F485100
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 899 | 736 | 1798 | 235 |
Family's Representative Sequence
| Representative Sequence | 3300009093|Ga0105240_10287399|Ga0105240_102873992 |
| Length | 291 |
| Sequence | MEVCQFDVALNRRALSAKFIRLKTHMRTMRYDSIMPIPERLNPIFANSEPANLRLEQARQRLIIALDVPDAASAVALVDRLEGTCRWCKVGLELFVAAGPAIVEKLSKRGLSIFLDLKFHDIPNTVAGAVRSASALGAKMLTLHAAGGPAMLASAHDAVSQLSDPPQLLAVTVLTSMDKAQLGAVGVKREPGPQVKLLAEMGMAAGLRGFVCSPEEVAELRSLSGQEGVLVVPGIRPAGAAVGDQKRIATPASAIRDGASYLVVGRPISQASNAAAAADAIVHEIAEELSA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 2 | 3300000546 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled | Metagenome | Rhizosphere |
| 3 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 4 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 5 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 6 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 7 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 8 | 3300002739 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA | Metagenome | Endosphere |
| 9 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 10 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 11 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 12 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 13 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 14 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 15 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 16 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 17 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 18 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 19 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 20 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 21 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 22 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 23 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 24 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 25 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 26 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 27 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 28 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 34 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 36 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 37 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 38 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 39 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 40 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 41 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 42 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 43 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 44 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 45 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 46 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 47 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 48 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 49 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 50 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 51 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 52 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 56 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 57 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 58 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 59 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 60 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 61 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 62 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 64 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 65 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 66 | 3300022739 | Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules | Metagenome | Nodule |
| 67 | 3300022740 | Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules | Metagenome | Nodule |
| 68 | 3300025207 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 69 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 70 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 71 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 72 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 73 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 74 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 75 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 76 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 77 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 78 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 79 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 80 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 81 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 82 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 83 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 84 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 85 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 86 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 87 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 88 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 89 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 90 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 91 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 110 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 112 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 114 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 115 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 116 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 117 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 118 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 119 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 120 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 121 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 122 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 123 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 124 | 3300031967 | Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules | Metagenome | Nodule |
| 125 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 126 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 127 | 3300033430 | Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules | Metagenome | Nodule |
| 128 | 3300033464 | Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules | Metagenome | Nodule |
| 129 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 130 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 131 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 132 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 133 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 134 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 135 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 136 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 137 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 138 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 139 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 140 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 154 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 155 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 156 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 157 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 158 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 159 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 160 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 161 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 162 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 163 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 164 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 165 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 166 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 167 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 168 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 169 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 170 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 171 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 172 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 173 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 174 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 175 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 176 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 177 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 178 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 179 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 180 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 181 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 182 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 183 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 184 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 185 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 186 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 187 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 188 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 189 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 190 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 191 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 192 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 193 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 194 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 195 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 196 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 197 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 198 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 199 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 201 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 202 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 203 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 204 | 3300053155 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere | Metagenome | Endosphere |
| 205 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 206 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 207 | 3300059505 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 208 | 2503198000 | Mesorhizobium opportunistum WSM2075 | Isolate | Nodule |
| 209 | 2508501123 | Mesorhizobium sp. WSM3626 | Isolate | Nodule |
| 210 | 2508501127 | Mesorhizobium sp. WSM2561 | Isolate | Nodule |
| 211 | 2509276018 | Mesorhizobium ciceri CMG6 | Isolate | Nodule |
| 212 | 2509276022 | Mesorhizobium australicum WSM2073 | Isolate | Nodule |
| 213 | 2510065057 | Sinorhizobium meliloti WSM1022 | Isolate | Nodule |
| 214 | 2510065059 | Mesorhizobium ciceri WSM4083 | Isolate | Nodule |
| 215 | 2510917022 | Rhizobium sp. AP16 | Isolate | Rhizosphere |
| 216 | 2511231052 | Sinorhizobium meliloti AK58 | Isolate | Nodule |
| 217 | 2512875016 | Mesorhizobium japonicum R7A | Isolate | Nodule |
| 218 | 2512875024 | |||
| 219 | 2512875026 | Sinorhizobium medicae WSM1115 | Isolate | Nodule |
| 220 | 2513237086 | Sinorhizobium meliloti MVII-I | Isolate | Nodule |
| 221 | 2513237089 | Sinorhizobium medicae DI28 | Isolate | Nodule |
| 222 | 2513237090 | Mesorhizobium sp. WSM3224 | Isolate | Nodule |
| 223 | 2513237091 | Sinorhizobium meliloti RRI128 | Isolate | Nodule |
| 224 | 2513237138 | Rhizobium favelukesii OR191 | Isolate | Nodule |
| 225 | 2513237140 | Sinorhizobium meliloti GVPV12 | Isolate | Nodule |
| 226 | 2513237143 | Sinorhizobium meliloti Mlalz-1 | Isolate | Nodule |
| 227 | 2513237144 | Rhizobium sullae WSM1592 | Isolate | Nodule |
| 228 | 2513237146 | Rhizobium mongolense USDA 1844 (Illumina) | Isolate | Nodule |
| 229 | 2513237160 | Sinorhizobium medicae WSM244 | Isolate | Nodule |
| 230 | 2513237164 | Mesorhizobium loti CJ3sym | Isolate | Nodule |
| 231 | 2513237305 | Mesorhizobium amorphae CCNWGS0123 | Isolate | Nodule |
| 232 | 2515154107 | Sinorhizobium meliloti 4H41 | Isolate | Nodule |
| 233 | 2516653046 | Sinorhizobium meliloti BO21CC | Isolate | Nodule |
| 234 | 2517487022 | Sinorhizobium medicae WSM4191 | Isolate | Nodule |
| 235 | 2524023207 | Ensifer sp. USDA 6670 | Isolate | Nodule |
| 236 | 2524023209 | Rhizobium leucaenae USDA 9039 | Isolate | Nodule |
| 237 | 2534681796 | Rhizobium grahamii CCGE 502 | Isolate | Nodule |
| 238 | 2551306084 | Sinorhizobium meliloti 5A14 | Isolate | Nodule |
| 239 | 2551306085 | Sinorhizobium meliloti AE608H | Isolate | Nodule |
| 240 | 2551306089 | Sinorhizobium meliloti 1A42 | Isolate | Nodule |
| 241 | 2551306093 | Sinorhizobium meliloti C0438LL | Isolate | Nodule |
| 242 | 2582581283 | Rhizobium sp. OK665 | Isolate | Rhizosphere |
| 243 | 2582581307 | Rhizobium sp. YR060 | Isolate | Rhizosphere |
| 244 | 2582581315 | Agrobacterium rhizogenes YR147 | Isolate | Rhizosphere |
| 245 | 2582581316 | Agrobacterium rhizogenes OK036 | Isolate | Rhizosphere |
| 246 | 2582581865 | Rhizobium sp. CF258 | Isolate | Rhizosphere |
| 247 | 2582581867 | Rhizobium sp. OV201 | Isolate | Rhizosphere |
| 248 | 2585427527 | Rhizobium lusitanum YR374 | Isolate | Rhizosphere |
| 249 | 2585427530 | Rhizobium tropici YR635 | Isolate | Rhizosphere |
| 250 | 2585427531 | Agrobacterium rhizogenes YR530 | Isolate | Rhizosphere |
| 251 | 2585427590 | Rhizobium sp. CF048 | Isolate | Rhizosphere |
| 252 | 2585427608 | Agrobacterium rhizogenes OV677 | Isolate | Rhizosphere |
| 253 | 2585427609 | Agrobacterium rhizogenes CF263 | Isolate | Rhizosphere |
| 254 | 2585428125 | Agrobacterium rhizogenes CF262 | Isolate | Rhizosphere |
| 255 | 2588253730 | Mesorhizobium huakuii 7653R | Isolate | Rhizosphere |
| 256 | 2597489875 | Mesorhizobium ciceri ca181 | Isolate | Unclassified |
| 257 | 2599185170 | Rhizobium mongolense USDA 1844 (PacBio) | Isolate | Nodule |
| 258 | 2599185301 | Mesorhizobium sp. NFR06 | Isolate | Rhizoplane |
| 259 | 2599185352 | Sinorhizobium sp. NFACC03 | Isolate | Rhizoplane |
| 260 | 2615840698 | Rhizobium multihospitium HAMBI 2975 | Isolate | Nodule |
| 261 | 2617270742 | Rhizobium miluonense HAMBI 2971 | Isolate | Nodule |
| 262 | 2643221550 | Mesorhizobium sp. Root552 | Isolate | Unclassified |
| 263 | 2643221564 | Mesorhizobium sp. Root157 | Isolate | Unclassified |
| 264 | 2643221595 | Mesorhizobium sp. Root695 | Isolate | Unclassified |
| 265 | 2643221599 | Rhizobium sp. Root708 | Isolate | Unclassified |
| 266 | 2643221623 | Aminobacter sp. DSM 101952 Root100 | Isolate | Unclassified |
| 267 | 2643221626 | Ensifer sp. Root31 | Isolate | Unclassified |
| 268 | 2643221627 | Mesorhizobium sp. Root102 | Isolate | Unclassified |
| 269 | 2643221634 | Rhizobium sp. Root1203 | Isolate | Unclassified |
| 270 | 2643221655 | Ensifer sp. Root1252 | Isolate | Unclassified |
| 271 | 2643221659 | Ensifer sp. Root127 | Isolate | Unclassified |
| 272 | 2643221698 | Ensifer sp. Root142 | Isolate | Unclassified |
| 273 | 2643221712 | Ensifer sp. Root258 | Isolate | Unclassified |
| 274 | 2643221723 | Ensifer sp. Root278 | Isolate | Unclassified |
| 275 | 2667528174 | Rhizobium sp. NFR17 | Isolate | Rhizoplane |
| 276 | 2687453392 | Mesorhizobium ciceri biserrulae WSM1284 | Isolate | Unclassified |
| 277 | 2690316117 | Sinorhizobium fredii CCBAU 45436 | Isolate | Unclassified |
| 278 | 2693429783 | Mesorhizobium sp. LCM 4577 | Isolate | Rhizosphere |
| 279 | 2693429784 | Mesorhizobium sp. LCM 4576 | Isolate | Rhizosphere |
| 280 | 2721755686 | Mesorhizobium amorphae CCNWGS0123 | Isolate | Nodule |
| 281 | 2738541317 | Rhizobium halophytocola DSM 21600 | Isolate | Unclassified |
| 282 | 2738543024 | Aminobacter sp. AP02 | Isolate | Unclassified |
| 283 | 2756170246 | Mesorhizobium loti DSM 2626 | Isolate | Nodule |
| 284 | 2775506902 | Phyllobacterium zundukense Tri-48 | Isolate | Unclassified |
| 285 | 2775506904 | Phyllobacterium zundukense Tri-38 | Isolate | Unclassified |
| 286 | 2775507266 | Rhizobium tropici PRF 81 | Isolate | Nodule |
| 287 | 2791355082 | Ensifer alkalisoli YIC4027 | Isolate | Nodule |
| 288 | 2791355092 | Sinorhizobium sp. NG07B | Isolate | Nodule |
| 289 | 2791355123 | Mesorhizobium sophorae ICMP 19535 | Isolate | Unclassified |
| 290 | 2802428858 | Sinorhizobium medicae M14-1 | Isolate | Nodule |
| 291 | 2802428859 | Sinorhizobium medicae SF3.41 | Isolate | Nodule |
| 292 | 2802428860 | Sinorhizobium medicae M19-1 | Isolate | Nodule |
| 293 | 2802428861 | Sinorhizobium medicae USDA1037 | Isolate | Nodule |
| 294 | 2802428862 | Sinorhizobium medicae M7-4 | Isolate | Nodule |
| 295 | 2802428863 | Sinorhizobium medicae M26-2 | Isolate | Nodule |
| 296 | 2818991448 | Rhizobium miluonense 1234 | Isolate | Unclassified |
| 297 | 2818991453 | Rhizobium lusitanum 1158 | Isolate | Unclassified |
| 298 | 2838029111 | Rhizobium tropici SEMIA 4079 | Isolate | Nodule |
| 299 | 2838035591 | Rhizobium mongolense SEMIA 4087 | Isolate | Nodule |
| 300 | 2841734538 | Mesorhizobium sp. M6A.T.Cr.TU.016.01.1.1 | Isolate | Nodule |
| 301 | 2842298080 | Rhizobium leucaenae SEMIA 492 | Isolate | Nodule |
| 302 | 2842357229 | Rhizobium leucaenae SEMIA 4015 | Isolate | Nodule |
| 303 | 2842475841 | Rhizobium tropici SEMIA 4059 | Isolate | Nodule |
| 304 | 2842482326 | Rhizobium lusitanum SEMIA 4060 | Isolate | Nodule |
| 305 | 2842502639 | Rhizobium tropici SEMIA 4063 | Isolate | Nodule |
| 306 | 2842509118 | Rhizobium paranaense SEMIA 4064 | Isolate | Nodule |
| 307 | 2844002411 | Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 | Isolate | Nodule |
| 308 | 2844009547 | Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1 | Isolate | Nodule |
| 309 | 2844163670 | Ensifer sp. 1H6 | Isolate | Unclassified |
| 310 | 2847417321 | Sinorhizobium fredii CCBAU 45436 | Isolate | Unclassified |
| 311 | 2847670302 | Mesorhizobium sp. M3A.F.Ca.ET.080.04.2.1 | Isolate | Nodule |
| 312 | 2847686936 | Mesorhizobium sp. M1A.F.Ca.IN.022.06.1.1 | Isolate | Nodule |
| 313 | 2855825444 | Sinorhizobium meliloti CXM1-105 | Isolate | Nodule |
| 314 | 2855839649 | Sinorhizobium meliloti AK555 | Isolate | Unclassified |
| 315 | 2856314179 | Mesorhizobium sp. M3A.F.Ca.ET.175.01.1.1 | Isolate | Nodule |
| 316 | 2856320880 | Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1 | Isolate | Nodule |
| 317 | 2856328259 | Mesorhizobium sp. Primo-B | Isolate | Nodule |
| 318 | 2856334872 | Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 | Isolate | Nodule |
| 319 | 2856342000 | Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 | Isolate | Nodule |
| 320 | 2856349417 | Mesorhizobium sp. M4A.F.Ca.ET.090.04.2.1 | Isolate | Nodule |
| 321 | 2856356410 | Mesorhizobium sp. M4B.F.Ca.ET.088.02.2.1 | Isolate | Nodule |
| 322 | 2856364286 | Mesorhizobium sp. M00.F.Ca.ET.151.01.1.1 | Isolate | Nodule |
| 323 | 2857349434 | Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 | Isolate | Nodule |
| 324 | 2857367948 | Mesorhizobium sp. M7A.F.Ca.US.002.01.1.1 | Isolate | Nodule |
| 325 | 2858800743 | Sinorhizobium meliloti AK170 | Isolate | Unclassified |
| 326 | 2869162929 | Mesorhizobium sanjuanii BSA136 | Isolate | Nodule |
| 327 | 2869169390 | Mesorhizobium sp. M7A.F.Ca.CA.001.10.2.1 | Isolate | Nodule |
| 328 | 2869234852 | Mesorhizobium sp. M7A.T.Ca.US.000.02.2.1 | Isolate | Nodule |
| 329 | 2869249662 | Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1 | Isolate | Nodule |
| 330 | 2869256925 | Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 | Isolate | Nodule |
| 331 | 2869264136 | Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 | Isolate | Nodule |
| 332 | 2869271264 | Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 | Isolate | Nodule |
| 333 | 2869278585 | Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 | Isolate | Nodule |
| 334 | 2869285874 | Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 | Isolate | Nodule |
| 335 | 2871429161 | Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 | Isolate | Nodule |
| 336 | 2871435913 | Mesorhizobium sp. M7A.F.Ca.MR.228.00.0.0 | Isolate | Nodule |
| 337 | 2871451962 | Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 | Isolate | Nodule |
| 338 | 2871459585 | Mesorhizobium sp. M7A.F.Ca.CA.001.09.1.1 | Isolate | Nodule |
| 339 | 2871466892 | Mesorhizobium sp. M7D.F.Ca.US.004.01.2.1 | Isolate | Nodule |
| 340 | 2871474448 | Mesorhizobium sp. M6A.T.Cr.TU.017.01.1.1 | Isolate | Nodule |
| 341 | 2871481445 | Mesorhizobium sp. M7A.F.Ca.CA.004.02.1.1 | Isolate | Nodule |
| 342 | 2871488783 | Mesorhizobium sp. M4B.F.Ca.ET.203.01.1.1 | Isolate | Nodule |
| 343 | 2871495908 | Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 | Isolate | Nodule |
| 344 | 2874102143 | Mesorhizobium sp. M1A.F.Ca.IN.022.04.1.1 | Isolate | Nodule |
| 345 | 2874109183 | Mesorhizobium sp. M7A.T.Ca.TU.009.02.1.1 | Isolate | Nodule |
| 346 | 2874116593 | Mesorhizobium sp. M7A.F.Ca.CA.004.08.2.1 | Isolate | Nodule |
| 347 | 2874123672 | Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 | Isolate | Nodule |
| 348 | 2874131515 | Mesorhizobium sp. M7A.F.Ca.CA.001.05.1.1 | Isolate | Nodule |
| 349 | 2874139085 | Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 | Isolate | Nodule |
| 350 | 2874146452 | Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 | Isolate | Nodule |
| 351 | 2874155637 | Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 | Isolate | Nodule |
| 352 | 2874162495 | Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 | Isolate | Nodule |
| 353 | 2874168670 | Mesorhizobium kowhaii Ach-343 | Isolate | Nodule |
| 354 | 2876363079 | Mesorhizobium loti R7ANS::ICEMlSym2042 | Isolate | Nodule |
| 355 | 2876369609 | Mesorhizobium sp. USDA-HM6 | Isolate | Unclassified |
| 356 | 2876377896 | Mesorhizobium sp. M2C.T.Ca.TU.009.01.2.1 | Isolate | Nodule |
| 357 | 2876386047 | Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 | Isolate | Nodule |
| 358 | 2876392853 | Mesorhizobium sp. M1D.F.Ca.ET.234.01.1.1 | Isolate | Nodule |
| 359 | 2876399893 | Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 | Isolate | Nodule |
| 360 | 2876406927 | Mesorhizobium sp. M7A.F.Ca.CA.002.03.2.1 | Isolate | Nodule |
| 361 | 2876413966 | Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 | Isolate | Nodule |
| 362 | 2876420981 | Mesorhizobium sp. M7A.F.Ca.CA.004.08.1.1 | Isolate | Nodule |
| 363 | 2878035449 | Mesorhizobium sp. M3A.F.Ca.ET.201.01.1.1 | Isolate | Nodule |
| 364 | 2878738818 | Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 | Isolate | Nodule |
| 365 | 2878745973 | Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 | Isolate | Nodule |
| 366 | 2878753008 | Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1 | Isolate | Nodule |
| 367 | 2878760144 | Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 | Isolate | Nodule |
| 368 | 2878767105 | Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 | Isolate | Nodule |
| 369 | 2878774303 | Mesorhizobium sp. M7A.F.Ca.CA.002.15.1.1 | Isolate | Nodule |
| 370 | 2878781027 | Mesorhizobium sp. M7A.F.Ca.CA.001.12.2.1 | Isolate | Nodule |
| 371 | 2878788777 | Mesorhizobium sp. M6A.T.Ca.TU.002.02.2.1 | Isolate | Nodule |
| 372 | 2881147464 | Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 | Isolate | Nodule |
| 373 | 2881155292 | Mesorhizobium sp. M4B.F.Ca.ET.058.02.1.1 | Isolate | Nodule |
| 374 | 2881161766 | Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 | Isolate | Nodule |
| 375 | 2881845957 | Mesorhizobium sp. M4B.F.Ca.ET.019.03.1.1 | Isolate | Nodule |
| 376 | 2881853255 | Mesorhizobium sp. M4A.F.Ca.ET.020.02.1.1 | Isolate | Nodule |
| 377 | 2881861095 | Mesorhizobium sp. M4B.F.Ca.ET.049.02.1.2 | Isolate | Nodule |
| 378 | 2882632389 | Mesorhizobium waimense ICMP19557 | Isolate | Unclassified |
| 379 | 2882912400 | Mesorhizobium sp. M4B.F.Ca.ET.013.02.1.1 | Isolate | Nodule |
| 380 | 2885305155 | Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 | Isolate | Nodule |
| 381 | 2885312484 | Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 | Isolate | Nodule |
| 382 | 2885318864 | Mesorhizobium sp. M4B.F.Ca.ET.017.02.2.1 | Isolate | Nodule |
| 383 | 2885334103 | Mesorhizobium sp. M1E.F.Ca.ET.063.01.1.1 | Isolate | Nodule |
| 384 | 2885342637 | Mesorhizobium sp. M4A.F.Ca.ET.050.02.1.1 | Isolate | Nodule |
| 385 | 2885350715 | Mesorhizobium sp. M4A.F.Ca.ET.022.05.2.1 | Isolate | Nodule |
| 386 | 2888337043 | Mesorhizobium sp. M8A.F.Ca.ET.057.01.1.1 | Isolate | Nodule |
| 387 | 2888343758 | Mesorhizobium sp. AA22 | Isolate | Unclassified |
| 388 | 2888350351 | Mesorhizobium sp. M2A.F.Ca.ET.046.03.2.1 | Isolate | Nodule |
| 389 | 2889010040 | Mesorhizobium sp. M2A.F.Ca.ET.043.05.1.1 | Isolate | Nodule |
| 390 | 2889016732 | Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1 | Isolate | Nodule |
| 391 | 2903448605 | Mesorhizobium japonicum Opo-235 | Isolate | Nodule |
| 392 | 2903492973 | Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 | Isolate | Nodule |
| 393 | 2903513507 | Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.2 | Isolate | Nodule |
| 394 | 2903521522 | Mesorhizobium loti R7ANS::ICEMlSym2014 | Isolate | Nodule |
| 395 | 2903528002 | Mesorhizobium loti R7ANS::ICEMlSym2037 | Isolate | Nodule |
| 396 | 2903540706 | Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 | Isolate | Nodule |
| 397 | 2904659560 | Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1 | Isolate | Nodule |
| 398 | 2906308376 | Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 | Isolate | Nodule |
| 399 | 2906321335 | Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 | Isolate | Nodule |
| 400 | 2906328253 | Mesorhizobium sp. M1A.T.Ca.IN.004.03.1.1 | Isolate | Nodule |
| 401 | 2906354277 | Mesorhizobium sp. M2A.F.Ca.ET.040.01.1.1 | Isolate | Nodule |
| 402 | 2906363423 | Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1 | Isolate | Nodule |
| 403 | 2906370794 | Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1 | Isolate | Nodule |
| 404 | 2906378014 | Mesorhizobium sp. M7D.F.Ca.US.004.03.1.1 | Isolate | Nodule |
| 405 | 2906386501 | Mesorhizobium sp. M7A.F.Ca.CA.003.01.2.1 | Isolate | Nodule |
| 406 | 2906393657 | Mesorhizobium sp. M7A.F.Ca.CA.001.11.2.1 | Isolate | Nodule |
| 407 | 2906401398 | Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 | Isolate | Nodule |
| 408 | 2906408224 | Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 | Isolate | Nodule |
| 409 | 2906414383 | Mesorhizobium sp. M3A.F.Ca.ET.174.01.1.1 | Isolate | Nodule |
| 410 | 2906427513 | Mesorhizobium sp. M7A.F.Ca.CA.004.05.1.1 | Isolate | Nodule |
| 411 | 2913308742 | Rhizobium halophytocola DSM 21600 | Isolate | Unclassified |
| 412 | 2915980308 | Sinorhizobium medicae USDA1149 | Isolate | Nodule |
| 413 | 2915986958 | Sinorhizobium meliloti USDA1659 | Isolate | Nodule |
| 414 | 2915993759 | Sinorhizobium meliloti USDA1336 | Isolate | Nodule |
| 415 | 2916000859 | Sinorhizobium meliloti USDA1562 | Isolate | Nodule |
| 416 | 2916007675 | Sinorhizobium meliloti USDA1289 | Isolate | Nodule |
| 417 | 2916014648 | Sinorhizobium meliloti USDA1583 | Isolate | Nodule |
| 418 | 2916021584 | Sinorhizobium meliloti USDA1550 | Isolate | Nodule |
| 419 | 2916028427 | Sinorhizobium meliloti USDA1613 | Isolate | Nodule |
| 420 | 2916035215 | Sinorhizobium meliloti 3011 | Isolate | Nodule |
| 421 | 2916041962 | Sinorhizobium meliloti USDA1795 | Isolate | Nodule |
| 422 | 2916048683 | Sinorhizobium meliloti USDA1796 | Isolate | Nodule |
| 423 | 2916055098 | Sinorhizobium meliloti USDA1770 | Isolate | Nodule |
| 424 | 2916061851 | Sinorhizobium medicae USDA1638 | Isolate | Nodule |
| 425 | 2916068649 | Sinorhizobium meliloti USDA1220 | Isolate | Nodule |
| 426 | 2916076590 | Sinorhizobium meliloti USDA1661 | Isolate | Nodule |
| 427 | 2919408235 | Rhizobium miluonense 3199 | Isolate | Unclassified |
| 428 | 2921201388 | Sinorhizobium meliloti USDA1692 | Isolate | Nodule |
| 429 | 2921208531 | Sinorhizobium meliloti USDA1660 | Isolate | Nodule |
| 430 | 2921237296 | Sinorhizobium meliloti USDA1508 | Isolate | Nodule |
| 431 | 2921244191 | Sinorhizobium meliloti 2119 | Isolate | Nodule |
| 432 | 2921250672 | Sinorhizobium medicae USDA1169 | Isolate | Nodule |
| 433 | 2921257292 | Sinorhizobium meliloti USDA1320 | Isolate | Nodule |
| 434 | 2921263974 | Sinorhizobium meliloti USDA1107 | Isolate | Nodule |
| 435 | 2921282425 | Sinorhizobium meliloti USDA1203 | Isolate | Nodule |
| 436 | 2921289301 | Sinorhizobium meliloti USDA1730 | Isolate | Nodule |
| 437 | 2921296804 | Sinorhizobium meliloti USDA1200 | Isolate | Nodule |
| 438 | 2922130491 | Mesorhizobium sp. M00.F.Ca.ET.038.03.1.1 | Isolate | Nodule |
| 439 | 2922151315 | Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 | Isolate | Nodule |
| 440 | 2922158528 | Mesorhizobium sp. M1A.F.Ca.IN.022.05.2.1 | Isolate | Nodule |
| 441 | 2922172374 | Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 | Isolate | Nodule |
| 442 | 2922178524 | Mesorhizobium sp. M7A.F.Ca.CA.002.09.1.1 | Isolate | Nodule |
| 443 | 2922185730 | Mesorhizobium sp. M2A.F.Ca.ET.037.01.1.1 | Isolate | Nodule |
| 444 | 2923556063 | Rhizobium tibeticum 3740 | Isolate | Unclassified |
| 445 | 2924144063 | Sinorhizobium meliloti USDA1022 | Isolate | Nodule |
| 446 | 2924150972 | Sinorhizobium meliloti USDA1700 | Isolate | Nodule |
| 447 | 2924158325 | Sinorhizobium meliloti USDA1146 | Isolate | Nodule |
| 448 | 2924165586 | Sinorhizobium meliloti USDA1264 | Isolate | Nodule |
| 449 | 2924172951 | Sinorhizobium meliloti USDA1626 | Isolate | Nodule |
| 450 | 2924179722 | Sinorhizobium meliloti USDA1280 | Isolate | Nodule |
| 451 | 2924186466 | Sinorhizobium meliloti USDA1389 | Isolate | Nodule |
| 452 | 2924193448 | Sinorhizobium meliloti USDA1158 | Isolate | Nodule |
| 453 | 2924200457 | Sinorhizobium meliloti USDA1007 | Isolate | Nodule |
| 454 | 2924207177 | Sinorhizobium meliloti USDA1589 | Isolate | Nodule |
| 455 | 2924214083 | Sinorhizobium meliloti USDA1702 | Isolate | Nodule |
| 456 | 2924221636 | Sinorhizobium meliloti USDA1416 | Isolate | Nodule |
| 457 | 2924228884 | Sinorhizobium meliloti USDA1581 | Isolate | Nodule |
| 458 | 2924710171 | Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.2 | Isolate | Nodule |
| 459 | 2924718760 | Mesorhizobium sp. M8A.F.Ca.ET.023.01.1.1 | Isolate | Nodule |
| 460 | 2924726620 | Mesorhizobium sp. M1A.F.Ca.IN.020.03.2.1 | Isolate | Nodule |
| 461 | 2924733363 | Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 | Isolate | Nodule |
| 462 | 2924741084 | Mesorhizobium sp. M7A.F.Ca.CA.004.09.1.2 | Isolate | Nodule |
| 463 | 2924748358 | Mesorhizobium sp. M7A.F.Ca.CA.002.14.1.2 | Isolate | Nodule |
| 464 | 2924754689 | Mesorhizobium sp. M5C.F.Ca.IN.020.32.2.1 | Isolate | Nodule |
| 465 | 2924762789 | Mesorhizobium sp. WSM4303 | Isolate | Unclassified |
| 466 | 2924776078 | Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 | Isolate | Nodule |
| 467 | 2924784321 | Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 | Isolate | Nodule |
| 468 | 2936996657 | Sinorhizobium meliloti USDA1025 | Isolate | Nodule |
| 469 | 2937002841 | Sinorhizobium meliloti USDA1006 | Isolate | Nodule |
| 470 | 2937009748 | Sinorhizobium meliloti USDA1162 | Isolate | Nodule |
| 471 | 2937016420 | Sinorhizobium meliloti USDA1027 | Isolate | Nodule |
| 472 | 2937023124 | Sinorhizobium meliloti USDA1335 | Isolate | Nodule |
| 473 | 2937029754 | Sinorhizobium medicae USDA1624 | Isolate | Nodule |
| 474 | 2937036028 | Sinorhizobium medicae USDA1608 | Isolate | Nodule |
| 475 | 2937042894 | Sinorhizobium meliloti USDA1687 | Isolate | Nodule |
| 476 | 2937049772 | Sinorhizobium meliloti USDA1691 | Isolate | Nodule |
| 477 | 2937056579 | Sinorhizobium meliloti USDA1357 | Isolate | Nodule |
| 478 | 2937063883 | Sinorhizobium meliloti USDA1808 | Isolate | Nodule |
| 479 | 2937071275 | Sinorhizobium meliloti USDA1623 | Isolate | Nodule |
| 480 | 2937078374 | Sinorhizobium medicae USDA1004 | Isolate | Nodule |
| 481 | 2937084907 | Sinorhizobium medicae USDA1664 | Isolate | Nodule |
| 482 | 2937091812 | Sinorhizobium meliloti USDA1221 | Isolate | Nodule |
| 483 | 2937098957 | Sinorhizobium meliloti USDA1519 | Isolate | Nodule |
| 484 | 2937106411 | Sinorhizobium meliloti USDA1214 | Isolate | Nodule |
| 485 | 2937113482 | Sinorhizobium meliloti USDA1180 | Isolate | Nodule |
| 486 | 2937119839 | Sinorhizobium meliloti USDA1790 | Isolate | Nodule |
| 487 | 2937126314 | Sinorhizobium meliloti USDA1612 | Isolate | Nodule |
| 488 | 2937813078 | Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 | Isolate | Nodule |
| 489 | 2937822353 | Mesorhizobium neociceri CCANP35 | Isolate | Nodule |
| 490 | 2937848649 | Mesorhizobium sp. WSM4310 | Isolate | Unclassified |
| 491 | 2937861824 | Mesorhizobium sp. M7A.F.Ca.CA.001.07.2.1 | Isolate | Nodule |
| 492 | 2937868953 | Mesorhizobium sp. M7A.F.Ca.CA.001.13.2.1 | Isolate | Nodule |
| 493 | 2937877337 | Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 | Isolate | Nodule |
| 494 | 2937891427 | Mesorhizobium sp. M1A.F.Ca.IN.022.07.1.1 | Isolate | Nodule |
| 495 | 2937972304 | Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 | Isolate | Nodule |
| 496 | 2937994558 | Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 | Isolate | Nodule |
| 497 | 2957375807 | Sinorhizobium medicae USDA1632 | Isolate | Nodule |
| 498 | 2957382221 | Sinorhizobium meliloti USDA1919 | Isolate | Nodule |
| 499 | 2957388812 | Sinorhizobium meliloti USDA1195 | Isolate | Nodule |
| 500 | 2957395598 | Sinorhizobium meliloti USDA1237 | Isolate | Nodule |
| 501 | 2957402308 | Sinorhizobium meliloti USDA1794 | Isolate | Nodule |
| 502 | 2957408893 | Sinorhizobium meliloti USDA1163 | Isolate | Nodule |
| 503 | 2957415311 | Sinorhizobium meliloti USDA1724 | Isolate | Nodule |
| 504 | 2957422303 | Sinorhizobium meliloti USDA1497 | Isolate | Nodule |
| 505 | 2957430029 | Sinorhizobium meliloti USDA1590 | Isolate | Nodule |
| 506 | 2957437181 | Sinorhizobium medicae USDA1694 | Isolate | Nodule |
| 507 | 2957443900 | Sinorhizobium meliloti USDA1734 | Isolate | Nodule |
| 508 | 2957450854 | Sinorhizobium meliloti USDA1655 | Isolate | Nodule |
| 509 | 2957457609 | Sinorhizobium meliloti USDA1751 | Isolate | Nodule |
| 510 | 2957464669 | Sinorhizobium meliloti USDA1520 | Isolate | Nodule |
| 511 | 2957471148 | Sinorhizobium meliloti USDA1204 | Isolate | Nodule |
| 512 | 2957478035 | Sinorhizobium meliloti USDA1171 | Isolate | Nodule |
| 513 | 2957484790 | Sinorhizobium meliloti USDA1464 | Isolate | Nodule |
| 514 | 2957491536 | Sinorhizobium meliloti USDA1804 | Isolate | Nodule |
| 515 | 2957498199 | Sinorhizobium meliloti USDA1561 | Isolate | Nodule |
| 516 | 2957505466 | Sinorhizobium meliloti USDA1696 | Isolate | Nodule |
| 517 | 2958034702 | Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 | Isolate | Nodule |
| 518 | 2958041894 | Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 | Isolate | Nodule |
| 519 | 2958064165 | Mesorhizobium sp. SARCC-RB16n | Isolate | Unclassified |
| 520 | 2958071322 | Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 | Isolate | Nodule |
| 521 | 2958084443 | Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 | Isolate | Nodule |
| 522 | 2958100919 | Mesorhizobium sp. M2A.F.Ca.ET.015.02.1.1 | Isolate | Nodule |
| 523 | 2958115193 | Mesorhizobium sp. M00.F.Ca.ET.217.01.1.1 | Isolate | Nodule |
| 524 | 2958122699 | Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 | Isolate | Nodule |
| 525 | 2958130278 | Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 | Isolate | Nodule |
| 526 | 2958137437 | Mesorhizobium sp. M7A.F.Ca.CA.002.04.1.1 | Isolate | Nodule |
| 527 | 2958144490 | Mesorhizobium sp. M8A.F.Ca.ET.021.01.1.1 | Isolate | Nodule |
| 528 | 2958158011 | Mesorhizobium sp. M7A.F.Ca.CA.002.15.2.1 | Isolate | Nodule |
| 529 | 2958165035 | Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 | Isolate | Nodule |
| 530 | 2958172287 | Mesorhizobium sp. M2A.F.Ca.ET.029.05.1.1 | Isolate | Nodule |
| 531 | 2958179912 | Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 | Isolate | Nodule |
| 532 | 2960584000 | Sinorhizobium meliloti USDA1530 | Isolate | Nodule |
| 533 | 2960591022 | Sinorhizobium medicae USDA1066 | Isolate | Nodule |
| 534 | 2960597568 | Sinorhizobium meliloti 3085 | Isolate | Nodule |
| 535 | 2960603979 | Sinorhizobium meliloti USDA1580 | Isolate | Nodule |
| 536 | 2960610863 | Sinorhizobium meliloti USDA1792 | Isolate | Nodule |
| 537 | 2960617483 | Sinorhizobium meliloti USDA1719 | Isolate | Nodule |
| 538 | 2960624210 | Sinorhizobium meliloti USDA1415 | Isolate | Nodule |
| 539 | 2960631154 | Sinorhizobium medicae USDA1629 | Isolate | Nodule |
| 540 | 2960637947 | Sinorhizobium meliloti USDA1202 | Isolate | Nodule |
| 541 | 2960645483 | Sinorhizobium meliloti USDA1703 | Isolate | Nodule |
| 542 | 2960652885 | Sinorhizobium meliloti USDA1199 | Isolate | Nodule |
| 543 | 2960660292 | Sinorhizobium meliloti USDA1883 | Isolate | Nodule |
| 544 | 2960667422 | Sinorhizobium meliloti USDA1170 | Isolate | Nodule |
| 545 | 2960674078 | Sinorhizobium meliloti USDA1666 | Isolate | Nodule |
| 546 | 2960680706 | Sinorhizobium medicae USDA1150 | Isolate | Nodule |
| 547 | 2960687367 | Sinorhizobium meliloti USDA1462 | Isolate | Nodule |
| 548 | 2960693952 | Sinorhizobium medicae USDA1630 | Isolate | Nodule |
| 549 | 2961077736 | Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 | Isolate | Nodule |
| 550 | 2961114664 | Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 | Isolate | Nodule |
| 551 | 2961127735 | Mesorhizobium sp. M4A.F.Ca.ET.029.04.2.1 | Isolate | Nodule |
| 552 | 2961136820 | Mesorhizobium sp. M7A.F.Ca.AU.001.01.1.1 | Isolate | Nodule |
| 553 | 2961163497 | Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 | Isolate | Nodule |
| 554 | 2961170736 | Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 | Isolate | Nodule |
| 555 | 2961183825 | Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 | Isolate | Nodule |
| 556 | 2963644680 | Mesorhizobium japonicum R7A | Isolate | Nodule |
| 557 | 2964607997 | Sinorhizobium meliloti USDA1212 | Isolate | Nodule |
| 558 | 2964615318 | Sinorhizobium meliloti USDA1248 | Isolate | Nodule |
| 559 | 2964621998 | Sinorhizobium meliloti USDA1235 | Isolate | Nodule |
| 560 | 2964628898 | Sinorhizobium meliloti USDA1191 | Isolate | Nodule |
| 561 | 2964636051 | Sinorhizobium meliloti USDA1594 | Isolate | Nodule |
| 562 | 2964643177 | Sinorhizobium meliloti USDA1760 | Isolate | Nodule |
| 563 | 2964649959 | Sinorhizobium meliloti USDA1591 | Isolate | Nodule |
| 564 | 2964656573 | Sinorhizobium meliloti USDA1308 | Isolate | Nodule |
| 565 | 2964663802 | Sinorhizobium meliloti USDA1688 | Isolate | Nodule |
| 566 | 2964670856 | Sinorhizobium meliloti USDA1211 | Isolate | Nodule |
| 567 | 2964678106 | Sinorhizobium meliloti USDA1210 | Isolate | Nodule |
| 568 | 2964685014 | Sinorhizobium meliloti USDA1232 | Isolate | Nodule |
| 569 | 2964691889 | Sinorhizobium meliloti USDA1379 | Isolate | Nodule |
| 570 | 2964698721 | Sinorhizobium meliloti USDA1656 | Isolate | Nodule |
| 571 | 2964705432 | Sinorhizobium meliloti USDA1614 | Isolate | Nodule |
| 572 | 2964712639 | Sinorhizobium meliloti USDA1616 | Isolate | Nodule |
| 573 | 2964719344 | Sinorhizobium meliloti USDA1456 | Isolate | Nodule |
| 574 | 2965018300 | Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 | Isolate | Nodule |
| 575 | 2965025482 | Mesorhizobium sp. Primo-A | Isolate | Nodule |
| 576 | 2965032056 | Mesorhizobium sp. M7A.F.Ca.US.006.04.2.1 | Isolate | Nodule |
| 577 | 2965040258 | Mesorhizobium sp. M7A.F.Ca.CA.001.06.1.1 | Isolate | Nodule |
| 578 | 2965047637 | Mesorhizobium sp. M7A.F.Ca.US.014.04.1.1 | Isolate | Nodule |
| 579 | 2965062239 | Mesorhizobium sp. M1A.F.Ca.ET.072.01.1.1 | Isolate | Nodule |
| 580 | 2965089291 | Mesorhizobium sp. M7A.F.Ca.CA.001.04.1.1 | Isolate | Nodule |
| 581 | 2965102966 | Mesorhizobium sp. M7A.F.Ca.AU.002.02.1.1 | Isolate | Nodule |
| 582 | 2965110997 | Mesorhizobium sp. M7A.F.Ca.US.003.02.2.1 | Isolate | Nodule |
| 583 | 2965119406 | Mesorhizobium sp. M2A.F.Ca.ET.067.02.1.1 | Isolate | Nodule |
| 584 | 2967664464 | Sinorhizobium meliloti USDA1208 | Isolate | Nodule |
| 585 | 2967671571 | Sinorhizobium meliloti USDA1496 | Isolate | Nodule |
| 586 | 2967678726 | Sinorhizobium meliloti USDA1467 | Isolate | Nodule |
| 587 | 2967686174 | Sinorhizobium medicae USDA1641 | Isolate | Nodule |
| 588 | 2967693043 | Sinorhizobium meliloti USDA1183 | Isolate | Nodule |
| 589 | 2967699805 | Sinorhizobium meliloti USDA1695 | Isolate | Nodule |
| 590 | 2967706974 | Sinorhizobium meliloti USDA1206 | Isolate | Nodule |
| 591 | 2967714385 | Sinorhizobium meliloti USDA1023 | Isolate | Nodule |
| 592 | 2967721400 | Sinorhizobium meliloti USDA1742 | Isolate | Nodule |
| 593 | 2967728569 | Sinorhizobium medicae USDA1607 | Isolate | Nodule |
| 594 | 2967735183 | Sinorhizobium meliloti USDA1710 | Isolate | Nodule |
| 595 | 2967742019 | Sinorhizobium meliloti USDA1676 | Isolate | Nodule |
| 596 | 2967748971 | Sinorhizobium meliloti USDA1024A | Isolate | Nodule |
| 597 | 2967755722 | Sinorhizobium meliloti USDA1302 | Isolate | Nodule |
| 598 | 2967762386 | Sinorhizobium meliloti USDA1397 | Isolate | Nodule |
| 599 | 2967769361 | Sinorhizobium meliloti USDA1005 | Isolate | Nodule |
| 600 | 2967775926 | Sinorhizobium meliloti USDA1678 | Isolate | Nodule |
| 601 | 2967996073 | Mesorhizobium sp. M4B.F.Ca.ET.169.01.1.1 | Isolate | Nodule |
| 602 | 2968003550 | Mesorhizobium sp. M4B.F.Ca.ET.215.01.1.1 | Isolate | Nodule |
| 603 | 2968016561 | Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 | Isolate | Nodule |
| 604 | 2968083720 | Mesorhizobium erdmanii Opo-242 | Isolate | Unclassified |
| 605 | 2968091066 | Mesorhizobium sp. AA23 | Isolate | Unclassified |
| 606 | 2968097103 | Mesorhizobium sp. M1A.F.Ca.IN.020.30.1.1 | Isolate | Nodule |
| 607 | 2968110612 | Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 | Isolate | Nodule |
| 608 | 2968117919 | Mesorhizobium atlanticum CNPSo 3140 | Isolate | Unclassified |
| 609 | 2968128360 | Mesorhizobium sp. WSM3873 | Isolate | Unclassified |
| 610 | 2968138860 | Mesorhizobium sp. M7A.F.Ca.ET.027.03.2.1 | Isolate | Nodule |
| 611 | 2968171901 | Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 | Isolate | Nodule |
| 612 | 2970019648 | Sinorhizobium meliloti USDA1603 | Isolate | Nodule |
| 613 | 2970026789 | Sinorhizobium medicae USDA1611 | Isolate | Nodule |
| 614 | 2970040964 | Sinorhizobium meliloti USDA1501 | Isolate | Nodule |
| 615 | 2970047711 | Sinorhizobium meliloti USDA1793 | Isolate | Nodule |
| 616 | 2970054988 | Sinorhizobium meliloti USDA1031 | Isolate | Nodule |
| 617 | 2970061556 | Sinorhizobium meliloti USDA1810 | Isolate | Nodule |
| 618 | 2970076120 | Sinorhizobium meliloti USDA1706 | Isolate | Nodule |
| 619 | 2970082768 | Sinorhizobium meliloti USDA1803 | Isolate | Nodule |
| 620 | 2970088815 | Sinorhizobium meliloti USDA1819 | Isolate | Nodule |
| 621 | 2970095765 | Sinorhizobium meliloti USDA1225 | Isolate | Nodule |
| 622 | 2970102677 | Sinorhizobium meliloti USDA1325 | Isolate | Nodule |
| 623 | 2970109326 | Sinorhizobium meliloti USDA1186 | Isolate | Nodule |
| 624 | 2970116247 | Sinorhizobium meliloti USDA1566 | Isolate | Nodule |
| 625 | 2970122695 | Sinorhizobium medicae 3082 | Isolate | Nodule |
| 626 | 2970129317 | Sinorhizobium meliloti USDA1008 | Isolate | Nodule |
| 627 | 2970136068 | Sinorhizobium meliloti USDA1699 | Isolate | Nodule |
| 628 | 2970143518 | Sinorhizobium medicae USDA1652 | Isolate | Nodule |
| 629 | 2970149975 | Sinorhizobium meliloti USDA1215 | Isolate | Nodule |
| 630 | 2970156795 | Sinorhizobium meliloti USDA1491 | Isolate | Nodule |
| 631 | 2970164137 | Sinorhizobium meliloti USDA1018 | Isolate | Nodule |
| 632 | 2970170962 | Sinorhizobium meliloti USDA1571 | Isolate | Nodule |
| 633 | 2970177841 | Sinorhizobium meliloti USDA1533 | Isolate | Nodule |
| 634 | 2970184632 | Sinorhizobium meliloti USDA1593 | Isolate | Nodule |
| 635 | 2970191845 | Sinorhizobium meliloti USDA1187 | Isolate | Nodule |
| 636 | 2970469710 | Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 | Isolate | Nodule |
| 637 | 2970489779 | Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 | Isolate | Nodule |
| 638 | 2970503327 | Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 | Isolate | Nodule |
| 639 | 2970510686 | Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 | Isolate | Nodule |
| 640 | 2970524798 | Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1 | Isolate | Nodule |
| 641 | 2970532167 | Mesorhizobium sp. M7A.F.Ca.CA.002.05.1.1 | Isolate | Nodule |
| 642 | 2970547951 | Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 | Isolate | Nodule |
| 643 | 2970554993 | Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 | Isolate | Nodule |
| 644 | 2970593180 | Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 | Isolate | Nodule |
| 645 | 2970619444 | Mesorhizobium sp. M7A.F.Ca.ET.027.02.1.1 | Isolate | Nodule |
| 646 | 2970627176 | Mesorhizobium sp. M7A.F.Ca.US.006.01.2.1 | Isolate | Nodule |
| 647 | 2977516862 | Sinorhizobium meliloti USDA1791 | Isolate | Nodule |
| 648 | 2977523885 | Sinorhizobium meliloti USDA1777 | Isolate | Nodule |
| 649 | 2977530762 | Sinorhizobium medicae USDA1606 | Isolate | Nodule |
| 650 | 2977537788 | Sinorhizobium meliloti USDA1184 | Isolate | Nodule |
| 651 | 2977544691 | Sinorhizobium medicae USDA1631 | Isolate | Nodule |
| 652 | 2977551784 | Sinorhizobium meliloti USDA1035 | Isolate | Nodule |
| 653 | 2977558990 | Sinorhizobium meliloti USDA1222 | Isolate | Nodule |
| 654 | 2977565890 | Sinorhizobium meliloti USDA1617 | Isolate | Nodule |
| 655 | 2977572785 | Sinorhizobium meliloti USDA1767 | Isolate | Nodule |
| 656 | 2977579622 | Sinorhizobium meliloti USDA1161 | Isolate | Nodule |
| 657 | 2977821940 | Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1 | Isolate | Nodule |
| 658 | 2977828996 | Mesorhizobium sp. M4B.F.Ca.ET.089.01.1.1 | Isolate | Nodule |
| 659 | 2977843712 | Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 | Isolate | Nodule |
| 660 | 2977851361 | Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 | Isolate | Nodule |
| 661 | 2977858184 | Mesorhizobium sp. M1A.F.Ca.IN.020.03.1.1 | Isolate | Nodule |
| 662 | 2977864932 | Mesorhizobium tamadayense DSM 28320 | Isolate | Nodule |
| 663 | 2977872689 | Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 | Isolate | Nodule |
| 664 | 2977898635 | Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.1 | Isolate | Nodule |
| 665 | 2977907340 | Mesorhizobium sp. M7A.F.Ca.CA.004.12.1.1 | Isolate | Nodule |
| 666 | 2977915119 | Mesorhizobium sp. M7A.F.Ca.CA.001.09.2.1 | Isolate | Nodule |
| 667 | 2977922695 | Mesorhizobium sp. WSM4305 | Isolate | Unclassified |
| 668 | 2977935797 | Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 | Isolate | Nodule |
| 669 | 2977942078 | Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 | Isolate | Nodule |
| 670 | 2977950692 | Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 | Isolate | Nodule |
| 671 | 2977957713 | Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1 | Isolate | Nodule |
| 672 | 2977971508 | Mesorhizobium sp. M2A.F.Ca.ET.039.01.1.1 | Isolate | Nodule |
| 673 | 2977986579 | Mesorhizobium intechi BD68 | Isolate | Unclassified |
| 674 | 2979710463 | Mesorhizobium sp. M2A.F.Ca.ET.017.03.2.1 | Isolate | Nodule |
| 675 | 2979742915 | Mesorhizobium sp. M2A.F.Ca.ET.046.02.1.1 | Isolate | Nodule |
| 676 | 2979764755 | Mesorhizobium sp. M7A.F.Ca.CA.004.05.2.1 | Isolate | Nodule |
| 677 | 2979779861 | Mesorhizobium sp. M1A.F.Ca.IN.022.02.1.1 | Isolate | Nodule |
| 678 | 2979793036 | Mesorhizobium sp. M7A.F.Ca.US.007.01.1.1 | Isolate | Nodule |
| 679 | 2979808191 | Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 | Isolate | Nodule |
| 680 | 2987636660 | Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 | Isolate | Nodule |
| 681 | 2987645492 | Mesorhizobium sp. M7A.F.Ca.CA.002.10.1.1 | Isolate | Nodule |
| 682 | 2987652177 | Mesorhizobium sp. M2A.F.Ca.ET.042.01.1.1 | Isolate | Nodule |
| 683 | 2987659509 | Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 | Isolate | Nodule |
| 684 | 2987666974 | Mesorhizobium sp. WSM4306 | Isolate | Unclassified |
| 685 | 2987673487 | Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1 | Isolate | Nodule |
| 686 | 2996310559 | Mesorhizobium zhangyense CGMCC 1.15528 | Isolate | Unclassified |
| 687 | 2996336353 | Mesorhizobium sp. YM1C-6-2 | Isolate | Unclassified |
| 688 | 2996341866 | Mesorhizobium sp. M1A.F.Ca.IN.020.32.1.1 | Isolate | Nodule |
| 689 | 2996348954 | Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 | Isolate | Nodule |
| 690 | 2996386984 | Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 | Isolate | Nodule |
| 691 | 2996887358 | Rhizobium sp. R711 | Isolate | Nodule |
| 692 | 3000135777 | Unclassified bacterium M00.F.Ca.ET.205.01.1.1 | Isolate | Unclassified |
| 693 | 3004167301 | Mesorhizobium loti 582 | Isolate | Unclassified |
| 694 | 3004188549 | Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 | Isolate | Nodule |
| 695 | 3004195979 | Mesorhizobium sp. M7A.F.Ca.CA.001.08.2.1 | Isolate | Nodule |
| 696 | 3004203850 | Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 | Isolate | Nodule |
| 697 | 3004211236 | Mesorhizobium sp. WSM4307 | Isolate | Unclassified |
| 698 | 3004218560 | Mesorhizobium sp. WSM4315 | Isolate | Unclassified |
| 699 | 3004232784 | Mesorhizobium sp. M7A.T.Ca.US.000.02.1.1 | Isolate | Nodule |
| 700 | 3004239961 | Mesorhizobium sp. M7A.F.Ca.US.005.03.2.1 | Isolate | Nodule |
| 701 | 3004248173 | Mesorhizobium sp. M7A.F.Ca.CA.004.06.1.1 | Isolate | Nodule |
| 702 | 3004268573 | Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1 | Isolate | Nodule |
| 703 | 3004275668 | Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 | Isolate | Nodule |
| 704 | 3004334049 | Mesorhizobium huakuii 583 | Isolate | Unclassified |
| 705 | 3005409236 | Rhizobium sp. P32RR-XVIII | Isolate | Rhizosphere |
| 706 | 3005416602 | Rhizobium sp. P40RR-XXII | Isolate | Rhizosphere |
| 707 | 3005452660 | Rhizobium grahamii BG7 | Isolate | Unclassified |
| 708 | 637000159 | Mesorhizobium japonicum MAFF 303099 | Isolate | Unclassified |
| 709 | 648276728 | Sinorhizobium meliloti BL225C | Isolate | Nodule |
| 710 | 649633066 | Mesorhizobium ciceri bv. biserrulae WSM1271 | Isolate | Nodule |
| 711 | 8002285264 | Aminobacter anthyllidis LMG 26462 | Isolate | Nodule |
| 712 | 8003992118 | Sinorhizobium meliloti RRI128 | Isolate | Nodule |
| 713 | 8003999396 | Sinorhizobium medicae WSM1115 | Isolate | Nodule |
| 714 | 8004300914 | Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 | Isolate | Nodule |
| 715 | 8004312739 | Mesorhizobium sp. M7A.F.Ca.MR.362.00.0.0 | Isolate | Nodule |
| 716 | 8004361976 | Mesorhizobium sp. M7A.F.Ca.CA.001.08.1.1 | Isolate | Nodule |
| 717 | 8004374579 | Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1 | Isolate | Nodule |
| 718 | 8004387939 | Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 | Isolate | Nodule |
| 719 | 8004445564 | Mesorhizobium sp. M1A.F.Ca.IN.020.04.1.1 | Isolate | Nodule |
| 720 | 8004640170 | Mesorhizobium sp. GbtcB19 | Isolate | Unclassified |
| 721 | 8004695233 | Mesorhizobium sp. M7A.F.Ca.US.001.01.1.1 | Isolate | Nodule |
| 722 | 8004703790 | Mesorhizobium sp. M00.F.Ca.ET.158.01.1.1 | Isolate | Nodule |
| 723 | 8004714634 | Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 | Isolate | Nodule |
| 724 | 8004727605 | Mesorhizobium sp. M7A.F.Ca.CA.004.01.1.1 | Isolate | Nodule |
| 725 | 8005314921 | Rhizobium sp. P28RR-XV | Isolate | Rhizosphere |
| 726 | 8005321885 | Rhizobium sp. R72 | Isolate | Nodule |
| 727 | 8005484373 | Rhizobium tropici SARCC-755 | Isolate | Nodule |
| 728 | 8005542996 | Rhizobium grahamii CCGM3 | Isolate | Unclassified |
| 729 | 8005645114 | Rhizobium tropici IGFRI Rhizo-19 | Isolate | Rhizosphere |
| 730 | 8005658619 | Rhizobium terrae CC-HIH110 | Isolate | Unclassified |
| 731 | 8005682033 | Rhizobium dioscoreae S-93 | Isolate | Unclassified |
| 732 | 8018150411 | Rhizobium straminoryzae SM12 | Isolate | Rhizosphere |
| 733 | 8046767195 | Rhizobium calliandrae CCGE524 | Isolate | Unclassified |
| 734 | 8049293176 | Ensifer alkalisoli YIC4027 | Isolate | Nodule |
| 735 | 8055617313 | Mesorhizobium onobrychidis OM4 | Isolate | Nodule |
| 736 | 8057575449 | Rhizobium mayense CCGE526 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 40.71 |
| Metatranscriptomes | 0.11 |
| Isolates | 59.18 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 10.46 |
| Nodule | 51.06 |
| Rhizoplane | 1.11 |
| Rhizosphere | 28.92 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0105240_10287399 | 3300009093 | Bacteria | 1887 |
| 2 | LJNas_1000120 | 3300000546 | Bacteria | 12289 |
| 3 | JGI24740J21852_10003637 | 3300001979 | Bacteria | 6723 |
| 4 | JGI24739J22299_10028216 | 3300001989 | Bacteria | 1958 |
| 5 | JGI24735J21928_10019579 | 3300002067 | Bacteria | 2079 |
| 6 | JGI25156J39149_1013450 | 3300002705 | Bacteria | 1734 |
| 7 | JGI25162J39368_1000244 | 3300002737 | Bacteria | 54424 |
| 8 | JGI25162J39368_1000493 | 3300002737 | Bacteria | 29984 |
| 9 | JGI25158J39367_1000756 | 3300002739 | Bacteria | 6197 |
| 10 | JGI25157J39369_1000555 | 3300002741 | Bacteria | 22318 |
| 11 | JGI25152J39213_1004107 | 3300002773 | Bacteria | 4706 |
| 12 | JGI25159J45721_1000015 | 3300002987 | Bacteria | 142431 |
| 13 | JGI25159J45721_1000338 | 3300002987 | Bacteria | 21677 |
| 14 | JGI25151J46595_10033099 | 3300003187 | Bacteria | 1996 |
| 15 | JGI25406J46586_10006406 | 3300003203 | Bacteria | 5426 |
| 16 | JGI25165J46597_1000079 | 3300003214 | Bacteria | 179163 |
| 17 | JGI25165J46597_1000553 | 3300003214 | Bacteria | 34037 |
| 18 | JGI25165J46597_1000796 | 3300003214 | Bacteria | 23932 |
| 19 | rootH2_10027501 | 3300003320 | Bacteria | 5291 |
| 20 | rootH1_10271729 | 3300003323 | Bacteria | 1405 |
| 21 | JGI25160J50197_1000003 | 3300003354 | Bacteria | 482719 |
| 22 | JGI25160J50197_1000012 | 3300003354 | Bacteria | 267582 |
| 23 | JGI25161J50226_1000002 | 3300003374 | Bacteria | 420324 |
| 24 | JGI25161J50226_1000219 | 3300003374 | Bacteria | 35426 |
| 25 | Ga0055542_1000618 | 3300003762 | Bacteria | 30135 |
| 26 | Ga0055542_1001408 | 3300003762 | Bacteria | 12130 |
| 27 | Ga0055529_1003209 | 3300003763 | Bacteria | 2793 |
| 28 | Ga0055526_1003824 | 3300003771 | Bacteria | 9358 |
| 29 | Ga0055536_1005156 | 3300003781 | Bacteria | 6460 |
| 30 | Ga0055528_1021666 | 3300003790 | Bacteria | 2029 |
| 31 | Ga0055540_1008648 | 3300003792 | Bacteria | 3639 |
| 32 | Ga0055531_10011294 | 3300003794 | Bacteria | 4327 |
| 33 | Ga0055543_1000011 | 3300004625 | Bacteria | 196089 |
| 34 | Ga0055543_1000034 | 3300004625 | Bacteria | 128668 |
| 35 | Ga0065165_1000025 | 3300005262 | Bacteria | 246909 |
| 36 | Ga0065165_1000082 | 3300005262 | Bacteria | 158536 |
| 37 | Ga0070658_10085777 | 3300005327 | Bacteria | 2590 |
| 38 | Ga0070660_100079572 | 3300005339 | Bacteria | 2571 |
| 39 | Ga0070660_100209391 | 3300005339 | Bacteria | 1582 |
| 40 | Ga0070668_100006252 | 3300005347 | Bacteria | 8821 |
| 41 | Ga0070671_100130795 | 3300005355 | Bacteria | 2114 |
| 42 | Ga0070663_100068052 | 3300005455 | Bacteria | 2585 |
| 43 | Ga0068853_100328096 | 3300005539 | Bacteria | 1420 |
| 44 | Ga0070665_100028010 | 3300005548 | Bacteria | 5675 |
| 45 | Ga0070665_100052306 | 3300005548 | Bacteria | 4097 |
| 46 | Ga0070665_100079272 | 3300005548 | Bacteria | 3290 |
| 47 | Ga0070665_100112308 | 3300005548 | Bacteria | 2727 |
| 48 | Ga0070665_100270158 | 3300005548 | Bacteria | 1702 |
| 49 | Ga0070665_100303155 | 3300005548 | Bacteria | 1600 |
| 50 | Ga0070665_100628597 | 3300005548 | Bacteria | 1087 |
| 51 | Ga0068855_100008160 | 3300005563 | Bacteria | 12659 |
| 52 | Ga0068855_100310359 | 3300005563 | Bacteria | 1745 |
| 53 | Ga0068855_100463947 | 3300005563 | Bacteria | 1381 |
| 54 | Ga0068857_100206963 | 3300005577 | Bacteria | 1790 |
| 55 | Ga0068854_100100728 | 3300005578 | Bacteria | 2166 |
| 56 | Ga0068856_100976370 | 3300005614 | Bacteria | 865 |
| 57 | Ga0068852_100191337 | 3300005616 | Bacteria | 1931 |
| 58 | Ga0081540_1009710 | 3300005983 | Bacteria | 6604 |
| 59 | Ga0081539_10002395 | 3300005985 | Bacteria | 26644 |
| 60 | Ga0075365_10014555 | 3300006038 | Bacteria | 4736 |
| 61 | Ga0075365_10154229 | 3300006038 | Bacteria | 1598 |
| 62 | Ga0075365_10180082 | 3300006038 | Bacteria | 1477 |
| 63 | Ga0075368_10016651 | 3300006042 | Bacteria | 2741 |
| 64 | Ga0075364_10270979 | 3300006051 | Bacteria | 1155 |
| 65 | Ga0075362_10034225 | 3300006177 | Bacteria | 2213 |
| 66 | Ga0075367_10002953 | 3300006178 | Bacteria | 7945 |
| 67 | Ga0075367_10099335 | 3300006178 | Bacteria | 1778 |
| 68 | Ga0075367_10299299 | 3300006178 | Bacteria | 1012 |
| 69 | Ga0075367_10371192 | 3300006178 | Bacteria | 904 |
| 70 | Ga0075370_10147872 | 3300006353 | Bacteria | 1376 |
| 71 | Ga0075370_10294165 | 3300006353 | Bacteria | 965 |
| 72 | Ga0068871_100538950 | 3300006358 | Bacteria | 1056 |
| 73 | Ga0079104_1002459 | 3300006946 | Bacteria | 9964 |
| 74 | Ga0079104_1006003 | 3300006946 | Bacteria | 4704 |
| 75 | Ga0105251_10009293 | 3300009011 | Bacteria | 5819 |
| 76 | Ga0105240_10249534 | 3300009093 | Bacteria | 2053 |
| 77 | Ga0105247_10172516 | 3300009101 | Bacteria | 1439 |
| 78 | Ga0105248_10012216 | 3300009177 | Bacteria | 9469 |
| 79 | Ga0105237_10038673 | 3300009545 | Bacteria | 4817 |
| 80 | Ga0105237_10540323 | 3300009545 | Bacteria | 1172 |
| 81 | Ga0105237_10851545 | 3300009545 | Bacteria | 918 |
| 82 | Ga0105238_10040306 | 3300009551 | Bacteria | 4733 |
| 83 | Ga0105239_10127612 | 3300010375 | Bacteria | 2828 |
| 84 | Ga0157370_10064885 | 3300013104 | Bacteria | 3455 |
| 85 | Ga0157370_10593368 | 3300013104 | Bacteria | 1014 |
| 86 | Ga0157369_10006251 | 3300013105 | Bacteria | 13822 |
| 87 | Ga0157369_10021348 | 3300013105 | Bacteria | 7241 |
| 88 | Ga0157369_10059190 | 3300013105 | Bacteria | 4131 |
| 89 | Ga0157374_10014300 | 3300013296 | Bacteria | 6945 |
| 90 | Ga0157372_10022080 | 3300013307 | Bacteria | 6883 |
| 91 | Ga0157372_10356875 | 3300013307 | Bacteria | 1703 |
| 92 | Ga0163163_10029885 | 3300014325 | Bacteria | 5244 |
| 93 | Ga0163163_10220505 | 3300014325 | Bacteria | 1945 |
| 94 | Ga0182008_10042226 | 3300014497 | Bacteria | 2272 |
| 95 | Ga0157376_10037849 | 3300014969 | Bacteria | 3921 |
| 96 | Ga0182006_1047427 | 3300015261 | Bacteria | 1665 |
| 97 | Ga0182007_10004110 | 3300015262 | Bacteria | 6690 |
| 98 | Ga0182005_1007445 | 3300015265 | Bacteria | 3283 |
| 99 | Ga0228711_1003057 | 3300022739 | Bacteria | 25943 |
| 100 | Ga0228710_1000004 | 3300022740 | Bacteria | 250560 |
| 101 | Ga0209760_101730 | 3300025207 | Bacteria | 2200 |
| 102 | Ga0209436_100767 | 3300025208 | Bacteria | 13307 |
| 103 | Ga0209436_115828 | 3300025208 | Bacteria | 1151 |
| 104 | Ga0209563_105661 | 3300025230 | Bacteria | 2234 |
| 105 | Ga0209437_100050 | 3300025233 | Bacteria | 394010 |
| 106 | Ga0209437_100056 | 3300025233 | Bacteria | 363071 |
| 107 | Ga0209437_107127 | 3300025233 | Bacteria | 1833 |
| 108 | Ga0207425_1014638 | 3300025245 | Bacteria | 1777 |
| 109 | Ga0209026_1000118 | 3300025250 | Bacteria | 130611 |
| 110 | Ga0209677_102979 | 3300025253 | Bacteria | 5879 |
| 111 | Ga0209148_1000212 | 3300025254 | Bacteria | 101454 |
| 112 | Ga0209148_1005894 | 3300025254 | Bacteria | 2729 |
| 113 | Ga0209759_1000076 | 3300025256 | Bacteria | 175911 |
| 114 | Ga0209129_1001420 | 3300025258 | Bacteria | 13383 |
| 115 | Ga0209233_1000037 | 3300025261 | Bacteria | 554620 |
| 116 | Ga0209233_1000071 | 3300025261 | Bacteria | 363290 |
| 117 | Ga0209233_1000236 | 3300025261 | Bacteria | 92446 |
| 118 | Ga0209233_1000247 | 3300025261 | Bacteria | 87890 |
| 119 | Ga0209233_1009599 | 3300025261 | Bacteria | 2938 |
| 120 | Ga0209233_1019681 | 3300025261 | Bacteria | 1788 |
| 121 | Ga0209455_1000170 | 3300025272 | Bacteria | 110681 |
| 122 | Ga0209455_1021969 | 3300025272 | Bacteria | 1226 |
| 123 | Ga0209673_1006659 | 3300025273 | Bacteria | 5518 |
| 124 | Ga0209130_1000005 | 3300025284 | Bacteria | 599620 |
| 125 | Ga0209130_1000028 | 3300025284 | Bacteria | 325668 |
| 126 | Ga0209676_1003201 | 3300025292 | Bacteria | 10368 |
| 127 | Ga0209025_1000105 | 3300025294 | Bacteria | 224157 |
| 128 | Ga0209025_1040299 | 3300025294 | Bacteria | 2023 |
| 129 | Ga0209564_1000113 | 3300025295 | Bacteria | 211564 |
| 130 | Ga0209564_1009543 | 3300025295 | Bacteria | 4601 |
| 131 | Ga0209758_1015666 | 3300025297 | Bacteria | 3908 |
| 132 | Ga0209050_1000773 | 3300025298 | Bacteria | 45942 |
| 133 | Ga0209256_1004283 | 3300025299 | Bacteria | 9094 |
| 134 | Ga0209256_1019044 | 3300025299 | Bacteria | 2202 |
| 135 | Ga0207426_1000012 | 3300025302 | Bacteria | 730942 |
| 136 | Ga0207426_1000015 | 3300025302 | Bacteria | 599316 |
| 137 | Ga0207426_1003762 | 3300025302 | Bacteria | 7907 |
| 138 | Ga0207426_1022640 | 3300025302 | Bacteria | 2153 |
| 139 | Ga0209051_1003420 | 3300025303 | Bacteria | 10421 |
| 140 | Ga0209257_1002062 | 3300025304 | Bacteria | 21252 |
| 141 | Ga0207713_1052608 | 3300025735 | Bacteria | 1610 |
| 142 | Ga0207647_10009305 | 3300025904 | Bacteria | 6984 |
| 143 | Ga0207647_10039889 | 3300025904 | Bacteria | 2960 |
| 144 | Ga0207705_10010808 | 3300025909 | Bacteria | 6627 |
| 145 | Ga0207705_10112997 | 3300025909 | Bacteria | 2008 |
| 146 | Ga0207705_10426788 | 3300025909 | Bacteria | 1027 |
| 147 | Ga0207654_10390094 | 3300025911 | Bacteria | 966 |
| 148 | Ga0207695_10235536 | 3300025913 | Bacteria | 1733 |
| 149 | Ga0207695_10309487 | 3300025913 | Bacteria | 1470 |
| 150 | Ga0207695_10364520 | 3300025913 | Bacteria | 1331 |
| 151 | Ga0207695_10461299 | 3300025913 | Bacteria | 1153 |
| 152 | Ga0207671_10119104 | 3300025914 | Bacteria | 2017 |
| 153 | Ga0207671_10618974 | 3300025914 | Bacteria | 863 |
| 154 | Ga0207657_10056625 | 3300025919 | Bacteria | 3381 |
| 155 | Ga0207649_10106102 | 3300025920 | Bacteria | 1868 |
| 156 | Ga0207694_10008166 | 3300025924 | Bacteria | 7909 |
| 157 | Ga0207659_10173312 | 3300025926 | Bacteria | 1703 |
| 158 | Ga0207711_10095829 | 3300025941 | Bacteria | 2618 |
| 159 | Ga0207711_10182891 | 3300025941 | Bacteria | 1907 |
| 160 | Ga0207667_10012351 | 3300025949 | Bacteria | 9847 |
| 161 | Ga0207668_10039475 | 3300025972 | Bacteria | 3178 |
| 162 | Ga0207640_10039683 | 3300025981 | Bacteria | 2982 |
| 163 | Ga0207639_10149943 | 3300026041 | Bacteria | 1952 |
| 164 | Ga0207678_10036692 | 3300026067 | Bacteria | 4267 |
| 165 | Ga0207702_10071810 | 3300026078 | Bacteria | 2982 |
| 166 | Ga0207674_10033322 | 3300026116 | Bacteria | 5394 |
| 167 | Ga0207674_10684775 | 3300026116 | Bacteria | 990 |
| 168 | Ga0209281_1000134 | 3300027111 | Bacteria | 185406 |
| 169 | Ga0209281_1000445 | 3300027111 | Bacteria | 59209 |
| 170 | Ga0209371_1004523 | 3300027312 | Bacteria | 5986 |
| 171 | Ga0209282_1000029 | 3300027666 | Bacteria | 157883 |
| 172 | Ga0268266_10002316 | 3300028379 | Bacteria | 20650 |
| 173 | Ga0268266_10005331 | 3300028379 | Bacteria | 12041 |
| 174 | Ga0268266_10012715 | 3300028379 | Bacteria | 7274 |
| 175 | Ga0268266_10018558 | 3300028379 | Bacteria | 5928 |
| 176 | Ga0268266_10022478 | 3300028379 | Bacteria | 5374 |
| 177 | Ga0268266_10279701 | 3300028379 | Bacteria | 1551 |
| 178 | Ga0268266_10684560 | 3300028379 | Bacteria | 988 |
| 179 | Ga0265338_10234800 | 3300028800 | Bacteria | 1362 |
| 180 | Ga0268256_1003507 | 3300030500 | Bacteria | 7043 |
| 181 | Ga0265339_10030630 | 3300031249 | Bacteria | 3046 |
| 182 | Ga0265316_10052088 | 3300031344 | Bacteria | 3212 |
| 183 | Ga0307513_10104308 | 3300031456 | Bacteria | 2849 |
| 184 | Ga0307408_100296053 | 3300031548 | Bacteria | 1353 |
| 185 | Ga0307405_10379387 | 3300031731 | Bacteria | 1100 |
| 186 | Ga0307413_10193624 | 3300031824 | Bacteria | 1462 |
| 187 | Ga0307406_10520473 | 3300031901 | Bacteria | 968 |
| 188 | Ga0307407_10305387 | 3300031903 | Bacteria | 1111 |
| 189 | Ga0307412_10308405 | 3300031911 | Bacteria | 1254 |
| 190 | Ga0315914_1000004 | 3300031967 | Bacteria | 288534 |
| 191 | Ga0307416_100824385 | 3300032002 | Bacteria | 1025 |
| 192 | Ga0307416_101006405 | 3300032002 | Bacteria | 936 |
| 193 | Ga0307414_10591751 | 3300032004 | Bacteria | 994 |
| 194 | Ga0315913_1000370 | 3300033430 | Bacteria | 38384 |
| 195 | Ga0315915_1000003 | 3300033464 | Bacteria | 407996 |
| 196 | Ga0373926_0084441 | 3300035083 | Bacteria | 1177 |
| 197 | Ga0373927_0000144 | 3300035695 | Bacteria | 55726 |
| 198 | Ga0373947_0100887 | 3300035725 | Bacteria | 1814 |
| 199 | Ga0316582_0067401 | 3300036647 | Bacteria | 2309 |
| 200 | Ga0316582_0296719 | 3300036647 | Bacteria | 1110 |
| 201 | Ga0373925_0000481 | 3300037068 | Bacteria | 39959 |
| 202 | Ga0395900_0246407 | 3300037418 | Bacteria | 1790 |
| 203 | Ga0395900_0253816 | 3300037418 | Bacteria | 1759 |
| 204 | Ga0395905_0069723 | 3300037471 | Bacteria | 3293 |
| 205 | Ga0395905_0103827 | 3300037471 | Bacteria | 2668 |
| 206 | Ga0395905_0401077 | 3300037471 | Bacteria | 1266 |
| 207 | Ga0395905_0642189 | 3300037471 | Bacteria | 963 |
| 208 | Ga0395901_0062742 | 3300038443 | Bacteria | 3867 |
| 209 | Ga0395901_0090720 | 3300038443 | Bacteria | 3199 |
| 210 | Ga0395901_0279437 | 3300038443 | Bacteria | 1735 |
| 211 | Ga0466972_0082084 | 3300044658 | Bacteria | 1534 |
| 212 | Ga0466965_0215208 | 3300044683 | Bacteria | 1023 |
| 213 | Ga0466958_0020303 | 3300045836 | Bacteria | 3873 |
| 214 | Ga0495638_0002052 | 3300046460 | Bacteria | 17104 |
| 215 | Ga0495650_0003032 | 3300046471 | Bacteria | 12678 |
| 216 | Ga0495585_0019476 | 3300046492 | Bacteria | 3912 |
| 217 | Ga0495606_0206785 | 3300046507 | Bacteria | 1115 |
| 218 | Ga0495643_0025307 | 3300046522 | Bacteria | 3359 |
| 219 | Ga0495645_0024585 | 3300046543 | Bacteria | 4372 |
| 220 | Ga0495625_0000182 | 3300046660 | Bacteria | 98244 |
| 221 | Ga0495625_0005589 | 3300046660 | Bacteria | 11404 |
| 222 | Ga0495625_0025984 | 3300046660 | Bacteria | 4430 |
| 223 | Ga0495625_0041200 | 3300046660 | Bacteria | 3363 |
| 224 | Ga0495660_0159642 | 3300046810 | Bacteria | 1107 |
| 225 | Ga0495672_0067521 | 3300047320 | Bacteria | 2036 |
| 226 | Ga0495687_063021 | 3300047443 | Bacteria | 1520 |
| 227 | Ga0495681_0094339 | 3300047470 | Bacteria | 1317 |
| 228 | Ga0495686_0005687 | 3300047472 | Bacteria | 9748 |
| 229 | Ga0495615_0103679 | 3300048090 | Bacteria | 806 |
| 230 | Ga0496102_0373845 | 3300048905 | Bacteria | 1341 |
| 231 | Ga0496104_0245332 | 3300048907 | Bacteria | 1704 |
| 232 | Ga0496108_0099977 | 3300048911 | Bacteria | 2473 |
| 233 | Ga0496112_0073729 | 3300048915 | Bacteria | 3374 |
| 234 | Ga0496112_0243971 | 3300048915 | Bacteria | 1748 |
| 235 | Ga0496113_0224774 | 3300048916 | Bacteria | 1496 |
| 236 | Ga0496115_0090073 | 3300048918 | Bacteria | 2506 |
| 237 | Ga0496116_0014048 | 3300048919 | Bacteria | 6414 |
| 238 | Ga0496116_0145175 | 3300048919 | Bacteria | 1327 |
| 239 | Ga0496119_0016320 | 3300048922 | Bacteria | 5659 |
| 240 | Ga0496120_0002072 | 3300048923 | Bacteria | 21552 |
| 241 | Ga0496120_0023868 | 3300048923 | Bacteria | 3822 |
| 242 | Ga0496122_0082939 | 3300048925 | Bacteria | 2225 |
| 243 | Ga0496123_0029128 | 3300048926 | Bacteria | 4075 |
| 244 | Ga0496124_0166319 | 3300048927 | Bacteria | 1714 |
| 245 | Ga0496125_0075313 | 3300048928 | Bacteria | 2613 |
| 246 | Ga0496125_0208006 | 3300048928 | Bacteria | 1274 |
| 247 | Ga0496126_0003783 | 3300048929 | Bacteria | 18780 |
| 248 | Ga0496126_0155177 | 3300048929 | Bacteria | 1960 |
| 249 | Ga0501031_0000002 | 3300049568 | Bacteria | 217588 |
| 250 | Ga0501031_0010981 | 3300049568 | Bacteria | 5901 |
| 251 | Ga0501031_0032232 | 3300049568 | Bacteria | 3417 |
| 252 | Ga0501031_0175768 | 3300049568 | Bacteria | 1399 |
| 253 | Ga0501031_0259214 | 3300049568 | Bacteria | 1130 |
| 254 | Ga0501032_0000004 | 3300049569 | Bacteria | 310855 |
| 255 | Ga0501032_0001866 | 3300049569 | Bacteria | 16660 |
| 256 | Ga0501032_0051201 | 3300049569 | Bacteria | 2785 |
| 257 | Ga0501033_0000016 | 3300049570 | Bacteria | 217458 |
| 258 | Ga0501033_0000182 | 3300049570 | Bacteria | 60298 |
| 259 | Ga0501033_0000818 | 3300049570 | Bacteria | 28395 |
| 260 | Ga0501033_0009577 | 3300049570 | Bacteria | 7452 |
| 261 | Ga0501033_0022586 | 3300049570 | Bacteria | 4746 |
| 262 | Ga0501033_0042065 | 3300049570 | Bacteria | 3407 |
| 263 | Ga0501033_0133254 | 3300049570 | Bacteria | 1799 |
| 264 | Ga0501033_0282180 | 3300049570 | Bacteria | 1172 |
| 265 | Ga0501034_0000011 | 3300049571 | Bacteria | 310855 |
| 266 | Ga0501034_0001712 | 3300049571 | Bacteria | 28224 |
| 267 | Ga0501034_0007755 | 3300049571 | Bacteria | 11413 |
| 268 | Ga0501034_0158900 | 3300049571 | Bacteria | 2233 |
| 269 | Ga0501036_0000001 | 3300049572 | Bacteria | 310855 |
| 270 | Ga0501036_0006422 | 3300049572 | Bacteria | 9544 |
| 271 | Ga0501036_0030701 | 3300049572 | Bacteria | 4539 |
| 272 | Ga0501036_0185647 | 3300049572 | Bacteria | 1750 |
| 273 | Ga0501036_0278911 | 3300049572 | Bacteria | 1399 |
| 274 | Ga0501036_0467918 | 3300049572 | Bacteria | 1050 |
| 275 | Ga0501036_0477232 | 3300049572 | Bacteria | 1038 |
| 276 | Ga0501037_0000006 | 3300049573 | Bacteria | 217461 |
| 277 | Ga0501037_0000142 | 3300049573 | Bacteria | 66550 |
| 278 | Ga0501038_0000003 | 3300049574 | Bacteria | 310855 |
| 279 | Ga0501038_0000979 | 3300049574 | Bacteria | 25625 |
| 280 | Ga0501038_0071504 | 3300049574 | Bacteria | 2943 |
| 281 | Ga0501038_0148296 | 3300049574 | Bacteria | 1914 |
| 282 | Ga0501038_0252505 | 3300049574 | Bacteria | 1396 |
| 283 | Ga0501039_0000004 | 3300049575 | Bacteria | 310855 |
| 284 | Ga0501039_0070449 | 3300049575 | Bacteria | 2716 |
| 285 | Ga0501039_0605123 | 3300049575 | Bacteria | 859 |
| 286 | Ga0501040_0004502 | 3300049576 | Bacteria | 9045 |
| 287 | Ga0501042_0068089 | 3300049578 | Bacteria | 2545 |
| 288 | Ga0501043_0000066 | 3300049579 | Bacteria | 93258 |
| 289 | Ga0501043_0000588 | 3300049579 | Bacteria | 32210 |
| 290 | Ga0501043_0009297 | 3300049579 | Bacteria | 7723 |
| 291 | Ga0501043_0332533 | 3300049579 | Bacteria | 1157 |
| 292 | Ga0501046_0015684 | 3300049580 | Bacteria | 6360 |
| 293 | Ga0501046_0096005 | 3300049580 | Bacteria | 2277 |
| 294 | Ga0501047_0011488 | 3300049581 | Bacteria | 8382 |
| 295 | Ga0501047_0024880 | 3300049581 | Bacteria | 5749 |
| 296 | Ga0501047_0030377 | 3300049581 | Bacteria | 5209 |
| 297 | Ga0501047_0075152 | 3300049581 | Bacteria | 3251 |
| 298 | Ga0501047_0167104 | 3300049581 | Bacteria | 2070 |
| 299 | Ga0501047_0423512 | 3300049581 | Bacteria | 1162 |
| 300 | Ga0501048_0005100 | 3300049582 | Bacteria | 10007 |
| 301 | Ga0501067_0029599 | 3300049583 | Bacteria | 3035 |
| 302 | Ga0501067_0074703 | 3300049583 | Bacteria | 1878 |
| 303 | Ga0501068_0005415 | 3300049584 | Bacteria | 6984 |
| 304 | Ga0501068_0014507 | 3300049584 | Bacteria | 4505 |
| 305 | Ga0501068_0113680 | 3300049584 | Bacteria | 1685 |
| 306 | Ga0501069_0000002 | 3300049585 | Bacteria | 269636 |
| 307 | Ga0501069_0008770 | 3300049585 | Bacteria | 5324 |
| 308 | Ga0501069_0048007 | 3300049585 | Bacteria | 2370 |
| 309 | Ga0501069_0106949 | 3300049585 | Bacteria | 1591 |
| 310 | Ga0501070_0000051 | 3300049586 | Bacteria | 101897 |
| 311 | Ga0501070_0002384 | 3300049586 | Bacteria | 16474 |
| 312 | Ga0501070_0004526 | 3300049586 | Bacteria | 11930 |
| 313 | Ga0501070_0006025 | 3300049586 | Bacteria | 10327 |
| 314 | Ga0501070_0016663 | 3300049586 | Bacteria | 6172 |
| 315 | Ga0501071_0085231 | 3300049587 | Bacteria | 2316 |
| 316 | Ga0501071_0106162 | 3300049587 | Bacteria | 2074 |
| 317 | Ga0501073_0006953 | 3300049589 | Bacteria | 8425 |
| 318 | Ga0501073_0010824 | 3300049589 | Bacteria | 6680 |
| 319 | Ga0501074_0001350 | 3300049590 | Bacteria | 16259 |
| 320 | Ga0501074_0227658 | 3300049590 | Bacteria | 1327 |
| 321 | Ga0501080_0001856 | 3300049742 | Bacteria | 18153 |
| 322 | Ga0501080_0007434 | 3300049742 | Bacteria | 9889 |
| 323 | Ga0501080_0042886 | 3300049742 | Bacteria | 4212 |
| 324 | Ga0501080_0236362 | 3300049742 | Bacteria | 1669 |
| 325 | Ga0501083_0000187 | 3300049744 | Bacteria | 39905 |
| 326 | Ga0501083_0033156 | 3300049744 | Bacteria | 3538 |
| 327 | Ga0501083_0110715 | 3300049744 | Bacteria | 1806 |
| 328 | Ga0501035_0000009 | 3300049822 | Bacteria | 310827 |
| 329 | Ga0501035_0002215 | 3300049822 | Bacteria | 19311 |
| 330 | Ga0501035_0002554 | 3300049822 | Bacteria | 17805 |
| 331 | Ga0501035_0002576 | 3300049822 | Bacteria | 17719 |
| 332 | Ga0501035_0003955 | 3300049822 | Bacteria | 14136 |
| 333 | Ga0501035_0007237 | 3300049822 | Bacteria | 10383 |
| 334 | Ga0501035_0019856 | 3300049822 | Bacteria | 6172 |
| 335 | Ga0501035_0045873 | 3300049822 | Bacteria | 3931 |
| 336 | Ga0501035_0216599 | 3300049822 | Bacteria | 1636 |
| 337 | Ga0501035_0369045 | 3300049822 | Bacteria | 1198 |
| 338 | Ga0501035_0558194 | 3300049822 | Bacteria | 937 |
| 339 | Ga0501044_0000005 | 3300049823 | Bacteria | 310855 |
| 340 | Ga0501044_0000923 | 3300049823 | Bacteria | 35383 |
| 341 | Ga0501044_0007678 | 3300049823 | Bacteria | 11859 |
| 342 | Ga0501044_0010931 | 3300049823 | Bacteria | 9853 |
| 343 | Ga0501044_0017045 | 3300049823 | Bacteria | 7795 |
| 344 | Ga0501044_0029897 | 3300049823 | Bacteria | 5744 |
| 345 | Ga0501044_0157203 | 3300049823 | Bacteria | 2252 |
| 346 | Ga0501044_0517847 | 3300049823 | Bacteria | 1093 |
| 347 | Ga0501045_0015261 | 3300049824 | Bacteria | 5452 |
| 348 | nmdc:mga03683_7962_c1 | 3300050489 | Bacteria | 3705 |
| 349 | nmdc:mga03n38_49596_c1 | 3300050490 | Bacteria | 1867 |
| 350 | nmdc:mga03n38_7203_c1 | 3300050490 | Bacteria | 3921 |
| 351 | nmdc:mga00v17_115493_c1 | 3300050491 | Bacteria | 1706 |
| 352 | nmdc:mga00v17_12374_c1 | 3300050491 | Bacteria | 4707 |
| 353 | nmdc:mga0yw44_149407_c1 | 3300050492 | Bacteria | 1523 |
| 354 | nmdc:mga0yw44_76772_c1 | 3300050492 | Bacteria | 2086 |
| 355 | nmdc:mga0k408_388348_c1 | 3300050493 | Bacteria | 831 |
| 356 | nmdc:mga0sz30_50634_c1 | 3300050516 | Bacteria | 1761 |
| 357 | nmdc:mga0sz30_57025_c1 | 3300050516 | Bacteria | 1664 |
| 358 | Ga0495612_0085143 | 3300053078 | Bacteria | 1332 |
| 359 | Ga0500559_0001518 | 3300053136 | Bacteria | 13013 |
| 360 | Ga0500568_0000010 | 3300053139 | Bacteria | 249043 |
| 361 | Ga0500604_0038969 | 3300053151 | Bacteria | 1427 |
| 362 | Ga0500616_0070377 | 3300053153 | Bacteria | 1786 |
| 363 | Ga0500616_0216385 | 3300053153 | Bacteria | 838 |
| 364 | Ga0500620_001452 | 3300053155 | Bacteria | 4384 |
| 365 | Ga0500627_0210728 | 3300053158 | Bacteria | 869 |
| 366 | Ga0500611_004053 | 3300053727 | Bacteria | 1940 |
| 367 | Ga0587083_0014694 | 3300059505 | Bacteria | 1353 |
| 368 | 2503198747 | 2503198000 | Bacteria | 6884444 |
| 369 | 2509114127 | 2508501123 | Bacteria | 6283661 |
| 370 | 2509144411 | 2508501127 | Bacteria | 7037543 |
| 371 | 2509368776 | 2509276018 | Bacteria | 6910194 |
| 372 | 2509393634 | 2509276022 | Bacteria | 6200534 |
| 373 | 2510308163 | 2510065057 | Bacteria | 6649661 |
| 374 | 2510315060 | 2510065059 | Bacteria | 6847884 |
| 375 | 2511137143 | 2510917022 | Bacteria | 6504556 |
| 376 | 2511498942 | 2511231052 | Bacteria | 6974333 |
| 377 | 2512933855 | 2512875016 | Bacteria | 6529530 |
| 378 | 2512962052 | 2512875024 | Bacteria | 7195110 |
| 379 | 2512973105 | 2512875026 | Bacteria | 6861065 |
| 380 | 2513587210 | 2513237086 | Bacteria | 7265287 |
| 381 | 2513604314 | 2513237089 | Bacteria | 6553624 |
| 382 | 2513610502 | 2513237090 | Bacteria | 7096802 |
| 383 | 2513616200 | 2513237091 | Bacteria | 6900273 |
| 384 | 2513870246 | 2513237138 | Bacteria | 7368160 |
| 385 | 2513882647 | 2513237140 | Bacteria | 7076289 |
| 386 | 2513904630 | 2513237143 | Bacteria | 6664116 |
| 387 | 2513911075 | 2513237144 | Bacteria | 7530820 |
| 388 | 2513924407 | 2513237146 | Bacteria | 7166346 |
| 389 | 2514008172 | 2513237160 | Bacteria | 6650282 |
| 390 | 2514039142 | 2513237164 | Bacteria | 7563725 |
| 391 | 2514417570 | 2513237305 | Bacteria | 7293571 |
| 392 | 2515607360 | 2515154107 | Bacteria | 6795637 |
| 393 | 2516895218 | 2516653046 | Bacteria | 6989037 |
| 394 | 2517571895 | 2517487022 | Bacteria | 7227575 |
| 395 | 2524450898 | 2524023207 | Bacteria | 6813453 |
| 396 | 2524458030 | 2524023209 | Bacteria | 6679728 |
| 397 | 2535514690 | 2534681796 | Bacteria | 7146037 |
| 398 | 2551675220 | 2551306084 | Bacteria | 8942552 |
| 399 | 2551686967 | 2551306085 | Bacteria | 7347181 |
| 400 | 2551709248 | 2551306089 | Bacteria | 7162724 |
| 401 | 2551743146 | 2551306093 | Bacteria | 7064773 |
| 402 | 2585164521 | 2582581283 | Bacteria | 6030556 |
| 403 | 2585273604 | 2582581307 | Bacteria | 6597605 |
| 404 | 2585326311 | 2582581315 | Bacteria | 7318924 |
| 405 | 2585330477 | 2582581316 | Bacteria | 7774528 |
| 406 | 2585386114 | 2582581865 | Bacteria | 6644329 |
| 407 | 2585398968 | 2582581867 | Bacteria | 7184437 |
| 408 | 2585533831 | 2585427527 | Bacteria | 7273426 |
| 409 | 2585553424 | 2585427530 | Bacteria | 7383882 |
| 410 | 2585559777 | 2585427531 | Bacteria | 6992870 |
| 411 | 2585818911 | 2585427590 | Bacteria | 6824633 |
| 412 | 2585900465 | 2585427608 | Bacteria | 6544331 |
| 413 | 2585906043 | 2585427609 | Bacteria | 6667127 |
| 414 | 2587978842 | 2585428125 | Bacteria | 6662905 |
| 415 | 2588519953 | 2588253730 | Bacteria | 6881675 |
| 416 | 2597810709 | 2597489875 | Bacteria | 7010078 |
| 417 | 2599419634 | 2599185170 | Bacteria | 7295545 |
| 418 | 2599940126 | 2599185301 | Bacteria | 6161860 |
| 419 | 2600197546 | 2599185352 | Bacteria | 7228948 |
| 420 | 2616556220 | 2615840698 | Bacteria | 7319877 |
| 421 | 2617380582 | 2617270742 | Bacteria | 6808054 |
| 422 | 2643773368 | 2643221550 | Bacteria | 4619371 |
| 423 | 2643839500 | 2643221564 | Bacteria | 4193379 |
| 424 | 2643985819 | 2643221595 | Bacteria | 6565519 |
| 425 | 2644004532 | 2643221599 | Bacteria | 6292121 |
| 426 | 2644134020 | 2643221623 | Bacteria | 5239945 |
| 427 | 2644144561 | 2643221626 | Bacteria | 8069654 |
| 428 | 2644157121 | 2643221627 | Bacteria | 6761570 |
| 429 | 2644196955 | 2643221634 | Bacteria | 6705461 |
| 430 | 2644306612 | 2643221655 | Bacteria | 7722067 |
| 431 | 2644330802 | 2643221659 | Bacteria | 7890716 |
| 432 | 2644542392 | 2643221698 | Bacteria | 7756764 |
| 433 | 2644612223 | 2643221712 | Bacteria | 7729434 |
| 434 | 2644671579 | 2643221723 | Bacteria | 7095460 |
| 435 | 2671113994 | 2667528174 | Bacteria | 6435400 |
| 436 | 2688596031 | 2687453392 | Bacteria | 6880454 |
| 437 | 2692317657 | 2690316117 | Bacteria | 6800650 |
| 438 | 2694627774 | 2693429783 | Bacteria | 7019804 |
| 439 | 2694636047 | 2693429784 | Bacteria | 7241525 |
| 440 | 2694636888 | 2693429784 | Bacteria | 7241525 |
| 441 | 2723573188 | 2721755686 | Bacteria | 7343952 |
| 442 | 2738947736 | 2738541317 | Bacteria | 5340176 |
| 443 | 2739309892 | 2738543024 | Bacteria | 5603683 |
| 444 | 2756675102 | 2756170246 | Bacteria | 7451806 |
| 445 | 2776269449 | 2775506902 | Bacteria | 6208009 |
| 446 | 2776282379 | 2775506904 | Bacteria | 5954060 |
| 447 | 2778173839 | 2775507266 | Bacteria | 7392367 |
| 448 | 2792583338 | 2791355082 | Bacteria | 5973319 |
| 449 | 2792625275 | 2791355092 | Bacteria | 6248105 |
| 450 | 2792747241 | 2791355123 | Bacteria | 8049106 |
| 451 | 2802718672 | 2802428858 | Bacteria | 6636079 |
| 452 | 2802724352 | 2802428859 | Bacteria | 6667919 |
| 453 | 2802729986 | 2802428860 | Bacteria | 6525526 |
| 454 | 2802737329 | 2802428861 | Bacteria | 6534206 |
| 455 | 2802742245 | 2802428862 | Bacteria | 6633353 |
| 456 | 2802748927 | 2802428863 | Bacteria | 6410669 |
| 457 | 2819608735 | 2818991448 | Bacteria | 6772224 |
| 458 | 2819640844 | 2818991453 | Bacteria | 7181617 |
| 459 | 2838029626 | 2838029111 | Bacteria | 6603031 |
| 460 | 2838039834 | 2838035591 | Bacteria | 7166484 |
| 461 | 2841736421 | 2841734538 | Bacteria | 6784580 |
| 462 | 2842299788 | 2842298080 | Bacteria | 6123127 |
| 463 | 2842359690 | 2842357229 | Bacteria | 6485165 |
| 464 | 2842475944 | 2842475841 | Bacteria | 6603183 |
| 465 | 2842486027 | 2842482326 | Bacteria | 7212537 |
| 466 | 2842503154 | 2842502639 | Bacteria | 6604161 |
| 467 | 2842513022 | 2842509118 | Bacteria | 6850950 |
| 468 | 2844003406 | 2844002411 | Bacteria | 7168230 |
| 469 | 2844010844 | 2844009547 | Bacteria | 6728125 |
| 470 | 2844170042 | 2844163670 | Bacteria | 7266046 |
| 471 | 2847421363 | 2847417321 | Bacteria | 6913799 |
| 472 | 2847673487 | 2847670302 | Bacteria | 6165597 |
| 473 | 2847689996 | 2847686936 | Bacteria | 6278406 |
| 474 | 2855827856 | 2855825444 | Bacteria | 6785811 |
| 475 | 2855843224 | 2855839649 | Bacteria | 7135830 |
| 476 | 2856319044 | 2856314179 | Bacteria | 6477897 |
| 477 | 2856323815 | 2856320880 | Bacteria | 7263508 |
| 478 | 2856332484 | 2856328259 | Bacteria | 6528202 |
| 479 | 2856337387 | 2856334872 | Bacteria | 7037011 |
| 480 | 2856347486 | 2856342000 | Bacteria | 7176905 |
| 481 | 2856350804 | 2856349417 | Bacteria | 6230045 |
| 482 | 2856358208 | 2856356410 | Bacteria | 6297484 |
| 483 | 2856369813 | 2856364286 | Bacteria | 6939991 |
| 484 | 2857352991 | 2857349434 | Bacteria | 7926032 |
| 485 | 2857370485 | 2857367948 | Bacteria | 6965560 |
| 486 | 2858802952 | 2858800743 | Bacteria | 6603254 |
| 487 | 2869166073 | 2869162929 | Bacteria | 6399702 |
| 488 | 2869170896 | 2869169390 | Bacteria | 6659796 |
| 489 | 2869235644 | 2869234852 | Bacteria | 6654993 |
| 490 | 2869252877 | 2869249662 | Bacteria | 6868783 |
| 491 | 2869261601 | 2869256925 | Bacteria | 6981691 |
| 492 | 2869267939 | 2869264136 | Bacteria | 6880765 |
| 493 | 2869272818 | 2869271264 | Bacteria | 6908218 |
| 494 | 2869284786 | 2869278585 | Bacteria | 7077053 |
| 495 | 2869290620 | 2869285874 | Bacteria | 6901219 |
| 496 | 2871432902 | 2871429161 | Bacteria | 6547891 |
| 497 | 2871443221 | 2871435913 | Bacteria | 6880295 |
| 498 | 2871457001 | 2871451962 | Bacteria | 7336357 |
| 499 | 2871462355 | 2871459585 | Bacteria | 6866887 |
| 500 | 2871471713 | 2871466892 | Bacteria | 6923287 |
| 501 | 2871477215 | 2871474448 | Bacteria | 6806570 |
| 502 | 2871484220 | 2871481445 | Bacteria | 6700002 |
| 503 | 2871489792 | 2871488783 | Bacteria | 6929816 |
| 504 | 2871499836 | 2871495908 | Bacteria | 6935695 |
| 505 | 2874107208 | 2874102143 | Bacteria | 6342645 |
| 506 | 2874112251 | 2874109183 | Bacteria | 6517025 |
| 507 | 2874118167 | 2874116593 | Bacteria | 6674494 |
| 508 | 2874128388 | 2874123672 | Bacteria | 7238285 |
| 509 | 2874131936 | 2874131515 | Bacteria | 6820270 |
| 510 | 2874142893 | 2874139085 | Bacteria | 7021506 |
| 511 | 2874153937 | 2874146452 | Bacteria | 7533118 |
| 512 | 2874158625 | 2874155637 | Bacteria | 6724144 |
| 513 | 2874165960 | 2874162495 | Bacteria | 6174670 |
| 514 | 2874172496 | 2874168670 | Bacteria | 8062617 |
| 515 | 2876363889 | 2876363079 | Bacteria | 6544991 |
| 516 | 2876373106 | 2876369609 | Bacteria | 6807521 |
| 517 | 2876379261 | 2876377896 | Bacteria | 6565995 |
| 518 | 2876390969 | 2876386047 | Bacteria | 6698674 |
| 519 | 2876396982 | 2876392853 | Bacteria | 6660880 |
| 520 | 2876400159 | 2876399893 | Bacteria | 6927900 |
| 521 | 2876413444 | 2876406927 | Bacteria | 6191900 |
| 522 | 2876419242 | 2876413966 | Bacteria | 6831344 |
| 523 | 2876427413 | 2876420981 | Bacteria | 6687741 |
| 524 | 2878039433 | 2878035449 | Bacteria | 6555736 |
| 525 | 2878741037 | 2878738818 | Bacteria | 7136951 |
| 526 | 2878750515 | 2878745973 | Bacteria | 6867388 |
| 527 | 2878754172 | 2878753008 | Bacteria | 6922523 |
| 528 | 2878764000 | 2878760144 | Bacteria | 6823465 |
| 529 | 2878771030 | 2878767105 | Bacteria | 6898628 |
| 530 | 2878777743 | 2878774303 | Bacteria | 6108671 |
| 531 | 2878785704 | 2878781027 | Bacteria | 6834456 |
| 532 | 2878788966 | 2878788777 | Bacteria | 6567085 |
| 533 | 2881148256 | 2881147464 | Bacteria | 7779814 |
| 534 | 2881159339 | 2881155292 | Bacteria | 6461656 |
| 535 | 2881165039 | 2881161766 | Bacteria | 7127907 |
| 536 | 2881847566 | 2881845957 | Bacteria | 6611900 |
| 537 | 2881855859 | 2881853255 | Bacteria | 6698367 |
| 538 | 2881864554 | 2881861095 | Bacteria | 7128710 |
| 539 | 2882636790 | 2882632389 | Bacteria | 8154593 |
| 540 | 2882915899 | 2882912400 | Bacteria | 6801539 |
| 541 | 2885306907 | 2885305155 | Bacteria | 7348390 |
| 542 | 2885314086 | 2885312484 | Bacteria | 6415165 |
| 543 | 2885320096 | 2885318864 | Bacteria | 6729568 |
| 544 | 2885335464 | 2885334103 | Bacteria | 7216818 |
| 545 | 2885344996 | 2885342637 | Bacteria | 7011821 |
| 546 | 2885352925 | 2885350715 | Bacteria | 6787678 |
| 547 | 2888343352 | 2888337043 | Bacteria | 6629336 |
| 548 | 2888344425 | 2888343758 | Bacteria | 6611049 |
| 549 | 2888353129 | 2888350351 | Bacteria | 7372807 |
| 550 | 2889014975 | 2889010040 | Bacteria | 6749192 |
| 551 | 2889019955 | 2889016732 | Bacteria | 6700763 |
| 552 | 2903454030 | 2903448605 | Bacteria | 7357801 |
| 553 | 2903497513 | 2903492973 | Bacteria | 13473544 |
| 554 | 2903499639 | 2903492973 | Bacteria | 13473544 |
| 555 | 2903513887 | 2903513507 | Bacteria | 6344008 |
| 556 | 2903525952 | 2903521522 | Bacteria | 6525694 |
| 557 | 2903532502 | 2903528002 | Bacteria | 6586099 |
| 558 | 2903544647 | 2903540706 | Bacteria | 7062119 |
| 559 | 2904663736 | 2904659560 | Bacteria | 6685615 |
| 560 | 2906313440 | 2906308376 | Bacteria | 6841989 |
| 561 | 2906326149 | 2906321335 | Bacteria | 6579571 |
| 562 | 2906334142 | 2906328253 | Bacteria | 6585166 |
| 563 | 2906355873 | 2906354277 | Bacteria | 6991324 |
| 564 | 2906367797 | 2906363423 | Bacteria | 6856682 |
| 565 | 2906371268 | 2906370794 | Bacteria | 6881062 |
| 566 | 2906382012 | 2906378014 | Bacteria | 6911440 |
| 567 | 2906390073 | 2906386501 | Bacteria | 5977019 |
| 568 | 2906399367 | 2906393657 | Bacteria | 6790866 |
| 569 | 2906405153 | 2906401398 | Bacteria | 6693206 |
| 570 | 2906413864 | 2906408224 | Bacteria | 6162342 |
| 571 | 2906419115 | 2906414383 | Bacteria | 6580790 |
| 572 | 2906432854 | 2906427513 | Bacteria | 6375796 |
| 573 | 2913311610 | 2913308742 | Bacteria | 5350706 |
| 574 | 2915986596 | 2915980308 | Bacteria | 6624279 |
| 575 | 2915993660 | 2915986958 | Bacteria | 6739310 |
| 576 | 2915994196 | 2915993759 | Bacteria | 7016183 |
| 577 | 2916004902 | 2916000859 | Bacteria | 6865702 |
| 578 | 2916008305 | 2916007675 | Bacteria | 6898660 |
| 579 | 2916015124 | 2916014648 | Bacteria | 6946486 |
| 580 | 2916026181 | 2916021584 | Bacteria | 6854472 |
| 581 | 2916035163 | 2916028427 | Bacteria | 6748433 |
| 582 | 2916041532 | 2916035215 | Bacteria | 6755766 |
| 583 | 2916047426 | 2916041962 | Bacteria | 6820487 |
| 584 | 2916054837 | 2916048683 | Bacteria | 6543552 |
| 585 | 2916058943 | 2916055098 | Bacteria | 6758838 |
| 586 | 2916065888 | 2916061851 | Bacteria | 6737736 |
| 587 | 2916071699 | 2916068649 | Bacteria | 6943657 |
| 588 | 2916077278 | 2916076590 | Bacteria | 6596108 |
| 589 | 2919408464 | 2919408235 | Bacteria | 6149349 |
| 590 | 2921202469 | 2921201388 | Bacteria | 6926299 |
| 591 | 2921209226 | 2921208531 | Bacteria | 6745326 |
| 592 | 2921237611 | 2921237296 | Bacteria | 6876710 |
| 593 | 2921249756 | 2921244191 | Bacteria | 6568419 |
| 594 | 2921254873 | 2921250672 | Bacteria | 6677771 |
| 595 | 2921263866 | 2921257292 | Bacteria | 6808382 |
| 596 | 2921270529 | 2921263974 | Bacteria | 6864552 |
| 597 | 2921283121 | 2921282425 | Bacteria | 6826397 |
| 598 | 2921290001 | 2921289301 | Bacteria | 7316391 |
| 599 | 2921301751 | 2921296804 | Bacteria | 7176999 |
| 600 | 2922134635 | 2922130491 | Bacteria | 7173936 |
| 601 | 2922157629 | 2922151315 | Bacteria | 6902399 |
| 602 | 2922162016 | 2922158528 | Bacteria | 6573167 |
| 603 | 2922175649 | 2922172374 | Bacteria | 6167644 |
| 604 | 2922183223 | 2922178524 | Bacteria | 6025201 |
| 605 | 2922188853 | 2922185730 | Bacteria | 7113964 |
| 606 | 2923556304 | 2923556063 | Bacteria | 6793593 |
| 607 | 2924146146 | 2924144063 | Bacteria | 6883928 |
| 608 | 2924158219 | 2924150972 | Bacteria | 7169444 |
| 609 | 2924164548 | 2924158325 | Bacteria | 7188855 |
| 610 | 2924171361 | 2924165586 | Bacteria | 7260590 |
| 611 | 2924179621 | 2924172951 | Bacteria | 6749356 |
| 612 | 2924180045 | 2924179722 | Bacteria | 6843264 |
| 613 | 2924186811 | 2924186466 | Bacteria | 6876637 |
| 614 | 2924200286 | 2924193448 | Bacteria | 6955718 |
| 615 | 2924202603 | 2924200457 | Bacteria | 6757188 |
| 616 | 2924209452 | 2924207177 | Bacteria | 6917007 |
| 617 | 2924216663 | 2924214083 | Bacteria | 7080103 |
| 618 | 2924227049 | 2924221636 | Bacteria | 7113495 |
| 619 | 2924234751 | 2924228884 | Bacteria | 6633132 |
| 620 | 2924710593 | 2924710171 | Bacteria | 6752351 |
| 621 | 2924720569 | 2924718760 | Bacteria | 6331356 |
| 622 | 2924731419 | 2924726620 | Bacteria | 6271473 |
| 623 | 2924734850 | 2924733363 | Bacteria | 7574837 |
| 624 | 2924747703 | 2924741084 | Bacteria | 6661321 |
| 625 | 2924752954 | 2924748358 | Bacteria | 6154725 |
| 626 | 2924760814 | 2924754689 | Bacteria | 6774424 |
| 627 | 2924766119 | 2924762789 | Bacteria | 6561353 |
| 628 | 2924778638 | 2924776078 | Bacteria | 7492003 |
| 629 | 2924784860 | 2924784321 | Bacteria | 7416538 |
| 630 | 2936998652 | 2936996657 | Bacteria | 6298727 |
| 631 | 2937006328 | 2937002841 | Bacteria | 6934057 |
| 632 | 2937011686 | 2937009748 | Bacteria | 6746052 |
| 633 | 2937018392 | 2937016420 | Bacteria | 6782579 |
| 634 | 2937025734 | 2937023124 | Bacteria | 6815156 |
| 635 | 2937033613 | 2937029754 | Bacteria | 6424026 |
| 636 | 2937040351 | 2937036028 | Bacteria | 6846469 |
| 637 | 2937044593 | 2937042894 | Bacteria | 6741576 |
| 638 | 2937055983 | 2937049772 | Bacteria | 6757901 |
| 639 | 2937057231 | 2937056579 | Bacteria | 7107896 |
| 640 | 2937069957 | 2937063883 | Bacteria | 7199456 |
| 641 | 2937078325 | 2937071275 | Bacteria | 6984483 |
| 642 | 2937082702 | 2937078374 | Bacteria | 6610289 |
| 643 | 2937088639 | 2937084907 | Bacteria | 6618516 |
| 644 | 2937092589 | 2937091812 | Bacteria | 6979387 |
| 645 | 2937106313 | 2937098957 | Bacteria | 7249374 |
| 646 | 2937108289 | 2937106411 | Bacteria | 6947143 |
| 647 | 2937118678 | 2937113482 | Bacteria | 6505872 |
| 648 | 2937121877 | 2937119839 | Bacteria | 6597547 |
| 649 | 2937129665 | 2937126314 | Bacteria | 6771275 |
| 650 | 2937820256 | 2937813078 | Bacteria | 7783518 |
| 651 | 2937822696 | 2937822353 | Bacteria | 7290551 |
| 652 | 2937850091 | 2937848649 | Bacteria | 6983481 |
| 653 | 2937867692 | 2937861824 | Bacteria | 6660327 |
| 654 | 2937870478 | 2937868953 | Bacteria | 6639878 |
| 655 | 2937878464 | 2937877337 | Bacteria | 7246526 |
| 656 | 2937892671 | 2937891427 | Bacteria | 6357007 |
| 657 | 2937974305 | 2937972304 | Bacteria | 7532020 |
| 658 | 2937998495 | 2937994558 | Bacteria | 7036190 |
| 659 | 2957377919 | 2957375807 | Bacteria | 6425588 |
| 660 | 2957384337 | 2957382221 | Bacteria | 6737050 |
| 661 | 2957393787 | 2957388812 | Bacteria | 6778072 |
| 662 | 2957396037 | 2957395598 | Bacteria | 6822399 |
| 663 | 2957405590 | 2957402308 | Bacteria | 6741770 |
| 664 | 2957413517 | 2957408893 | Bacteria | 6558585 |
| 665 | 2957422284 | 2957415311 | Bacteria | 6991633 |
| 666 | 2957425509 | 2957422303 | Bacteria | 7172205 |
| 667 | 2957434343 | 2957430029 | Bacteria | 7022557 |
| 668 | 2957437540 | 2957437181 | Bacteria | 6568994 |
| 669 | 2957450150 | 2957443900 | Bacteria | 6869977 |
| 670 | 2957452830 | 2957450854 | Bacteria | 6765715 |
| 671 | 2957458223 | 2957457609 | Bacteria | 6967680 |
| 672 | 2957466299 | 2957464669 | Bacteria | 6568877 |
| 673 | 2957474681 | 2957471148 | Bacteria | 6797643 |
| 674 | 2957484092 | 2957478035 | Bacteria | 6756658 |
| 675 | 2957485215 | 2957484790 | Bacteria | 6703082 |
| 676 | 2957493785 | 2957491536 | Bacteria | 6695180 |
| 677 | 2957499264 | 2957498199 | Bacteria | 7126688 |
| 678 | 2957506017 | 2957505466 | Bacteria | 7253085 |
| 679 | 2958041359 | 2958034702 | Bacteria | 6989922 |
| 680 | 2958042333 | 2958041894 | Bacteria | 13082850 |
| 681 | 2958046639 | 2958041894 | Bacteria | 13082850 |
| 682 | 2958071194 | 2958064165 | Bacteria | 7158582 |
| 683 | 2958077376 | 2958071322 | Bacteria | 6815895 |
| 684 | 2958085737 | 2958084443 | Bacteria | 7312792 |
| 685 | 2958106546 | 2958100919 | Bacteria | 6800575 |
| 686 | 2958119124 | 2958115193 | Bacteria | 6923548 |
| 687 | 2958123987 | 2958122699 | Bacteria | 7280457 |
| 688 | 2958135020 | 2958130278 | Bacteria | 6897202 |
| 689 | 2958141397 | 2958137437 | Bacteria | 6050276 |
| 690 | 2958144747 | 2958144490 | Bacteria | 6677056 |
| 691 | 2958164386 | 2958158011 | Bacteria | 6058449 |
| 692 | 2958168971 | 2958165035 | Bacteria | 6906348 |
| 693 | 2958177138 | 2958172287 | Bacteria | 6716688 |
| 694 | 2958184049 | 2958179912 | Bacteria | 6874908 |
| 695 | 2960584622 | 2960584000 | Bacteria | 6864594 |
| 696 | 2960593265 | 2960591022 | Bacteria | 6622873 |
| 697 | 2960603178 | 2960597568 | Bacteria | 6550735 |
| 698 | 2960609368 | 2960603979 | Bacteria | 6898737 |
| 699 | 2960615337 | 2960610863 | Bacteria | 6691244 |
| 700 | 2960623249 | 2960617483 | Bacteria | 6727748 |
| 701 | 2960624825 | 2960624210 | Bacteria | 6875384 |
| 702 | 2960637051 | 2960631154 | Bacteria | 6732508 |
| 703 | 2960638877 | 2960637947 | Bacteria | 7296468 |
| 704 | 2960650944 | 2960645483 | Bacteria | 7211087 |
| 705 | 2960659365 | 2960652885 | Bacteria | 7083688 |
| 706 | 2960666939 | 2960660292 | Bacteria | 7041660 |
| 707 | 2960670179 | 2960667422 | Bacteria | 6763020 |
| 708 | 2960679550 | 2960674078 | Bacteria | 6609048 |
| 709 | 2960685247 | 2960680706 | Bacteria | 6624464 |
| 710 | 2960693656 | 2960687367 | Bacteria | 6535474 |
| 711 | 2960697376 | 2960693952 | Bacteria | 6749742 |
| 712 | 2961082104 | 2961077736 | Bacteria | 7079850 |
| 713 | 2961119124 | 2961114664 | Bacteria | 6680456 |
| 714 | 2961129713 | 2961127735 | Bacteria | 7196641 |
| 715 | 2961139603 | 2961136820 | Bacteria | 6775228 |
| 716 | 2961167433 | 2961163497 | Bacteria | 6901077 |
| 717 | 2961176230 | 2961170736 | Bacteria | 7072258 |
| 718 | 2961187584 | 2961183825 | Bacteria | 6688536 |
| 719 | 2963645347 | 2963644680 | Bacteria | 6530403 |
| 720 | 2964611556 | 2964607997 | Bacteria | 7101408 |
| 721 | 2964621555 | 2964615318 | Bacteria | 6809089 |
| 722 | 2964622459 | 2964621998 | Bacteria | 6834995 |
| 723 | 2964634249 | 2964628898 | Bacteria | 7083044 |
| 724 | 2964641419 | 2964636051 | Bacteria | 7091832 |
| 725 | 2964644966 | 2964643177 | Bacteria | 6820887 |
| 726 | 2964655945 | 2964649959 | Bacteria | 6675118 |
| 727 | 2964657017 | 2964656573 | Bacteria | 7100150 |
| 728 | 2964670343 | 2964663802 | Bacteria | 7019362 |
| 729 | 2964672389 | 2964670856 | Bacteria | 6851364 |
| 730 | 2964684543 | 2964678106 | Bacteria | 6792020 |
| 731 | 2964685342 | 2964685014 | Bacteria | 6839111 |
| 732 | 2964692384 | 2964691889 | Bacteria | 6802758 |
| 733 | 2964705397 | 2964698721 | Bacteria | 6765331 |
| 734 | 2964708965 | 2964705432 | Bacteria | 7114648 |
| 735 | 2964713027 | 2964712639 | Bacteria | 6695970 |
| 736 | 2964720285 | 2964719344 | Bacteria | 7286602 |
| 737 | 2965022255 | 2965018300 | Bacteria | 6883036 |
| 738 | 2965029932 | 2965025482 | Bacteria | 6532201 |
| 739 | 2965035993 | 2965032056 | Bacteria | 6887443 |
| 740 | 2965044239 | 2965040258 | Bacteria | 6855979 |
| 741 | 2965052391 | 2965047637 | Bacteria | 6623551 |
| 742 | 2965064143 | 2965062239 | Bacteria | 7412989 |
| 743 | 2965094816 | 2965089291 | Bacteria | 6866420 |
| 744 | 2965105261 | 2965102966 | Bacteria | 6800987 |
| 745 | 2965115722 | 2965110997 | Bacteria | 6693150 |
| 746 | 2965123609 | 2965119406 | Bacteria | 6956431 |
| 747 | 2967665783 | 2967664464 | Bacteria | 6948836 |
| 748 | 2967671968 | 2967671571 | Bacteria | 7021409 |
| 749 | 2967679120 | 2967678726 | Bacteria | 7264382 |
| 750 | 2967689917 | 2967686174 | Bacteria | 6678622 |
| 751 | 2967695287 | 2967693043 | Bacteria | 6804451 |
| 752 | 2967701129 | 2967699805 | Bacteria | 6854538 |
| 753 | 2967707694 | 2967706974 | Bacteria | 7186053 |
| 754 | 2967720682 | 2967714385 | Bacteria | 7000047 |
| 755 | 2967728489 | 2967721400 | Bacteria | 7073753 |
| 756 | 2967732787 | 2967728569 | Bacteria | 6641507 |
| 757 | 2967741114 | 2967735183 | Bacteria | 6827012 |
| 758 | 2967742370 | 2967742019 | Bacteria | 6794534 |
| 759 | 2967749591 | 2967748971 | Bacteria | 6733771 |
| 760 | 2967761949 | 2967755722 | Bacteria | 6814706 |
| 761 | 2967768680 | 2967762386 | Bacteria | 6923502 |
| 762 | 2967771404 | 2967769361 | Bacteria | 6587838 |
| 763 | 2967776559 | 2967775926 | Bacteria | 6738189 |
| 764 | 2967996855 | 2967996073 | Bacteria | 6787468 |
| 765 | 2968004918 | 2968003550 | Bacteria | 6929263 |
| 766 | 2968022879 | 2968016561 | Bacteria | 7022047 |
| 767 | 2968089756 | 2968083720 | Bacteria | 7351627 |
| 768 | 2968093553 | 2968091066 | Bacteria | 6052692 |
| 769 | 2968101402 | 2968097103 | Bacteria | 6107094 |
| 770 | 2968114875 | 2968110612 | Bacteria | 6814636 |
| 771 | 2968122606 | 2968117919 | Bacteria | 6536078 |
| 772 | 2968134018 | 2968128360 | Bacteria | 6270294 |
| 773 | 2968143086 | 2968138860 | Bacteria | 6605449 |
| 774 | 2968175840 | 2968171901 | Bacteria | 6894245 |
| 775 | 2970020055 | 2970019648 | Bacteria | 7072033 |
| 776 | 2970031055 | 2970026789 | Bacteria | 6785236 |
| 777 | 2970046858 | 2970040964 | Bacteria | 6731123 |
| 778 | 2970051846 | 2970047711 | Bacteria | 7088379 |
| 779 | 2970060402 | 2970054988 | Bacteria | 6611507 |
| 780 | 2970062071 | 2970061556 | Bacteria | 7099761 |
| 781 | 2970082276 | 2970076120 | Bacteria | 6697332 |
| 782 | 2970087991 | 2970082768 | Bacteria | 6183754 |
| 783 | 2970091653 | 2970088815 | Bacteria | 6933825 |
| 784 | 2970102493 | 2970095765 | Bacteria | 6936963 |
| 785 | 2970108312 | 2970102677 | Bacteria | 6812532 |
| 786 | 2970113543 | 2970109326 | Bacteria | 6863976 |
| 787 | 2970121994 | 2970116247 | Bacteria | 6501857 |
| 788 | 2970128607 | 2970122695 | Bacteria | 6625855 |
| 789 | 2970135415 | 2970129317 | Bacteria | 6806560 |
| 790 | 2970137819 | 2970136068 | Bacteria | 7207982 |
| 791 | 2970149322 | 2970143518 | Bacteria | 6446480 |
| 792 | 2970153611 | 2970149975 | Bacteria | 6779706 |
| 793 | 2970157884 | 2970156795 | Bacteria | 7168044 |
| 794 | 2970169670 | 2970164137 | Bacteria | 6861252 |
| 795 | 2970174044 | 2970170962 | Bacteria | 6876229 |
| 796 | 2970182451 | 2970177841 | Bacteria | 6768001 |
| 797 | 2970187008 | 2970184632 | Bacteria | 7054431 |
| 798 | 2970198645 | 2970191845 | Bacteria | 7032787 |
| 799 | 2970475464 | 2970469710 | Bacteria | 6969209 |
| 800 | 2970493686 | 2970489779 | Bacteria | 6517260 |
| 801 | 2970508901 | 2970503327 | Bacteria | 7099517 |
| 802 | 2970517239 | 2970510686 | Bacteria | 7006402 |
| 803 | 2970526140 | 2970524798 | Bacteria | 6840927 |
| 804 | 2970534121 | 2970532167 | Bacteria | 6553173 |
| 805 | 2970553232 | 2970547951 | Bacteria | 6931819 |
| 806 | 2970558844 | 2970554993 | Bacteria | 6814252 |
| 807 | 2970599397 | 2970593180 | Bacteria | 7073582 |
| 808 | 2970621582 | 2970619444 | Bacteria | 6986144 |
| 809 | 2970630673 | 2970627176 | Bacteria | 6680862 |
| 810 | 2977517458 | 2977516862 | Bacteria | 6940108 |
| 811 | 2977530351 | 2977523885 | Bacteria | 6960446 |
| 812 | 2977530996 | 2977530762 | Bacteria | 6951399 |
| 813 | 2977538610 | 2977537788 | Bacteria | 6929320 |
| 814 | 2977548645 | 2977544691 | Bacteria | 6875412 |
| 815 | 2977554209 | 2977551784 | Bacteria | 7125765 |
| 816 | 2977565326 | 2977558990 | Bacteria | 6863948 |
| 817 | 2977569975 | 2977565890 | Bacteria | 6901543 |
| 818 | 2977579425 | 2977572785 | Bacteria | 6763888 |
| 819 | 2977584028 | 2977579622 | Bacteria | 6772100 |
| 820 | 2977823387 | 2977821940 | Bacteria | 6906439 |
| 821 | 2977835456 | 2977828996 | Bacteria | 7007971 |
| 822 | 2977847051 | 2977843712 | Bacteria | 6753583 |
| 823 | 2977855810 | 2977851361 | Bacteria | 6694324 |
| 824 | 2977864191 | 2977858184 | Bacteria | 6215359 |
| 825 | 2977868123 | 2977864932 | Bacteria | 7534097 |
| 826 | 2977875957 | 2977872689 | Bacteria | 7270173 |
| 827 | 2977899474 | 2977898635 | Bacteria | 6675551 |
| 828 | 2977913185 | 2977907340 | Bacteria | 6577984 |
| 829 | 2977920181 | 2977915119 | Bacteria | 6829656 |
| 830 | 2977924551 | 2977922695 | Bacteria | 6956781 |
| 831 | 2977941145 | 2977935797 | Bacteria | 6252826 |
| 832 | 2977943294 | 2977942078 | Bacteria | 7570577 |
| 833 | 2977952899 | 2977950692 | Bacteria | 6893264 |
| 834 | 2977962248 | 2977957713 | Bacteria | 6877875 |
| 835 | 2977976220 | 2977971508 | Bacteria | 7472917 |
| 836 | 2977992106 | 2977986579 | Bacteria | 6581278 |
| 837 | 2979710776 | 2979710463 | Bacteria | 6785254 |
| 838 | 2979747025 | 2979742915 | Bacteria | 7301278 |
| 839 | 2979765957 | 2979764755 | Bacteria | 6610066 |
| 840 | 2979786418 | 2979779861 | Bacteria | 6219781 |
| 841 | 2979794125 | 2979793036 | Bacteria | 6808957 |
| 842 | 2979813580 | 2979808191 | Bacteria | 7179355 |
| 843 | 2987641584 | 2987636660 | Bacteria | 8088555 |
| 844 | 2987650523 | 2987645492 | Bacteria | 6117018 |
| 845 | 2987656327 | 2987652177 | Bacteria | 6969023 |
| 846 | 2987663439 | 2987659509 | Bacteria | 6966464 |
| 847 | 2987667003 | 2987666974 | Bacteria | 6509233 |
| 848 | 2987678534 | 2987673487 | Bacteria | 6884027 |
| 849 | 2996311558 | 2996310559 | Bacteria | 6357320 |
| 850 | 2996341488 | 2996336353 | Bacteria | 5511628 |
| 851 | 2996341921 | 2996341866 | Bacteria | 6643098 |
| 852 | 2996349399 | 2996348954 | Bacteria | 7239054 |
| 853 | 2996387017 | 2996386984 | Bacteria | 6978667 |
| 854 | 2996888092 | 2996887358 | Bacteria | 5795980 |
| 855 | 3000137400 | 3000135777 | Bacteria | 6891109 |
| 856 | 3004173302 | 3004167301 | Bacteria | 8330599 |
| 857 | 3004192498 | 3004188549 | Bacteria | 6952365 |
| 858 | 3004202459 | 3004195979 | Bacteria | 6776956 |
| 859 | 3004209605 | 3004203850 | Bacteria | 7307914 |
| 860 | 3004216956 | 3004211236 | Bacteria | 7417683 |
| 861 | 3004225450 | 3004218560 | Bacteria | 7421728 |
| 862 | 3004233962 | 3004232784 | Bacteria | 6662140 |
| 863 | 3004240854 | 3004239961 | Bacteria | 6892290 |
| 864 | 3004249981 | 3004248173 | Bacteria | 6563236 |
| 865 | 3004271818 | 3004268573 | Bacteria | 7043476 |
| 866 | 3004276107 | 3004275668 | Bacteria | 7114440 |
| 867 | 3004337242 | 3004334049 | Bacteria | 8449246 |
| 868 | 3005410736 | 3005409236 | Bacteria | 7188837 |
| 869 | 3005423150 | 3005416602 | Bacteria | 7064308 |
| 870 | 3005456484 | 3005452660 | Bacteria | 5889319 |
| 871 | 637077018 | 637000159 | Bacteria | 7596297 |
| 872 | 648736679 | 648276728 | Bacteria | 6968865 |
| 873 | 649870598 | 649633066 | Bacteria | 6690028 |
| 874 | 8002286423 | 8002285264 | Bacteria | 6717907 |
| 875 | 8003995806 | 8003992118 | Bacteria | 7266902 |
| 876 | 8004003566 | 8003999396 | Bacteria | 7063185 |
| 877 | 8004306371 | 8004300914 | Bacteria | 6132239 |
| 878 | 8004318537 | 8004312739 | Bacteria | 7444653 |
| 879 | 8004363092 | 8004361976 | Bacteria | 6858373 |
| 880 | 8004375749 | 8004374579 | Bacteria | 6898112 |
| 881 | 8004392909 | 8004387939 | Bacteria | 7049250 |
| 882 | 8004449476 | 8004445564 | Bacteria | 6322258 |
| 883 | 8004643856 | 8004640170 | Bacteria | 6723001 |
| 884 | 8004699362 | 8004695233 | Bacteria | 6731676 |
| 885 | 8004706707 | 8004703790 | Bacteria | 8006957 |
| 886 | 8004719696 | 8004714634 | Bacteria | 6776161 |
| 887 | 8004734668 | 8004727605 | Bacteria | 6643904 |
| 888 | 8005315477 | 8005314921 | Bacteria | 7072929 |
| 889 | 8005322619 | 8005321885 | Bacteria | 5795980 |
| 890 | 8005484615 | 8005484373 | Bacteria | 6297373 |
| 891 | 8005543358 | 8005542996 | Bacteria | 7077758 |
| 892 | 8005649308 | 8005645114 | Bacteria | 6950293 |
| 893 | 8005661606 | 8005658619 | Bacteria | 4500593 |
| 894 | 8005685455 | 8005682033 | Bacteria | 6726518 |
| 895 | 8018152823 | 8018150411 | Bacteria | 5549903 |
| 896 | 8046769623 | 8046767195 | Bacteria | 7547379 |
| 897 | 8049296693 | 8049293176 | Bacteria | 6128433 |
| 898 | 8055617952 | 8055617313 | Bacteria | 7548464 |
| 899 | 8057580338 | 8057575449 | Bacteria | 7367519 |
| 900 | Ga0105240_10287399 | |||
| 901 | LJNas_1000120 | |||
| 902 | JGI24740J21852_10003637 | |||
| 903 | JGI24739J22299_10028216 | |||
| 904 | JGI24735J21928_10019579 | |||
| 905 | JGI25156J39149_1013450 | |||
| 906 | JGI25162J39368_1000244 | |||
| 907 | JGI25162J39368_1000493 | |||
| 908 | JGI25158J39367_1000756 | |||
| 909 | JGI25157J39369_1000555 | |||
| 910 | JGI25152J39213_1004107 | |||
| 911 | JGI25159J45721_1000015 | |||
| 912 | JGI25159J45721_1000338 | |||
| 913 | JGI25151J46595_10033099 | |||
| 914 | JGI25406J46586_10006406 | |||
| 915 | JGI25165J46597_1000079 | |||
| 916 | JGI25165J46597_1000553 | |||
| 917 | JGI25165J46597_1000796 | |||
| 918 | rootH2_10027501 | |||
| 919 | rootH1_10271729 | |||
| 920 | JGI25160J50197_1000003 | |||
| 921 | JGI25160J50197_1000012 | |||
| 922 | JGI25161J50226_1000002 | |||
| 923 | JGI25161J50226_1000219 | |||
| 924 | Ga0055542_1000618 | |||
| 925 | Ga0055542_1001408 | |||
| 926 | Ga0055529_1003209 | |||
| 927 | Ga0055526_1003824 | |||
| 928 | Ga0055536_1005156 | |||
| 929 | Ga0055528_1021666 | |||
| 930 | Ga0055540_1008648 | |||
| 931 | Ga0055531_10011294 | |||
| 932 | Ga0055543_1000011 | |||
| 933 | Ga0055543_1000034 | |||
| 934 | Ga0065165_1000025 | |||
| 935 | Ga0065165_1000082 | |||
| 936 | Ga0070658_10085777 | |||
| 937 | Ga0070660_100079572 | |||
| 938 | Ga0070660_100209391 | |||
| 939 | Ga0070668_100006252 | |||
| 940 | Ga0070671_100130795 | |||
| 941 | Ga0070663_100068052 | |||
| 942 | Ga0068853_100328096 | |||
| 943 | Ga0070665_100028010 | |||
| 944 | Ga0070665_100052306 | |||
| 945 | Ga0070665_100079272 | |||
| 946 | Ga0070665_100112308 | |||
| 947 | Ga0070665_100270158 | |||
| 948 | Ga0070665_100303155 | |||
| 949 | Ga0070665_100628597 | |||
| 950 | Ga0068855_100008160 | |||
| 951 | Ga0068855_100310359 | |||
| 952 | Ga0068855_100463947 | |||
| 953 | Ga0068857_100206963 | |||
| 954 | Ga0068854_100100728 | |||
| 955 | Ga0068856_100976370 | |||
| 956 | Ga0068852_100191337 | |||
| 957 | Ga0081540_1009710 | |||
| 958 | Ga0081539_10002395 | |||
| 959 | Ga0075365_10014555 | |||
| 960 | Ga0075365_10154229 | |||
| 961 | Ga0075365_10180082 | |||
| 962 | Ga0075368_10016651 | |||
| 963 | Ga0075364_10270979 | |||
| 964 | Ga0075362_10034225 | |||
| 965 | Ga0075367_10002953 | |||
| 966 | Ga0075367_10099335 | |||
| 967 | Ga0075367_10299299 | |||
| 968 | Ga0075367_10371192 | |||
| 969 | Ga0075370_10147872 | |||
| 970 | Ga0075370_10294165 | |||
| 971 | Ga0068871_100538950 | |||
| 972 | Ga0079104_1002459 | |||
| 973 | Ga0079104_1006003 | |||
| 974 | Ga0105251_10009293 | |||
| 975 | Ga0105240_10249534 | |||
| 976 | Ga0105247_10172516 | |||
| 977 | Ga0105248_10012216 | |||
| 978 | Ga0105237_10038673 | |||
| 979 | Ga0105237_10540323 | |||
| 980 | Ga0105237_10851545 | |||
| 981 | Ga0105238_10040306 | |||
| 982 | Ga0105239_10127612 | |||
| 983 | Ga0157370_10064885 | |||
| 984 | Ga0157370_10593368 | |||
| 985 | Ga0157369_10006251 | |||
| 986 | Ga0157369_10021348 | |||
| 987 | Ga0157369_10059190 | |||
| 988 | Ga0157374_10014300 | |||
| 989 | Ga0157372_10022080 | |||
| 990 | Ga0157372_10356875 | |||
| 991 | Ga0163163_10029885 | |||
| 992 | Ga0163163_10220505 | |||
| 993 | Ga0182008_10042226 | |||
| 994 | Ga0157376_10037849 | |||
| 995 | Ga0182006_1047427 | |||
| 996 | Ga0182007_10004110 | |||
| 997 | Ga0182005_1007445 | |||
| 998 | Ga0228711_1003057 | |||
| 999 | Ga0228710_1000004 | |||
| 1000 | Ga0209760_101730 | |||
| 1001 | Ga0209436_100767 | |||
| 1002 | Ga0209436_115828 | |||
| 1003 | Ga0209563_105661 | |||
| 1004 | Ga0209437_100050 | |||
| 1005 | Ga0209437_100056 | |||
| 1006 | Ga0209437_107127 | |||
| 1007 | Ga0207425_1014638 | |||
| 1008 | Ga0209026_1000118 | |||
| 1009 | Ga0209677_102979 | |||
| 1010 | Ga0209148_1000212 | |||
| 1011 | Ga0209148_1005894 | |||
| 1012 | Ga0209759_1000076 | |||
| 1013 | Ga0209129_1001420 | |||
| 1014 | Ga0209233_1000037 | |||
| 1015 | Ga0209233_1000071 | |||
| 1016 | Ga0209233_1000236 | |||
| 1017 | Ga0209233_1000247 | |||
| 1018 | Ga0209233_1009599 | |||
| 1019 | Ga0209233_1019681 | |||
| 1020 | Ga0209455_1000170 | |||
| 1021 | Ga0209455_1021969 | |||
| 1022 | Ga0209673_1006659 | |||
| 1023 | Ga0209130_1000005 | |||
| 1024 | Ga0209130_1000028 | |||
| 1025 | Ga0209676_1003201 | |||
| 1026 | Ga0209025_1000105 | |||
| 1027 | Ga0209025_1040299 | |||
| 1028 | Ga0209564_1000113 | |||
| 1029 | Ga0209564_1009543 | |||
| 1030 | Ga0209758_1015666 | |||
| 1031 | Ga0209050_1000773 | |||
| 1032 | Ga0209256_1004283 | |||
| 1033 | Ga0209256_1019044 | |||
| 1034 | Ga0207426_1000012 | |||
| 1035 | Ga0207426_1000015 | |||
| 1036 | Ga0207426_1003762 | |||
| 1037 | Ga0207426_1022640 | |||
| 1038 | Ga0209051_1003420 | |||
| 1039 | Ga0209257_1002062 | |||
| 1040 | Ga0207713_1052608 | |||
| 1041 | Ga0207647_10009305 | |||
| 1042 | Ga0207647_10039889 | |||
| 1043 | Ga0207705_10010808 | |||
| 1044 | Ga0207705_10112997 | |||
| 1045 | Ga0207705_10426788 | |||
| 1046 | Ga0207654_10390094 | |||
| 1047 | Ga0207695_10235536 | |||
| 1048 | Ga0207695_10309487 | |||
| 1049 | Ga0207695_10364520 | |||
| 1050 | Ga0207695_10461299 | |||
| 1051 | Ga0207671_10119104 | |||
| 1052 | Ga0207671_10618974 | |||
| 1053 | Ga0207657_10056625 | |||
| 1054 | Ga0207649_10106102 | |||
| 1055 | Ga0207694_10008166 | |||
| 1056 | Ga0207659_10173312 | |||
| 1057 | Ga0207711_10095829 | |||
| 1058 | Ga0207711_10182891 | |||
| 1059 | Ga0207667_10012351 | |||
| 1060 | Ga0207668_10039475 | |||
| 1061 | Ga0207640_10039683 | |||
| 1062 | Ga0207639_10149943 | |||
| 1063 | Ga0207678_10036692 | |||
| 1064 | Ga0207702_10071810 | |||
| 1065 | Ga0207674_10033322 | |||
| 1066 | Ga0207674_10684775 | |||
| 1067 | Ga0209281_1000134 | |||
| 1068 | Ga0209281_1000445 | |||
| 1069 | Ga0209371_1004523 | |||
| 1070 | Ga0209282_1000029 | |||
| 1071 | Ga0268266_10002316 | |||
| 1072 | Ga0268266_10005331 | |||
| 1073 | Ga0268266_10012715 | |||
| 1074 | Ga0268266_10018558 | |||
| 1075 | Ga0268266_10022478 | |||
| 1076 | Ga0268266_10279701 | |||
| 1077 | Ga0268266_10684560 | |||
| 1078 | Ga0265338_10234800 | |||
| 1079 | Ga0268256_1003507 | |||
| 1080 | Ga0265339_10030630 | |||
| 1081 | Ga0265316_10052088 | |||
| 1082 | Ga0307513_10104308 | |||
| 1083 | Ga0307408_100296053 | |||
| 1084 | Ga0307405_10379387 | |||
| 1085 | Ga0307413_10193624 | |||
| 1086 | Ga0307406_10520473 | |||
| 1087 | Ga0307407_10305387 | |||
| 1088 | Ga0307412_10308405 | |||
| 1089 | Ga0315914_1000004 | |||
| 1090 | Ga0307416_100824385 | |||
| 1091 | Ga0307416_101006405 | |||
| 1092 | Ga0307414_10591751 | |||
| 1093 | Ga0315913_1000370 | |||
| 1094 | Ga0315915_1000003 | |||
| 1095 | Ga0373926_0084441 | |||
| 1096 | Ga0373927_0000144 | |||
| 1097 | Ga0373947_0100887 | |||
| 1098 | Ga0316582_0067401 | |||
| 1099 | Ga0316582_0296719 | |||
| 1100 | Ga0373925_0000481 | |||
| 1101 | Ga0395900_0246407 | |||
| 1102 | Ga0395900_0253816 | |||
| 1103 | Ga0395905_0069723 | |||
| 1104 | Ga0395905_0103827 | |||
| 1105 | Ga0395905_0401077 | |||
| 1106 | Ga0395905_0642189 | |||
| 1107 | Ga0395901_0062742 | |||
| 1108 | Ga0395901_0090720 | |||
| 1109 | Ga0395901_0279437 | |||
| 1110 | Ga0466972_0082084 | |||
| 1111 | Ga0466965_0215208 | |||
| 1112 | Ga0466958_0020303 | |||
| 1113 | Ga0495638_0002052 | |||
| 1114 | Ga0495650_0003032 | |||
| 1115 | Ga0495585_0019476 | |||
| 1116 | Ga0495606_0206785 | |||
| 1117 | Ga0495643_0025307 | |||
| 1118 | Ga0495645_0024585 | |||
| 1119 | Ga0495625_0000182 | |||
| 1120 | Ga0495625_0005589 | |||
| 1121 | Ga0495625_0025984 | |||
| 1122 | Ga0495625_0041200 | |||
| 1123 | Ga0495660_0159642 | |||
| 1124 | Ga0495672_0067521 | |||
| 1125 | Ga0495687_063021 | |||
| 1126 | Ga0495681_0094339 | |||
| 1127 | Ga0495686_0005687 | |||
| 1128 | Ga0495615_0103679 | |||
| 1129 | Ga0496102_0373845 | |||
| 1130 | Ga0496104_0245332 | |||
| 1131 | Ga0496108_0099977 | |||
| 1132 | Ga0496112_0073729 | |||
| 1133 | Ga0496112_0243971 | |||
| 1134 | Ga0496113_0224774 | |||
| 1135 | Ga0496115_0090073 | |||
| 1136 | Ga0496116_0014048 | |||
| 1137 | Ga0496116_0145175 | |||
| 1138 | Ga0496119_0016320 | |||
| 1139 | Ga0496120_0002072 | |||
| 1140 | Ga0496120_0023868 | |||
| 1141 | Ga0496122_0082939 | |||
| 1142 | Ga0496123_0029128 | |||
| 1143 | Ga0496124_0166319 | |||
| 1144 | Ga0496125_0075313 | |||
| 1145 | Ga0496125_0208006 | |||
| 1146 | Ga0496126_0003783 | |||
| 1147 | Ga0496126_0155177 | |||
| 1148 | Ga0501031_0000002 | |||
| 1149 | Ga0501031_0010981 | |||
| 1150 | Ga0501031_0032232 | |||
| 1151 | Ga0501031_0175768 | |||
| 1152 | Ga0501031_0259214 | |||
| 1153 | Ga0501032_0000004 | |||
| 1154 | Ga0501032_0001866 | |||
| 1155 | Ga0501032_0051201 | |||
| 1156 | Ga0501033_0000016 | |||
| 1157 | Ga0501033_0000182 | |||
| 1158 | Ga0501033_0000818 | |||
| 1159 | Ga0501033_0009577 | |||
| 1160 | Ga0501033_0022586 | |||
| 1161 | Ga0501033_0042065 | |||
| 1162 | Ga0501033_0133254 | |||
| 1163 | Ga0501033_0282180 | |||
| 1164 | Ga0501034_0000011 | |||
| 1165 | Ga0501034_0001712 | |||
| 1166 | Ga0501034_0007755 | |||
| 1167 | Ga0501034_0158900 | |||
| 1168 | Ga0501036_0000001 | |||
| 1169 | Ga0501036_0006422 | |||
| 1170 | Ga0501036_0030701 | |||
| 1171 | Ga0501036_0185647 | |||
| 1172 | Ga0501036_0278911 | |||
| 1173 | Ga0501036_0467918 | |||
| 1174 | Ga0501036_0477232 | |||
| 1175 | Ga0501037_0000006 | |||
| 1176 | Ga0501037_0000142 | |||
| 1177 | Ga0501038_0000003 | |||
| 1178 | Ga0501038_0000979 | |||
| 1179 | Ga0501038_0071504 | |||
| 1180 | Ga0501038_0148296 | |||
| 1181 | Ga0501038_0252505 | |||
| 1182 | Ga0501039_0000004 | |||
| 1183 | Ga0501039_0070449 | |||
| 1184 | Ga0501039_0605123 | |||
| 1185 | Ga0501040_0004502 | |||
| 1186 | Ga0501042_0068089 | |||
| 1187 | Ga0501043_0000066 | |||
| 1188 | Ga0501043_0000588 | |||
| 1189 | Ga0501043_0009297 | |||
| 1190 | Ga0501043_0332533 | |||
| 1191 | Ga0501046_0015684 | |||
| 1192 | Ga0501046_0096005 | |||
| 1193 | Ga0501047_0011488 | |||
| 1194 | Ga0501047_0024880 | |||
| 1195 | Ga0501047_0030377 | |||
| 1196 | Ga0501047_0075152 | |||
| 1197 | Ga0501047_0167104 | |||
| 1198 | Ga0501047_0423512 | |||
| 1199 | Ga0501048_0005100 | |||
| 1200 | Ga0501067_0029599 | |||
| 1201 | Ga0501067_0074703 | |||
| 1202 | Ga0501068_0005415 | |||
| 1203 | Ga0501068_0014507 | |||
| 1204 | Ga0501068_0113680 | |||
| 1205 | Ga0501069_0000002 | |||
| 1206 | Ga0501069_0008770 | |||
| 1207 | Ga0501069_0048007 | |||
| 1208 | Ga0501069_0106949 | |||
| 1209 | Ga0501070_0000051 | |||
| 1210 | Ga0501070_0002384 | |||
| 1211 | Ga0501070_0004526 | |||
| 1212 | Ga0501070_0006025 | |||
| 1213 | Ga0501070_0016663 | |||
| 1214 | Ga0501071_0085231 | |||
| 1215 | Ga0501071_0106162 | |||
| 1216 | Ga0501073_0006953 | |||
| 1217 | Ga0501073_0010824 | |||
| 1218 | Ga0501074_0001350 | |||
| 1219 | Ga0501074_0227658 | |||
| 1220 | Ga0501080_0001856 | |||
| 1221 | Ga0501080_0007434 | |||
| 1222 | Ga0501080_0042886 | |||
| 1223 | Ga0501080_0236362 | |||
| 1224 | Ga0501083_0000187 | |||
| 1225 | Ga0501083_0033156 | |||
| 1226 | Ga0501083_0110715 | |||
| 1227 | Ga0501035_0000009 | |||
| 1228 | Ga0501035_0002215 | |||
| 1229 | Ga0501035_0002554 | |||
| 1230 | Ga0501035_0002576 | |||
| 1231 | Ga0501035_0003955 | |||
| 1232 | Ga0501035_0007237 | |||
| 1233 | Ga0501035_0019856 | |||
| 1234 | Ga0501035_0045873 | |||
| 1235 | Ga0501035_0216599 | |||
| 1236 | Ga0501035_0369045 | |||
| 1237 | Ga0501035_0558194 | |||
| 1238 | Ga0501044_0000005 | |||
| 1239 | Ga0501044_0000923 | |||
| 1240 | Ga0501044_0007678 | |||
| 1241 | Ga0501044_0010931 | |||
| 1242 | Ga0501044_0017045 | |||
| 1243 | Ga0501044_0029897 | |||
| 1244 | Ga0501044_0157203 | |||
| 1245 | Ga0501044_0517847 | |||
| 1246 | Ga0501045_0015261 | |||
| 1247 | nmdc:mga03683_7962_c1 | |||
| 1248 | nmdc:mga03n38_49596_c1 | |||
| 1249 | nmdc:mga03n38_7203_c1 | |||
| 1250 | nmdc:mga00v17_115493_c1 | |||
| 1251 | nmdc:mga00v17_12374_c1 | |||
| 1252 | nmdc:mga0yw44_149407_c1 | |||
| 1253 | nmdc:mga0yw44_76772_c1 | |||
| 1254 | nmdc:mga0k408_388348_c1 | |||
| 1255 | nmdc:mga0sz30_50634_c1 | |||
| 1256 | nmdc:mga0sz30_57025_c1 | |||
| 1257 | Ga0495612_0085143 | |||
| 1258 | Ga0500559_0001518 | |||
| 1259 | Ga0500568_0000010 | |||
| 1260 | Ga0500604_0038969 | |||
| 1261 | Ga0500616_0070377 | |||
| 1262 | Ga0500616_0216385 | |||
| 1263 | Ga0500620_001452 | |||
| 1264 | Ga0500627_0210728 | |||
| 1265 | Ga0500611_004053 | |||
| 1266 | Ga0587083_0014694 | |||
| 1267 | 2503198747 | |||
| 1268 | 2509114127 | |||
| 1269 | 2509144411 | |||
| 1270 | 2509368776 | |||
| 1271 | 2509393634 | |||
| 1272 | 2510308163 | |||
| 1273 | 2510315060 | |||
| 1274 | 2511137143 | |||
| 1275 | 2511498942 | |||
| 1276 | 2512933855 | |||
| 1277 | 2512962052 | |||
| 1278 | 2512973105 | |||
| 1279 | 2513587210 | |||
| 1280 | 2513604314 | |||
| 1281 | 2513610502 | |||
| 1282 | 2513616200 | |||
| 1283 | 2513870246 | |||
| 1284 | 2513882647 | |||
| 1285 | 2513904630 | |||
| 1286 | 2513911075 | |||
| 1287 | 2513924407 | |||
| 1288 | 2514008172 | |||
| 1289 | 2514039142 | |||
| 1290 | 2514417570 | |||
| 1291 | 2515607360 | |||
| 1292 | 2516895218 | |||
| 1293 | 2517571895 | |||
| 1294 | 2524450898 | |||
| 1295 | 2524458030 | |||
| 1296 | 2535514690 | |||
| 1297 | 2551675220 | |||
| 1298 | 2551686967 | |||
| 1299 | 2551709248 | |||
| 1300 | 2551743146 | |||
| 1301 | 2585164521 | |||
| 1302 | 2585273604 | |||
| 1303 | 2585326311 | |||
| 1304 | 2585330477 | |||
| 1305 | 2585386114 | |||
| 1306 | 2585398968 | |||
| 1307 | 2585533831 | |||
| 1308 | 2585553424 | |||
| 1309 | 2585559777 | |||
| 1310 | 2585818911 | |||
| 1311 | 2585900465 | |||
| 1312 | 2585906043 | |||
| 1313 | 2587978842 | |||
| 1314 | 2588519953 | |||
| 1315 | 2597810709 | |||
| 1316 | 2599419634 | |||
| 1317 | 2599940126 | |||
| 1318 | 2600197546 | |||
| 1319 | 2616556220 | |||
| 1320 | 2617380582 | |||
| 1321 | 2643773368 | |||
| 1322 | 2643839500 | |||
| 1323 | 2643985819 | |||
| 1324 | 2644004532 | |||
| 1325 | 2644134020 | |||
| 1326 | 2644144561 | |||
| 1327 | 2644157121 | |||
| 1328 | 2644196955 | |||
| 1329 | 2644306612 | |||
| 1330 | 2644330802 | |||
| 1331 | 2644542392 | |||
| 1332 | 2644612223 | |||
| 1333 | 2644671579 | |||
| 1334 | 2671113994 | |||
| 1335 | 2688596031 | |||
| 1336 | 2692317657 | |||
| 1337 | 2694627774 | |||
| 1338 | 2694636047 | |||
| 1339 | 2694636888 | |||
| 1340 | 2723573188 | |||
| 1341 | 2738947736 | |||
| 1342 | 2739309892 | |||
| 1343 | 2756675102 | |||
| 1344 | 2776269449 | |||
| 1345 | 2776282379 | |||
| 1346 | 2778173839 | |||
| 1347 | 2792583338 | |||
| 1348 | 2792625275 | |||
| 1349 | 2792747241 | |||
| 1350 | 2802718672 | |||
| 1351 | 2802724352 | |||
| 1352 | 2802729986 | |||
| 1353 | 2802737329 | |||
| 1354 | 2802742245 | |||
| 1355 | 2802748927 | |||
| 1356 | 2819608735 | |||
| 1357 | 2819640844 | |||
| 1358 | 2838029626 | |||
| 1359 | 2838039834 | |||
| 1360 | 2841736421 | |||
| 1361 | 2842299788 | |||
| 1362 | 2842359690 | |||
| 1363 | 2842475944 | |||
| 1364 | 2842486027 | |||
| 1365 | 2842503154 | |||
| 1366 | 2842513022 | |||
| 1367 | 2844003406 | |||
| 1368 | 2844010844 | |||
| 1369 | 2844170042 | |||
| 1370 | 2847421363 | |||
| 1371 | 2847673487 | |||
| 1372 | 2847689996 | |||
| 1373 | 2855827856 | |||
| 1374 | 2855843224 | |||
| 1375 | 2856319044 | |||
| 1376 | 2856323815 | |||
| 1377 | 2856332484 | |||
| 1378 | 2856337387 | |||
| 1379 | 2856347486 | |||
| 1380 | 2856350804 | |||
| 1381 | 2856358208 | |||
| 1382 | 2856369813 | |||
| 1383 | 2857352991 | |||
| 1384 | 2857370485 | |||
| 1385 | 2858802952 | |||
| 1386 | 2869166073 | |||
| 1387 | 2869170896 | |||
| 1388 | 2869235644 | |||
| 1389 | 2869252877 | |||
| 1390 | 2869261601 | |||
| 1391 | 2869267939 | |||
| 1392 | 2869272818 | |||
| 1393 | 2869284786 | |||
| 1394 | 2869290620 | |||
| 1395 | 2871432902 | |||
| 1396 | 2871443221 | |||
| 1397 | 2871457001 | |||
| 1398 | 2871462355 | |||
| 1399 | 2871471713 | |||
| 1400 | 2871477215 | |||
| 1401 | 2871484220 | |||
| 1402 | 2871489792 | |||
| 1403 | 2871499836 | |||
| 1404 | 2874107208 | |||
| 1405 | 2874112251 | |||
| 1406 | 2874118167 | |||
| 1407 | 2874128388 | |||
| 1408 | 2874131936 | |||
| 1409 | 2874142893 | |||
| 1410 | 2874153937 | |||
| 1411 | 2874158625 | |||
| 1412 | 2874165960 | |||
| 1413 | 2874172496 | |||
| 1414 | 2876363889 | |||
| 1415 | 2876373106 | |||
| 1416 | 2876379261 | |||
| 1417 | 2876390969 | |||
| 1418 | 2876396982 | |||
| 1419 | 2876400159 | |||
| 1420 | 2876413444 | |||
| 1421 | 2876419242 | |||
| 1422 | 2876427413 | |||
| 1423 | 2878039433 | |||
| 1424 | 2878741037 | |||
| 1425 | 2878750515 | |||
| 1426 | 2878754172 | |||
| 1427 | 2878764000 | |||
| 1428 | 2878771030 | |||
| 1429 | 2878777743 | |||
| 1430 | 2878785704 | |||
| 1431 | 2878788966 | |||
| 1432 | 2881148256 | |||
| 1433 | 2881159339 | |||
| 1434 | 2881165039 | |||
| 1435 | 2881847566 | |||
| 1436 | 2881855859 | |||
| 1437 | 2881864554 | |||
| 1438 | 2882636790 | |||
| 1439 | 2882915899 | |||
| 1440 | 2885306907 | |||
| 1441 | 2885314086 | |||
| 1442 | 2885320096 | |||
| 1443 | 2885335464 | |||
| 1444 | 2885344996 | |||
| 1445 | 2885352925 | |||
| 1446 | 2888343352 | |||
| 1447 | 2888344425 | |||
| 1448 | 2888353129 | |||
| 1449 | 2889014975 | |||
| 1450 | 2889019955 | |||
| 1451 | 2903454030 | |||
| 1452 | 2903497513 | |||
| 1453 | 2903499639 | |||
| 1454 | 2903513887 | |||
| 1455 | 2903525952 | |||
| 1456 | 2903532502 | |||
| 1457 | 2903544647 | |||
| 1458 | 2904663736 | |||
| 1459 | 2906313440 | |||
| 1460 | 2906326149 | |||
| 1461 | 2906334142 | |||
| 1462 | 2906355873 | |||
| 1463 | 2906367797 | |||
| 1464 | 2906371268 | |||
| 1465 | 2906382012 | |||
| 1466 | 2906390073 | |||
| 1467 | 2906399367 | |||
| 1468 | 2906405153 | |||
| 1469 | 2906413864 | |||
| 1470 | 2906419115 | |||
| 1471 | 2906432854 | |||
| 1472 | 2913311610 | |||
| 1473 | 2915986596 | |||
| 1474 | 2915993660 | |||
| 1475 | 2915994196 | |||
| 1476 | 2916004902 | |||
| 1477 | 2916008305 | |||
| 1478 | 2916015124 | |||
| 1479 | 2916026181 | |||
| 1480 | 2916035163 | |||
| 1481 | 2916041532 | |||
| 1482 | 2916047426 | |||
| 1483 | 2916054837 | |||
| 1484 | 2916058943 | |||
| 1485 | 2916065888 | |||
| 1486 | 2916071699 | |||
| 1487 | 2916077278 | |||
| 1488 | 2919408464 | |||
| 1489 | 2921202469 | |||
| 1490 | 2921209226 | |||
| 1491 | 2921237611 | |||
| 1492 | 2921249756 | |||
| 1493 | 2921254873 | |||
| 1494 | 2921263866 | |||
| 1495 | 2921270529 | |||
| 1496 | 2921283121 | |||
| 1497 | 2921290001 | |||
| 1498 | 2921301751 | |||
| 1499 | 2922134635 | |||
| 1500 | 2922157629 | |||
| 1501 | 2922162016 | |||
| 1502 | 2922175649 | |||
| 1503 | 2922183223 | |||
| 1504 | 2922188853 | |||
| 1505 | 2923556304 | |||
| 1506 | 2924146146 | |||
| 1507 | 2924158219 | |||
| 1508 | 2924164548 | |||
| 1509 | 2924171361 | |||
| 1510 | 2924179621 | |||
| 1511 | 2924180045 | |||
| 1512 | 2924186811 | |||
| 1513 | 2924200286 | |||
| 1514 | 2924202603 | |||
| 1515 | 2924209452 | |||
| 1516 | 2924216663 | |||
| 1517 | 2924227049 | |||
| 1518 | 2924234751 | |||
| 1519 | 2924710593 | |||
| 1520 | 2924720569 | |||
| 1521 | 2924731419 | |||
| 1522 | 2924734850 | |||
| 1523 | 2924747703 | |||
| 1524 | 2924752954 | |||
| 1525 | 2924760814 | |||
| 1526 | 2924766119 | |||
| 1527 | 2924778638 | |||
| 1528 | 2924784860 | |||
| 1529 | 2936998652 | |||
| 1530 | 2937006328 | |||
| 1531 | 2937011686 | |||
| 1532 | 2937018392 | |||
| 1533 | 2937025734 | |||
| 1534 | 2937033613 | |||
| 1535 | 2937040351 | |||
| 1536 | 2937044593 | |||
| 1537 | 2937055983 | |||
| 1538 | 2937057231 | |||
| 1539 | 2937069957 | |||
| 1540 | 2937078325 | |||
| 1541 | 2937082702 | |||
| 1542 | 2937088639 | |||
| 1543 | 2937092589 | |||
| 1544 | 2937106313 | |||
| 1545 | 2937108289 | |||
| 1546 | 2937118678 | |||
| 1547 | 2937121877 | |||
| 1548 | 2937129665 | |||
| 1549 | 2937820256 | |||
| 1550 | 2937822696 | |||
| 1551 | 2937850091 | |||
| 1552 | 2937867692 | |||
| 1553 | 2937870478 | |||
| 1554 | 2937878464 | |||
| 1555 | 2937892671 | |||
| 1556 | 2937974305 | |||
| 1557 | 2937998495 | |||
| 1558 | 2957377919 | |||
| 1559 | 2957384337 | |||
| 1560 | 2957393787 | |||
| 1561 | 2957396037 | |||
| 1562 | 2957405590 | |||
| 1563 | 2957413517 | |||
| 1564 | 2957422284 | |||
| 1565 | 2957425509 | |||
| 1566 | 2957434343 | |||
| 1567 | 2957437540 | |||
| 1568 | 2957450150 | |||
| 1569 | 2957452830 | |||
| 1570 | 2957458223 | |||
| 1571 | 2957466299 | |||
| 1572 | 2957474681 | |||
| 1573 | 2957484092 | |||
| 1574 | 2957485215 | |||
| 1575 | 2957493785 | |||
| 1576 | 2957499264 | |||
| 1577 | 2957506017 | |||
| 1578 | 2958041359 | |||
| 1579 | 2958042333 | |||
| 1580 | 2958046639 | |||
| 1581 | 2958071194 | |||
| 1582 | 2958077376 | |||
| 1583 | 2958085737 | |||
| 1584 | 2958106546 | |||
| 1585 | 2958119124 | |||
| 1586 | 2958123987 | |||
| 1587 | 2958135020 | |||
| 1588 | 2958141397 | |||
| 1589 | 2958144747 | |||
| 1590 | 2958164386 | |||
| 1591 | 2958168971 | |||
| 1592 | 2958177138 | |||
| 1593 | 2958184049 | |||
| 1594 | 2960584622 | |||
| 1595 | 2960593265 | |||
| 1596 | 2960603178 | |||
| 1597 | 2960609368 | |||
| 1598 | 2960615337 | |||
| 1599 | 2960623249 | |||
| 1600 | 2960624825 | |||
| 1601 | 2960637051 | |||
| 1602 | 2960638877 | |||
| 1603 | 2960650944 | |||
| 1604 | 2960659365 | |||
| 1605 | 2960666939 | |||
| 1606 | 2960670179 | |||
| 1607 | 2960679550 | |||
| 1608 | 2960685247 | |||
| 1609 | 2960693656 | |||
| 1610 | 2960697376 | |||
| 1611 | 2961082104 | |||
| 1612 | 2961119124 | |||
| 1613 | 2961129713 | |||
| 1614 | 2961139603 | |||
| 1615 | 2961167433 | |||
| 1616 | 2961176230 | |||
| 1617 | 2961187584 | |||
| 1618 | 2963645347 | |||
| 1619 | 2964611556 | |||
| 1620 | 2964621555 | |||
| 1621 | 2964622459 | |||
| 1622 | 2964634249 | |||
| 1623 | 2964641419 | |||
| 1624 | 2964644966 | |||
| 1625 | 2964655945 | |||
| 1626 | 2964657017 | |||
| 1627 | 2964670343 | |||
| 1628 | 2964672389 | |||
| 1629 | 2964684543 | |||
| 1630 | 2964685342 | |||
| 1631 | 2964692384 | |||
| 1632 | 2964705397 | |||
| 1633 | 2964708965 | |||
| 1634 | 2964713027 | |||
| 1635 | 2964720285 | |||
| 1636 | 2965022255 | |||
| 1637 | 2965029932 | |||
| 1638 | 2965035993 | |||
| 1639 | 2965044239 | |||
| 1640 | 2965052391 | |||
| 1641 | 2965064143 | |||
| 1642 | 2965094816 | |||
| 1643 | 2965105261 | |||
| 1644 | 2965115722 | |||
| 1645 | 2965123609 | |||
| 1646 | 2967665783 | |||
| 1647 | 2967671968 | |||
| 1648 | 2967679120 | |||
| 1649 | 2967689917 | |||
| 1650 | 2967695287 | |||
| 1651 | 2967701129 | |||
| 1652 | 2967707694 | |||
| 1653 | 2967720682 | |||
| 1654 | 2967728489 | |||
| 1655 | 2967732787 | |||
| 1656 | 2967741114 | |||
| 1657 | 2967742370 | |||
| 1658 | 2967749591 | |||
| 1659 | 2967761949 | |||
| 1660 | 2967768680 | |||
| 1661 | 2967771404 | |||
| 1662 | 2967776559 | |||
| 1663 | 2967996855 | |||
| 1664 | 2968004918 | |||
| 1665 | 2968022879 | |||
| 1666 | 2968089756 | |||
| 1667 | 2968093553 | |||
| 1668 | 2968101402 | |||
| 1669 | 2968114875 | |||
| 1670 | 2968122606 | |||
| 1671 | 2968134018 | |||
| 1672 | 2968143086 | |||
| 1673 | 2968175840 | |||
| 1674 | 2970020055 | |||
| 1675 | 2970031055 | |||
| 1676 | 2970046858 | |||
| 1677 | 2970051846 | |||
| 1678 | 2970060402 | |||
| 1679 | 2970062071 | |||
| 1680 | 2970082276 | |||
| 1681 | 2970087991 | |||
| 1682 | 2970091653 | |||
| 1683 | 2970102493 | |||
| 1684 | 2970108312 | |||
| 1685 | 2970113543 | |||
| 1686 | 2970121994 | |||
| 1687 | 2970128607 | |||
| 1688 | 2970135415 | |||
| 1689 | 2970137819 | |||
| 1690 | 2970149322 | |||
| 1691 | 2970153611 | |||
| 1692 | 2970157884 | |||
| 1693 | 2970169670 | |||
| 1694 | 2970174044 | |||
| 1695 | 2970182451 | |||
| 1696 | 2970187008 | |||
| 1697 | 2970198645 | |||
| 1698 | 2970475464 | |||
| 1699 | 2970493686 | |||
| 1700 | 2970508901 | |||
| 1701 | 2970517239 | |||
| 1702 | 2970526140 | |||
| 1703 | 2970534121 | |||
| 1704 | 2970553232 | |||
| 1705 | 2970558844 | |||
| 1706 | 2970599397 | |||
| 1707 | 2970621582 | |||
| 1708 | 2970630673 | |||
| 1709 | 2977517458 | |||
| 1710 | 2977530351 | |||
| 1711 | 2977530996 | |||
| 1712 | 2977538610 | |||
| 1713 | 2977548645 | |||
| 1714 | 2977554209 | |||
| 1715 | 2977565326 | |||
| 1716 | 2977569975 | |||
| 1717 | 2977579425 | |||
| 1718 | 2977584028 | |||
| 1719 | 2977823387 | |||
| 1720 | 2977835456 | |||
| 1721 | 2977847051 | |||
| 1722 | 2977855810 | |||
| 1723 | 2977864191 | |||
| 1724 | 2977868123 | |||
| 1725 | 2977875957 | |||
| 1726 | 2977899474 | |||
| 1727 | 2977913185 | |||
| 1728 | 2977920181 | |||
| 1729 | 2977924551 | |||
| 1730 | 2977941145 | |||
| 1731 | 2977943294 | |||
| 1732 | 2977952899 | |||
| 1733 | 2977962248 | |||
| 1734 | 2977976220 | |||
| 1735 | 2977992106 | |||
| 1736 | 2979710776 | |||
| 1737 | 2979747025 | |||
| 1738 | 2979765957 | |||
| 1739 | 2979786418 | |||
| 1740 | 2979794125 | |||
| 1741 | 2979813580 | |||
| 1742 | 2987641584 | |||
| 1743 | 2987650523 | |||
| 1744 | 2987656327 | |||
| 1745 | 2987663439 | |||
| 1746 | 2987667003 | |||
| 1747 | 2987678534 | |||
| 1748 | 2996311558 | |||
| 1749 | 2996341488 | |||
| 1750 | 2996341921 | |||
| 1751 | 2996349399 | |||
| 1752 | 2996387017 | |||
| 1753 | 2996888092 | |||
| 1754 | 3000137400 | |||
| 1755 | 3004173302 | |||
| 1756 | 3004192498 | |||
| 1757 | 3004202459 | |||
| 1758 | 3004209605 | |||
| 1759 | 3004216956 | |||
| 1760 | 3004225450 | |||
| 1761 | 3004233962 | |||
| 1762 | 3004240854 | |||
| 1763 | 3004249981 | |||
| 1764 | 3004271818 | |||
| 1765 | 3004276107 | |||
| 1766 | 3004337242 | |||
| 1767 | 3005410736 | |||
| 1768 | 3005423150 | |||
| 1769 | 3005456484 | |||
| 1770 | 637077018 | |||
| 1771 | 648736679 | |||
| 1772 | 649870598 | |||
| 1773 | 8002286423 | |||
| 1774 | 8003995806 | |||
| 1775 | 8004003566 | |||
| 1776 | 8004306371 | |||
| 1777 | 8004318537 | |||
| 1778 | 8004363092 | |||
| 1779 | 8004375749 | |||
| 1780 | 8004392909 | |||
| 1781 | 8004449476 | |||
| 1782 | 8004643856 | |||
| 1783 | 8004699362 | |||
| 1784 | 8004706707 | |||
| 1785 | 8004719696 | |||
| 1786 | 8004734668 | |||
| 1787 | 8005315477 | |||
| 1788 | 8005322619 | |||
| 1789 | 8005484615 | |||
| 1790 | 8005543358 | |||
| 1791 | 8005649308 | |||
| 1792 | 8005661606 | |||
| 1793 | 8005685455 | |||
| 1794 | 8018152823 | |||
| 1795 | 8046769623 | |||
| 1796 | 8049296693 | |||
| 1797 | 8055617952 | |||
| 1798 | 8057580338 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1dbt-assembly2.cif.gz_C-2 | crystal structure of orotidine 5'-monophosphate decarboxylase from bacillus subtilis complexed with ump | 0.9702 | 17 | 242 |
| 1jjk-assembly1.cif.gz_A | selenomethionine substitution of orotidine-5'-monophosphate decarboxylase from e. coli causes a change in crystal contacts and space group | 0.9604 | 19 | 241 |
| 8cso-assembly1.cif.gz_B | crystal structure of orotidine 5'-phosphate decarboxylase from klebsiella pneumoniae in complex with uridine-5'-monophosphate | 0.9581 | 18 | 242 |
| 3ru6-assembly2.cif.gz_C | 1.8 angstrom resolution crystal structure of orotidine 5'-phosphate decarboxylase (pyrf) from campylobacter jejuni subsp. jejuni nctc 11168 | 0.9505 | 18 | 241 |
| 3ru6-assembly1.cif.gz_D | 1.8 angstrom resolution crystal structure of orotidine 5'-phosphate decarboxylase (pyrf) from campylobacter jejuni subsp. jejuni nctc 11168 | 0.9457 | 18 | 240 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1jjkA00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9476 | 19 | 241 | 3.20.20.70 |
| 3ru6D00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9457 | 18 | 240 | 3.20.20.70 |
| 3ru6D00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9331 | 18 | 240 | 3.20.20.70 |
| 2yyuB00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9295 | 18 | 241 | 3.20.20.70 |
| 1jjkA00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9188 | 19 | 241 | 3.20.20.70 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-Q3AC06-F1-model_v4 | Orotidine 5'-phosphate decarboxylase (EC 4.1.1.23) (OMP decarboxylase) (OMPDCase) (OMPdecase) | 0.9825 | 16 | 243 |
GO:0004590
GO:0005829 GO:0006207 GO:0044205 |
| AF-A0A7C3S5B3-F1-model_v4 | Orotidine 5'-phosphate decarboxylase (EC 4.1.1.23) (OMP decarboxylase) (OMPDCase) (OMPdecase) | 0.9784 | 15 | 241 |
GO:0004590
GO:0005829 GO:0006207 GO:0044205 |
| AF-A0A3D1YY64-F1-model_v4 | Orotidine 5'-phosphate decarboxylase (EC 4.1.1.23) (OMP decarboxylase) (OMPDCase) (OMPdecase) | 0.9784 | 18 | 244 |
GO:0004590
GO:0005829 GO:0006207 GO:0044205 |
| AF-A0A0F0CST2-F1-model_v4 | Orotidine 5'-phosphate decarboxylase (EC 4.1.1.23) (OMP decarboxylase) (OMPDCase) (OMPdecase) | 0.9772 | 15 | 242 |
GO:0004590
GO:0005829 GO:0006207 GO:0044205 |
| AF-A0A2V9V226-F1-model_v4 | Orotidine 5'-phosphate decarboxylase (EC 4.1.1.23) (OMP decarboxylase) (OMPDCase) (OMPdecase) | 0.9767 | 13 | 241 |
GO:0004590
GO:0005829 GO:0006207 GO:0044205 |