F485098

General Info

Members Datasets Scaffolds Average Seq Length
899 651 1796 312

Family's Representative Sequence

Representative Sequence 3300006946|Ga0079104_1002504|Ga0079104_10025045
Length 343
Sequence LRANLHSLIVWTNETGEANLQSALNRGEAMLRFILSRLAMAIPTVVLVSVTVFALIRFIPGDPAALMLGDMAQPDQIAAMRVELGLDRSMPQQFLIWAGDVLRGDFGRSIVNDEAVLPLVVSRFLVSAEIVVVAVLLASLIAVPAGVIAAWRQNSLTDLALVGTATVLLSIPTFWLGLLLLLLFGLKLGWLPVLGYVSISDNLVDGLLYLVLPVVTLVIHEAGVLIRMARASTLEVLRLDYITHARAKGLSEGAVLWRHAFKNAFGPTWTMIGLILGNLLGGIAVIETVFTIPGLGRLMVDSIFARDYPVIQGCLLFVALSYVLVNLVIDLLYPLFDPRVVAE

Samples

Sample ID Description Type Environment
1 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
2 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
4 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
5 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
6 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
7 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
8 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
9 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
10 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
11 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
12 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
13 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
14 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
15 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
16 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
17 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
18 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
19 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
20 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
21 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
22 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
23 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
24 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
25 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
26 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
27 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
28 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
29 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
30 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
31 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
32 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
33 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
34 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
35 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
36 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
37 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
38 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
39 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
40 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
41 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
42 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
43 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
44 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
45 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
46 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
47 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
48 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
49 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
50 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
51 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
52 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
53 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
54 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
55 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
56 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
57 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
58 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
59 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
60 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
61 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
62 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
63 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
65 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
66 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
67 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
68 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
69 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
70 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
71 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
72 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
73 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
74 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
75 3300009986 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_92 metaG Metagenome Rhizosphere
76 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
77 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
78 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
79 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
80 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
81 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
82 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
83 3300013249 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 Metagenome Rhizosphere
84 3300013250 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 Metagenome Rhizosphere
85 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
86 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
87 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
88 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
89 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
90 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
91 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
92 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
93 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
94 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
95 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
96 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
97 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
98 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
99 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
100 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
101 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
102 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
103 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
104 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
105 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
106 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
107 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
108 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
109 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
110 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
127 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
128 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
129 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
130 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
131 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
135 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
136 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
137 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
138 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
139 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
140 3300031967 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules Metagenome Nodule
141 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
142 3300033430 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules Metagenome Nodule
143 3300033464 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules Metagenome Nodule
144 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
145 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
146 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
147 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
148 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
149 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
150 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
151 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
152 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
153 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
154 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
155 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
156 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
157 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
158 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
159 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
160 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
161 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
162 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
163 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
164 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
165 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
166 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
167 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
168 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
169 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
170 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
171 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
172 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
173 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
174 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
175 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
176 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
177 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
178 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
179 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
180 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
181 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
182 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
183 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
184 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
185 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
186 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
187 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
188 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
189 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
190 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
191 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
192 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
193 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
194 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
195 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
196 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
197 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
198 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
199 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
200 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
201 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
202 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
203 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
204 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
205 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
206 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
207 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
208 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
209 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
210 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
211 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
212 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
213 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
214 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
215 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
216 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
217 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
218 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
219 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
220 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
221 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
222 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
223 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
224 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
225 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
226 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
227 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
228 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
229 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
230 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
231 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
232 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
233 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
234 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
235 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
236 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
237 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
238 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
239 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
240 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
241 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
242 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
243 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
244 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
245 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
246 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
247 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
248 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
249 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
250 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
251 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
252 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
253 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
254 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
255 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
256 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
257 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
258 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
259 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
260 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
261 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
262 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
263 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
264 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
265 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
266 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
267 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
268 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
269 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
270 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
271 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
272 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
273 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
274 2508501050 Microvirga lupini Lut6 Isolate Nodule
275 2508501114 Microvirga lotononidis WSM3557 Isolate Nodule
276 2509276021 Rhizobium leguminosarum bv. trifolii WSM597 Isolate Nodule
277 2510065019 Rhizobium leguminosarum bv. trifolii WSM1689 Isolate Nodule
278 2510065057 Sinorhizobium meliloti WSM1022 Isolate Nodule
279 2510461069 Rhizobium sp. PDO1-076 Isolate Rhizosphere
280 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
281 2510917026 Rhizobium sp. CF80 Isolate Rhizosphere
282 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
283 2511231002 Polaromonas sp. CF318 Isolate Rhizosphere
284 2511231003 Herbaspirillum sp. CF444 Isolate Rhizosphere
285 2511231052 Sinorhizobium meliloti AK58 Isolate Nodule
286 2512875026 Sinorhizobium medicae WSM1115 Isolate Nodule
287 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
288 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
289 2513237086 Sinorhizobium meliloti MVII-I Isolate Nodule
290 2513237089 Sinorhizobium medicae DI28 Isolate Nodule
291 2513237091 Sinorhizobium meliloti RRI128 Isolate Nodule
292 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
293 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
294 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
295 2513237140 Sinorhizobium meliloti GVPV12 Isolate Nodule
296 2513237143 Sinorhizobium meliloti Mlalz-1 Isolate Nodule
297 2513237160 Sinorhizobium medicae WSM244 Isolate Nodule
298 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
299 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
300 2515154107 Sinorhizobium meliloti 4H41 Isolate Nodule
301 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
302 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
303 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
304 2515154134 Rhizobium gallicum bv. gallicum R602sp Isolate Nodule
305 2516653046 Sinorhizobium meliloti BO21CC Isolate Nodule
306 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
307 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
308 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
309 2517487022 Sinorhizobium medicae WSM4191 Isolate Nodule
310 2524023207 Ensifer sp. USDA 6670 Isolate Nodule
311 2529292951 Rhizobium sp. CCGE 510 Isolate Nodule
312 2537561587 Agrobacterium tumefaciens Cherry 2E-2-2 Isolate Rhizosphere
313 2551306084 Sinorhizobium meliloti 5A14 Isolate Nodule
314 2551306085 Sinorhizobium meliloti AE608H Isolate Nodule
315 2551306086 Sinorhizobium meliloti AK11 Isolate Nodule
316 2551306087 Sinorhizobium meliloti A0643DD Isolate Nodule
317 2551306089 Sinorhizobium meliloti 1A42 Isolate Nodule
318 2551306090 Sinorhizobium meliloti A0641M Isolate Nodule
319 2551306091 Sinorhizobium meliloti C0431A Isolate Nodule
320 2551306092 Sinorhizobium meliloti AK75 Isolate Nodule
321 2551306093 Sinorhizobium meliloti C0438LL Isolate Nodule
322 2554235003 Agrobacterium tumefaciens WRT31 Isolate Rhizosphere
323 2558860242 Agrobacterium fabacearum P4 Isolate Rhizosphere
324 2582581283 Rhizobium sp. OK665 Isolate Rhizosphere
325 2582581298 Rhizobium alamii YR540 Isolate Rhizosphere
326 2582581315 Agrobacterium rhizogenes YR147 Isolate Rhizosphere
327 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
328 2582581866 Rhizobium sp. CF097 Isolate Rhizosphere
329 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
330 2585427528 Rhizobium leguminosarum CF307 Isolate Rhizosphere
331 2585427529 Rhizobium alamii YR584 Isolate Rhizosphere
332 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
333 2599185210 Rhizobium sp. NFACC06-2 Isolate Rhizoplane
334 2599185352 Sinorhizobium sp. NFACC03 Isolate Rhizoplane
335 2600255279 Rhizobium sp. NFIX01 Isolate Rhizoplane
336 2600255308 Rhizobium sp. NFIX02 Isolate Rhizoplane
337 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
338 2617270742 Rhizobium miluonense HAMBI 2971 Isolate Nodule
339 2643221557 Ensifer sp. Root558 Isolate Unclassified
340 2643221558 Rhizobium sp. Root149 Isolate Unclassified
341 2643221568 Rhizobium sp. Root564 Isolate Unclassified
342 2643221582 Rhizobium sp. Root651 Isolate Unclassified
343 2643221607 Rhizobium sp. Root73 Isolate Unclassified
344 2643221610 Ensifer sp. Root74 Isolate Unclassified
345 2643221618 Ensifer sp. Root231 Isolate Unclassified
346 2643221626 Ensifer sp. Root31 Isolate Unclassified
347 2643221636 Rhizobium sp. Root1204 Isolate Unclassified
348 2643221655 Ensifer sp. Root1252 Isolate Unclassified
349 2643221659 Ensifer sp. Root127 Isolate Unclassified
350 2643221668 Ensifer sp. Root423 Isolate Unclassified
351 2643221675 Ensifer sp. Root1298 Isolate Unclassified
352 2643221680 Ensifer sp. Root1312 Isolate Unclassified
353 2643221686 Rhizobium sp. Root1334 Isolate Unclassified
354 2643221693 Rhizobium sp. Root491 Isolate Unclassified
355 2643221698 Ensifer sp. Root142 Isolate Unclassified
356 2643221712 Ensifer sp. Root258 Isolate Unclassified
357 2643221723 Ensifer sp. Root278 Isolate Unclassified
358 2643221726 Ensifer sp. Root954 Isolate Unclassified
359 2643221734 Bosea sp. Root670 Isolate Unclassified
360 2643221736 Bosea sp. Root483D1 Isolate Unclassified
361 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
362 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
363 2751185800 Brucella pituitosa AA2 Isolate Unclassified
364 2758568016 [Ochrobactrum] quorumnocens A44 Isolate Rhizosphere
365 2773857925 Microvirga vignae BR3299 Isolate Unclassified
366 2775506902 Phyllobacterium zundukense Tri-48 Isolate Unclassified
367 2775506904 Phyllobacterium zundukense Tri-38 Isolate Unclassified
368 2775507266 Rhizobium tropici PRF 81 Isolate Nodule
369 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
370 2791355256 Rhizobium sp. M10 Isolate Nodule
371 2791355261 Rhizobium sp. J15 Isolate Nodule
372 2791355262 Rhizobium sp. M1 Isolate Nodule
373 2791355265 Rhizobium sp. H4 Isolate Nodule
374 2791355266 Rhizobium sp. L43 Isolate Nodule
375 2791355267 Rhizobium sp. L18 Isolate Nodule
376 2802428858 Sinorhizobium medicae M14-1 Isolate Nodule
377 2802428859 Sinorhizobium medicae SF3.41 Isolate Nodule
378 2802428860 Sinorhizobium medicae M19-1 Isolate Nodule
379 2802428861 Sinorhizobium medicae USDA1037 Isolate Nodule
380 2802428862 Sinorhizobium medicae M7-4 Isolate Nodule
381 2802428863 Sinorhizobium medicae M26-2 Isolate Nodule
382 2802429605 Rhizobium sophoriradicis L101 Isolate Nodule
383 2802429633 Rhizobium anhuiense J3 Isolate Nodule
384 2802429634 Rhizobium anhuiense S10 Isolate Nodule
385 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
386 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
387 2802429637 Rhizobium anhuiense C15 Isolate Nodule
388 2808606387 Rhizobium sp. SJZ105 Isolate Rhizosphere
389 2818991439 Agrobacterium tumefaciens 1187 Isolate Unclassified
390 2818991461 Neorhizobium alkalisoli 1225 Isolate Unclassified
391 2818991467 Bosea vestrisii 3192 Isolate Unclassified
392 2821123053 Rhizobium cellulosilyticum 1193 Isolate Unclassified
393 2838661181 Rhizobium mongolense SEMIA 402 Isolate Nodule
394 2838668709 Rhizobium sophoriradicis SEMIA 403 Isolate Nodule
395 2838675328 Agrobacterium radiobacter SEMIA 410 Isolate Nodule
396 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
397 2838701080 Rhizobium aethiopicum SEMIA 428 Isolate Nodule
398 2838714209 Agrobacterium radiobacter SEMIA 435 Isolate Nodule
399 2838719591 Agrobacterium radiobacter SEMIA 436 Isolate Nodule
400 2838724970 Agrobacterium radiobacter SEMIA 437 Isolate Nodule
401 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
402 2838736955 Rhizobium cellulosilyticum SEMIA 448 Isolate Nodule
403 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
404 2840764183 Phyllobacterium sophorae CCBAU 03422 Isolate Unclassified
405 2841760612 Bosea sp. Tri-49 Isolate Nodule
406 2841840854 Rhizobium cellulosilyticum SEMIA 444 Isolate Nodule
407 2841846520 Agrobacterium radiobacter SEMIA 440 Isolate Nodule
408 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
409 2841859092 Agrobacterium radiobacter SEMIA 4026 Isolate Nodule
410 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
411 2842124991 Agrobacterium radiobacter SEMIA 434 Isolate Nodule
412 2842130223 Agrobacterium radiobacter SEMIA 441 Isolate Nodule
413 2842140634 Rhizobium cellulosilyticum SEMIA 452 Isolate Nodule
414 2842146304 Rhizobium sophoriradicis SEMIA 454 Isolate Nodule
415 2842152218 Agrobacterium radiobacter SEMIA 457 Isolate Nodule
416 2842156927 Rhizobium leguminosarum SEMIA 459 Isolate Nodule
417 2842163707 Rhizobium leguminosarum SEMIA 460 Isolate Nodule
418 2842170452 Agrobacterium radiobacter SEMIA 461 Isolate Nodule
419 2842175837 Agrobacterium radiobacter SEMIA 462 Isolate Nodule
420 2842180545 Rhizobium leguminosarum SEMIA 463 Isolate Nodule
421 2842187318 Agrobacterium radiobacter SEMIA 464 Isolate Nodule
422 2842211629 Agrobacterium radiobacter SEMIA 472 Isolate Nodule
423 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
424 2842224351 Agrobacterium radiobacter SEMIA 480 Isolate Nodule
425 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
426 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
427 2842250916 Rhizobium etli SEMIA 484 Isolate Nodule
428 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
429 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
430 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
431 2842317721 Rhizobium etli SEMIA 4004 Isolate Nodule
432 2842341865 Rhizobium leguminosarum SEMIA 4011 Isolate Nodule
433 2842395702 Rhizobium ecuadorense SEMIA 4029 Isolate Nodule
434 2842489311 Rhizobium sophoriradicis SEMIA 4061 Isolate Nodule
435 2842495871 Rhizobium etli SEMIA 4062 Isolate Nodule
436 2842515876 Agrobacterium radiobacter SEMIA 4072 Isolate Nodule
437 2842871566 Phyllobacterium sp. R-73111 Isolate Unclassified
438 2844104063 Bosea sp. Tri-39 Isolate Nodule
439 2844163670 Ensifer sp. 1H6 Isolate Unclassified
440 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
441 2844533157 Inquilinus sp. R-72501 v. 2 Isolate Unclassified
442 2851182111 Bosea sp. Tri-44 Isolate Nodule
443 2851246043 Bosea sp. Tri-54 Isolate Nodule
444 2855839649 Sinorhizobium meliloti AK555 Isolate Unclassified
445 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
446 2857531043 Neorhizobium sp. R-72160 Isolate Unclassified
447 2857576091 Pigmentiphaga sp. R-72090 Isolate Unclassified
448 2858800743 Sinorhizobium meliloti AK170 Isolate Unclassified
449 2891048133 Martelella lutilitoris GH2-6 Isolate Rhizosphere
450 2899792073 Agrobacterium deltaense CNPSo 3391 Isolate Nodule
451 2899845264 Agrobacterium fabacearum CNPSo 675 Isolate Unclassified
452 2915980308 Sinorhizobium medicae USDA1149 Isolate Nodule
453 2915986958 Sinorhizobium meliloti USDA1659 Isolate Nodule
454 2915993759 Sinorhizobium meliloti USDA1336 Isolate Nodule
455 2916000859 Sinorhizobium meliloti USDA1562 Isolate Nodule
456 2916007675 Sinorhizobium meliloti USDA1289 Isolate Nodule
457 2916014648 Sinorhizobium meliloti USDA1583 Isolate Nodule
458 2916021584 Sinorhizobium meliloti USDA1550 Isolate Nodule
459 2916028427 Sinorhizobium meliloti USDA1613 Isolate Nodule
460 2916035215 Sinorhizobium meliloti 3011 Isolate Nodule
461 2916041962 Sinorhizobium meliloti USDA1795 Isolate Nodule
462 2916048683 Sinorhizobium meliloti USDA1796 Isolate Nodule
463 2916055098 Sinorhizobium meliloti USDA1770 Isolate Nodule
464 2916061851 Sinorhizobium medicae USDA1638 Isolate Nodule
465 2916068649 Sinorhizobium meliloti USDA1220 Isolate Nodule
466 2916076590 Sinorhizobium meliloti USDA1661 Isolate Nodule
467 2917699015 Bosea sp. F3-2 Isolate Rhizosphere
468 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
469 2919114240 Agrobacterium tumefaciens 1457 Isolate Rhizosphere
470 2919166419 Agrobacterium cavarae 2074 Isolate Unclassified
471 2921201388 Sinorhizobium meliloti USDA1692 Isolate Nodule
472 2921208531 Sinorhizobium meliloti USDA1660 Isolate Nodule
473 2921237296 Sinorhizobium meliloti USDA1508 Isolate Nodule
474 2921244191 Sinorhizobium meliloti 2119 Isolate Nodule
475 2921250672 Sinorhizobium medicae USDA1169 Isolate Nodule
476 2921263974 Sinorhizobium meliloti USDA1107 Isolate Nodule
477 2921282425 Sinorhizobium meliloti USDA1203 Isolate Nodule
478 2921289301 Sinorhizobium meliloti USDA1730 Isolate Nodule
479 2924144063 Sinorhizobium meliloti USDA1022 Isolate Nodule
480 2924150972 Sinorhizobium meliloti USDA1700 Isolate Nodule
481 2924158325 Sinorhizobium meliloti USDA1146 Isolate Nodule
482 2924165586 Sinorhizobium meliloti USDA1264 Isolate Nodule
483 2924172951 Sinorhizobium meliloti USDA1626 Isolate Nodule
484 2924179722 Sinorhizobium meliloti USDA1280 Isolate Nodule
485 2924186466 Sinorhizobium meliloti USDA1389 Isolate Nodule
486 2924193448 Sinorhizobium meliloti USDA1158 Isolate Nodule
487 2924200457 Sinorhizobium meliloti USDA1007 Isolate Nodule
488 2924207177 Sinorhizobium meliloti USDA1589 Isolate Nodule
489 2924228884 Sinorhizobium meliloti USDA1581 Isolate Nodule
490 2926754445 Agrobacterium radiobacter SLBN-94 Isolate Rhizosphere
491 2926760298 Agrobacterium tumefaciens SLBN-170 Isolate Rhizosphere
492 2929138655 Agrobacterium sp. R-72433 Hybrid assembly Isolate Unclassified
493 2929199973 Roseomonas sp. R-73070 Hybrid assembly Isolate Unclassified
494 2933006813 Rhizobium sp. SEMIA 439 Isolate Unclassified
495 2933011516 Rhizobium sp. SEMIA 4032 Isolate Unclassified
496 2933016740 Rhizobium sp. SEMIA 4085 Isolate Nodule
497 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
498 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
499 2933594066 Agrobacterium fabrum 35/80 Isolate Nodule
500 2935901341 Rhizobium leguminosarum SEMIA 4082 Isolate Nodule
501 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
502 2936375103 Rhizobium changzhiense WYCCWR 11317 Isolate Nodule
503 2936996657 Sinorhizobium meliloti USDA1025 Isolate Nodule
504 2937002841 Sinorhizobium meliloti USDA1006 Isolate Nodule
505 2937016420 Sinorhizobium meliloti USDA1027 Isolate Nodule
506 2937029754 Sinorhizobium medicae USDA1624 Isolate Nodule
507 2937036028 Sinorhizobium medicae USDA1608 Isolate Nodule
508 2937042894 Sinorhizobium meliloti USDA1687 Isolate Nodule
509 2937056579 Sinorhizobium meliloti USDA1357 Isolate Nodule
510 2937063883 Sinorhizobium meliloti USDA1808 Isolate Nodule
511 2937071275 Sinorhizobium meliloti USDA1623 Isolate Nodule
512 2937078374 Sinorhizobium medicae USDA1004 Isolate Nodule
513 2937084907 Sinorhizobium medicae USDA1664 Isolate Nodule
514 2937098957 Sinorhizobium meliloti USDA1519 Isolate Nodule
515 2937106411 Sinorhizobium meliloti USDA1214 Isolate Nodule
516 2937113482 Sinorhizobium meliloti USDA1180 Isolate Nodule
517 2937119839 Sinorhizobium meliloti USDA1790 Isolate Nodule
518 2937126314 Sinorhizobium meliloti USDA1612 Isolate Nodule
519 2937843397 Mesorhizobium xinjiangense lm94 Isolate Rhizosphere
520 2941499720 Ensifer sp. 4252 Isolate Rhizosphere
521 2957375807 Sinorhizobium medicae USDA1632 Isolate Nodule
522 2957382221 Sinorhizobium meliloti USDA1919 Isolate Nodule
523 2957388812 Sinorhizobium meliloti USDA1195 Isolate Nodule
524 2957402308 Sinorhizobium meliloti USDA1794 Isolate Nodule
525 2957408893 Sinorhizobium meliloti USDA1163 Isolate Nodule
526 2957415311 Sinorhizobium meliloti USDA1724 Isolate Nodule
527 2957422303 Sinorhizobium meliloti USDA1497 Isolate Nodule
528 2957430029 Sinorhizobium meliloti USDA1590 Isolate Nodule
529 2957437181 Sinorhizobium medicae USDA1694 Isolate Nodule
530 2957443900 Sinorhizobium meliloti USDA1734 Isolate Nodule
531 2957450854 Sinorhizobium meliloti USDA1655 Isolate Nodule
532 2957457609 Sinorhizobium meliloti USDA1751 Isolate Nodule
533 2957464669 Sinorhizobium meliloti USDA1520 Isolate Nodule
534 2957471148 Sinorhizobium meliloti USDA1204 Isolate Nodule
535 2957478035 Sinorhizobium meliloti USDA1171 Isolate Nodule
536 2957484790 Sinorhizobium meliloti USDA1464 Isolate Nodule
537 2957491536 Sinorhizobium meliloti USDA1804 Isolate Nodule
538 2957498199 Sinorhizobium meliloti USDA1561 Isolate Nodule
539 2957505466 Sinorhizobium meliloti USDA1696 Isolate Nodule
540 2960584000 Sinorhizobium meliloti USDA1530 Isolate Nodule
541 2960591022 Sinorhizobium medicae USDA1066 Isolate Nodule
542 2960597568 Sinorhizobium meliloti 3085 Isolate Nodule
543 2960610863 Sinorhizobium meliloti USDA1792 Isolate Nodule
544 2960617483 Sinorhizobium meliloti USDA1719 Isolate Nodule
545 2960624210 Sinorhizobium meliloti USDA1415 Isolate Nodule
546 2960631154 Sinorhizobium medicae USDA1629 Isolate Nodule
547 2960637947 Sinorhizobium meliloti USDA1202 Isolate Nodule
548 2960645483 Sinorhizobium meliloti USDA1703 Isolate Nodule
549 2960652885 Sinorhizobium meliloti USDA1199 Isolate Nodule
550 2960660292 Sinorhizobium meliloti USDA1883 Isolate Nodule
551 2960667422 Sinorhizobium meliloti USDA1170 Isolate Nodule
552 2960674078 Sinorhizobium meliloti USDA1666 Isolate Nodule
553 2960680706 Sinorhizobium medicae USDA1150 Isolate Nodule
554 2960693952 Sinorhizobium medicae USDA1630 Isolate Nodule
555 2964607997 Sinorhizobium meliloti USDA1212 Isolate Nodule
556 2964621998 Sinorhizobium meliloti USDA1235 Isolate Nodule
557 2964628898 Sinorhizobium meliloti USDA1191 Isolate Nodule
558 2964636051 Sinorhizobium meliloti USDA1594 Isolate Nodule
559 2964649959 Sinorhizobium meliloti USDA1591 Isolate Nodule
560 2964656573 Sinorhizobium meliloti USDA1308 Isolate Nodule
561 2964663802 Sinorhizobium meliloti USDA1688 Isolate Nodule
562 2964670856 Sinorhizobium meliloti USDA1211 Isolate Nodule
563 2964678106 Sinorhizobium meliloti USDA1210 Isolate Nodule
564 2964685014 Sinorhizobium meliloti USDA1232 Isolate Nodule
565 2964691889 Sinorhizobium meliloti USDA1379 Isolate Nodule
566 2964698721 Sinorhizobium meliloti USDA1656 Isolate Nodule
567 2964705432 Sinorhizobium meliloti USDA1614 Isolate Nodule
568 2964712639 Sinorhizobium meliloti USDA1616 Isolate Nodule
569 2964719344 Sinorhizobium meliloti USDA1456 Isolate Nodule
570 2967664464 Sinorhizobium meliloti USDA1208 Isolate Nodule
571 2967671571 Sinorhizobium meliloti USDA1496 Isolate Nodule
572 2967678726 Sinorhizobium meliloti USDA1467 Isolate Nodule
573 2967686174 Sinorhizobium medicae USDA1641 Isolate Nodule
574 2967693043 Sinorhizobium meliloti USDA1183 Isolate Nodule
575 2967699805 Sinorhizobium meliloti USDA1695 Isolate Nodule
576 2967714385 Sinorhizobium meliloti USDA1023 Isolate Nodule
577 2967721400 Sinorhizobium meliloti USDA1742 Isolate Nodule
578 2967728569 Sinorhizobium medicae USDA1607 Isolate Nodule
579 2967735183 Sinorhizobium meliloti USDA1710 Isolate Nodule
580 2967742019 Sinorhizobium meliloti USDA1676 Isolate Nodule
581 2967748971 Sinorhizobium meliloti USDA1024A Isolate Nodule
582 2967762386 Sinorhizobium meliloti USDA1397 Isolate Nodule
583 2967769361 Sinorhizobium meliloti USDA1005 Isolate Nodule
584 2967775926 Sinorhizobium meliloti USDA1678 Isolate Nodule
585 2970019648 Sinorhizobium meliloti USDA1603 Isolate Nodule
586 2970033650 Sinorhizobium meliloti USDA1565 Isolate Nodule
587 2970047711 Sinorhizobium meliloti USDA1793 Isolate Nodule
588 2970054988 Sinorhizobium meliloti USDA1031 Isolate Nodule
589 2970061556 Sinorhizobium meliloti USDA1810 Isolate Nodule
590 2970068827 Sinorhizobium meliloti USDA1227 Isolate Nodule
591 2970076120 Sinorhizobium meliloti USDA1706 Isolate Nodule
592 2970082768 Sinorhizobium meliloti USDA1803 Isolate Nodule
593 2970088815 Sinorhizobium meliloti USDA1819 Isolate Nodule
594 2970095765 Sinorhizobium meliloti USDA1225 Isolate Nodule
595 2970109326 Sinorhizobium meliloti USDA1186 Isolate Nodule
596 2970122695 Sinorhizobium medicae 3082 Isolate Nodule
597 2970129317 Sinorhizobium meliloti USDA1008 Isolate Nodule
598 2970143518 Sinorhizobium medicae USDA1652 Isolate Nodule
599 2970149975 Sinorhizobium meliloti USDA1215 Isolate Nodule
600 2970156795 Sinorhizobium meliloti USDA1491 Isolate Nodule
601 2970164137 Sinorhizobium meliloti USDA1018 Isolate Nodule
602 2970170962 Sinorhizobium meliloti USDA1571 Isolate Nodule
603 2970177841 Sinorhizobium meliloti USDA1533 Isolate Nodule
604 2970184632 Sinorhizobium meliloti USDA1593 Isolate Nodule
605 2970191845 Sinorhizobium meliloti USDA1187 Isolate Nodule
606 2977516862 Sinorhizobium meliloti USDA1791 Isolate Nodule
607 2977523885 Sinorhizobium meliloti USDA1777 Isolate Nodule
608 2977530762 Sinorhizobium medicae USDA1606 Isolate Nodule
609 2977537788 Sinorhizobium meliloti USDA1184 Isolate Nodule
610 2977544691 Sinorhizobium medicae USDA1631 Isolate Nodule
611 2977551784 Sinorhizobium meliloti USDA1035 Isolate Nodule
612 2977558990 Sinorhizobium meliloti USDA1222 Isolate Nodule
613 2977565890 Sinorhizobium meliloti USDA1617 Isolate Nodule
614 2977572785 Sinorhizobium meliloti USDA1767 Isolate Nodule
615 2979089926 Agrobacterium sp. SORGH_AS 745 Isolate Unclassified
616 2979095461 Agrobacterium tumefaciens SORGH_AS 749 Isolate Unclassified
617 2979100975 Agrobacterium pusense SORGH_AS 755 Isolate Unclassified
618 2984509177 Agrobacterium pusense SORGH_AS260 Isolate Aerial Root
619 2984518228 Agrobacterium pusense SORGH_AS285 Isolate Aerial Root
620 2984537506 Agrobacterium sp. SORGH_AS440 Isolate Aerial Root
621 2984587000 Agrobacterium larrymoorei SORGH_AS974 Isolate Aerial Root
622 2984601300 Rhizobium pusense SORGH_AS1083 Isolate Aerial Root
623 2989349275 Shinella kummerowiae CCBAU 25048 Isolate Unclassified
624 2996893221 Rhizobium sp. R635 Isolate Nodule
625 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
626 3007511990 Pseudomonas fluorescens G20-18 Isolate Rhizosphere
627 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
628 648276728 Sinorhizobium meliloti BL225C Isolate Nodule
629 650716007 Agrobacterium fabacearum H13-3 Isolate Rhizosphere
630 8003570095 Agrobacterium rhizogenes GBBC3284 Isolate Unclassified
631 8003992118 Sinorhizobium meliloti RRI128 Isolate Nodule
632 8003999396 Sinorhizobium medicae WSM1115 Isolate Nodule
633 8005289223 Rhizobium bangladeshense 1002 Isolate Nodule
634 8005307578 Rhizobium leguminosarum bv. phaseoli LCS0306 Isolate Unclassified
635 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
636 8005382845 Rhizobium sp. R634 Isolate Nodule
637 8005395548 Rhizobium sp. R339 Isolate Nodule
638 8005460587 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
639 8005556819 Rhizobium sp. WYCCWR 11128 Isolate Nodule
640 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
641 8005570704 Rhizobium anhuiense bv. trifolii WYCCWR10015 Isolate Nodule
642 8018150411 Rhizobium straminoryzae SM12 Isolate Rhizosphere
643 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
644 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule
645 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule
646 8024501048 Rhizobium sp. H4 Isolate Nodule
647 8054002106 Azospirillum lipoferum 59b Isolate Unclassified
648 8055909800 Plastoroseomonas hellenica LMG 31523 Isolate Unclassified
649 8056382006 Rhizobium croatiense 13T Isolate Nodule
650 8057529695 Bosea vestrisii A18/4-2 Isolate Nodule
651 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 57.06
Metatranscriptomes 0
Isolates 42.94

Biome Distribution

Category Percentage (%)
Aerial Root 0.56
Bulb 0
Endosphere 20.69
Nodule 33.15
Rhizoplane 1.56
Rhizosphere 28.59
Stem 0
Stem Tuber 0
Unclassified 2.45

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0079104_1002504 3300006946 Bacteria 9770
2 MRS1b_contig_162853 2162886011 Bacteria 1220
3 JGI25155J39150_1000901 3300002704 Bacteria 4145
4 JGI25156J39149_1001487 3300002705 Bacteria 9804
5 JGI25162J39368_1000503 3300002737 Bacteria 29400
6 JGI25154J39366_1000017 3300002738 Bacteria 252448
7 JGI25154J39366_1000178 3300002738 Bacteria 49620
8 JGI25157J39369_1000003 3300002741 Bacteria 274935
9 JGI25157J39369_1000054 3300002741 Bacteria 108825
10 JGI25150J39212_1003964 3300002774 Bacteria 3371
11 JGI25159J45721_1000031 3300002987 Bacteria 94896
12 JGI25159J45721_1000554 3300002987 Bacteria 16951
13 JGI25159J45721_1002081 3300002987 Bacteria 7886
14 JGI25151J46595_10000339 3300003187 Bacteria 50125
15 JGI25151J46595_10000497 3300003187 Bacteria 36971
16 JGI25151J46595_10002011 3300003187 Bacteria 12725
17 JGI25151J46595_10031435 3300003187 Bacteria 2074
18 JGI25406J46586_10005779 3300003203 Bacteria 5723
19 JGI25165J46597_1000488 3300003214 Bacteria 38301
20 JGI25153J46596_10006840 3300003215 Bacteria 5700
21 JGI25153J46596_10007518 3300003215 Bacteria 5338
22 JGI25153J46596_10034002 3300003215 Bacteria 1673
23 JGI25160J50197_1000005 3300003354 Bacteria 417280
24 JGI25160J50197_1000340 3300003354 Bacteria 31558
25 JGI25160J50197_1006475 3300003354 Bacteria 4732
26 JGI25160J50197_1008063 3300003354 Bacteria 4047
27 JGI25161J50226_1000098 3300003374 Bacteria 71121
28 JGI25161J50226_1000658 3300003374 Bacteria 13830
29 JGI25161J50226_1003034 3300003374 Bacteria 4025
30 Ga0055526_1000588 3300003771 Bacteria 28638
31 Ga0055526_1000876 3300003771 Bacteria 22387
32 Ga0055526_1001404 3300003771 Bacteria 17132
33 Ga0055526_1001890 3300003771 Bacteria 14525
34 Ga0055526_1002191 3300003771 Bacteria 13397
35 Ga0055526_1004737 3300003771 Bacteria 8059
36 Ga0055526_1007767 3300003771 Bacteria 5503
37 Ga0055524_1000205 3300003775 Bacteria 64186
38 Ga0055524_1002883 3300003775 Bacteria 8607
39 Ga0055524_1003038 3300003775 Bacteria 8306
40 Ga0055528_1003958 3300003790 Bacteria 7258
41 Ga0055540_1000255 3300003792 Bacteria 48177
42 Ga0055531_10008217 3300003794 Bacteria 5555
43 Ga0058692_1012344 3300003856 Bacteria 2026
44 Ga0055543_1000082 3300004625 Bacteria 83659
45 Ga0055543_1000144 3300004625 Bacteria 59417
46 Ga0055543_1000382 3300004625 Bacteria 28981
47 Ga0065165_1000002 3300005262 Bacteria 444192
48 Ga0065165_1000014 3300005262 Bacteria 292366
49 Ga0065165_1004665 3300005262 Bacteria 8288
50 Ga0065165_1009214 3300005262 Bacteria 4465
51 Ga0065704_10132021 3300005289 Bacteria 1617
52 Ga0065707_10096128 3300005295 Unclassified 3301
53 Ga0065707_10161805 3300005295 Bacteria 1556
54 Ga0070670_100103999 3300005331 Bacteria 2446
55 Ga0070666_10055473 3300005335 Bacteria 2675
56 Ga0070680_100303555 3300005336 Unclassified 1354
57 Ga0068868_100450061 3300005338 Bacteria 1120
58 Ga0070689_100028427 3300005340 Unclassified 4226
59 Ga0070689_100145600 3300005340 Bacteria 1908
60 Ga0070687_100094564 3300005343 Bacteria 1660
61 Ga0070705_100008463 3300005440 Bacteria 5098
62 Ga0070694_100446755 3300005444 Bacteria 1020
63 Ga0070663_100014089 3300005455 Bacteria 5123
64 Ga0070707_100377056 3300005468 Unclassified 1378
65 Ga0070698_100009158 3300005471 Bacteria 10627
66 Ga0070698_100037268 3300005471 Bacteria 5014
67 Ga0070698_100132674 3300005471 Archaea 2445
68 Ga0070699_100450813 3300005518 Bacteria 1166
69 Ga0068853_100259414 3300005539 Bacteria 1597
70 Ga0070696_100065379 3300005546 Unclassified 2550
71 Ga0070665_100009499 3300005548 Bacteria 9836
72 Ga0070665_100014985 3300005548 Bacteria 7782
73 Ga0068855_100087419 3300005563 Bacteria 3603
74 Ga0068857_100046333 3300005577 Bacteria 3858
75 Ga0068856_100022173 3300005614 Bacteria 6174
76 Ga0068856_100085516 3300005614 Bacteria 3133
77 Ga0068859_100116583 3300005617 Bacteria 2736
78 Ga0068859_100124215 3300005617 Bacteria 2649
79 Ga0068859_100134700 3300005617 Unclassified 2542
80 Ga0068860_100271855 3300005843 Bacteria 1654
81 Ga0068862_100009948 3300005844 Bacteria 7857
82 Ga0068862_100169034 3300005844 Bacteria 1956
83 Ga0068862_100236469 3300005844 Unclassified 1659
84 Ga0081455_10017706 3300005937 Bacteria 6817
85 Ga0081540_1026700 3300005983 Bacteria 3288
86 Ga0081539_10003879 3300005985 Bacteria 17463
87 Ga0075365_10003424 3300006038 Bacteria 8163
88 Ga0075365_10021137 3300006038 Bacteria 4054
89 Ga0075365_10119596 3300006038 Bacteria 1816
90 Ga0075368_10001877 3300006042 Bacteria 6746
91 Ga0075368_10030391 3300006042 Bacteria 2092
92 Ga0075363_100004136 3300006048 Bacteria 6297
93 Ga0075363_100016241 3300006048 Bacteria 3675
94 Ga0075363_100030952 3300006048 Bacteria 2772
95 Ga0075363_100155706 3300006048 Bacteria 1292
96 Ga0075364_10032405 3300006051 Bacteria 3359
97 Ga0075364_10180519 3300006051 Bacteria 1428
98 Ga0075432_10000009 3300006058 Bacteria 37251
99 Ga0070712_100462430 3300006175 Bacteria 1058
100 Ga0075362_10002513 3300006177 Bacteria 6175
101 Ga0075362_10009519 3300006177 Bacteria 3761
102 Ga0075362_10049813 3300006177 Bacteria 1872
103 Ga0075362_10064874 3300006177 Bacteria 1657
104 Ga0075367_10002826 3300006178 Bacteria 8063
105 Ga0075367_10003480 3300006178 Bacteria 7512
106 Ga0075367_10017525 3300006178 Bacteria 3932
107 Ga0075369_10001401 3300006186 Bacteria 8212
108 Ga0075369_10039539 3300006186 Bacteria 2014
109 Ga0075366_10002890 3300006195 Bacteria 8915
110 Ga0075366_10004479 3300006195 Bacteria 7496
111 Ga0075366_10015560 3300006195 Bacteria 4363
112 Ga0075366_10087156 3300006195 Bacteria 1868
113 Ga0075366_10165046 3300006195 Bacteria 1343
114 Ga0075370_10007391 3300006353 Bacteria 5593
115 Ga0075370_10082134 3300006353 Bacteria 1853
116 Ga0075370_10218012 3300006353 Bacteria 1127
117 Ga0075433_10087389 3300006852 Bacteria 2753
118 Ga0075434_100030239 3300006871 Bacteria 5333
119 Ga0097620_100116579 3300006931 Bacteria 2736
120 Ga0097620_100124216 3300006931 Bacteria 2649
121 Ga0097620_100134704 3300006931 Unclassified 2542
122 Ga0079104_1000123 3300006946 Bacteria 111052
123 Ga0099826_10000328 3300006948 Bacteria 21645
124 Ga0099826_10004259 3300006948 Bacteria 9985
125 Ga0075435_100114484 3300007076 Bacteria 2245
126 Ga0105244_10086983 3300009036 Bacteria 1540
127 Ga0105240_10017697 3300009093 Bacteria 9596
128 Ga0105247_10086365 3300009101 Bacteria 1985
129 Ga0114129_10083606 3300009147 Unclassified 4433
130 Ga0114129_10137546 3300009147 Bacteria 3351
131 Ga0114129_10516859 3300009147 Bacteria 1557
132 Ga0105243_10017517 3300009148 Bacteria 5416
133 Ga0105243_10144668 3300009148 Bacteria 2033
134 Ga0105241_10053569 3300009174 Bacteria 3086
135 Ga0105248_10076244 3300009177 Bacteria 3769
136 Ga0105238_10146528 3300009551 Bacteria 2337
137 Ga0105249_10005986 3300009553 Bacteria 10543
138 Ga0105249_10085241 3300009553 Bacteria 2944
139 Ga0105249_10314814 3300009553 Bacteria 1575
140 Ga0105033_101019 3300009986 Bacteria 2245
141 Ga0105239_10118516 3300010375 Bacteria 2938
142 Ga0105246_10073161 3300011119 Bacteria 2419
143 Ga0105246_10096060 3300011119 Bacteria 2147
144 Ga0157326_1001143 3300012513 Bacteria 2953
145 Ga0157373_10074872 3300013100 Bacteria 2388
146 Ga0157371_10000002 3300013102 Bacteria 665040
147 Ga0157371_10000409 3300013102 Bacteria 53288
148 Ga0157370_10000269 3300013104 Bacteria 65839
149 Ga0157369_10022116 3300013105 Bacteria 7104
150 Ga0157369_10039045 3300013105 Bacteria 5189
151 Ga0171463_1002 3300013249 Bacteria 1274851
152 Ga0171462_1024 3300013250 Bacteria 129278
153 Ga0157380_10151027 3300014326 Bacteria 2008
154 Ga0157379_10156535 3300014968 Bacteria 2056
155 Ga0183363_1303 3300015690 Bacteria 6872
156 Ga0209435_100002 3300025206 Bacteria 794178
157 Ga0209435_100165 3300025206 Bacteria 20816
158 Ga0209436_100407 3300025208 Bacteria 19379
159 Ga0209437_100414 3300025233 Bacteria 39087
160 Ga0207425_1001938 3300025245 Bacteria 7789
161 Ga0207425_1017790 3300025245 Bacteria 1554
162 Ga0209646_1000001 3300025246 Bacteria 3092932
163 Ga0209646_1000107 3300025246 Bacteria 163112
164 Ga0209026_1000001 3300025250 Bacteria 1228671
165 Ga0209759_1000001 3300025256 Bacteria 2799452
166 Ga0209759_1000340 3300025256 Bacteria 61605
167 Ga0209129_1002318 3300025258 Bacteria 9441
168 Ga0209233_1000381 3300025261 Bacteria 38369
169 Ga0209565_1001698 3300025263 Bacteria 9085
170 Ga0209673_1000366 3300025273 Bacteria 81215
171 Ga0209673_1011274 3300025273 Bacteria 3696
172 Ga0209673_1036661 3300025273 Bacteria 1451
173 Ga0209130_1000010 3300025284 Bacteria 444920
174 Ga0209130_1000024 3300025284 Bacteria 354212
175 Ga0209130_1000090 3300025284 Bacteria 151512
176 Ga0209130_1000104 3300025284 Bacteria 136694
177 Ga0209130_1000106 3300025284 Bacteria 134559
178 Ga0209130_1015319 3300025284 Bacteria 1893
179 Ga0209675_1001016 3300025291 Bacteria 17568
180 Ga0209675_1002904 3300025291 Bacteria 8481
181 Ga0209676_1041023 3300025292 Bacteria 1297
182 Ga0209025_1000017 3300025294 Bacteria 768983
183 Ga0209025_1000082 3300025294 Bacteria 265613
184 Ga0209025_1000683 3300025294 Bacteria 58209
185 Ga0209025_1002817 3300025294 Bacteria 17498
186 Ga0209025_1005985 3300025294 Bacteria 9664
187 Ga0209564_1000025 3300025295 Bacteria 520535
188 Ga0209564_1000044 3300025295 Bacteria 381017
189 Ga0209564_1000128 3300025295 Bacteria 196532
190 Ga0209564_1000177 3300025295 Bacteria 152313
191 Ga0209564_1000732 3300025295 Bacteria 46815
192 Ga0209758_1000319 3300025297 Bacteria 92649
193 Ga0209758_1002099 3300025297 Bacteria 21167
194 Ga0209758_1010483 3300025297 Bacteria 5538
195 Ga0209758_1033099 3300025297 Bacteria 2084
196 Ga0209050_1008565 3300025298 Bacteria 5427
197 Ga0209050_1018384 3300025298 Bacteria 2718
198 Ga0209256_1000032 3300025299 Bacteria 395041
199 Ga0209256_1000320 3300025299 Bacteria 82751
200 Ga0209256_1000658 3300025299 Bacteria 46924
201 Ga0209256_1001523 3300025299 Bacteria 23390
202 Ga0207426_1000036 3300025302 Bacteria 444920
203 Ga0207426_1000113 3300025302 Bacteria 228304
204 Ga0207426_1000156 3300025302 Bacteria 178646
205 Ga0207426_1000210 3300025302 Bacteria 138932
206 Ga0207426_1022674 3300025302 Bacteria 2151
207 Ga0209051_1000062 3300025303 Bacteria 251081
208 Ga0209051_1039935 3300025303 Bacteria 1688
209 Ga0209257_1005004 3300025304 Bacteria 9667
210 Ga0209257_1035478 3300025304 Bacteria 1543
211 Ga0207655_1056866 3300025728 Bacteria 1540
212 Ga0207647_10008439 3300025904 Bacteria 7389
213 Ga0207681_10140959 3300025923 Bacteria 1795
214 Ga0207644_10039225 3300025931 Bacteria 3342
215 Ga0207706_10181948 3300025933 Bacteria 1846
216 Ga0207704_10273921 3300025938 Bacteria 1279
217 Ga0207711_10085882 3300025941 Bacteria 2758
218 Ga0207667_10207729 3300025949 Bacteria 2007
219 Ga0207712_10141972 3300025961 Bacteria 1844
220 Ga0207712_10142107 3300025961 Bacteria 1843
221 Ga0207639_10228984 3300026041 Bacteria 1610
222 Ga0207678_10243939 3300026067 Bacteria 1539
223 Ga0207678_10345160 3300026067 Bacteria 1283
224 Ga0207708_10042610 3300026075 Unclassified 3459
225 Ga0207648_10026851 3300026089 Bacteria 5114
226 Ga0207676_10173313 3300026095 Bacteria 1882
227 Ga0207674_10045900 3300026116 Bacteria 4490
228 Ga0207675_100464765 3300026118 Bacteria 1256
229 Ga0209281_1000082 3300027111 Bacteria 257684
230 Ga0209281_1000251 3300027111 Bacteria 106988
231 Ga0209281_1000890 3300027111 Bacteria 25425
232 Ga0209371_1000012 3300027312 Bacteria 748304
233 Ga0209371_1004909 3300027312 Bacteria 5572
234 Ga0209371_1027410 3300027312 Bacteria 1283
235 Ga0209282_1000006 3300027666 Bacteria 276998
236 Ga0209282_1000131 3300027666 Bacteria 45265
237 Ga0209813_10002132 3300027866 Bacteria 4515
238 Ga0207428_10000694 3300027907 Bacteria 39141
239 Ga0268266_10015090 3300028379 Bacteria 6634
240 Ga0268265_10025095 3300028380 Bacteria 4226
241 Ga0268265_10163881 3300028380 Bacteria 1892
242 Ga0268264_10249329 3300028381 Bacteria 1649
243 Ga0307515_10000014 3300028794 Bacteria 562358
244 Ga0307515_10000103 3300028794 Bacteria 198308
245 Ga0307515_10032141 3300028794 Bacteria 8709
246 Ga0307515_10038527 3300028794 Bacteria 7642
247 Ga0307515_10041667 3300028794 Bacteria 7209
248 Ga0307515_10124172 3300028794 Bacteria 2898
249 Ga0307515_10300342 3300028794 Bacteria 1291
250 Ga0268256_1000013 3300030500 Bacteria 752103
251 Ga0268256_1001570 3300030500 Bacteria 13394
252 Ga0268256_1015513 3300030500 Bacteria 2220
253 Ga0268256_1036862 3300030500 Bacteria 1124
254 Ga0307513_10000038 3300031456 Bacteria 174780
255 Ga0307513_10003898 3300031456 Bacteria 20062
256 Ga0307513_10016362 3300031456 Bacteria 8948
257 Ga0307513_10034144 3300031456 Bacteria 5711
258 Ga0307513_10155678 3300031456 Bacteria 2186
259 Ga0307408_100432129 3300031548 Bacteria 1138
260 Ga0307410_10075236 3300031852 Bacteria 2354
261 Ga0307412_10134454 3300031911 Bacteria 1802
262 Ga0315914_1000003 3300031967 Bacteria 314370
263 Ga0307414_10396930 3300032004 Bacteria 1197
264 Ga0315913_1000001 3300033430 Bacteria 284459
265 Ga0315915_1000008 3300033464 Bacteria 258517
266 Ga0395900_0001135 3300037418 Bacteria 33640
267 Ga0395898_0001446 3300037466 Bacteria 33640
268 Ga0395905_0000252 3300037471 Bacteria 80112
269 Ga0395901_0000848 3300038443 Bacteria 33640
270 Ga0436361_0229411 3300039447 Bacteria 3428
271 Ga0436361_0279106 3300039447 Bacteria 1791
272 Ga0439436_0024617 3300041404 Bacteria 1776
273 Ga0451839_0199310 3300041496 Bacteria 2647
274 Ga0451845_0298546 3300041501 Bacteria 2958
275 Ga0451853_2389351 3300041512 Bacteria 1438
276 Ga0439449_0001481 3300042007 Bacteria 9195
277 Ga0450907_004348 3300042146 Bacteria 2450
278 Ga0453684_0178533 3300044712 Unclassified 2495
279 Ga0451576_0001229 3300045051 Bacteria 45387
280 Ga0451576_0293967 3300045051 Unclassified 1698
281 Ga0495617_020650 3300046452 Bacteria 2226
282 Ga0495591_001659 3300046458 Bacteria 13409
283 Ga0495638_0000216 3300046460 Bacteria 80528
284 Ga0495650_0061191 3300046471 Bacteria 1509
285 Ga0495605_0003850 3300046474 Bacteria 8905
286 Ga0495605_0014925 3300046474 Bacteria 4237
287 Ga0495605_0041860 3300046474 Bacteria 2280
288 Ga0495596_0037259 3300046500 Bacteria 1924
289 Ga0495607_0000298 3300046501 Bacteria 51955
290 Ga0495607_0007977 3300046501 Bacteria 7276
291 Ga0495583_0000923 3300046506 Bacteria 34538
292 Ga0495583_0006109 3300046506 Bacteria 7944
293 Ga0495606_0005799 3300046507 Bacteria 11659
294 Ga0495606_0093995 3300046507 Bacteria 1838
295 Ga0495610_0005539 3300046512 Bacteria 8936
296 Ga0495610_0032887 3300046512 Bacteria 2688
297 Ga0495616_0009682 3300046513 Bacteria 5618
298 Ga0495630_0013414 3300046517 Bacteria 5963
299 Ga0495631_0001565 3300046518 Bacteria 13742
300 Ga0495637_0004735 3300046520 Bacteria 7022
301 Ga0495643_0003686 3300046522 Bacteria 11104
302 Ga0495643_0024395 3300046522 Bacteria 3431
303 Ga0495648_0003877 3300046524 Bacteria 12974
304 Ga0495648_0007745 3300046524 Bacteria 8551
305 Ga0495663_0059051 3300046525 Bacteria 1203
306 Ga0495654_0004988 3300046530 Bacteria 7795
307 Ga0495587_0053395 3300046536 Bacteria 2383
308 Ga0495609_0002786 3300046538 Bacteria 10514
309 Ga0495609_0016249 3300046538 Bacteria 3468
310 Ga0495609_0056672 3300046538 Bacteria 1736
311 Ga0495597_0003872 3300046542 Bacteria 8468
312 Ga0495597_0061854 3300046542 Bacteria 1630
313 Ga0495633_0026855 3300046558 Bacteria 2820
314 Ga0495633_0050434 3300046558 Bacteria 1962
315 Ga0495633_0101920 3300046558 Bacteria 1332
316 Ga0495611_0119779 3300046648 Bacteria 1227
317 Ga0495625_0004678 3300046660 Bacteria 12852
318 Ga0495625_0024695 3300046660 Bacteria 4569
319 Ga0495625_0084563 3300046660 Bacteria 2203
320 Ga0495661_0006530 3300046665 Bacteria 8194
321 Ga0495661_0021233 3300046665 Bacteria 4235
322 Ga0495588_0044229 3300046674 Bacteria 2280
323 Ga0495669_0001614 3300046684 Bacteria 9253
324 Ga0495670_0000006 3300046691 Bacteria 255322
325 Ga0495670_0054676 3300046691 Bacteria 2001
326 Ga0495670_0080285 3300046691 Bacteria 1661
327 Ga0495671_0020431 3300046692 Bacteria 3490
328 Ga0495671_0041547 3300046692 Bacteria 2315
329 Ga0495649_0023817 3300046694 Bacteria 3418
330 Ga0495649_0043465 3300046694 Bacteria 2453
331 Ga0495649_0174655 3300046694 Bacteria 1123
332 Ga0495589_0000740 3300046794 Bacteria 21033
333 Ga0495660_0002272 3300046810 Bacteria 12352
334 Ga0495680_0002273 3300047322 Bacteria 19775
335 Ga0495683_0004434 3300047323 Bacteria 7972
336 Ga0495683_0077405 3300047323 Bacteria 1626
337 Ga0495677_0153608 3300047445 Bacteria 887
338 Ga0495673_0001184 3300047469 Bacteria 21958
339 Ga0495673_0004456 3300047469 Bacteria 8756
340 Ga0495681_0007267 3300047470 Bacteria 7116
341 Ga0495681_0009288 3300047470 Bacteria 6073
342 Ga0495681_0039133 3300047470 Bacteria 2318
343 Ga0495686_0002573 3300047472 Bacteria 16888
344 Ga0495626_0000326 3300048091 Bacteria 50232
345 Ga0496102_0009506 3300048905 Bacteria 8360
346 Ga0496103_0014045 3300048906 Bacteria 4754
347 Ga0496104_0124203 3300048907 Bacteria 2478
348 Ga0496108_0004612 3300048911 Bacteria 11098
349 Ga0496108_0333469 3300048911 Unclassified 1323
350 Ga0496109_0013349 3300048912 Bacteria 7122
351 Ga0496110_0206303 3300048913 Bacteria 1786
352 Ga0496111_0060808 3300048914 Bacteria 2738
353 Ga0496112_0202757 3300048915 Bacteria 1942
354 Ga0496113_0065393 3300048916 Bacteria 2752
355 Ga0496116_0000049 3300048919 Bacteria 314452
356 Ga0496116_0008756 3300048919 Bacteria 8728
357 Ga0496116_0017332 3300048919 Bacteria 5593
358 Ga0496117_0000016 3300048920 Bacteria 523642
359 Ga0496117_0079021 3300048920 Bacteria 2169
360 Ga0496118_0001242 3300048921 Bacteria 39180
361 Ga0496118_0093154 3300048921 Bacteria 2065
362 Ga0496119_0004439 3300048922 Bacteria 13970
363 Ga0496119_0005055 3300048922 Bacteria 12823
364 Ga0496119_0007386 3300048922 Bacteria 9919
365 Ga0496119_0042979 3300048922 Bacteria 2860
366 Ga0496120_0000772 3300048923 Bacteria 46288
367 Ga0496120_0002229 3300048923 Bacteria 20320
368 Ga0496120_0061641 3300048923 Bacteria 2092
369 Ga0496120_0080409 3300048923 Bacteria 1767
370 Ga0496121_0000005 3300048924 Bacteria 1034486
371 Ga0496121_0006954 3300048924 Bacteria 13774
372 Ga0496121_0006959 3300048924 Bacteria 13771
373 Ga0496121_0022369 3300048924 Bacteria 6140
374 Ga0496122_0000002 3300048925 Bacteria 905834
375 Ga0496122_0003860 3300048925 Bacteria 19231
376 Ga0496122_0008137 3300048925 Bacteria 11419
377 Ga0496122_0032953 3300048925 Bacteria 4270
378 Ga0496122_0037303 3300048925 Bacteria 3914
379 Ga0496122_0052789 3300048925 Bacteria 3072
380 Ga0496122_0056850 3300048925 Bacteria 2912
381 Ga0496122_0064383 3300048925 Bacteria 2667
382 Ga0496122_0093760 3300048925 Bacteria 2035
383 Ga0496122_0179887 3300048925 Bacteria 1263
384 Ga0496123_0000002 3300048926 Bacteria 1811682
385 Ga0496123_0003116 3300048926 Bacteria 19021
386 Ga0496123_0019631 3300048926 Bacteria 5323
387 Ga0496123_0066025 3300048926 Bacteria 2295
388 Ga0496123_0076621 3300048926 Bacteria 2057
389 Ga0496123_0084584 3300048926 Bacteria 1912
390 Ga0496124_0000131 3300048927 Bacteria 156256
391 Ga0496124_0004816 3300048927 Bacteria 15536
392 Ga0496124_0005168 3300048927 Bacteria 14848
393 Ga0496124_0014452 3300048927 Bacteria 7633
394 Ga0496124_0118741 3300048927 Bacteria 2116
395 Ga0496125_0000034 3300048928 Bacteria 348231
396 Ga0496125_0000107 3300048928 Bacteria 197483
397 Ga0496125_0002566 3300048928 Bacteria 23401
398 Ga0496125_0026481 3300048928 Bacteria 5282
399 Ga0496125_0026642 3300048928 Bacteria 5260
400 Ga0496125_0041848 3300048928 Bacteria 3911
401 Ga0496125_0046082 3300048928 Bacteria 3662
402 Ga0496125_0094006 3300048928 Bacteria 2235
403 Ga0496125_0111461 3300048928 Bacteria 1980
404 Ga0496126_0005332 3300048929 Bacteria 14726
405 Ga0496126_0034748 3300048929 Bacteria 4730
406 Ga0496126_0118820 3300048929 Bacteria 2294
407 Ga0495678_021516 3300049459 Bacteria 2839
408 Ga0495682_0043629 3300049460 Bacteria 1642
409 Ga0501033_0030908 3300049570 Bacteria 4025
410 Ga0501033_0055252 3300049570 Bacteria 2936
411 Ga0501034_0108346 3300049571 Bacteria 2769
412 Ga0501034_0171556 3300049571 Bacteria 2136
413 Ga0501037_0019474 3300049573 Bacteria 5006
414 Ga0501039_0146468 3300049575 Unclassified 1856
415 Ga0501041_0044213 3300049577 Unclassified 2708
416 Ga0501047_0222182 3300049581 Bacteria 1745
417 Ga0501069_0012920 3300049585 Bacteria 4448
418 Ga0501070_0035707 3300049586 Bacteria 4152
419 Ga0501071_0040927 3300049587 Unclassified 3318
420 Ga0501071_0172374 3300049587 Bacteria 1620
421 Ga0501075_0041946 3300049591 Unclassified 3430
422 Ga0501075_0083430 3300049591 Bacteria 2421
423 Ga0501079_0122116 3300049741 Unclassified 2026
424 Ga0501080_0003061 3300049742 Bacteria 14764
425 Ga0501080_0063893 3300049742 Unclassified 3425
426 Ga0501080_0115750 3300049742 Bacteria 2486
427 Ga0501083_0008064 3300049744 Bacteria 7450
428 Ga0501083_0013122 3300049744 Bacteria 5788
429 Ga0501035_0238304 3300049822 Bacteria 1548
430 Ga0501035_0372363 3300049822 Bacteria 1192
431 Ga0501035_0402100 3300049822 Unclassified 1139
432 Ga0501035_0452462 3300049822 Bacteria 1062
433 Ga0501044_0171236 3300049823 Bacteria 2143
434 nmdc:mga03683_4943_c1 3300050489 Bacteria 4460
435 nmdc:mga00v17_21773_c1 3300050491 Bacteria 3690
436 nmdc:mga00v17_3864_c1 3300050491 Bacteria 7726
437 nmdc:mga00v17_3_c1 3300050491 Bacteria 242367
438 nmdc:mga00v17_92342_c1 3300050491 Bacteria 1903
439 nmdc:mga0yw44_113896_c1 3300050492 Bacteria 1735
440 nmdc:mga0yw44_30421_c1 3300050492 Bacteria 3129
441 nmdc:mga0yw44_30682_c1 3300050492 Bacteria 3119
442 nmdc:mga0yw44_316362_c1 3300050492 Bacteria 1048
443 nmdc:mga0yw44_7962_c2 3300050492 Bacteria 4666
444 nmdc:mga0k408_1087_c1 3300050493 Bacteria 14917
445 nmdc:mga0k408_112178_c1 3300050493 Bacteria 1612
446 nmdc:mga0k408_146970_c1 3300050493 Bacteria 1403
447 nmdc:mga0k408_55702_c1 3300050493 Bacteria 2293
448 nmdc:mga0k408_7475_c1 3300050493 Bacteria 5833
449 nmdc:mga06z11_40069_c1 3300050494 Bacteria 2336
450 nmdc:mga06z11_473_c1 3300050494 Bacteria 14875
451 nmdc:mga06z11_6083_c1 3300050494 Bacteria 4883
452 nmdc:mga06z11_94708_c1 3300050494 Bacteria 1628
453 nmdc:mga04h51_1193_c1 3300050495 Bacteria 5991
454 nmdc:mga07m45_12579_c1 3300050496 Bacteria 4475
455 nmdc:mga07m45_149200_c1 3300050496 Bacteria 1356
456 nmdc:mga07m45_36238_c1 3300050496 Bacteria 2747
457 nmdc:mga05p37_75160_c1 3300050507 Unclassified 4159
458 nmdc:mga0qj67_296413_c1 3300050509 Bacteria 1310
459 nmdc:mga0n895_291105_c1 3300050512 Bacteria 1656
460 nmdc:mga0rr50_102355_c1 3300050513 Bacteria 2253
461 nmdc:mga0a205_7632_c1 3300050515 Bacteria 9809
462 nmdc:mga0sz30_213_c1 3300050516 Bacteria 21919
463 nmdc:mga0sz30_4189_c1 3300050516 Bacteria 5195
464 Ga0500578_0114951 3300053086 Bacteria 1694
465 Ga0500578_0115857 3300053086 Bacteria 1687
466 Ga0500644_0022087 3300053088 Bacteria 1915
467 Ga0500641_0086297 3300053096 Bacteria 1337
468 Ga0500560_000069 3300053107 Bacteria 9821
469 Ga0500560_000906 3300053107 Bacteria 4663
470 Ga0500562_003093 3300053108 Bacteria 4155
471 Ga0500569_010366 3300053109 Bacteria 2193
472 Ga0500572_000072 3300053111 Bacteria 32032
473 Ga0500608_030314 3300053122 Bacteria 2564
474 Ga0500618_000257 3300053125 Bacteria 41903
475 Ga0500618_001845 3300053125 Bacteria 8869
476 Ga0500618_003584 3300053125 Bacteria 5274
477 Ga0500618_020882 3300053125 Bacteria 1601
478 Ga0500655_013833 3300053133 Bacteria 1475
479 Ga0500658_0004793 3300053134 Bacteria 5042
480 Ga0500658_0030546 3300053134 Bacteria 2102
481 Ga0500559_0000030 3300053136 Bacteria 115347
482 Ga0500561_0000086 3300053137 Bacteria 18553
483 Ga0500568_0000248 3300053139 Bacteria 45933
484 Ga0500573_0000978 3300053140 Bacteria 13094
485 Ga0500573_0019763 3300053140 Bacteria 3854
486 Ga0500604_0046293 3300053151 Bacteria 1330
487 Ga0500616_0001995 3300053153 Bacteria 18114
488 Ga0500616_0027597 3300053153 Bacteria 3133
489 Ga0500616_0034767 3300053153 Bacteria 2744
490 Ga0500616_0043017 3300053153 Bacteria 2416
491 Ga0500622_0000174 3300053156 Bacteria 69403
492 Ga0500622_0014166 3300053156 Bacteria 4286
493 Ga0500622_0065584 3300053156 Bacteria 1844
494 Ga0500624_000238 3300053157 Bacteria 19610
495 Ga0500627_0034396 3300053158 Bacteria 2148
496 Ga0500634_0000005 3300053161 Bacteria 184092
497 Ga0500634_0011492 3300053161 Bacteria 4572
498 Ga0500634_0105712 3300053161 Bacteria 1399
499 Ga0500639_013413 3300053163 Bacteria 4309
500 Ga0500636_0000121 3300053177 Bacteria 40628
501 Ga0500636_0000558 3300053177 Bacteria 20323
502 Ga0500636_0013195 3300053177 Bacteria 4848
503 Ga0500636_0031463 3300053177 Bacteria 3141
504 Ga0500636_0094918 3300053177 Bacteria 1703
505 Ga0500645_001234 3300053730 Bacteria 13469
506 Ga0500645_057323 3300053730 Bacteria 1129
507 Ga0500596_006521 3300053735 Bacteria 1968
508 Ga0501084_0004472 3300054114 Bacteria 11418
509 Ga0501082_0003626 3300060353 Bacteria 13487
510 Ga0530510_0011285 3300061734 Bacteria 6270
511 Ga0530510_0193256 3300061734 Bacteria 1511
512 Ga0530510_0198952 3300061734 Unclassified 1488
513 2508728805 2508501050 Bacteria 9633614
514 2509074135 2508501114 Bacteria 7082538
515 2509076243 2508501114 Bacteria 7082538
516 2509385645 2509276021 Bacteria 7634384
517 2510136633 2510065019 Bacteria 6903379
518 2510304178 2510065057 Bacteria 6649661
519 2510840879 2510461069 Bacteria 5505000
520 2510900120 2510461076 Bacteria 8618824
521 2510900716 2510461076 Bacteria 8618824
522 2511174224 2510917026 Bacteria 7046020
523 2511193746 2510917030 Bacteria 7460662
524 2511243110 2511231002 Bacteria 5042903
525 2511248581 2511231003 Bacteria 5606035
526 2511502616 2511231052 Bacteria 6974333
527 2512970266 2512875026 Bacteria 6861065
528 2513569493 2513237084 Bacteria 7231967
529 2513576345 2513237085 Bacteria 7695351
530 2513583247 2513237086 Bacteria 7265287
531 2513601330 2513237089 Bacteria 6553624
532 2513618551 2513237091 Bacteria 6900273
533 2513635197 2513237093 Bacteria 7545552
534 2513709901 2513237103 Bacteria 7647401
535 2513714632 2513237104 Bacteria 10034502
536 2513881688 2513237140 Bacteria 7076289
537 2513905781 2513237143 Bacteria 6664116
538 2514003223 2513237160 Bacteria 6650282
539 2514018893 2513237162 Bacteria 7468464
540 2515115202 2515075009 Bacteria 7288508
541 2515609386 2515154107 Bacteria 6795637
542 2515633372 2515154113 Bacteria 7807172
543 2515645430 2515154114 Bacteria 7848616
544 2515658572 2515154116 Bacteria 7552979
545 2515742053 2515154134 Bacteria 7220242
546 2516893992 2516653046 Bacteria 6989037
547 2517041808 2516653077 Bacteria 7555578
548 2517081172 2516653085 Bacteria 7346596
549 2517099249 2517093000 Bacteria 7412387
550 2517570696 2517487022 Bacteria 7227575
551 2524448195 2524023207 Bacteria 6813453
552 2530644697 2529292951 Bacteria 6916614
553 2537877435 2537561587 Bacteria 5425293
554 2551675381 2551306084 Bacteria 8942552
555 2551676791 2551306084 Bacteria 8942552
556 2551689335 2551306085 Bacteria 7347181
557 2551695537 2551306086 Bacteria 6843938
558 2551697910 2551306087 Bacteria 7351905
559 2551711143 2551306089 Bacteria 7162724
560 2551721974 2551306090 Bacteria 7953713
561 2551724347 2551306091 Bacteria 7086830
562 2551735139 2551306092 Bacteria 6992595
563 2551741108 2551306093 Bacteria 7064773
564 2554245518 2554235003 Bacteria 5877155
565 2559296652 2558860242 Bacteria 5568029
566 2585167086 2582581283 Bacteria 6030556
567 2585226227 2582581298 Bacteria 7315509
568 2585328441 2582581315 Bacteria 7318924
569 2585333249 2582581316 Bacteria 7774528
570 2585394440 2582581866 Bacteria 6859583
571 2585524286 2585427526 Bacteria 7258840
572 2585539483 2585427528 Bacteria 6842387
573 2585548853 2585427529 Bacteria 7395659
574 2585837437 2585427593 Bacteria 7141551
575 2599602858 2599185210 Bacteria 5624189
576 2600196984 2599185352 Bacteria 7228948
577 2601610466 2600255279 Bacteria 5605316
578 2601747204 2600255308 Bacteria 5611129
579 2616552372 2615840698 Bacteria 7319877
580 2617384686 2617270742 Bacteria 6808054
581 2643809396 2643221557 Bacteria 7184309
582 2643812948 2643221558 Bacteria 5460675
583 2643854746 2643221568 Bacteria 5187270
584 2643917378 2643221582 Bacteria 5804683
585 2644051301 2643221607 Bacteria 6314006
586 2644069384 2643221610 Bacteria 7480339
587 2644106821 2643221618 Bacteria 7717186
588 2644149331 2643221626 Bacteria 8069654
589 2644200972 2643221636 Bacteria 6583769
590 2644309893 2643221655 Bacteria 7722067
591 2644337174 2643221659 Bacteria 7890716
592 2644379961 2643221668 Bacteria 7306521
593 2644420537 2643221675 Bacteria 7473456
594 2644454063 2643221680 Bacteria 7473610
595 2644484205 2643221686 Bacteria 6310811
596 2644520780 2643221693 Bacteria 5513853
597 2644540512 2643221698 Bacteria 7756764
598 2644616344 2643221712 Bacteria 7729434
599 2644674780 2643221723 Bacteria 7095460
600 2644686164 2643221726 Bacteria 7455827
601 2644734171 2643221734 Bacteria 5365412
602 2644742873 2643221736 Bacteria 6608466
603 2725946186 2724679232 Bacteria 7646494
604 2739033942 2738541333 Bacteria 7106503
605 2753357129 2751185800 Bacteria 5467370
606 2758639413 2758568016 Bacteria 5645291
607 2774868853 2773857925 Bacteria 6472445
608 2776268632 2775506902 Bacteria 6208009
609 2776285287 2775506904 Bacteria 5954060
610 2778178558 2775507266 Bacteria 7392367
611 2793068849 2791355197 Bacteria 8420563
612 2793293650 2791355256 Bacteria 6798008
613 2793328538 2791355261 Bacteria 6661293
614 2793333366 2791355262 Bacteria 6774204
615 2793353687 2791355265 Bacteria 6539969
616 2793358137 2791355266 Bacteria 7116587
617 2793369853 2791355267 Bacteria 7222458
618 2802716623 2802428858 Bacteria 6636079
619 2802725434 2802428859 Bacteria 6667919
620 2802730474 2802428860 Bacteria 6525526
621 2802737554 2802428861 Bacteria 6534206
622 2802743056 2802428862 Bacteria 6633353
623 2802750480 2802428863 Bacteria 6410669
624 2805929392 2802429605 Bacteria 6875453
625 2806045727 2802429633 Bacteria 7341974
626 2806053296 2802429634 Bacteria 7083200
627 2806062337 2802429635 Bacteria 7650140
628 2806066332 2802429636 Bacteria 7597525
629 2806073088 2802429637 Bacteria 7067217
630 2808987105 2808606387 Bacteria 5697198
631 2819560593 2818991439 Bacteria 6907412
632 2819688297 2818991461 Bacteria 7026071
633 2819721226 2818991467 Bacteria 5893227
634 2821127066 2821123053 Bacteria 7836056
635 2838667456 2838661181 Bacteria 7385261
636 2838671151 2838668709 Bacteria 6671819
637 2838677915 2838675328 Bacteria 4909118
638 2838692934 2838686498 Bacteria 7807632
639 2838703670 2838701080 Bacteria 6669771
640 2838717179 2838714209 Bacteria 5525906
641 2838722210 2838719591 Bacteria 5523910
642 2838727928 2838724970 Bacteria 4908691
643 2838734158 2838729681 Bacteria 7400765
644 2838740792 2838736955 Bacteria 5760694
645 2838746610 2838742623 Bacteria 7396178
646 2840770494 2840764183 Bacteria 6358399
647 2841765320 2841760612 Bacteria 6454112
648 2841844633 2841840854 Bacteria 5761912
649 2841849586 2841846520 Bacteria 5345850
650 2841853301 2841851746 Bacteria 7532261
651 2841861373 2841859092 Bacteria 5436171
652 2842115677 2842110456 Bacteria 7656360
653 2842127666 2842124991 Bacteria 5346824
654 2842132808 2842130223 Bacteria 4909145
655 2842144298 2842140634 Bacteria 5759631
656 2842149329 2842146304 Bacteria 5957337
657 2842154801 2842152218 Bacteria 4908957
658 2842161614 2842156927 Bacteria 6894975
659 2842167172 2842163707 Bacteria 6916235
660 2842173300 2842170452 Bacteria 5525737
661 2842178422 2842175837 Bacteria 4908771
662 2842185585 2842180545 Bacteria 6888678
663 2842190287 2842187318 Bacteria 5524014
664 2842214601 2842211629 Bacteria 5523832
665 2842222134 2842217011 Bacteria 7497767
666 2842227320 2842224351 Bacteria 5524473
667 2842234244 2842229732 Bacteria 7475766
668 2842246545 2842243621 Bacteria 7421798
669 2842254034 2842250916 Bacteria 6579627
670 2842260595 2842257432 Bacteria 7401195
671 2842277402 2842271015 Bacteria 7807131
672 2842308793 2842304105 Bacteria 7023636
673 2842321401 2842317721 Bacteria 6793725
674 2842344138 2842341865 Bacteria 7003929
675 2842396498 2842395702 Bacteria 6780583
676 2842493263 2842489311 Bacteria 6620893
677 2842499167 2842495871 Bacteria 6820686
678 2842518360 2842515876 Bacteria 5436280
679 2842874979 2842871566 Bacteria 4827117
680 2844106930 2844104063 Bacteria 6440972
681 2844171010 2844163670 Bacteria 7266046
682 2844460977 2844454524 Bacteria 7952546
683 2844536146 2844533157 Bacteria 7517899
684 2851185917 2851182111 Bacteria 6047226
685 2851248970 2851246043 Bacteria 6439203
686 2855842107 2855839649 Bacteria 7135830
687 2857519300 2857516855 Bacteria 7787325
688 2857534947 2857531043 Bacteria 6754041
689 2857576405 2857576091 Bacteria 5465855
690 2858802781 2858800743 Bacteria 6603254
691 2891048986 2891048133 Bacteria 4447501
692 2899796416 2899792073 Bacteria 4926588
693 2899848482 2899845264 Bacteria 5672268
694 2899849959 2899845264 Bacteria 5672268
695 2915981240 2915980308 Bacteria 6624279
696 2915992261 2915986958 Bacteria 6739310
697 2915998621 2915993759 Bacteria 7016183
698 2916001432 2916000859 Bacteria 6865702
699 2916013551 2916007675 Bacteria 6898660
700 2916019477 2916014648 Bacteria 6946486
701 2916026812 2916021584 Bacteria 6854472
702 2916033066 2916028427 Bacteria 6748433
703 2916039251 2916035215 Bacteria 6755766
704 2916046471 2916041962 Bacteria 6820487
705 2916050532 2916048683 Bacteria 6543552
706 2916055921 2916055098 Bacteria 6758838
707 2916062101 2916061851 Bacteria 6737736
708 2916075780 2916068649 Bacteria 6943657
709 2916078118 2916076590 Bacteria 6596108
710 2917703238 2917699015 Bacteria 7043791
711 2919104733 2919100787 Bacteria 7710546
712 2919117437 2919114240 Bacteria 5700270
713 2919169083 2919166419 Bacteria 4952238
714 2921204204 2921201388 Bacteria 6926299
715 2921210333 2921208531 Bacteria 6745326
716 2921240448 2921237296 Bacteria 6876710
717 2921247700 2921244191 Bacteria 6568419
718 2921251746 2921250672 Bacteria 6677771
719 2921270224 2921263974 Bacteria 6864552
720 2921287245 2921282425 Bacteria 6826397
721 2921291997 2921289301 Bacteria 7316391
722 2924144952 2924144063 Bacteria 6883928
723 2924153684 2924150972 Bacteria 7169444
724 2924161567 2924158325 Bacteria 7188855
725 2924169452 2924165586 Bacteria 7260590
726 2924173515 2924172951 Bacteria 6749356
727 2924183339 2924179722 Bacteria 6843264
728 2924189637 2924186466 Bacteria 6876637
729 2924195123 2924193448 Bacteria 6955718
730 2924201565 2924200457 Bacteria 6757188
731 2924208177 2924207177 Bacteria 6917007
732 2924235249 2924228884 Bacteria 6633132
733 2926758884 2926754445 Bacteria 5964435
734 2926763605 2926760298 Bacteria 5505990
735 2926764982 2926760298 Bacteria 5505990
736 2929142344 2929138655 Bacteria 5810547
737 2929142667 2929138655 Bacteria 5810547
738 2929201140 2929199973 Bacteria 7260745
739 2933009816 2933006813 Bacteria 4912075
740 2933013987 2933011516 Bacteria 5439334
741 2933020108 2933016740 Bacteria 6355406
742 2933575077 2933570622 Bacteria 7023390
743 2933591644 2933586486 Bacteria 7667493
744 2933595772 2933594066 Bacteria 5594265
745 2935905882 2935901341 Bacteria 7341747
746 2936370303 2936367885 Bacteria 7324495
747 2936377970 2936375103 Bacteria 6652732
748 2937000815 2936996657 Bacteria 6298727
749 2937003962 2937002841 Bacteria 6934057
750 2937021767 2937016420 Bacteria 6782579
751 2937035728 2937029754 Bacteria 6424026
752 2937039391 2937036028 Bacteria 6846469
753 2937042960 2937042894 Bacteria 6741576
754 2937057487 2937056579 Bacteria 7107896
755 2937064599 2937063883 Bacteria 7199456
756 2937073290 2937071275 Bacteria 6984483
757 2937080790 2937078374 Bacteria 6610289
758 2937085356 2937084907 Bacteria 6618516
759 2937101784 2937098957 Bacteria 7249374
760 2937110876 2937106411 Bacteria 6947143
761 2937117575 2937113482 Bacteria 6505872
762 2937124407 2937119839 Bacteria 6597547
763 2937129506 2937126314 Bacteria 6771275
764 2937844451 2937843397 Bacteria 5256375
765 2941503250 2941499720 Bacteria 7599444
766 2941505845 2941499720 Bacteria 7599444
767 2957380597 2957375807 Bacteria 6425588
768 2957382621 2957382221 Bacteria 6737050
769 2957389401 2957388812 Bacteria 6778072
770 2957408423 2957402308 Bacteria 6741770
771 2957410122 2957408893 Bacteria 6558585
772 2957420010 2957415311 Bacteria 6991633
773 2957424821 2957422303 Bacteria 7172205
774 2957433626 2957430029 Bacteria 7022557
775 2957439948 2957437181 Bacteria 6568994
776 2957450672 2957443900 Bacteria 6869977
777 2957452212 2957450854 Bacteria 6765715
778 2957460391 2957457609 Bacteria 6967680
779 2957465583 2957464669 Bacteria 6568877
780 2957473369 2957471148 Bacteria 6797643
781 2957479013 2957478035 Bacteria 6756658
782 2957488854 2957484790 Bacteria 6703082
783 2957497886 2957491536 Bacteria 6695180
784 2957501795 2957498199 Bacteria 7126688
785 2957509948 2957505466 Bacteria 7253085
786 2960585178 2960584000 Bacteria 6864594
787 2960591903 2960591022 Bacteria 6622873
788 2960602002 2960597568 Bacteria 6550735
789 2960614762 2960610863 Bacteria 6691244
790 2960618097 2960617483 Bacteria 6727748
791 2960629997 2960624210 Bacteria 6875384
792 2960633925 2960631154 Bacteria 6732508
793 2960642632 2960637947 Bacteria 7296468
794 2960648287 2960645483 Bacteria 7211087
795 2960654834 2960652885 Bacteria 7083688
796 2960667227 2960660292 Bacteria 7041660
797 2960669960 2960667422 Bacteria 6763020
798 2960678590 2960674078 Bacteria 6609048
799 2960680711 2960680706 Bacteria 6624464
800 2960695004 2960693952 Bacteria 6749742
801 2964608533 2964607997 Bacteria 7101408
802 2964627224 2964621998 Bacteria 6834995
803 2964630843 2964628898 Bacteria 7083044
804 2964637738 2964636051 Bacteria 7091832
805 2964652672 2964649959 Bacteria 6675118
806 2964657273 2964656573 Bacteria 7100150
807 2964666314 2964663802 Bacteria 7019362
808 2964674908 2964670856 Bacteria 6851364
809 2964684272 2964678106 Bacteria 6792020
810 2964688075 2964685014 Bacteria 6839111
811 2964693887 2964691889 Bacteria 6802758
812 2964704749 2964698721 Bacteria 6765331
813 2964707043 2964705432 Bacteria 7114648
814 2964716490 2964712639 Bacteria 6695970
815 2964725709 2964719344 Bacteria 7286602
816 2967668395 2967664464 Bacteria 6948836
817 2967677372 2967671571 Bacteria 7021409
818 2967682172 2967678726 Bacteria 7264382
819 2967692198 2967686174 Bacteria 6678622
820 2967698956 2967693043 Bacteria 6804451
821 2967700124 2967699805 Bacteria 6854538
822 2967720489 2967714385 Bacteria 7000047
823 2967724424 2967721400 Bacteria 7073753
824 2967731017 2967728569 Bacteria 6641507
825 2967739966 2967735183 Bacteria 6827012
826 2967744488 2967742019 Bacteria 6794534
827 2967749410 2967748971 Bacteria 6733771
828 2967767235 2967762386 Bacteria 6923502
829 2967770472 2967769361 Bacteria 6587838
830 2967781160 2967775926 Bacteria 6738189
831 2970022800 2970019648 Bacteria 7072033
832 2970036081 2970033650 Bacteria 7118744
833 2970048368 2970047711 Bacteria 7088379
834 2970057230 2970054988 Bacteria 6611507
835 2970064706 2970061556 Bacteria 7099761
836 2970071090 2970068827 Bacteria 7123112
837 2970082522 2970076120 Bacteria 6697332
838 2970083603 2970082768 Bacteria 6183754
839 2970094169 2970088815 Bacteria 6933825
840 2970098371 2970095765 Bacteria 6936963
841 2970112165 2970109326 Bacteria 6863976
842 2970123437 2970122695 Bacteria 6625855
843 2970135953 2970129317 Bacteria 6806560
844 2970144824 2970143518 Bacteria 6446480
845 2970152651 2970149975 Bacteria 6779706
846 2970161370 2970156795 Bacteria 7168044
847 2970168377 2970164137 Bacteria 6861252
848 2970173757 2970170962 Bacteria 6876229
849 2970181006 2970177841 Bacteria 6768001
850 2970186854 2970184632 Bacteria 7054431
851 2970196047 2970191845 Bacteria 7032787
852 2977519413 2977516862 Bacteria 6940108
853 2977530505 2977523885 Bacteria 6960446
854 2977534453 2977530762 Bacteria 6951399
855 2977543235 2977537788 Bacteria 6929320
856 2977546476 2977544691 Bacteria 6875412
857 2977554846 2977551784 Bacteria 7125765
858 2977565189 2977558990 Bacteria 6863948
859 2977567050 2977565890 Bacteria 6901543
860 2977574400 2977572785 Bacteria 6763888
861 2979091356 2979089926 Bacteria 5670289
862 2979096880 2979095461 Bacteria 5669583
863 2979101452 2979100975 Bacteria 5423623
864 2984510598 2984509177 Bacteria 5274802
865 2984518699 2984518228 Bacteria 5277463
866 2984538947 2984537506 Bacteria 5277481
867 2984587019 2984587000 Bacteria 5263363
868 2984605641 2984601300 Bacteria 5455244
869 2989350082 2989349275 Bacteria 6349068
870 2996898759 2996893221 Bacteria 5823108
871 3005480543 3005474847 Bacteria 9259049
872 3007515059 3007511990 Bacteria 6481491
873 639651829 639633055 Bacteria 7751309
874 648738810 648276728 Bacteria 6968865
875 650741395 650716007 Bacteria 5573770
876 650843074 650716007 Bacteria 5573770
877 8003574221 8003570095 Bacteria 5747666
878 8003994549 8003992118 Bacteria 7266902
879 8004002234 8003999396 Bacteria 7063185
880 8005294280 8005289223 Bacteria 6634003
881 8005309996 8005307578 Bacteria 7395396
882 8005381979 8005376324 Bacteria 6590079
883 8005384396 8005382845 Bacteria 6732062
884 8005401408 8005395548 Bacteria 6806915
885 8005466929 8005460587 Bacteria 7157962
886 8005562219 8005556819 Bacteria 6908598
887 8005567016 8005563573 Bacteria 7153261
888 8005576612 8005570704 Bacteria 6957481
889 8018150634 8018150411 Bacteria 5549903
890 8018166018 8018163183 Bacteria 7277977
891 8023688177 8023680758 Bacteria 7729763
892 8024483831 8024479707 Bacteria 6954785
893 8024505954 8024501048 Bacteria 6427847
894 8054002677 8054002106 Bacteria 7987183
895 8055909901 8055909800 Bacteria 7278581
896 8056387007 8056382006 Bacteria 6408074
897 8057532504 8057529695 Bacteria 6306553
898 8057878574 8057874678 Bacteria 7494653
899 Ga0079104_1002504
900 MRS1b_contig_162853
901 JGI25155J39150_1000901
902 JGI25156J39149_1001487
903 JGI25162J39368_1000503
904 JGI25154J39366_1000017
905 JGI25154J39366_1000178
906 JGI25157J39369_1000003
907 JGI25157J39369_1000054
908 JGI25150J39212_1003964
909 JGI25159J45721_1000031
910 JGI25159J45721_1000554
911 JGI25159J45721_1002081
912 JGI25151J46595_10000339
913 JGI25151J46595_10000497
914 JGI25151J46595_10002011
915 JGI25151J46595_10031435
916 JGI25406J46586_10005779
917 JGI25165J46597_1000488
918 JGI25153J46596_10006840
919 JGI25153J46596_10007518
920 JGI25153J46596_10034002
921 JGI25160J50197_1000005
922 JGI25160J50197_1000340
923 JGI25160J50197_1006475
924 JGI25160J50197_1008063
925 JGI25161J50226_1000098
926 JGI25161J50226_1000658
927 JGI25161J50226_1003034
928 Ga0055526_1000588
929 Ga0055526_1000876
930 Ga0055526_1001404
931 Ga0055526_1001890
932 Ga0055526_1002191
933 Ga0055526_1004737
934 Ga0055526_1007767
935 Ga0055524_1000205
936 Ga0055524_1002883
937 Ga0055524_1003038
938 Ga0055528_1003958
939 Ga0055540_1000255
940 Ga0055531_10008217
941 Ga0058692_1012344
942 Ga0055543_1000082
943 Ga0055543_1000144
944 Ga0055543_1000382
945 Ga0065165_1000002
946 Ga0065165_1000014
947 Ga0065165_1004665
948 Ga0065165_1009214
949 Ga0065704_10132021
950 Ga0065707_10096128
951 Ga0065707_10161805
952 Ga0070670_100103999
953 Ga0070666_10055473
954 Ga0070680_100303555
955 Ga0068868_100450061
956 Ga0070689_100028427
957 Ga0070689_100145600
958 Ga0070687_100094564
959 Ga0070705_100008463
960 Ga0070694_100446755
961 Ga0070663_100014089
962 Ga0070707_100377056
963 Ga0070698_100009158
964 Ga0070698_100037268
965 Ga0070698_100132674
966 Ga0070699_100450813
967 Ga0068853_100259414
968 Ga0070696_100065379
969 Ga0070665_100009499
970 Ga0070665_100014985
971 Ga0068855_100087419
972 Ga0068857_100046333
973 Ga0068856_100022173
974 Ga0068856_100085516
975 Ga0068859_100116583
976 Ga0068859_100124215
977 Ga0068859_100134700
978 Ga0068860_100271855
979 Ga0068862_100009948
980 Ga0068862_100169034
981 Ga0068862_100236469
982 Ga0081455_10017706
983 Ga0081540_1026700
984 Ga0081539_10003879
985 Ga0075365_10003424
986 Ga0075365_10021137
987 Ga0075365_10119596
988 Ga0075368_10001877
989 Ga0075368_10030391
990 Ga0075363_100004136
991 Ga0075363_100016241
992 Ga0075363_100030952
993 Ga0075363_100155706
994 Ga0075364_10032405
995 Ga0075364_10180519
996 Ga0075432_10000009
997 Ga0070712_100462430
998 Ga0075362_10002513
999 Ga0075362_10009519
1000 Ga0075362_10049813
1001 Ga0075362_10064874
1002 Ga0075367_10002826
1003 Ga0075367_10003480
1004 Ga0075367_10017525
1005 Ga0075369_10001401
1006 Ga0075369_10039539
1007 Ga0075366_10002890
1008 Ga0075366_10004479
1009 Ga0075366_10015560
1010 Ga0075366_10087156
1011 Ga0075366_10165046
1012 Ga0075370_10007391
1013 Ga0075370_10082134
1014 Ga0075370_10218012
1015 Ga0075433_10087389
1016 Ga0075434_100030239
1017 Ga0097620_100116579
1018 Ga0097620_100124216
1019 Ga0097620_100134704
1020 Ga0079104_1000123
1021 Ga0099826_10000328
1022 Ga0099826_10004259
1023 Ga0075435_100114484
1024 Ga0105244_10086983
1025 Ga0105240_10017697
1026 Ga0105247_10086365
1027 Ga0114129_10083606
1028 Ga0114129_10137546
1029 Ga0114129_10516859
1030 Ga0105243_10017517
1031 Ga0105243_10144668
1032 Ga0105241_10053569
1033 Ga0105248_10076244
1034 Ga0105238_10146528
1035 Ga0105249_10005986
1036 Ga0105249_10085241
1037 Ga0105249_10314814
1038 Ga0105033_101019
1039 Ga0105239_10118516
1040 Ga0105246_10073161
1041 Ga0105246_10096060
1042 Ga0157326_1001143
1043 Ga0157373_10074872
1044 Ga0157371_10000002
1045 Ga0157371_10000409
1046 Ga0157370_10000269
1047 Ga0157369_10022116
1048 Ga0157369_10039045
1049 Ga0171463_1002
1050 Ga0171462_1024
1051 Ga0157380_10151027
1052 Ga0157379_10156535
1053 Ga0183363_1303
1054 Ga0209435_100002
1055 Ga0209435_100165
1056 Ga0209436_100407
1057 Ga0209437_100414
1058 Ga0207425_1001938
1059 Ga0207425_1017790
1060 Ga0209646_1000001
1061 Ga0209646_1000107
1062 Ga0209026_1000001
1063 Ga0209759_1000001
1064 Ga0209759_1000340
1065 Ga0209129_1002318
1066 Ga0209233_1000381
1067 Ga0209565_1001698
1068 Ga0209673_1000366
1069 Ga0209673_1011274
1070 Ga0209673_1036661
1071 Ga0209130_1000010
1072 Ga0209130_1000024
1073 Ga0209130_1000090
1074 Ga0209130_1000104
1075 Ga0209130_1000106
1076 Ga0209130_1015319
1077 Ga0209675_1001016
1078 Ga0209675_1002904
1079 Ga0209676_1041023
1080 Ga0209025_1000017
1081 Ga0209025_1000082
1082 Ga0209025_1000683
1083 Ga0209025_1002817
1084 Ga0209025_1005985
1085 Ga0209564_1000025
1086 Ga0209564_1000044
1087 Ga0209564_1000128
1088 Ga0209564_1000177
1089 Ga0209564_1000732
1090 Ga0209758_1000319
1091 Ga0209758_1002099
1092 Ga0209758_1010483
1093 Ga0209758_1033099
1094 Ga0209050_1008565
1095 Ga0209050_1018384
1096 Ga0209256_1000032
1097 Ga0209256_1000320
1098 Ga0209256_1000658
1099 Ga0209256_1001523
1100 Ga0207426_1000036
1101 Ga0207426_1000113
1102 Ga0207426_1000156
1103 Ga0207426_1000210
1104 Ga0207426_1022674
1105 Ga0209051_1000062
1106 Ga0209051_1039935
1107 Ga0209257_1005004
1108 Ga0209257_1035478
1109 Ga0207655_1056866
1110 Ga0207647_10008439
1111 Ga0207681_10140959
1112 Ga0207644_10039225
1113 Ga0207706_10181948
1114 Ga0207704_10273921
1115 Ga0207711_10085882
1116 Ga0207667_10207729
1117 Ga0207712_10141972
1118 Ga0207712_10142107
1119 Ga0207639_10228984
1120 Ga0207678_10243939
1121 Ga0207678_10345160
1122 Ga0207708_10042610
1123 Ga0207648_10026851
1124 Ga0207676_10173313
1125 Ga0207674_10045900
1126 Ga0207675_100464765
1127 Ga0209281_1000082
1128 Ga0209281_1000251
1129 Ga0209281_1000890
1130 Ga0209371_1000012
1131 Ga0209371_1004909
1132 Ga0209371_1027410
1133 Ga0209282_1000006
1134 Ga0209282_1000131
1135 Ga0209813_10002132
1136 Ga0207428_10000694
1137 Ga0268266_10015090
1138 Ga0268265_10025095
1139 Ga0268265_10163881
1140 Ga0268264_10249329
1141 Ga0307515_10000014
1142 Ga0307515_10000103
1143 Ga0307515_10032141
1144 Ga0307515_10038527
1145 Ga0307515_10041667
1146 Ga0307515_10124172
1147 Ga0307515_10300342
1148 Ga0268256_1000013
1149 Ga0268256_1001570
1150 Ga0268256_1015513
1151 Ga0268256_1036862
1152 Ga0307513_10000038
1153 Ga0307513_10003898
1154 Ga0307513_10016362
1155 Ga0307513_10034144
1156 Ga0307513_10155678
1157 Ga0307408_100432129
1158 Ga0307410_10075236
1159 Ga0307412_10134454
1160 Ga0315914_1000003
1161 Ga0307414_10396930
1162 Ga0315913_1000001
1163 Ga0315915_1000008
1164 Ga0395900_0001135
1165 Ga0395898_0001446
1166 Ga0395905_0000252
1167 Ga0395901_0000848
1168 Ga0436361_0229411
1169 Ga0436361_0279106
1170 Ga0439436_0024617
1171 Ga0451839_0199310
1172 Ga0451845_0298546
1173 Ga0451853_2389351
1174 Ga0439449_0001481
1175 Ga0450907_004348
1176 Ga0453684_0178533
1177 Ga0451576_0001229
1178 Ga0451576_0293967
1179 Ga0495617_020650
1180 Ga0495591_001659
1181 Ga0495638_0000216
1182 Ga0495650_0061191
1183 Ga0495605_0003850
1184 Ga0495605_0014925
1185 Ga0495605_0041860
1186 Ga0495596_0037259
1187 Ga0495607_0000298
1188 Ga0495607_0007977
1189 Ga0495583_0000923
1190 Ga0495583_0006109
1191 Ga0495606_0005799
1192 Ga0495606_0093995
1193 Ga0495610_0005539
1194 Ga0495610_0032887
1195 Ga0495616_0009682
1196 Ga0495630_0013414
1197 Ga0495631_0001565
1198 Ga0495637_0004735
1199 Ga0495643_0003686
1200 Ga0495643_0024395
1201 Ga0495648_0003877
1202 Ga0495648_0007745
1203 Ga0495663_0059051
1204 Ga0495654_0004988
1205 Ga0495587_0053395
1206 Ga0495609_0002786
1207 Ga0495609_0016249
1208 Ga0495609_0056672
1209 Ga0495597_0003872
1210 Ga0495597_0061854
1211 Ga0495633_0026855
1212 Ga0495633_0050434
1213 Ga0495633_0101920
1214 Ga0495611_0119779
1215 Ga0495625_0004678
1216 Ga0495625_0024695
1217 Ga0495625_0084563
1218 Ga0495661_0006530
1219 Ga0495661_0021233
1220 Ga0495588_0044229
1221 Ga0495669_0001614
1222 Ga0495670_0000006
1223 Ga0495670_0054676
1224 Ga0495670_0080285
1225 Ga0495671_0020431
1226 Ga0495671_0041547
1227 Ga0495649_0023817
1228 Ga0495649_0043465
1229 Ga0495649_0174655
1230 Ga0495589_0000740
1231 Ga0495660_0002272
1232 Ga0495680_0002273
1233 Ga0495683_0004434
1234 Ga0495683_0077405
1235 Ga0495677_0153608
1236 Ga0495673_0001184
1237 Ga0495673_0004456
1238 Ga0495681_0007267
1239 Ga0495681_0009288
1240 Ga0495681_0039133
1241 Ga0495686_0002573
1242 Ga0495626_0000326
1243 Ga0496102_0009506
1244 Ga0496103_0014045
1245 Ga0496104_0124203
1246 Ga0496108_0004612
1247 Ga0496108_0333469
1248 Ga0496109_0013349
1249 Ga0496110_0206303
1250 Ga0496111_0060808
1251 Ga0496112_0202757
1252 Ga0496113_0065393
1253 Ga0496116_0000049
1254 Ga0496116_0008756
1255 Ga0496116_0017332
1256 Ga0496117_0000016
1257 Ga0496117_0079021
1258 Ga0496118_0001242
1259 Ga0496118_0093154
1260 Ga0496119_0004439
1261 Ga0496119_0005055
1262 Ga0496119_0007386
1263 Ga0496119_0042979
1264 Ga0496120_0000772
1265 Ga0496120_0002229
1266 Ga0496120_0061641
1267 Ga0496120_0080409
1268 Ga0496121_0000005
1269 Ga0496121_0006954
1270 Ga0496121_0006959
1271 Ga0496121_0022369
1272 Ga0496122_0000002
1273 Ga0496122_0003860
1274 Ga0496122_0008137
1275 Ga0496122_0032953
1276 Ga0496122_0037303
1277 Ga0496122_0052789
1278 Ga0496122_0056850
1279 Ga0496122_0064383
1280 Ga0496122_0093760
1281 Ga0496122_0179887
1282 Ga0496123_0000002
1283 Ga0496123_0003116
1284 Ga0496123_0019631
1285 Ga0496123_0066025
1286 Ga0496123_0076621
1287 Ga0496123_0084584
1288 Ga0496124_0000131
1289 Ga0496124_0004816
1290 Ga0496124_0005168
1291 Ga0496124_0014452
1292 Ga0496124_0118741
1293 Ga0496125_0000034
1294 Ga0496125_0000107
1295 Ga0496125_0002566
1296 Ga0496125_0026481
1297 Ga0496125_0026642
1298 Ga0496125_0041848
1299 Ga0496125_0046082
1300 Ga0496125_0094006
1301 Ga0496125_0111461
1302 Ga0496126_0005332
1303 Ga0496126_0034748
1304 Ga0496126_0118820
1305 Ga0495678_021516
1306 Ga0495682_0043629
1307 Ga0501033_0030908
1308 Ga0501033_0055252
1309 Ga0501034_0108346
1310 Ga0501034_0171556
1311 Ga0501037_0019474
1312 Ga0501039_0146468
1313 Ga0501041_0044213
1314 Ga0501047_0222182
1315 Ga0501069_0012920
1316 Ga0501070_0035707
1317 Ga0501071_0040927
1318 Ga0501071_0172374
1319 Ga0501075_0041946
1320 Ga0501075_0083430
1321 Ga0501079_0122116
1322 Ga0501080_0003061
1323 Ga0501080_0063893
1324 Ga0501080_0115750
1325 Ga0501083_0008064
1326 Ga0501083_0013122
1327 Ga0501035_0238304
1328 Ga0501035_0372363
1329 Ga0501035_0402100
1330 Ga0501035_0452462
1331 Ga0501044_0171236
1332 nmdc:mga03683_4943_c1
1333 nmdc:mga00v17_21773_c1
1334 nmdc:mga00v17_3864_c1
1335 nmdc:mga00v17_3_c1
1336 nmdc:mga00v17_92342_c1
1337 nmdc:mga0yw44_113896_c1
1338 nmdc:mga0yw44_30421_c1
1339 nmdc:mga0yw44_30682_c1
1340 nmdc:mga0yw44_316362_c1
1341 nmdc:mga0yw44_7962_c2
1342 nmdc:mga0k408_1087_c1
1343 nmdc:mga0k408_112178_c1
1344 nmdc:mga0k408_146970_c1
1345 nmdc:mga0k408_55702_c1
1346 nmdc:mga0k408_7475_c1
1347 nmdc:mga06z11_40069_c1
1348 nmdc:mga06z11_473_c1
1349 nmdc:mga06z11_6083_c1
1350 nmdc:mga06z11_94708_c1
1351 nmdc:mga04h51_1193_c1
1352 nmdc:mga07m45_12579_c1
1353 nmdc:mga07m45_149200_c1
1354 nmdc:mga07m45_36238_c1
1355 nmdc:mga05p37_75160_c1
1356 nmdc:mga0qj67_296413_c1
1357 nmdc:mga0n895_291105_c1
1358 nmdc:mga0rr50_102355_c1
1359 nmdc:mga0a205_7632_c1
1360 nmdc:mga0sz30_213_c1
1361 nmdc:mga0sz30_4189_c1
1362 Ga0500578_0114951
1363 Ga0500578_0115857
1364 Ga0500644_0022087
1365 Ga0500641_0086297
1366 Ga0500560_000069
1367 Ga0500560_000906
1368 Ga0500562_003093
1369 Ga0500569_010366
1370 Ga0500572_000072
1371 Ga0500608_030314
1372 Ga0500618_000257
1373 Ga0500618_001845
1374 Ga0500618_003584
1375 Ga0500618_020882
1376 Ga0500655_013833
1377 Ga0500658_0004793
1378 Ga0500658_0030546
1379 Ga0500559_0000030
1380 Ga0500561_0000086
1381 Ga0500568_0000248
1382 Ga0500573_0000978
1383 Ga0500573_0019763
1384 Ga0500604_0046293
1385 Ga0500616_0001995
1386 Ga0500616_0027597
1387 Ga0500616_0034767
1388 Ga0500616_0043017
1389 Ga0500622_0000174
1390 Ga0500622_0014166
1391 Ga0500622_0065584
1392 Ga0500624_000238
1393 Ga0500627_0034396
1394 Ga0500634_0000005
1395 Ga0500634_0011492
1396 Ga0500634_0105712
1397 Ga0500639_013413
1398 Ga0500636_0000121
1399 Ga0500636_0000558
1400 Ga0500636_0013195
1401 Ga0500636_0031463
1402 Ga0500636_0094918
1403 Ga0500645_001234
1404 Ga0500645_057323
1405 Ga0500596_006521
1406 Ga0501084_0004472
1407 Ga0501082_0003626
1408 Ga0530510_0011285
1409 Ga0530510_0193256
1410 Ga0530510_0198952
1411 2508728805
1412 2509074135
1413 2509076243
1414 2509385645
1415 2510136633
1416 2510304178
1417 2510840879
1418 2510900120
1419 2510900716
1420 2511174224
1421 2511193746
1422 2511243110
1423 2511248581
1424 2511502616
1425 2512970266
1426 2513569493
1427 2513576345
1428 2513583247
1429 2513601330
1430 2513618551
1431 2513635197
1432 2513709901
1433 2513714632
1434 2513881688
1435 2513905781
1436 2514003223
1437 2514018893
1438 2515115202
1439 2515609386
1440 2515633372
1441 2515645430
1442 2515658572
1443 2515742053
1444 2516893992
1445 2517041808
1446 2517081172
1447 2517099249
1448 2517570696
1449 2524448195
1450 2530644697
1451 2537877435
1452 2551675381
1453 2551676791
1454 2551689335
1455 2551695537
1456 2551697910
1457 2551711143
1458 2551721974
1459 2551724347
1460 2551735139
1461 2551741108
1462 2554245518
1463 2559296652
1464 2585167086
1465 2585226227
1466 2585328441
1467 2585333249
1468 2585394440
1469 2585524286
1470 2585539483
1471 2585548853
1472 2585837437
1473 2599602858
1474 2600196984
1475 2601610466
1476 2601747204
1477 2616552372
1478 2617384686
1479 2643809396
1480 2643812948
1481 2643854746
1482 2643917378
1483 2644051301
1484 2644069384
1485 2644106821
1486 2644149331
1487 2644200972
1488 2644309893
1489 2644337174
1490 2644379961
1491 2644420537
1492 2644454063
1493 2644484205
1494 2644520780
1495 2644540512
1496 2644616344
1497 2644674780
1498 2644686164
1499 2644734171
1500 2644742873
1501 2725946186
1502 2739033942
1503 2753357129
1504 2758639413
1505 2774868853
1506 2776268632
1507 2776285287
1508 2778178558
1509 2793068849
1510 2793293650
1511 2793328538
1512 2793333366
1513 2793353687
1514 2793358137
1515 2793369853
1516 2802716623
1517 2802725434
1518 2802730474
1519 2802737554
1520 2802743056
1521 2802750480
1522 2805929392
1523 2806045727
1524 2806053296
1525 2806062337
1526 2806066332
1527 2806073088
1528 2808987105
1529 2819560593
1530 2819688297
1531 2819721226
1532 2821127066
1533 2838667456
1534 2838671151
1535 2838677915
1536 2838692934
1537 2838703670
1538 2838717179
1539 2838722210
1540 2838727928
1541 2838734158
1542 2838740792
1543 2838746610
1544 2840770494
1545 2841765320
1546 2841844633
1547 2841849586
1548 2841853301
1549 2841861373
1550 2842115677
1551 2842127666
1552 2842132808
1553 2842144298
1554 2842149329
1555 2842154801
1556 2842161614
1557 2842167172
1558 2842173300
1559 2842178422
1560 2842185585
1561 2842190287
1562 2842214601
1563 2842222134
1564 2842227320
1565 2842234244
1566 2842246545
1567 2842254034
1568 2842260595
1569 2842277402
1570 2842308793
1571 2842321401
1572 2842344138
1573 2842396498
1574 2842493263
1575 2842499167
1576 2842518360
1577 2842874979
1578 2844106930
1579 2844171010
1580 2844460977
1581 2844536146
1582 2851185917
1583 2851248970
1584 2855842107
1585 2857519300
1586 2857534947
1587 2857576405
1588 2858802781
1589 2891048986
1590 2899796416
1591 2899848482
1592 2899849959
1593 2915981240
1594 2915992261
1595 2915998621
1596 2916001432
1597 2916013551
1598 2916019477
1599 2916026812
1600 2916033066
1601 2916039251
1602 2916046471
1603 2916050532
1604 2916055921
1605 2916062101
1606 2916075780
1607 2916078118
1608 2917703238
1609 2919104733
1610 2919117437
1611 2919169083
1612 2921204204
1613 2921210333
1614 2921240448
1615 2921247700
1616 2921251746
1617 2921270224
1618 2921287245
1619 2921291997
1620 2924144952
1621 2924153684
1622 2924161567
1623 2924169452
1624 2924173515
1625 2924183339
1626 2924189637
1627 2924195123
1628 2924201565
1629 2924208177
1630 2924235249
1631 2926758884
1632 2926763605
1633 2926764982
1634 2929142344
1635 2929142667
1636 2929201140
1637 2933009816
1638 2933013987
1639 2933020108
1640 2933575077
1641 2933591644
1642 2933595772
1643 2935905882
1644 2936370303
1645 2936377970
1646 2937000815
1647 2937003962
1648 2937021767
1649 2937035728
1650 2937039391
1651 2937042960
1652 2937057487
1653 2937064599
1654 2937073290
1655 2937080790
1656 2937085356
1657 2937101784
1658 2937110876
1659 2937117575
1660 2937124407
1661 2937129506
1662 2937844451
1663 2941503250
1664 2941505845
1665 2957380597
1666 2957382621
1667 2957389401
1668 2957408423
1669 2957410122
1670 2957420010
1671 2957424821
1672 2957433626
1673 2957439948
1674 2957450672
1675 2957452212
1676 2957460391
1677 2957465583
1678 2957473369
1679 2957479013
1680 2957488854
1681 2957497886
1682 2957501795
1683 2957509948
1684 2960585178
1685 2960591903
1686 2960602002
1687 2960614762
1688 2960618097
1689 2960629997
1690 2960633925
1691 2960642632
1692 2960648287
1693 2960654834
1694 2960667227
1695 2960669960
1696 2960678590
1697 2960680711
1698 2960695004
1699 2964608533
1700 2964627224
1701 2964630843
1702 2964637738
1703 2964652672
1704 2964657273
1705 2964666314
1706 2964674908
1707 2964684272
1708 2964688075
1709 2964693887
1710 2964704749
1711 2964707043
1712 2964716490
1713 2964725709
1714 2967668395
1715 2967677372
1716 2967682172
1717 2967692198
1718 2967698956
1719 2967700124
1720 2967720489
1721 2967724424
1722 2967731017
1723 2967739966
1724 2967744488
1725 2967749410
1726 2967767235
1727 2967770472
1728 2967781160
1729 2970022800
1730 2970036081
1731 2970048368
1732 2970057230
1733 2970064706
1734 2970071090
1735 2970082522
1736 2970083603
1737 2970094169
1738 2970098371
1739 2970112165
1740 2970123437
1741 2970135953
1742 2970144824
1743 2970152651
1744 2970161370
1745 2970168377
1746 2970173757
1747 2970181006
1748 2970186854
1749 2970196047
1750 2977519413
1751 2977530505
1752 2977534453
1753 2977543235
1754 2977546476
1755 2977554846
1756 2977565189
1757 2977567050
1758 2977574400
1759 2979091356
1760 2979096880
1761 2979101452
1762 2984510598
1763 2984518699
1764 2984538947
1765 2984587019
1766 2984605641
1767 2989350082
1768 2996898759
1769 3005480543
1770 3007515059
1771 639651829
1772 648738810
1773 650741395
1774 650843074
1775 8003574221
1776 8003994549
1777 8004002234
1778 8005294280
1779 8005309996
1780 8005381979
1781 8005384396
1782 8005401408
1783 8005466929
1784 8005562219
1785 8005567016
1786 8005576612
1787 8018150634
1788 8018166018
1789 8023688177
1790 8024483831
1791 8024505954
1792 8054002677
1793 8055909901
1794 8056387007
1795 8057532504
1796 8057878574

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00528

BPD_transp_1

Binding-protein-dependent transport system inner membrane component

142

342

0.99

PF19300

BPD_transp_1_N

Binding-prot-dependent transport system membrane comp, N-term

30

131

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
3tuz-assembly2.cif.gz_F inward facing conformations of the metni methionine abc transporter: cy5 semet soak crystal form 0.8045 94 317
3dhw-assembly2.cif.gz_F crystal structure of methionine importer metni 0.7837 94 309
3tui-assembly2.cif.gz_E inward facing conformations of the metni methionine abc transporter: cy5 native crystal form 0.7769 92 317
3tuz-assembly2.cif.gz_F inward facing conformations of the metni methionine abc transporter: cy5 semet soak crystal form 0.7741 94 317
3dhw-assembly2.cif.gz_F crystal structure of methionine importer metni 0.7702 94 309
ID Description Score Start End Superfamily
af_Q2FYQ5_85_305_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9292 85 319 1.10.3720.10
af_Q2G1F7_265_478_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9216 89 313 1.10.3720.10
af_P0AFH2_84_300_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9206 89 315 1.10.3720.10
af_P33591_90_303_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9191 92 317 1.10.3720.10
af_Q2FZR7_83_297_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9186 89 315 1.10.3720.10
ID Description Score Start End GO Terms
AF-A0A7C4YU19-F1-model_v4 ABC transporter permease 0.9535 5 324 GO:0005886
GO:0055085
AF-A0A7C4YU19-F1-model_v4 ABC transporter permease 0.9449 5 324 GO:0005886
GO:0055085
AF-A0A2G6G778-F1-model_v4 Diguanylate cyclase 0.9332 2 321 GO:0005886
GO:0055085
AF-A0A1E4PC98-F1-model_v4 deleted 0.9307 1 324
AF-A0A2T9XRK3-F1-model_v4 Peptide ABC transporter permease 0.9282 1 321 GO:0005886
GO:0055085

Map