga0207642_10038684 Ga0207642_100386842 87
384 3300025900 Ga0207710_10659884 Ga0207710_106598842 87
385 3300025901 Ga0207688_10028580 Ga0207688_100285804 87
386 3300025903 Ga0207680_10030317 Ga0207680_100303173 87
387 3300025903 Ga0207680_10419713 Ga0207680_104197132 87
388 3300025903 Ga0207680_11238509 Ga0207680_112385091 87
389 3300025904 Ga0207647_10245966 Ga0207647_102459661 87
390 3300025905 Ga0207685_10106452 Ga0207685_101064523 87
391 3300025905 Ga0207685_10167245 Ga0207685_101672451 87
392 3300025905 Ga0207685_10461276 Ga0207685_104612761 87
393 3300025906 Ga0207699_10637505 Ga0207699_106375052 87
394 3300025907 Ga0207645_10000319 Ga0207645_1000031917 87
395 3300025908 Ga0207643_10084365 Ga0207643_100843652 87
396 3300025910 Ga0207684_10000354 Ga0207684_1000035411 87
397 3300025910 Ga0207684_10004998 Ga0207684_100049985 87
398 3300025910 Ga0207684_10011565 Ga0207684_100115657 87
399 3300025910 Ga0207684_10194665 Ga0207684_101946652 87
400 3300025910 Ga0207684_10239901 Ga0207684_102399013 87
401 3300025910 Ga0207684_10246606 Ga0207684_102466062 87
402 3300025910 Ga0207684_10305748 Ga0207684_103057482 87
403 3300025910 Ga0207684_10556385 Ga0207684_105563852 87
404 3300025911 Ga0207654_10926235 Ga0207654_109262351 87
405 3300025912 Ga0207707_10026688 Ga0207707_100266884 87
406 3300025912 Ga0207707_10128513 Ga0207707_101285131 87
407 3300025912 Ga0207707_10873013 Ga0207707_108730132 87
408 3300025914 Ga0207671_10934643 Ga0207671_109346431 87
409 3300025916 Ga0207663_10174053 Ga0207663_101740533 87
410 3300025916 Ga0207663_11740864 Ga0207663_117408641 87
411 3300025917 Ga0207660_10006168 Ga0207660_100061689 87
412 3300025917 Ga0207660_10025604 Ga0207660_100256043 87
413 3300025917 Ga0207660_10118004 Ga0207660_101180042 87
414 3300025918 Ga0207662_10000281 Ga0207662_1000028119 87
415 3300025918 Ga0207662_10010315 Ga0207662_100103158 87
416 3300025918 Ga0207662_10080299 Ga0207662_100802992 87
417 3300025918 Ga0207662_10624426 Ga0207662_106244262 87
418 3300025919 Ga0207657_10001887 Ga0207657_1000188716 87
419 3300025920 Ga0207649_10055832 Ga0207649_100558323 87
420 3300025920 Ga0207649_10184042 Ga0207649_101840422 87
421 3300025921 Ga0207652_10027975 Ga0207652_100279755 87
422 3300025921 Ga0207652_10115214 Ga0207652_101152143 87
423 3300025922 Ga0207646_10000011 Ga0207646_10000011155 87
424 3300025922 Ga0207646_10000252 Ga0207646_1000025265 87
425 3300025922 Ga0207646_10089293 Ga0207646_100892932 87
426 3300025922 Ga0207646_10233693 Ga0207646_102336932 87
427 3300025923 Ga0207681_10071862 Ga0207681_100718623 87
428 3300025923 Ga0207681_10718461 Ga0207681_107184611 87
429 3300025925 Ga0207650_10069245 Ga0207650_100692453 87
430 3300025926 Ga0207659_10032437 Ga0207659_100324371 87
431 3300025926 Ga0207659_10069014 Ga0207659_100690143 87
432 3300025927 Ga0207687_10030538 Ga0207687_100305384 87
433 3300025927 Ga0207687_10181887 Ga0207687_101818872 87
434 3300025931 Ga0207644_10043162 Ga0207644_100431622 87
435 3300025931 Ga0207644_10374307 Ga0207644_103743073 87
436 3300025932 Ga0207690_10020246 Ga0207690_100202467 87
437 3300025932 Ga0207690_10816009 Ga0207690_108160091 87
438 3300025933 Ga0207706_10000428 Ga0207706_1000042830 87
439 3300025933 Ga0207706_10678054 Ga0207706_106780542 87
440 3300025934 Ga0207686_10009930 Ga0207686_100099304 87
441 3300025934 Ga0207686_10035215 Ga0207686_100352152 87
442 3300025934 Ga0207686_10332146 Ga0207686_103321462 87
443 3300025935 Ga0207709_10152022 Ga0207709_101520223 87
444 3300025936 Ga0207670_10000024 Ga0207670_10000024111 87
445 3300025936 Ga0207670_10016294 Ga0207670_100162942 87
446 3300025936 Ga0207670_10363737 Ga0207670_103637372 87
447 3300025937 Ga0207669_10002413 Ga0207669_100024139 87
448 3300025937 Ga0207669_10049674 Ga0207669_100496742 87
449 3300025938 Ga0207704_10039635 Ga0207704_100396353 87
450 3300025938 Ga0207704_10269240 Ga0207704_102692403 87
451 3300025939 Ga0207665_10032938 Ga0207665_100329383 87
452 3300025940 Ga0207691_10000726 Ga0207691_100007269 87
453 3300025940 Ga0207691_10044629 Ga0207691_100446293 87
454 3300025940 Ga0207691_10063839 Ga0207691_100638393 87
455 3300025941 Ga0207711_10301706 Ga0207711_103017062 87
456 3300025941 Ga0207711_10340992 Ga0207711_103409922 87
457 3300025941 Ga0207711_11455700 Ga0207711_114557001 87
458 3300025942 Ga0207689_10055849 Ga0207689_100558494 87
459 3300025942 Ga0207689_10613735 Ga0207689_106137353 87
460 3300025944 Ga0207661_10126569 Ga0207661_101265692 87
461 3300025945 Ga0207679_10001492 Ga0207679_1000149213 87
462 3300025945 Ga0207679_10007191 Ga0207679_100071919 87
463 3300025945 Ga0207679_10113288 Ga0207679_101132883 87
464 3300025949 Ga0207667_10131926 Ga0207667_101319262 87
465 3300025960 Ga0207651_10187581 Ga0207651_101875812 87
466 3300025960 Ga0207651_10334824 Ga0207651_103348242 87
467 3300025960 Ga0207651_10712446 Ga0207651_107124462 87
468 3300025961 Ga0207712_10074085 Ga0207712_100740854 87
469 3300025972 Ga0207668_10006294 Ga0207668_100062942 87
470 3300025981 Ga0207640_10075813 Ga0207640_100758132 87
471 3300025986 Ga0207658_10274977 Ga0207658_102749774 87
472 3300026023 Ga0207677_10073522 Ga0207677_100735223 87
473 3300026023 Ga0207677_10486840 Ga0207677_104868402 87
474 3300026023 Ga0207677_11036051 Ga0207677_110360512 87
475 3300026035 Ga0207703_10364911 Ga0207703_103649113 87
476 3300026041 Ga0207639_12030666 Ga0207639_120306662 87
477 3300026067 Ga0207678_10229241 Ga0207678_102292412 87
478 3300026067 Ga0207678_11489676 Ga0207678_114896761 87
479 3300026075 Ga0207708_10000780 Ga0207708_1000078029 87
480 3300026075 Ga0207708_10001713 Ga0207708_1000171310 87
481 3300026075 Ga0207708_10139591 Ga0207708_101395914 87
482 3300026089 Ga0207648_10002186 Ga0207648_1000218618 87
483 3300026089 Ga0207648_10013209 Ga0207648_1001320910 87
484 3300026089 Ga0207648_10749583 Ga0207648_107495831 87
485 3300026095 Ga0207676_10073748 Ga0207676_100737483 87
486 3300026116 Ga0207674_10025795 Ga0207674_100257953 87
487 3300026118 Ga0207675_100162689 Ga0207675_1001626893 87
488 3300026118 Ga0207675_101565148 Ga0207675_1015651482 87
489 3300026118 Ga0207675_101954660 Ga0207675_1019546602 87
490 3300026121 Ga0207683_10000382 Ga0207683_1000038218 87
491 3300026121 Ga0207683_10198912 Ga0207683_101989123 87
492 3300026142 Ga0207698_10579083 Ga0207698_105790833 87
493 3300027252 Ga0209973_1008178 Ga0209973_10081782 87
494 3300027360 Ga0209969_1000206 Ga0209969_10002069 87
495 3300027364 Ga0209967_1000013 Ga0209967_100001324 87
496 3300027378 Ga0209981_1000720 Ga0209981_10007203 87
497 3300027378 Ga0209981_1005981 Ga0209981_10059812 87
498 3300027395 Ga0209996_1000180 Ga0209996_10001807 87
499 3300027424 Ga0209984_1000021 Ga0209984_100002111 87
500 3300027462 Ga0210000_1000181 Ga0210000_10001814 87
501 3300027471 Ga0209995_1000006 Ga0209995_100000635 87
502 3300027471 Ga0209995_1018382 Ga0209995_10183821 87
503 3300027526 Ga0209968_1000042 Ga0209968_100004217 87
504 3300027526 Ga0209968_1016708 Ga0209968_10167083 87
505 3300027526 Ga0209968_1054211 Ga0209968_10542112 87
506 3300027543 Ga0209999_1000492 Ga0209999_10004926 87
507 3300027543 Ga0209999_1063056 Ga0209999_10630562 87
508 3300027552 Ga0209982_1079918 Ga0209982_10799181 87
509 3300027614 Ga0209970_1000462 Ga0209970_10004624 87
510 3300027614 Ga0209970_1050183 Ga0209970_10501832 87
511 3300027617 Ga0210002_1000005 Ga0210002_100000530 87
512 3300027665 Ga0209983_1001278 Ga0209983_10012786 87
513 3300027665 Ga0209983_1077018 Ga0209983_10770182 87
514 3300027682 Ga0209971_1000482 Ga0209971_10004828 87
515 3300027682 Ga0209971_1019563 Ga0209971_10195632 87
516 3300027682 Ga0209971_1107834 Ga0209971_11078342 87
517 3300027695 Ga0209966_1000092 Ga0209966_100009228 87
518 3300027695 Ga0209966_1001168 Ga0209966_10011686 87
519 3300027717 Ga0209998_10000049 Ga0209998_1000004913 87
520 3300027717 Ga0209998_10015756 Ga0209998_100157564 87
521 3300027876 Ga0209974_10004159 Ga0209974_100041592 87
522 3300027876 Ga0209974_10005801 Ga0209974_100058016 87
523 3300027876 Ga0209974_10087637 Ga0209974_100876372 87
524 3300027876 Ga0209974_10150797 Ga0209974_101507972 87
525 3300027907 Ga0207428_10001066 Ga0207428_100010669 87
526 3300028379 Ga0268266_10308359 Ga0268266_103083593 87
527 3300028379 Ga0268266_11340318 Ga0268266_113403181 87
528 3300028380 Ga0268265_10546336 Ga0268265_105463362 87
529 3300028380 Ga0268265_11376484 Ga0268265_113764842 87
530 3300028381 Ga0268264_10046757 Ga0268264_100467576 87
531 3300028381 Ga0268264_10374807 Ga0268264_103748072 87
532 3300031344 Ga0265316_10913647 Ga0265316_109136471 87
533 3300031548 Ga0307408_100031691 Ga0307408_1000316912 87
534 3300031548 Ga0307408_100616472 Ga0307408_1006164721 87
535 3300031731 Ga0307405_10004671 Ga0307405_100046713 87
536 3300031731 Ga0307405_10830788 Ga0307405_108307882 87
537 3300031731 Ga0307405_11467576 Ga0307405_114675761 87
538 3300031824 Ga0307413_11044500 Ga0307413_110445002 87
539 3300031852 Ga0307410_10026168 Ga0307410_100261683 87
540 3300031852 Ga0307410_10353701 Ga0307410_103537013 87
541 3300031901 Ga0307406_10146134 Ga0307406_101461344 87
542 3300031903 Ga0307407_10061421 Ga0307407_100614212 87
543 3300031903 Ga0307407_11087645 Ga0307407_110876452 87
544 3300031911 Ga0307412_10012004 Ga0307412_100120042 87
545 3300031911 Ga0307412_10546556 Ga0307412_105465562 87
546 3300031995 Ga0307409_100075929 Ga0307409_1000759293 87
547 3300031995 Ga0307409_100136108 Ga0307409_1001361084 87
548 3300032002 Ga0307416_100024445 Ga0307416_1000244453 87
549 3300032002 Ga0307416_100782578 Ga0307416_1007825781 87
550 3300032002 Ga0307416_102807870 Ga0307416_1028078702 87
551 3300032004 Ga0307414_10344425 Ga0307414_103444251 87
552 3300032004 Ga0307414_11658893 Ga0307414_116588932 87
553 3300032005 Ga0307411_10003709 Ga0307411_100037093 87
554 3300032005 Ga0307411_10016375 Ga0307411_100163753 87
555 3300032126 Ga0307415_100038079 Ga0307415_1000380794 87
556 3300034819 Ga0373958_0163399 Ga0373958_0163399_281_544 87
557 3300035083 Ga0373926_0045995 Ga0373926_0045995_548_811 87
558 3300035085 Ga0373929_0193341 Ga0373929_0193341_211_474 87
559 3300035086 Ga0373934_0061495 Ga0373934_0061495_1050_1313 87
560 3300035111 Ga0373923_0083806 Ga0373923_0083806_876_1139 87
561 3300035115 Ga0373941_0127870 Ga0373941_0127870_83_346 87
562 3300035115 Ga0373941_0240033 Ga0373941_0240033_112_375 87
563 3300035116 Ga0373945_0110829 Ga0373945_0110829_674_937 87
564 3300035116 Ga0373945_0134495 Ga0373945_0134495_564_827 87
565 3300035119 Ga0373956_0277813 Ga0373956_0277813_104_367 87
566 3300035120 Ga0373957_0453771 Ga0373957_0453771_70_333 87
567 3300035121 Ga0373960_0085052 Ga0373960_0085052_719_982 87
568 3300035121 Ga0373960_0103335 Ga0373960_0103335_222_485 87
569 3300035170 Ga0373943_0026835 Ga0373943_0026835_1718_1981 87
570 3300035171 Ga0373946_0123635 Ga0373946_0123635_640_903 87
571 3300035172 Ga0373955_0134329 Ga0373955_0134329_547_810 87
572 3300035207 Ga0373942_0015789 Ga0373942_0015789_1073_1336 87
573 3300035241 Ga0373961_0369439 Ga0373961_0369439_76_339 87
574 3300035242 Ga0373962_0083044 Ga0373962_0083044_263_526 87
575 3300035410 Ga0373924_0368847 Ga0373924_0368847_204_467 87
576 3300035691 Ga0373931_0185987 Ga0373931_0185987_326_589 87
577 3300035691 Ga0373931_0195960 Ga0373931_0195960_19_282 87
578 3300035691 Ga0373931_0908606 Ga0373931_0908606_172_435 87
579 3300035692 Ga0373935_0044283 Ga0373935_0044283_1287_1550 87
580 3300035692 Ga0373935_0538420 Ga0373935_0538420_257_520 87
581 3300035695 Ga0373927_0035547 Ga0373927_0035547_958_1221 87
582 3300035724 Ga0373933_0032880 Ga0373933_0032880_575_838 87
583 3300035725 Ga0373947_0026956 Ga0373947_0026956_1601_1864 87
584 3300035725 Ga0373947_1063830 Ga0373947_1063830_22_285 87
585 3300036401 Ga0373937_0569003 Ga0373937_0569003_379_642 87
586 3300037068 Ga0373925_0522369 Ga0373925_0522369_485_748 87
587 3300038996 Ga0242420_049477 Ga0242420_049477_56_319 87
588 3300039062 Ga0400483_123123 Ga0400483_123123_475_750 87
589 3300039062 Ga0400483_261336 Ga0400483_261336_274_549 87
590 3300041405 Ga0439438_012686 Ga0439438_012686_1398_1661 87
591 3300041406 Ga0439439_0009813 Ga0439439_0009813_1295_1558 87
592 3300041407 Ga0439447_045113 Ga0439447_045113_630_893 87
593 3300041408 Ga0439453_0056649 Ga0439453_0056649_176_439 87
594 3300041410 Ga0439461_0011958 Ga0439461_0011958_660_923 87
595 3300041411 Ga0439466_0027179 Ga0439466_0027179_433_696 87
596 3300041413 Ga0439465_0261708 Ga0439465_0261708_117_380 87
597 3300041997 Ga0439431_0013413 Ga0439431_0013413_858_1121 87
598 3300041999 Ga0439433_0081645 Ga0439433_0081645_319_582 87
599 3300042001 Ga0439441_009512 Ga0439441_009512_468_731 87
600 3300042005 Ga0439448_0185249 Ga0439448_0185249_233_496 87
601 3300042006 Ga0439432_026350 Ga0439432_026350_1615_1878 87
602 3300042009 Ga0439451_076935 Ga0439451_076935_105_368 87
603 3300042010 Ga0439452_027821 Ga0439452_027821_1020_1283 87
604 3300042011 Ga0439454_121215 Ga0439454_121215_107_370 87
605 3300042012 Ga0439455_0081424 Ga0439455_0081424_493_756 87
606 3300042012 Ga0439455_0202149 Ga0439455_0202149_238_501 87
607 3300042013 Ga0439456_061353 Ga0439456_061353_387_650 87
608 3300042014 Ga0439457_138334 Ga0439457_138334_107_370 87
609 3300042015 Ga0439462_0051864 Ga0439462_0051864_689_952 87
610 3300042118 Ga0450914_030353 Ga0450914_030353_317_580 87
611 3300042133 Ga0450896_052909 Ga0450896_052909_91_354 87
612 3300042142 Ga0450905_036787 Ga0450905_036787_229_492 87
613 3300042156 Ga0439446_0031510 Ga0439446_0031510_71_334 87
614 3300042185 Ga0450909_012392 Ga0450909_012392_338_601 87
615 3300042436 Ga0439435_0010610 Ga0439435_0010610_1190_1453 87
616 3300042436 Ga0439435_0034881 Ga0439435_0034881_227_490 87
617 3300042437 Ga0439444_0063208 Ga0439444_0063208_183_446 87
618 3300042439 Ga0439464_0046380 Ga0439464_0046380_167_430 87
619 3300042439 Ga0439464_0077699 Ga0439464_0077699_193_456 87
620 3300042439 Ga0439464_0274740 Ga0439464_0274740_107_370 87
621 3300042461 Ga0439460_0019928 Ga0439460_0019928_1440_1703 87
622 3300042461 Ga0439460_0070169 Ga0439460_0070169_272_535 87
623 3300042532 Ga0450893_0106676 Ga0450893_0106676_86_349 87
624 3300042876 Ga0451577_0264706 Ga0451577_0264706_219_482 87
625 3300042876 Ga0451577_0395796 Ga0451577_0395796_113_376 87
626 3300042876 Ga0451577_1799548 Ga0451577_1799548_131_406 87
627 3300042993 Ga0439440_0256818 Ga0439440_0256818_197_460 87
628 3300042993 Ga0439440_0280681 Ga0439440_0280681_131_394 87
629 3300044673 Ga0453683_0069750 Ga0453683_0069750_663_935 87
630 3300044673 Ga0453683_0107305 Ga0453683_0107305_1299_1580 87
631 3300044673 Ga0453683_0292327 Ga0453683_0292327_335_598 87
632 3300044694 Ga0466963_0192463 Ga0466963_0192463_510_773 87
633 3300044712 Ga0453684_0255611 Ga0453684_0255611_1556_1831 87
634 3300044712 Ga0453684_0269147 Ga0453684_0269147_1630_1893 87
635 3300044712 Ga0453684_0388138 Ga0453684_0388138_855_1118 87
636 3300044712 Ga0453684_0527403 Ga0453684_0527403_504_767 87
637 3300044712 Ga0453684_0632788 Ga0453684_0632788_498_761 87
638 3300044712 Ga0453684_0950237 Ga0453684_0950237_418_684 87
639 3300044712 Ga0453684_1171214 Ga0453684_1171214_514_777 87
640 3300045051 Ga0451576_0010724 Ga0451576_0010724_8974_9237 87
641 3300045051 Ga0451576_0334658 Ga0451576_0334658_697_960 87
642 3300045051 Ga0451576_0585028 Ga0451576_0585028_279_542 87
643 3300045051 Ga0451576_0793871 Ga0451576_0793871_685_948 87
644 3300045051 Ga0451576_1891564 Ga0451576_1891564_160_423 87
645 3300045976 Ga0466967_0192171 Ga0466967_0192171_288_551 87
646 3300046454 Ga0495592_0228274 Ga0495592_0228274_40_303 87
647 3300046459 Ga0495629_0034132 Ga0495629_0034132_611_874 87
648 3300046462 Ga0495651_0360859 Ga0495651_0360859_580_843 87
649 3300046463 Ga0495653_0146529 Ga0495653_0146529_574_837 87
650 3300046473 Ga0495582_0072667 Ga0495582_0072667_751_1014 87
651 3300046473 Ga0495582_0416817 Ga0495582_0416817_106_369 87
652 3300046475 Ga0495639_0455303 Ga0495639_0455303_231_494 87
653 3300046491 Ga0495584_0616316 Ga0495584_0616316_247_510 87
654 3300046499 Ga0495594_0011487 Ga0495594_0011487_367_630 87
655 3300046499 Ga0495594_0285376 Ga0495594_0285376_314_577 87
656 3300046499 Ga0495594_0546203 Ga0495594_0546203_179_442 87
657 3300046500 Ga0495596_0272862 Ga0495596_0272862_83_346 87
658 3300046501 Ga0495607_0190683 Ga0495607_0190683_542_805 87
659 3300046520 Ga0495637_0050577 Ga0495637_0050577_1451_1714 87
660 3300046526 Ga0495666_0385049 Ga0495666_0385049_140_403 87
661 3300046538 Ga0495609_0139077 Ga0495609_0139077_231_494 87
662 3300046557 Ga0495622_0188528 Ga0495622_0188528_176_439 87
663 3300046615 Ga0495656_0327007 Ga0495656_0327007_63_326 87
664 3300046642 Ga0495634_0411341 Ga0495634_0411341_51_314 87
665 3300046663 Ga0495635_0268224 Ga0495635_0268224_313_576 87
666 3300046663 Ga0495635_0668671 Ga0495635_0668671_200_463 87
667 3300046664 Ga0495659_0009361 Ga0495659_0009361_2230_2493 87
668 3300046674 Ga0495588_0203174 Ga0495588_0203174_307_570 87
669 3300046675 Ga0495657_0032657 Ga0495657_0032657_2605_2868 87
670 3300046681 Ga0495647_0013988 Ga0495647_0013988_648_911 87
671 3300046683 Ga0495658_0097137 Ga0495658_0097137_1278_1541 87
672 3300046690 Ga0495624_0195130 Ga0495624_0195130_20_283 87
673 3300046691 Ga0495670_0129089 Ga0495670_0129089_522_785 87
674 3300046691 Ga0495670_0311570 Ga0495670_0311570_142_405 87
675 3300046794 Ga0495589_0174031 Ga0495589_0174031_503_766 87
676 3300046809 Ga0495600_0121010 Ga0495600_0121010_1257_1520 87
677 3300047315 Ga0495581_0030598 Ga0495581_0030598_255_518 87
678 3300047317 Ga0495604_0140888 Ga0495604_0140888_1098_1361 87
679 3300047318 Ga0495636_0530225 Ga0495636_0530225_212_475 87
680 3300047322 Ga0495680_0096615 Ga0495680_0096615_1650_1913 87
681 3300048089 Ga0495614_0065681 Ga0495614_0065681_574_837 87
682 3300048909 Ga0496106_0382029 Ga0496106_0382029_805_1068 87
683 3300048912 Ga0496109_1153059 Ga0496109_1153059_328_591 87
684 3300048915 Ga0496112_1794613 Ga0496112_1794613_137_400 87
685 3300049128 Ga0501308_063994 Ga0501308_063994_18_290 87
686 3300049129 Ga0501309_040989 Ga0501309_040989_77_340 87
687 3300049160 Ga0501304_023346 Ga0501304_023346_347_610 87
688 3300049513 Ga0501290_001203 Ga0501290_001203_455_718 87
689 3300049514 Ga0501291_000070 Ga0501291_000070_9687_9950 87
690 3300049515 Ga0501292_000097 Ga0501292_000097_10116_10379 87
691 3300049516 Ga0501293_001129 Ga0501293_001129_455_718 87
692 3300049517 Ga0501294_000073 Ga0501294_000073_4889_5152 87
693 3300049518 Ga0501295_000110 Ga0501295_000110_5886_6149 87
694 3300049519 Ga0501296_000001 Ga0501296_000001_18107_18370 87
695 3300049520 Ga0501297_000026 Ga0501297_000026_12702_12965 87
696 3300049521 Ga0501298_005654 Ga0501298_005654_466_729 87
697 3300049521 Ga0501298_052086 Ga0501298_052086_505_768 87
698 3300049522 Ga0501299_000081 Ga0501299_000081_1887_2150 87
699 3300049522 Ga0501299_100089 Ga0501299_100089_342_605 87
700 3300049523 Ga0501300_000275 Ga0501300_000275_4919_5182 87
701 3300049524 Ga0501301_000256 Ga0501301_000256_160_423 87
702 3300049526 Ga0501303_001156 Ga0501303_001156_19_282 87
703 3300049527 Ga0501311_102006 Ga0501311_102006_16_288 87
704 3300049528 Ga0501312_060276 Ga0501312_060276_20_283 87
705 3300049533 Ga0501317_106748 Ga0501317_106748_18_290 87
706 3300049568 Ga0501031_0003007 Ga0501031_0003007_3898_4161 87
707 3300049568 Ga0501031_0003309 Ga0501031_0003309_2950_3213 87
708 3300049568 Ga0501031_0013954 Ga0501031_0013954_3188_3451 87
709 3300049568 Ga0501031_0052700 Ga0501031_0052700_176_439 87
710 3300049568 Ga0501031_0221458 Ga0501031_0221458_536_799 87
711 3300049568 Ga0501031_0668675 Ga0501031_0668675_331_594 87
712 3300049569 Ga0501032_0011486 Ga0501032_0011486_2555_2818 87
713 3300049569 Ga0501032_0022670 Ga0501032_0022670_2047_2310 87
714 3300049569 Ga0501032_0275407 Ga0501032_0275407_603_866 87
715 3300049570 Ga0501033_0189779 Ga0501033_0189779_640_903 87
716 3300049570 Ga0501033_0926442 Ga0501033_0926442_48_311 87
717 3300049571 Ga0501034_0821894 Ga0501034_0821894_174_437 87
718 3300049571 Ga0501034_1136513 Ga0501034_1136513_182_445 87
719 3300049572 Ga0501036_0001418 Ga0501036_0001418_17774_18037 87
720 3300049572 Ga0501036_0072666 Ga0501036_0072666_2487_2750 87
721 3300049572 Ga0501036_0106647 Ga0501036_0106647_984_1247 87
722 3300049572 Ga0501036_0177349 Ga0501036_0177349_1030_1293 87
723 3300049573 Ga0501037_0005978 Ga0501037_0005978_863_1126 87
724 3300049573 Ga0501037_0019840 Ga0501037_0019840_4683_4946 87
725 3300049573 Ga0501037_0044493 Ga0501037_0044493_1997_2260 87
726 3300049573 Ga0501037_0186277 Ga0501037_0186277_423_686 87
727 3300049573 Ga0501037_0392312 Ga0501037_0392312_531_794 87
728 3300049574 Ga0501038_0034759 Ga0501038_0034759_1721_1984 87
729 3300049574 Ga0501038_0043832 Ga0501038_0043832_2644_2907 87
730 3300049574 Ga0501038_0048896 Ga0501038_0048896_214_477 87
731 3300049574 Ga0501038_0396391 Ga0501038_0396391_648_911 87
732 3300049574 Ga0501038_1308771 Ga0501038_1308771_98_361 87
733 3300049575 Ga0501039_0010478 Ga0501039_0010478_1397_1660 87
734 3300049575 Ga0501039_0020879 Ga0501039_0020879_1598_1861 87
735 3300049575 Ga0501039_0043557 Ga0501039_0043557_1099_1362 87
736 3300049575 Ga0501039_0220646 Ga0501039_0220646_221_484 87
737 3300049575 Ga0501039_0268065 Ga0501039_0268065_742_1005 87
738 3300049575 Ga0501039_0558912 Ga0501039_0558912_425_688 87
739 3300049576 Ga0501040_0019056 Ga0501040_0019056_1904_2167 87
740 3300049576 Ga0501040_0031341 Ga0501040_0031341_1069_1332 87
741 3300049576 Ga0501040_0053014 Ga0501040_0053014_2144_2407 87
742 3300049576 Ga0501040_0092978 Ga0501040_0092978_189_452 87
743 3300049576 Ga0501040_0937441 Ga0501040_0937441_227_490 87
744 3300049577 Ga0501041_0000835 Ga0501041_0000835_3078_3341 87
745 3300049577 Ga0501041_0006703 Ga0501041_0006703_3150_3413 87
746 3300049577 Ga0501041_0009263 Ga0501041_0009263_4092_4355 87
747 3300049577 Ga0501041_0145921 Ga0501041_0145921_387_650 87
748 3300049578 Ga0501042_0024884 Ga0501042_0024884_2203_2466 87
749 3300049578 Ga0501042_0033761 Ga0501042_0033761_1742_2005 87
750 3300049578 Ga0501042_0045230 Ga0501042_0045230_2245_2508 87
751 3300049578 Ga0501042_0094916 Ga0501042_0094916_1597_1860 87
752 3300049578 Ga0501042_0136752 Ga0501042_0136752_619_882 87
753 3300049579 Ga0501043_0177162 Ga0501043_0177162_935_1198 87
754 3300049579 Ga0501043_0220160 Ga0501043_0220160_773_1036 87
755 3300049580 Ga0501046_0003559 Ga0501046_0003559_9951_10214 87
756 3300049580 Ga0501046_0004698 Ga0501046_0004698_9423_9686 87
757 3300049580 Ga0501046_0018359 Ga0501046_0018359_43_306 87
758 3300049580 Ga0501046_0031280 Ga0501046_0031280_3434_3697 87
759 3300049580 Ga0501046_0374776 Ga0501046_0374776_347_616 87
760 3300049581 Ga0501047_0777516 Ga0501047_0777516_421_684 87
761 3300049582 Ga0501048_0000395 Ga0501048_0000395_4884_5147 87
762 3300049582 Ga0501048_0075391 Ga0501048_0075391_118_381 87
763 3300049582 Ga0501048_0127417 Ga0501048_0127417_111_374 87
764 3300049582 Ga0501048_0535514 Ga0501048_0535514_46_309 87
765 3300049582 Ga0501048_0983013 Ga0501048_0983013_293_556 87
766 3300049583 Ga0501067_0176473 Ga0501067_0176473_17_280 87
767 3300049583 Ga0501067_0378252 Ga0501067_0378252_449_712 87
768 3300049584 Ga0501068_0240630 Ga0501068_0240630_565_828 87
769 3300049584 Ga0501068_0360137 Ga0501068_0360137_558_821 87
770 3300049585 Ga0501069_0571397 Ga0501069_0571397_156_419 87
771 3300049585 Ga0501069_0612584 Ga0501069_0612584_87_350 87
772 3300049586 Ga0501070_0319362 Ga0501070_0319362_31_294 87
773 3300049586 Ga0501070_1197593 Ga0501070_1197593_29_292 87
774 3300049587 Ga0501071_0002970 Ga0501071_0002970_8930_9193 87
775 3300049587 Ga0501071_0132578 Ga0501071_0132578_500_763 87
776 3300049587 Ga0501071_0397358 Ga0501071_0397358_246_509 87
777 3300049588 Ga0501072_0029542 Ga0501072_0029542_1681_1944 87
778 3300049588 Ga0501072_0748481 Ga0501072_0748481_261_524 87
779 3300049589 Ga0501073_0479957 Ga0501073_0479957_133_396 87
780 3300049590 Ga0501074_0071057 Ga0501074_0071057_2028_2291 87
781 3300049590 Ga0501074_1289703 Ga0501074_1289703_154_417 87
782 3300049591 Ga0501075_0008078 Ga0501075_0008078_2478_2741 87
783 3300049591 Ga0501075_0191046 Ga0501075_0191046_267_536 87
784 3300049591 Ga0501075_0338407 Ga0501075_0338407_402_665 87
785 3300049591 Ga0501075_0913966 Ga0501075_0913966_256_519 87
786 3300049592 Ga0501076_0075708 Ga0501076_0075708_1474_1737 87
787 3300049592 Ga0501076_0210650 Ga0501076_0210650_660_923 87
788 3300049592 Ga0501076_0225491 Ga0501076_0225491_314_577 87
789 3300049592 Ga0501076_0561520 Ga0501076_0561520_324_593 87
790 3300049592 Ga0501076_0644930 Ga0501076_0644930_282_545 87
791 3300049649 Ga0501198_005747 Ga0501198_005747_1434_1697 87
792 3300049650 Ga0501199_000588 Ga0501199_000588_2439_2702 87
793 3300049651 Ga0501201_010914 Ga0501201_010914_159_422 87
794 3300049652 Ga0501202_001084 Ga0501202_001084_1014_1277 87
795 3300049653 Ga0501206_000681 Ga0501206_000681_3255_3518 87
796 3300049655 Ga0501208_000033 Ga0501208_000033_1956_2219 87
797 3300049659 Ga0501214_082232 Ga0501214_082232_76_339 87
798 3300049660 Ga0501216_000248 Ga0501216_000248_3207_3470 87
799 3300049661 Ga0501217_000657 Ga0501217_000657_691_954 87
800 3300049663 Ga0501223_100251 Ga0501223_100251_171_434 87
801 3300049664 Ga0501224_050918 Ga0501224_050918_211_474 87
802 3300049665 Ga0501227_023381 Ga0501227_023381_164_427 87
803 3300049668 Ga0501233_000389 Ga0501233_000389_1135_1398 87
804 3300049669 Ga0501235_000044 Ga0501235_000044_12920_13183 87
805 3300049670 Ga0501236_000030 Ga0501236_000030_1416_1679 87
806 3300049672 Ga0501239_000789 Ga0501239_000789_405_668 87
807 3300049674 Ga0501242_005697 Ga0501242_005697_1022_1285 87
808 3300049675 Ga0501243_003599 Ga0501243_003599_1616_1879 87
809 3300049677 Ga0501247_070289 Ga0501247_070289_66_329 87
810 3300049678 Ga0501248_000573 Ga0501248_000573_1629_1892 87
811 3300049679 Ga0501249_001670 Ga0501249_001670_2763_3026 87
812 3300049681 Ga0501251_003246 Ga0501251_003246_159_422 87
813 3300049683 Ga0501253_002203 Ga0501253_002203_1424_1687 87
814 3300049684 Ga0501255_001817 Ga0501255_001817_107_370 87
815 3300049685 Ga0501256_000607 Ga0501256_000607_22_285 87
816 3300049686 Ga0501257_001093 Ga0501257_001093_130_393 87
817 3300049688 Ga0501259_036823 Ga0501259_036823_160_423 87
818 3300049689 Ga0501260_048832 Ga0501260_048832_179_442 87
819 3300049690 Ga0501261_000708 Ga0501261_000708_249_512 87
820 3300049703 Ga0501219_001018 Ga0501219_001018_2078_2341 87
821 3300049705 Ga0501225_0001524 Ga0501225_0001524_2003_2266 87
822 3300049706 Ga0501229_001207 Ga0501229_001207_903_1166 87
823 3300049708 Ga0501245_001430 Ga0501245_001430_2003_2266 87
824 3300049741 Ga0501079_0193080 Ga0501079_0193080_880_1149 87
825 3300049742 Ga0501080_0607402 Ga0501080_0607402_285_548 87
826 3300049742 Ga0501080_1220989 Ga0501080_1220989_243_506 87
827 3300049743 Ga0501081_0471811 Ga0501081_0471811_74_337 87
828 3300049743 Ga0501081_0486350 Ga0501081_0486350_527_790 87
829 3300049744 Ga0501083_0033924 Ga0501083_0033924_2345_2608 87
830 3300049744 Ga0501083_1148339 Ga0501083_1148339_93_362 87
831 3300049757 Ga0501232_000579 Ga0501232_000579_2223_2486 87
832 3300049761 Ga0501264_000260 Ga0501264_000260_4576_4839 87
833 3300049762 Ga0501265_001370 Ga0501265_001370_2144_2407 87
834 3300049763 Ga0501266_000269 Ga0501266_000269_1199_1462 87
835 3300049766 Ga0501269_023202 Ga0501269_023202_437_700 87
836 3300049767 Ga0501270_002952 Ga0501270_002952_1263_1526 87
837 3300049768 Ga0501271_001541 Ga0501271_001541_217_480 87
838 3300049769 Ga0501272_000814 Ga0501272_000814_490_753 87
839 3300049770 Ga0501273_000418 Ga0501273_000418_314_577 87
840 3300049771 Ga0501274_000464 Ga0501274_000464_604_867 87
841 3300049772 Ga0501275_019137 Ga0501275_019137_162_425 87
842 3300049773 Ga0501276_000272 Ga0501276_000272_144_407 87
843 3300049774 Ga0501278_000701 Ga0501278_000701_263_526 87
844 3300049775 Ga0501279_002409 Ga0501279_002409_2021_2284 87
845 3300049776 Ga0501280_001221 Ga0501280_001221_223_486 87
846 3300049777 Ga0501281_00480 Ga0501281_00480_2080_2343 87
847 3300049778 Ga0501282_001620 Ga0501282_001620_2014_2277 87
848 3300049779 Ga0501283_000031 Ga0501283_000031_14698_14961 87
849 3300049822 Ga0501035_0004145 Ga0501035_0004145_341_604 87
850 3300049822 Ga0501035_0030679 Ga0501035_0030679_4465_4728 87
851 3300049822 Ga0501035_0048549 Ga0501035_0048549_1697_1960 87
852 3300049822 Ga0501035_0588486 Ga0501035_0588486_46_309 87
853 3300049823 Ga0501044_0198050 Ga0501044_0198050_1391_1654 87
854 3300049823 Ga0501044_0666574 Ga0501044_0666574_347_610 87
855 3300049823 Ga0501044_1444713 Ga0501044_1444713_99_362 87
856 3300049824 Ga0501045_0071010 Ga0501045_0071010_379_642 87
857 3300049824 Ga0501045_1105664 Ga0501045_1105664_137_400 87
858 3300050507 nmdc:mga05p37_21807_c1 nmdc:mga05p37_21807_c1_3751_4014 87
859 3300050507 nmdc:mga05p37_242672_c1 nmdc:mga05p37_242672_c1_739_1002 87
860 3300050507 nmdc:mga05p37_83120_c1 nmdc:mga05p37_83120_c1_1560_1823 87
861 3300050508 nmdc:mga09592_141745_c1 nmdc:mga09592_141745_c1_1086_1358 87
862 3300050508 nmdc:mga09592_27143_c1 nmdc:mga09592_27143_c1_3364_3627 87
863 3300050508 nmdc:mga09592_7623_c1 nmdc:mga09592_7623_c1_4052_4315 87
864 3300050509 nmdc:mga0qj67_10014_c1 nmdc:mga0qj67_10014_c1_4811_5083 87
865 3300050509 nmdc:mga0qj67_1216_c1 nmdc:mga0qj67_1216_c1_10170_10433 87
866 3300050509 nmdc:mga0qj67_18859_c1 nmdc:mga0qj67_18859_c1_1141_1404 87
867 3300050509 nmdc:mga0qj67_73283_c1 nmdc:mga0qj67_73283_c1_342_605 87
868 3300050510 nmdc:mga06r32_12279_c1 nmdc:mga06r32_12279_c1_2145_2408 87
869 3300050510 nmdc:mga06r32_31560_c1 nmdc:mga06r32_31560_c1_2241_2513 87
870 3300050510 nmdc:mga06r32_84525_c1 nmdc:mga06r32_84525_c1_1801_2064 87
871 3300050511 nmdc:mga08y16_49455_c1 nmdc:mga08y16_49455_c1_3857_4120 87
872 3300050512 nmdc:mga0n895_157515_c1 nmdc:mga0n895_157515_c1_1290_1553 87
873 3300050512 nmdc:mga0n895_2194854_c1 nmdc:mga0n895_2194854_c1_15_278 87
874 3300050512 nmdc:mga0n895_2230970_c1 nmdc:mga0n895_2230970_c1_180_443 87
875 3300050513 nmdc:mga0rr50_1025642_c1 nmdc:mga0rr50_1025642_c1_356_619 87
876 3300050513 nmdc:mga0rr50_1300338_c1 nmdc:mga0rr50_1300338_c1_42_305 87
877 3300050513 nmdc:mga0rr50_195989_c1 nmdc:mga0rr50_195989_c1_793_1056 87
878 3300050513 nmdc:mga0rr50_734488_c1 nmdc:mga0rr50_734488_c1_551_814 87
879 3300050514 nmdc:mga08x19_219847_c1 nmdc:mga08x19_219847_c1_596_859 87
880 3300050514 nmdc:mga08x19_343142_c1 nmdc:mga08x19_343142_c1_552_815 87
881 3300050514 nmdc:mga08x19_85669_c1 nmdc:mga08x19_85669_c1_211_474 87
882 3300050515 nmdc:mga0a205_20209_c1 nmdc:mga0a205_20209_c1_5867_6130 87
883 3300050515 nmdc:mga0a205_479739_c1 nmdc:mga0a205_479739_c1_540_803 87
884 3300053077 Ga0495601_0008311 Ga0495601_0008311_3027_3290 87
885 3300053078 Ga0495612_0172330 Ga0495612_0172330_497_760 87
886 3300053084 Ga0495595_0177233 Ga0495595_0177233_353_616 87
887 3300053085 Ga0495619_0146839 Ga0495619_0146839_827_1090 87
888 3300053085 Ga0495619_0157571 Ga0495619_0157571_236_499 87
889 3300054114 Ga0501084_0185142 Ga0501084_0185142_908_1171 87
890 3300054114 Ga0501084_0451151 Ga0501084_0451151_353_622 87
891 3300059421 Ga0590071_043061 Ga0590071_043061_90_353 87
892 3300059424 Ga0590075_003561 Ga0590075_003561_3413_3676 87
893 3300059426 Ga0590077_077776 Ga0590077_077776_320_583 87
894 3300059491 Ga0587070_093484 Ga0587070_093484_34_315 87
895 3300060353 Ga0501082_0036974 Ga0501082_0036974_2371_2634 87
896 3300060353 Ga0501082_1024111 Ga0501082_1024111_356_625 87
897 3300061734 Ga0530510_0024573 Ga0530510_0024573_1610_1873 87
898 3300061734 Ga0530510_0423946 Ga0530510_0423946_501_764 87
899 3300061734 Ga0530510_0717799 Ga0530510_0717799_54_323 87

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01016

Ribosomal_L27

Ribosomal L27 protein

2

81

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
1v8q-assembly1.cif.gz_A crystal structure of ribosomal protein l27 from thermus thermophilus hb8 0.9336 21 84
3j6b-assembly1.cif.gz_R structure of the yeast mitochondrial large ribosomal subunit 0.9312 21 81
7sae-assembly1.cif.gz_V 44sr70p class1 ribosomal particle 0.9238 21 83
8c94-assembly1.cif.gz_W cryo-em captures early ribosome assembly in action 0.9076 21 83
8c8z-assembly1.cif.gz_W cryo-em captures early ribosome assembly in action 0.9059 21 83
ID Description Score Start End Superfamily
1v8qA00 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.9336 21 84 2.40.50.100
1v8qA00 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.8934 21 84 2.40.50.100
af_Q8IBQ2_8_59_2.40.50.100 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.8707 29 81 2.40.50.100
af_Q9Y3B2_6_56_2.40.50.100 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.8692 29 81 2.40.50.100
af_Q9Y3B2_6_56_2.40.50.100 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.854 29 81 2.40.50.100
ID Description Score Start End GO Terms
AF-A0A068NYA2-F1-model_v4 Large ribosomal subunit protein bL27 (50S ribosomal protein L27) 0.9587 21 87 GO:0003735
GO:0006412
GO:0022625
AF-A0A2S6T0A6-F1-model_v4 Large ribosomal subunit protein bL27 (50S ribosomal protein L27) 0.9483 21 83 GO:0003735
GO:0005840
GO:0006412
GO:1990904
AF-A0A1V5VQS4-F1-model_v4 Large ribosomal subunit protein bL27 (50S ribosomal protein L27) 0.9391 21 81 GO:0003735
GO:0005840
GO:0006412
GO:1990904
AF-A0A420Z9C1-F1-model_v4 Large ribosomal subunit protein bL27 (50S ribosomal protein L27) 0.939 21 83 GO:0003735
GO:0005840
GO:0006412
GO:1990904
AF-A0A3D3VUF3-F1-model_v4 Large ribosomal subunit protein bL27 (50S ribosomal protein L27) 0.9361 23 85 GO:0003735
GO:0006412
GO:0022625

Feature Viewer

pLDDT pTM Quality
81.56 0.65 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map