F485100

General Info

Members Datasets Scaffolds Average Seq Length
899 736 1798 235

Family's Representative Sequence

Representative Sequence 3300009093|Ga0105240_10287399|Ga0105240_102873992
Length 291
Sequence MEVCQFDVALNRRALSAKFIRLKTHMRTMRYDSIMPIPERLNPIFANSEPANLRLEQARQRLIIALDVPDAASAVALVDRLEGTCRWCKVGLELFVAAGPAIVEKLSKRGLSIFLDLKFHDIPNTVAGAVRSASALGAKMLTLHAAGGPAMLASAHDAVSQLSDPPQLLAVTVLTSMDKAQLGAVGVKREPGPQVKLLAEMGMAAGLRGFVCSPEEVAELRSLSGQEGVLVVPGIRPAGAAVGDQKRIATPASAIRDGASYLVVGRPISQASNAAAAADAIVHEIAEELSA

Samples

Sample ID Description Type Environment
1 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
2 3300000546 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
5 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
6 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
7 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
8 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
9 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
10 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
11 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
12 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
13 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
14 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
15 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
16 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
17 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
18 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
19 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
20 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
21 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
22 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
23 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
24 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
25 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
26 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
27 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
28 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
29 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
30 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
31 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
32 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
33 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
34 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
35 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
36 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
37 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
38 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
39 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
40 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
41 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
42 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
43 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
44 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
45 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
46 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
47 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
48 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
49 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
50 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
51 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
52 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
53 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
54 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
55 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
56 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
57 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
58 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
59 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
60 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
61 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
62 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
63 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
64 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
65 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
66 3300022739 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules Metagenome Nodule
67 3300022740 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules Metagenome Nodule
68 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
69 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
70 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
71 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
72 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
73 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
74 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
75 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
76 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
77 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
78 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
79 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
80 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
81 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
82 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
83 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
84 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
85 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
86 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
87 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
88 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
89 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
90 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
91 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
110 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
111 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
112 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
114 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
115 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
116 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
117 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
118 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
119 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
120 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
121 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
122 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
123 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
124 3300031967 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules Metagenome Nodule
125 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
126 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
127 3300033430 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules Metagenome Nodule
128 3300033464 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules Metagenome Nodule
129 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
130 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
131 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
132 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
133 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
134 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
135 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
136 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
137 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
138 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
139 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
140 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
141 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
142 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
143 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
144 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
145 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
146 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
147 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
148 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
149 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
150 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
151 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
152 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
153 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
154 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
155 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
156 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
157 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
158 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
159 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
160 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
161 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
162 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
163 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
164 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
165 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
166 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
167 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
168 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
169 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
170 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
171 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
172 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
173 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
174 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
175 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
176 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
177 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
178 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
179 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
180 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
181 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
182 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
183 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
184 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
185 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
186 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
187 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
188 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
189 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
190 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
191 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
192 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
193 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
194 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
195 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
196 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
197 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
198 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
199 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
200 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
201 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
202 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
203 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
204 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
205 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
206 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
207 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
208 2503198000 Mesorhizobium opportunistum WSM2075 Isolate Nodule
209 2508501123 Mesorhizobium sp. WSM3626 Isolate Nodule
210 2508501127 Mesorhizobium sp. WSM2561 Isolate Nodule
211 2509276018 Mesorhizobium ciceri CMG6 Isolate Nodule
212 2509276022 Mesorhizobium australicum WSM2073 Isolate Nodule
213 2510065057 Sinorhizobium meliloti WSM1022 Isolate Nodule
214 2510065059 Mesorhizobium ciceri WSM4083 Isolate Nodule
215 2510917022 Rhizobium sp. AP16 Isolate Rhizosphere
216 2511231052 Sinorhizobium meliloti AK58 Isolate Nodule
217 2512875016 Mesorhizobium japonicum R7A Isolate Nodule
218 2512875024
219 2512875026 Sinorhizobium medicae WSM1115 Isolate Nodule
220 2513237086 Sinorhizobium meliloti MVII-I Isolate Nodule
221 2513237089 Sinorhizobium medicae DI28 Isolate Nodule
222 2513237090 Mesorhizobium sp. WSM3224 Isolate Nodule
223 2513237091 Sinorhizobium meliloti RRI128 Isolate Nodule
224 2513237138 Rhizobium favelukesii OR191 Isolate Nodule
225 2513237140 Sinorhizobium meliloti GVPV12 Isolate Nodule
226 2513237143 Sinorhizobium meliloti Mlalz-1 Isolate Nodule
227 2513237144 Rhizobium sullae WSM1592 Isolate Nodule
228 2513237146 Rhizobium mongolense USDA 1844 (Illumina) Isolate Nodule
229 2513237160 Sinorhizobium medicae WSM244 Isolate Nodule
230 2513237164 Mesorhizobium loti CJ3sym Isolate Nodule
231 2513237305 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
232 2515154107 Sinorhizobium meliloti 4H41 Isolate Nodule
233 2516653046 Sinorhizobium meliloti BO21CC Isolate Nodule
234 2517487022 Sinorhizobium medicae WSM4191 Isolate Nodule
235 2524023207 Ensifer sp. USDA 6670 Isolate Nodule
236 2524023209 Rhizobium leucaenae USDA 9039 Isolate Nodule
237 2534681796 Rhizobium grahamii CCGE 502 Isolate Nodule
238 2551306084 Sinorhizobium meliloti 5A14 Isolate Nodule
239 2551306085 Sinorhizobium meliloti AE608H Isolate Nodule
240 2551306089 Sinorhizobium meliloti 1A42 Isolate Nodule
241 2551306093 Sinorhizobium meliloti C0438LL Isolate Nodule
242 2582581283 Rhizobium sp. OK665 Isolate Rhizosphere
243 2582581307 Rhizobium sp. YR060 Isolate Rhizosphere
244 2582581315 Agrobacterium rhizogenes YR147 Isolate Rhizosphere
245 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
246 2582581865 Rhizobium sp. CF258 Isolate Rhizosphere
247 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
248 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
249 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
250 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
251 2585427590 Rhizobium sp. CF048 Isolate Rhizosphere
252 2585427608 Agrobacterium rhizogenes OV677 Isolate Rhizosphere
253 2585427609 Agrobacterium rhizogenes CF263 Isolate Rhizosphere
254 2585428125 Agrobacterium rhizogenes CF262 Isolate Rhizosphere
255 2588253730 Mesorhizobium huakuii 7653R Isolate Rhizosphere
256 2597489875 Mesorhizobium ciceri ca181 Isolate Unclassified
257 2599185170 Rhizobium mongolense USDA 1844 (PacBio) Isolate Nodule
258 2599185301 Mesorhizobium sp. NFR06 Isolate Rhizoplane
259 2599185352 Sinorhizobium sp. NFACC03 Isolate Rhizoplane
260 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
261 2617270742 Rhizobium miluonense HAMBI 2971 Isolate Nodule
262 2643221550 Mesorhizobium sp. Root552 Isolate Unclassified
263 2643221564 Mesorhizobium sp. Root157 Isolate Unclassified
264 2643221595 Mesorhizobium sp. Root695 Isolate Unclassified
265 2643221599 Rhizobium sp. Root708 Isolate Unclassified
266 2643221623 Aminobacter sp. DSM 101952 Root100 Isolate Unclassified
267 2643221626 Ensifer sp. Root31 Isolate Unclassified
268 2643221627 Mesorhizobium sp. Root102 Isolate Unclassified
269 2643221634 Rhizobium sp. Root1203 Isolate Unclassified
270 2643221655 Ensifer sp. Root1252 Isolate Unclassified
271 2643221659 Ensifer sp. Root127 Isolate Unclassified
272 2643221698 Ensifer sp. Root142 Isolate Unclassified
273 2643221712 Ensifer sp. Root258 Isolate Unclassified
274 2643221723 Ensifer sp. Root278 Isolate Unclassified
275 2667528174 Rhizobium sp. NFR17 Isolate Rhizoplane
276 2687453392 Mesorhizobium ciceri biserrulae WSM1284 Isolate Unclassified
277 2690316117 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
278 2693429783 Mesorhizobium sp. LCM 4577 Isolate Rhizosphere
279 2693429784 Mesorhizobium sp. LCM 4576 Isolate Rhizosphere
280 2721755686 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
281 2738541317 Rhizobium halophytocola DSM 21600 Isolate Unclassified
282 2738543024 Aminobacter sp. AP02 Isolate Unclassified
283 2756170246 Mesorhizobium loti DSM 2626 Isolate Nodule
284 2775506902 Phyllobacterium zundukense Tri-48 Isolate Unclassified
285 2775506904 Phyllobacterium zundukense Tri-38 Isolate Unclassified
286 2775507266 Rhizobium tropici PRF 81 Isolate Nodule
287 2791355082 Ensifer alkalisoli YIC4027 Isolate Nodule
288 2791355092 Sinorhizobium sp. NG07B Isolate Nodule
289 2791355123 Mesorhizobium sophorae ICMP 19535 Isolate Unclassified
290 2802428858 Sinorhizobium medicae M14-1 Isolate Nodule
291 2802428859 Sinorhizobium medicae SF3.41 Isolate Nodule
292 2802428860 Sinorhizobium medicae M19-1 Isolate Nodule
293 2802428861 Sinorhizobium medicae USDA1037 Isolate Nodule
294 2802428862 Sinorhizobium medicae M7-4 Isolate Nodule
295 2802428863 Sinorhizobium medicae M26-2 Isolate Nodule
296 2818991448 Rhizobium miluonense 1234 Isolate Unclassified
297 2818991453 Rhizobium lusitanum 1158 Isolate Unclassified
298 2838029111 Rhizobium tropici SEMIA 4079 Isolate Nodule
299 2838035591 Rhizobium mongolense SEMIA 4087 Isolate Nodule
300 2841734538 Mesorhizobium sp. M6A.T.Cr.TU.016.01.1.1 Isolate Nodule
301 2842298080 Rhizobium leucaenae SEMIA 492 Isolate Nodule
302 2842357229 Rhizobium leucaenae SEMIA 4015 Isolate Nodule
303 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
304 2842482326 Rhizobium lusitanum SEMIA 4060 Isolate Nodule
305 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
306 2842509118 Rhizobium paranaense SEMIA 4064 Isolate Nodule
307 2844002411 Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 Isolate Nodule
308 2844009547 Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1 Isolate Nodule
309 2844163670 Ensifer sp. 1H6 Isolate Unclassified
310 2847417321 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
311 2847670302 Mesorhizobium sp. M3A.F.Ca.ET.080.04.2.1 Isolate Nodule
312 2847686936 Mesorhizobium sp. M1A.F.Ca.IN.022.06.1.1 Isolate Nodule
313 2855825444 Sinorhizobium meliloti CXM1-105 Isolate Nodule
314 2855839649 Sinorhizobium meliloti AK555 Isolate Unclassified
315 2856314179 Mesorhizobium sp. M3A.F.Ca.ET.175.01.1.1 Isolate Nodule
316 2856320880 Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1 Isolate Nodule
317 2856328259 Mesorhizobium sp. Primo-B Isolate Nodule
318 2856334872 Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 Isolate Nodule
319 2856342000 Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 Isolate Nodule
320 2856349417 Mesorhizobium sp. M4A.F.Ca.ET.090.04.2.1 Isolate Nodule
321 2856356410 Mesorhizobium sp. M4B.F.Ca.ET.088.02.2.1 Isolate Nodule
322 2856364286 Mesorhizobium sp. M00.F.Ca.ET.151.01.1.1 Isolate Nodule
323 2857349434 Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 Isolate Nodule
324 2857367948 Mesorhizobium sp. M7A.F.Ca.US.002.01.1.1 Isolate Nodule
325 2858800743 Sinorhizobium meliloti AK170 Isolate Unclassified
326 2869162929 Mesorhizobium sanjuanii BSA136 Isolate Nodule
327 2869169390 Mesorhizobium sp. M7A.F.Ca.CA.001.10.2.1 Isolate Nodule
328 2869234852 Mesorhizobium sp. M7A.T.Ca.US.000.02.2.1 Isolate Nodule
329 2869249662 Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1 Isolate Nodule
330 2869256925 Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 Isolate Nodule
331 2869264136 Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 Isolate Nodule
332 2869271264 Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 Isolate Nodule
333 2869278585 Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 Isolate Nodule
334 2869285874 Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 Isolate Nodule
335 2871429161 Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 Isolate Nodule
336 2871435913 Mesorhizobium sp. M7A.F.Ca.MR.228.00.0.0 Isolate Nodule
337 2871451962 Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 Isolate Nodule
338 2871459585 Mesorhizobium sp. M7A.F.Ca.CA.001.09.1.1 Isolate Nodule
339 2871466892 Mesorhizobium sp. M7D.F.Ca.US.004.01.2.1 Isolate Nodule
340 2871474448 Mesorhizobium sp. M6A.T.Cr.TU.017.01.1.1 Isolate Nodule
341 2871481445 Mesorhizobium sp. M7A.F.Ca.CA.004.02.1.1 Isolate Nodule
342 2871488783 Mesorhizobium sp. M4B.F.Ca.ET.203.01.1.1 Isolate Nodule
343 2871495908 Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 Isolate Nodule
344 2874102143 Mesorhizobium sp. M1A.F.Ca.IN.022.04.1.1 Isolate Nodule
345 2874109183 Mesorhizobium sp. M7A.T.Ca.TU.009.02.1.1 Isolate Nodule
346 2874116593 Mesorhizobium sp. M7A.F.Ca.CA.004.08.2.1 Isolate Nodule
347 2874123672 Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 Isolate Nodule
348 2874131515 Mesorhizobium sp. M7A.F.Ca.CA.001.05.1.1 Isolate Nodule
349 2874139085 Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 Isolate Nodule
350 2874146452 Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 Isolate Nodule
351 2874155637 Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 Isolate Nodule
352 2874162495 Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 Isolate Nodule
353 2874168670 Mesorhizobium kowhaii Ach-343 Isolate Nodule
354 2876363079 Mesorhizobium loti R7ANS::ICEMlSym2042 Isolate Nodule
355 2876369609 Mesorhizobium sp. USDA-HM6 Isolate Unclassified
356 2876377896 Mesorhizobium sp. M2C.T.Ca.TU.009.01.2.1 Isolate Nodule
357 2876386047 Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 Isolate Nodule
358 2876392853 Mesorhizobium sp. M1D.F.Ca.ET.234.01.1.1 Isolate Nodule
359 2876399893 Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 Isolate Nodule
360 2876406927 Mesorhizobium sp. M7A.F.Ca.CA.002.03.2.1 Isolate Nodule
361 2876413966 Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 Isolate Nodule
362 2876420981 Mesorhizobium sp. M7A.F.Ca.CA.004.08.1.1 Isolate Nodule
363 2878035449 Mesorhizobium sp. M3A.F.Ca.ET.201.01.1.1 Isolate Nodule
364 2878738818 Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 Isolate Nodule
365 2878745973 Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 Isolate Nodule
366 2878753008 Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1 Isolate Nodule
367 2878760144 Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 Isolate Nodule
368 2878767105 Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 Isolate Nodule
369 2878774303 Mesorhizobium sp. M7A.F.Ca.CA.002.15.1.1 Isolate Nodule
370 2878781027 Mesorhizobium sp. M7A.F.Ca.CA.001.12.2.1 Isolate Nodule
371 2878788777 Mesorhizobium sp. M6A.T.Ca.TU.002.02.2.1 Isolate Nodule
372 2881147464 Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 Isolate Nodule
373 2881155292 Mesorhizobium sp. M4B.F.Ca.ET.058.02.1.1 Isolate Nodule
374 2881161766 Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 Isolate Nodule
375 2881845957 Mesorhizobium sp. M4B.F.Ca.ET.019.03.1.1 Isolate Nodule
376 2881853255 Mesorhizobium sp. M4A.F.Ca.ET.020.02.1.1 Isolate Nodule
377 2881861095 Mesorhizobium sp. M4B.F.Ca.ET.049.02.1.2 Isolate Nodule
378 2882632389 Mesorhizobium waimense ICMP19557 Isolate Unclassified
379 2882912400 Mesorhizobium sp. M4B.F.Ca.ET.013.02.1.1 Isolate Nodule
380 2885305155 Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 Isolate Nodule
381 2885312484 Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 Isolate Nodule
382 2885318864 Mesorhizobium sp. M4B.F.Ca.ET.017.02.2.1 Isolate Nodule
383 2885334103 Mesorhizobium sp. M1E.F.Ca.ET.063.01.1.1 Isolate Nodule
384 2885342637 Mesorhizobium sp. M4A.F.Ca.ET.050.02.1.1 Isolate Nodule
385 2885350715 Mesorhizobium sp. M4A.F.Ca.ET.022.05.2.1 Isolate Nodule
386 2888337043 Mesorhizobium sp. M8A.F.Ca.ET.057.01.1.1 Isolate Nodule
387 2888343758 Mesorhizobium sp. AA22 Isolate Unclassified
388 2888350351 Mesorhizobium sp. M2A.F.Ca.ET.046.03.2.1 Isolate Nodule
389 2889010040 Mesorhizobium sp. M2A.F.Ca.ET.043.05.1.1 Isolate Nodule
390 2889016732 Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1 Isolate Nodule
391 2903448605 Mesorhizobium japonicum Opo-235 Isolate Nodule
392 2903492973 Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 Isolate Nodule
393 2903513507 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.2 Isolate Nodule
394 2903521522 Mesorhizobium loti R7ANS::ICEMlSym2014 Isolate Nodule
395 2903528002 Mesorhizobium loti R7ANS::ICEMlSym2037 Isolate Nodule
396 2903540706 Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 Isolate Nodule
397 2904659560 Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1 Isolate Nodule
398 2906308376 Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 Isolate Nodule
399 2906321335 Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 Isolate Nodule
400 2906328253 Mesorhizobium sp. M1A.T.Ca.IN.004.03.1.1 Isolate Nodule
401 2906354277 Mesorhizobium sp. M2A.F.Ca.ET.040.01.1.1 Isolate Nodule
402 2906363423 Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1 Isolate Nodule
403 2906370794 Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1 Isolate Nodule
404 2906378014 Mesorhizobium sp. M7D.F.Ca.US.004.03.1.1 Isolate Nodule
405 2906386501 Mesorhizobium sp. M7A.F.Ca.CA.003.01.2.1 Isolate Nodule
406 2906393657 Mesorhizobium sp. M7A.F.Ca.CA.001.11.2.1 Isolate Nodule
407 2906401398 Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 Isolate Nodule
408 2906408224 Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 Isolate Nodule
409 2906414383 Mesorhizobium sp. M3A.F.Ca.ET.174.01.1.1 Isolate Nodule
410 2906427513 Mesorhizobium sp. M7A.F.Ca.CA.004.05.1.1 Isolate Nodule
411 2913308742 Rhizobium halophytocola DSM 21600 Isolate Unclassified
412 2915980308 Sinorhizobium medicae USDA1149 Isolate Nodule
413 2915986958 Sinorhizobium meliloti USDA1659 Isolate Nodule
414 2915993759 Sinorhizobium meliloti USDA1336 Isolate Nodule
415 2916000859 Sinorhizobium meliloti USDA1562 Isolate Nodule
416 2916007675 Sinorhizobium meliloti USDA1289 Isolate Nodule
417 2916014648 Sinorhizobium meliloti USDA1583 Isolate Nodule
418 2916021584 Sinorhizobium meliloti USDA1550 Isolate Nodule
419 2916028427 Sinorhizobium meliloti USDA1613 Isolate Nodule
420 2916035215 Sinorhizobium meliloti 3011 Isolate Nodule
421 2916041962 Sinorhizobium meliloti USDA1795 Isolate Nodule
422 2916048683 Sinorhizobium meliloti USDA1796 Isolate Nodule
423 2916055098 Sinorhizobium meliloti USDA1770 Isolate Nodule
424 2916061851 Sinorhizobium medicae USDA1638 Isolate Nodule
425 2916068649 Sinorhizobium meliloti USDA1220 Isolate Nodule
426 2916076590 Sinorhizobium meliloti USDA1661 Isolate Nodule
427 2919408235 Rhizobium miluonense 3199 Isolate Unclassified
428 2921201388 Sinorhizobium meliloti USDA1692 Isolate Nodule
429 2921208531 Sinorhizobium meliloti USDA1660 Isolate Nodule
430 2921237296 Sinorhizobium meliloti USDA1508 Isolate Nodule
431 2921244191 Sinorhizobium meliloti 2119 Isolate Nodule
432 2921250672 Sinorhizobium medicae USDA1169 Isolate Nodule
433 2921257292 Sinorhizobium meliloti USDA1320 Isolate Nodule
434 2921263974 Sinorhizobium meliloti USDA1107 Isolate Nodule
435 2921282425 Sinorhizobium meliloti USDA1203 Isolate Nodule
436 2921289301 Sinorhizobium meliloti USDA1730 Isolate Nodule
437 2921296804 Sinorhizobium meliloti USDA1200 Isolate Nodule
438 2922130491 Mesorhizobium sp. M00.F.Ca.ET.038.03.1.1 Isolate Nodule
439 2922151315 Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 Isolate Nodule
440 2922158528 Mesorhizobium sp. M1A.F.Ca.IN.022.05.2.1 Isolate Nodule
441 2922172374 Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 Isolate Nodule
442 2922178524 Mesorhizobium sp. M7A.F.Ca.CA.002.09.1.1 Isolate Nodule
443 2922185730 Mesorhizobium sp. M2A.F.Ca.ET.037.01.1.1 Isolate Nodule
444 2923556063 Rhizobium tibeticum 3740 Isolate Unclassified
445 2924144063 Sinorhizobium meliloti USDA1022 Isolate Nodule
446 2924150972 Sinorhizobium meliloti USDA1700 Isolate Nodule
447 2924158325 Sinorhizobium meliloti USDA1146 Isolate Nodule
448 2924165586 Sinorhizobium meliloti USDA1264 Isolate Nodule
449 2924172951 Sinorhizobium meliloti USDA1626 Isolate Nodule
450 2924179722 Sinorhizobium meliloti USDA1280 Isolate Nodule
451 2924186466 Sinorhizobium meliloti USDA1389 Isolate Nodule
452 2924193448 Sinorhizobium meliloti USDA1158 Isolate Nodule
453 2924200457 Sinorhizobium meliloti USDA1007 Isolate Nodule
454 2924207177 Sinorhizobium meliloti USDA1589 Isolate Nodule
455 2924214083 Sinorhizobium meliloti USDA1702 Isolate Nodule
456 2924221636 Sinorhizobium meliloti USDA1416 Isolate Nodule
457 2924228884 Sinorhizobium meliloti USDA1581 Isolate Nodule
458 2924710171 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.2 Isolate Nodule
459 2924718760 Mesorhizobium sp. M8A.F.Ca.ET.023.01.1.1 Isolate Nodule
460 2924726620 Mesorhizobium sp. M1A.F.Ca.IN.020.03.2.1 Isolate Nodule
461 2924733363 Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 Isolate Nodule
462 2924741084 Mesorhizobium sp. M7A.F.Ca.CA.004.09.1.2 Isolate Nodule
463 2924748358 Mesorhizobium sp. M7A.F.Ca.CA.002.14.1.2 Isolate Nodule
464 2924754689 Mesorhizobium sp. M5C.F.Ca.IN.020.32.2.1 Isolate Nodule
465 2924762789 Mesorhizobium sp. WSM4303 Isolate Unclassified
466 2924776078 Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 Isolate Nodule
467 2924784321 Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 Isolate Nodule
468 2936996657 Sinorhizobium meliloti USDA1025 Isolate Nodule
469 2937002841 Sinorhizobium meliloti USDA1006 Isolate Nodule
470 2937009748 Sinorhizobium meliloti USDA1162 Isolate Nodule
471 2937016420 Sinorhizobium meliloti USDA1027 Isolate Nodule
472 2937023124 Sinorhizobium meliloti USDA1335 Isolate Nodule
473 2937029754 Sinorhizobium medicae USDA1624 Isolate Nodule
474 2937036028 Sinorhizobium medicae USDA1608 Isolate Nodule
475 2937042894 Sinorhizobium meliloti USDA1687 Isolate Nodule
476 2937049772 Sinorhizobium meliloti USDA1691 Isolate Nodule
477 2937056579 Sinorhizobium meliloti USDA1357 Isolate Nodule
478 2937063883 Sinorhizobium meliloti USDA1808 Isolate Nodule
479 2937071275 Sinorhizobium meliloti USDA1623 Isolate Nodule
480 2937078374 Sinorhizobium medicae USDA1004 Isolate Nodule
481 2937084907 Sinorhizobium medicae USDA1664 Isolate Nodule
482 2937091812 Sinorhizobium meliloti USDA1221 Isolate Nodule
483 2937098957 Sinorhizobium meliloti USDA1519 Isolate Nodule
484 2937106411 Sinorhizobium meliloti USDA1214 Isolate Nodule
485 2937113482 Sinorhizobium meliloti USDA1180 Isolate Nodule
486 2937119839 Sinorhizobium meliloti USDA1790 Isolate Nodule
487 2937126314 Sinorhizobium meliloti USDA1612 Isolate Nodule
488 2937813078 Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 Isolate Nodule
489 2937822353 Mesorhizobium neociceri CCANP35 Isolate Nodule
490 2937848649 Mesorhizobium sp. WSM4310 Isolate Unclassified
491 2937861824 Mesorhizobium sp. M7A.F.Ca.CA.001.07.2.1 Isolate Nodule
492 2937868953 Mesorhizobium sp. M7A.F.Ca.CA.001.13.2.1 Isolate Nodule
493 2937877337 Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 Isolate Nodule
494 2937891427 Mesorhizobium sp. M1A.F.Ca.IN.022.07.1.1 Isolate Nodule
495 2937972304 Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 Isolate Nodule
496 2937994558 Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 Isolate Nodule
497 2957375807 Sinorhizobium medicae USDA1632 Isolate Nodule
498 2957382221 Sinorhizobium meliloti USDA1919 Isolate Nodule
499 2957388812 Sinorhizobium meliloti USDA1195 Isolate Nodule
500 2957395598 Sinorhizobium meliloti USDA1237 Isolate Nodule
501 2957402308 Sinorhizobium meliloti USDA1794 Isolate Nodule
502 2957408893 Sinorhizobium meliloti USDA1163 Isolate Nodule
503 2957415311 Sinorhizobium meliloti USDA1724 Isolate Nodule
504 2957422303 Sinorhizobium meliloti USDA1497 Isolate Nodule
505 2957430029 Sinorhizobium meliloti USDA1590 Isolate Nodule
506 2957437181 Sinorhizobium medicae USDA1694 Isolate Nodule
507 2957443900 Sinorhizobium meliloti USDA1734 Isolate Nodule
508 2957450854 Sinorhizobium meliloti USDA1655 Isolate Nodule
509 2957457609 Sinorhizobium meliloti USDA1751 Isolate Nodule
510 2957464669 Sinorhizobium meliloti USDA1520 Isolate Nodule
511 2957471148 Sinorhizobium meliloti USDA1204 Isolate Nodule
512 2957478035 Sinorhizobium meliloti USDA1171 Isolate Nodule
513 2957484790 Sinorhizobium meliloti USDA1464 Isolate Nodule
514 2957491536 Sinorhizobium meliloti USDA1804 Isolate Nodule
515 2957498199 Sinorhizobium meliloti USDA1561 Isolate Nodule
516 2957505466 Sinorhizobium meliloti USDA1696 Isolate Nodule
517 2958034702 Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 Isolate Nodule
518 2958041894 Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 Isolate Nodule
519 2958064165 Mesorhizobium sp. SARCC-RB16n Isolate Unclassified
520 2958071322 Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 Isolate Nodule
521 2958084443 Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 Isolate Nodule
522 2958100919 Mesorhizobium sp. M2A.F.Ca.ET.015.02.1.1 Isolate Nodule
523 2958115193 Mesorhizobium sp. M00.F.Ca.ET.217.01.1.1 Isolate Nodule
524 2958122699 Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 Isolate Nodule
525 2958130278 Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 Isolate Nodule
526 2958137437 Mesorhizobium sp. M7A.F.Ca.CA.002.04.1.1 Isolate Nodule
527 2958144490 Mesorhizobium sp. M8A.F.Ca.ET.021.01.1.1 Isolate Nodule
528 2958158011 Mesorhizobium sp. M7A.F.Ca.CA.002.15.2.1 Isolate Nodule
529 2958165035 Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 Isolate Nodule
530 2958172287 Mesorhizobium sp. M2A.F.Ca.ET.029.05.1.1 Isolate Nodule
531 2958179912 Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 Isolate Nodule
532 2960584000 Sinorhizobium meliloti USDA1530 Isolate Nodule
533 2960591022 Sinorhizobium medicae USDA1066 Isolate Nodule
534 2960597568 Sinorhizobium meliloti 3085 Isolate Nodule
535 2960603979 Sinorhizobium meliloti USDA1580 Isolate Nodule
536 2960610863 Sinorhizobium meliloti USDA1792 Isolate Nodule
537 2960617483 Sinorhizobium meliloti USDA1719 Isolate Nodule
538 2960624210 Sinorhizobium meliloti USDA1415 Isolate Nodule
539 2960631154 Sinorhizobium medicae USDA1629 Isolate Nodule
540 2960637947 Sinorhizobium meliloti USDA1202 Isolate Nodule
541 2960645483 Sinorhizobium meliloti USDA1703 Isolate Nodule
542 2960652885 Sinorhizobium meliloti USDA1199 Isolate Nodule
543 2960660292 Sinorhizobium meliloti USDA1883 Isolate Nodule
544 2960667422 Sinorhizobium meliloti USDA1170 Isolate Nodule
545 2960674078 Sinorhizobium meliloti USDA1666 Isolate Nodule
546 2960680706 Sinorhizobium medicae USDA1150 Isolate Nodule
547 2960687367 Sinorhizobium meliloti USDA1462 Isolate Nodule
548 2960693952 Sinorhizobium medicae USDA1630 Isolate Nodule
549 2961077736 Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 Isolate Nodule
550 2961114664 Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 Isolate Nodule
551 2961127735 Mesorhizobium sp. M4A.F.Ca.ET.029.04.2.1 Isolate Nodule
552 2961136820 Mesorhizobium sp. M7A.F.Ca.AU.001.01.1.1 Isolate Nodule
553 2961163497 Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 Isolate Nodule
554 2961170736 Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 Isolate Nodule
555 2961183825 Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 Isolate Nodule
556 2963644680 Mesorhizobium japonicum R7A Isolate Nodule
557 2964607997 Sinorhizobium meliloti USDA1212 Isolate Nodule
558 2964615318 Sinorhizobium meliloti USDA1248 Isolate Nodule
559 2964621998 Sinorhizobium meliloti USDA1235 Isolate Nodule
560 2964628898 Sinorhizobium meliloti USDA1191 Isolate Nodule
561 2964636051 Sinorhizobium meliloti USDA1594 Isolate Nodule
562 2964643177 Sinorhizobium meliloti USDA1760 Isolate Nodule
563 2964649959 Sinorhizobium meliloti USDA1591 Isolate Nodule
564 2964656573 Sinorhizobium meliloti USDA1308 Isolate Nodule
565 2964663802 Sinorhizobium meliloti USDA1688 Isolate Nodule
566 2964670856 Sinorhizobium meliloti USDA1211 Isolate Nodule
567 2964678106 Sinorhizobium meliloti USDA1210 Isolate Nodule
568 2964685014 Sinorhizobium meliloti USDA1232 Isolate Nodule
569 2964691889 Sinorhizobium meliloti USDA1379 Isolate Nodule
570 2964698721 Sinorhizobium meliloti USDA1656 Isolate Nodule
571 2964705432 Sinorhizobium meliloti USDA1614 Isolate Nodule
572 2964712639 Sinorhizobium meliloti USDA1616 Isolate Nodule
573 2964719344 Sinorhizobium meliloti USDA1456 Isolate Nodule
574 2965018300 Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 Isolate Nodule
575 2965025482 Mesorhizobium sp. Primo-A Isolate Nodule
576 2965032056 Mesorhizobium sp. M7A.F.Ca.US.006.04.2.1 Isolate Nodule
577 2965040258 Mesorhizobium sp. M7A.F.Ca.CA.001.06.1.1 Isolate Nodule
578 2965047637 Mesorhizobium sp. M7A.F.Ca.US.014.04.1.1 Isolate Nodule
579 2965062239 Mesorhizobium sp. M1A.F.Ca.ET.072.01.1.1 Isolate Nodule
580 2965089291 Mesorhizobium sp. M7A.F.Ca.CA.001.04.1.1 Isolate Nodule
581 2965102966 Mesorhizobium sp. M7A.F.Ca.AU.002.02.1.1 Isolate Nodule
582 2965110997 Mesorhizobium sp. M7A.F.Ca.US.003.02.2.1 Isolate Nodule
583 2965119406 Mesorhizobium sp. M2A.F.Ca.ET.067.02.1.1 Isolate Nodule
584 2967664464 Sinorhizobium meliloti USDA1208 Isolate Nodule
585 2967671571 Sinorhizobium meliloti USDA1496 Isolate Nodule
586 2967678726 Sinorhizobium meliloti USDA1467 Isolate Nodule
587 2967686174 Sinorhizobium medicae USDA1641 Isolate Nodule
588 2967693043 Sinorhizobium meliloti USDA1183 Isolate Nodule
589 2967699805 Sinorhizobium meliloti USDA1695 Isolate Nodule
590 2967706974 Sinorhizobium meliloti USDA1206 Isolate Nodule
591 2967714385 Sinorhizobium meliloti USDA1023 Isolate Nodule
592 2967721400 Sinorhizobium meliloti USDA1742 Isolate Nodule
593 2967728569 Sinorhizobium medicae USDA1607 Isolate Nodule
594 2967735183 Sinorhizobium meliloti USDA1710 Isolate Nodule
595 2967742019 Sinorhizobium meliloti USDA1676 Isolate Nodule
596 2967748971 Sinorhizobium meliloti USDA1024A Isolate Nodule
597 2967755722 Sinorhizobium meliloti USDA1302 Isolate Nodule
598 2967762386 Sinorhizobium meliloti USDA1397 Isolate Nodule
599 2967769361 Sinorhizobium meliloti USDA1005 Isolate Nodule
600 2967775926 Sinorhizobium meliloti USDA1678 Isolate Nodule
601 2967996073 Mesorhizobium sp. M4B.F.Ca.ET.169.01.1.1 Isolate Nodule
602 2968003550 Mesorhizobium sp. M4B.F.Ca.ET.215.01.1.1 Isolate Nodule
603 2968016561 Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 Isolate Nodule
604 2968083720 Mesorhizobium erdmanii Opo-242 Isolate Unclassified
605 2968091066 Mesorhizobium sp. AA23 Isolate Unclassified
606 2968097103 Mesorhizobium sp. M1A.F.Ca.IN.020.30.1.1 Isolate Nodule
607 2968110612 Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 Isolate Nodule
608 2968117919 Mesorhizobium atlanticum CNPSo 3140 Isolate Unclassified
609 2968128360 Mesorhizobium sp. WSM3873 Isolate Unclassified
610 2968138860 Mesorhizobium sp. M7A.F.Ca.ET.027.03.2.1 Isolate Nodule
611 2968171901 Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 Isolate Nodule
612 2970019648 Sinorhizobium meliloti USDA1603 Isolate Nodule
613 2970026789 Sinorhizobium medicae USDA1611 Isolate Nodule
614 2970040964 Sinorhizobium meliloti USDA1501 Isolate Nodule
615 2970047711 Sinorhizobium meliloti USDA1793 Isolate Nodule
616 2970054988 Sinorhizobium meliloti USDA1031 Isolate Nodule
617 2970061556 Sinorhizobium meliloti USDA1810 Isolate Nodule
618 2970076120 Sinorhizobium meliloti USDA1706 Isolate Nodule
619 2970082768 Sinorhizobium meliloti USDA1803 Isolate Nodule
620 2970088815 Sinorhizobium meliloti USDA1819 Isolate Nodule
621 2970095765 Sinorhizobium meliloti USDA1225 Isolate Nodule
622 2970102677 Sinorhizobium meliloti USDA1325 Isolate Nodule
623 2970109326 Sinorhizobium meliloti USDA1186 Isolate Nodule
624 2970116247 Sinorhizobium meliloti USDA1566 Isolate Nodule
625 2970122695 Sinorhizobium medicae 3082 Isolate Nodule
626 2970129317 Sinorhizobium meliloti USDA1008 Isolate Nodule
627 2970136068 Sinorhizobium meliloti USDA1699 Isolate Nodule
628 2970143518 Sinorhizobium medicae USDA1652 Isolate Nodule
629 2970149975 Sinorhizobium meliloti USDA1215 Isolate Nodule
630 2970156795 Sinorhizobium meliloti USDA1491 Isolate Nodule
631 2970164137 Sinorhizobium meliloti USDA1018 Isolate Nodule
632 2970170962 Sinorhizobium meliloti USDA1571 Isolate Nodule
633 2970177841 Sinorhizobium meliloti USDA1533 Isolate Nodule
634 2970184632 Sinorhizobium meliloti USDA1593 Isolate Nodule
635 2970191845 Sinorhizobium meliloti USDA1187 Isolate Nodule
636 2970469710 Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 Isolate Nodule
637 2970489779 Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 Isolate Nodule
638 2970503327 Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 Isolate Nodule
639 2970510686 Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 Isolate Nodule
640 2970524798 Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1 Isolate Nodule
641 2970532167 Mesorhizobium sp. M7A.F.Ca.CA.002.05.1.1 Isolate Nodule
642 2970547951 Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 Isolate Nodule
643 2970554993 Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 Isolate Nodule
644 2970593180 Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 Isolate Nodule
645 2970619444 Mesorhizobium sp. M7A.F.Ca.ET.027.02.1.1 Isolate Nodule
646 2970627176 Mesorhizobium sp. M7A.F.Ca.US.006.01.2.1 Isolate Nodule
647 2977516862 Sinorhizobium meliloti USDA1791 Isolate Nodule
648 2977523885 Sinorhizobium meliloti USDA1777 Isolate Nodule
649 2977530762 Sinorhizobium medicae USDA1606 Isolate Nodule
650 2977537788 Sinorhizobium meliloti USDA1184 Isolate Nodule
651 2977544691 Sinorhizobium medicae USDA1631 Isolate Nodule
652 2977551784 Sinorhizobium meliloti USDA1035 Isolate Nodule
653 2977558990 Sinorhizobium meliloti USDA1222 Isolate Nodule
654 2977565890 Sinorhizobium meliloti USDA1617 Isolate Nodule
655 2977572785 Sinorhizobium meliloti USDA1767 Isolate Nodule
656 2977579622 Sinorhizobium meliloti USDA1161 Isolate Nodule
657 2977821940 Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1 Isolate Nodule
658 2977828996 Mesorhizobium sp. M4B.F.Ca.ET.089.01.1.1 Isolate Nodule
659 2977843712 Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 Isolate Nodule
660 2977851361 Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 Isolate Nodule
661 2977858184 Mesorhizobium sp. M1A.F.Ca.IN.020.03.1.1 Isolate Nodule
662 2977864932 Mesorhizobium tamadayense DSM 28320 Isolate Nodule
663 2977872689 Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 Isolate Nodule
664 2977898635 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.1 Isolate Nodule
665 2977907340 Mesorhizobium sp. M7A.F.Ca.CA.004.12.1.1 Isolate Nodule
666 2977915119 Mesorhizobium sp. M7A.F.Ca.CA.001.09.2.1 Isolate Nodule
667 2977922695 Mesorhizobium sp. WSM4305 Isolate Unclassified
668 2977935797 Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 Isolate Nodule
669 2977942078 Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 Isolate Nodule
670 2977950692 Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 Isolate Nodule
671 2977957713 Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1 Isolate Nodule
672 2977971508 Mesorhizobium sp. M2A.F.Ca.ET.039.01.1.1 Isolate Nodule
673 2977986579 Mesorhizobium intechi BD68 Isolate Unclassified
674 2979710463 Mesorhizobium sp. M2A.F.Ca.ET.017.03.2.1 Isolate Nodule
675 2979742915 Mesorhizobium sp. M2A.F.Ca.ET.046.02.1.1 Isolate Nodule
676 2979764755 Mesorhizobium sp. M7A.F.Ca.CA.004.05.2.1 Isolate Nodule
677 2979779861 Mesorhizobium sp. M1A.F.Ca.IN.022.02.1.1 Isolate Nodule
678 2979793036 Mesorhizobium sp. M7A.F.Ca.US.007.01.1.1 Isolate Nodule
679 2979808191 Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 Isolate Nodule
680 2987636660 Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 Isolate Nodule
681 2987645492 Mesorhizobium sp. M7A.F.Ca.CA.002.10.1.1 Isolate Nodule
682 2987652177 Mesorhizobium sp. M2A.F.Ca.ET.042.01.1.1 Isolate Nodule
683 2987659509 Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 Isolate Nodule
684 2987666974 Mesorhizobium sp. WSM4306 Isolate Unclassified
685 2987673487 Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1 Isolate Nodule
686 2996310559 Mesorhizobium zhangyense CGMCC 1.15528 Isolate Unclassified
687 2996336353 Mesorhizobium sp. YM1C-6-2 Isolate Unclassified
688 2996341866 Mesorhizobium sp. M1A.F.Ca.IN.020.32.1.1 Isolate Nodule
689 2996348954 Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 Isolate Nodule
690 2996386984 Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 Isolate Nodule
691 2996887358 Rhizobium sp. R711 Isolate Nodule
692 3000135777 Unclassified bacterium M00.F.Ca.ET.205.01.1.1 Isolate Unclassified
693 3004167301 Mesorhizobium loti 582 Isolate Unclassified
694 3004188549 Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 Isolate Nodule
695 3004195979 Mesorhizobium sp. M7A.F.Ca.CA.001.08.2.1 Isolate Nodule
696 3004203850 Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 Isolate Nodule
697 3004211236 Mesorhizobium sp. WSM4307 Isolate Unclassified
698 3004218560 Mesorhizobium sp. WSM4315 Isolate Unclassified
699 3004232784 Mesorhizobium sp. M7A.T.Ca.US.000.02.1.1 Isolate Nodule
700 3004239961 Mesorhizobium sp. M7A.F.Ca.US.005.03.2.1 Isolate Nodule
701 3004248173 Mesorhizobium sp. M7A.F.Ca.CA.004.06.1.1 Isolate Nodule
702 3004268573 Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1 Isolate Nodule
703 3004275668 Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 Isolate Nodule
704 3004334049 Mesorhizobium huakuii 583 Isolate Unclassified
705 3005409236 Rhizobium sp. P32RR-XVIII Isolate Rhizosphere
706 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
707 3005452660 Rhizobium grahamii BG7 Isolate Unclassified
708 637000159 Mesorhizobium japonicum MAFF 303099 Isolate Unclassified
709 648276728 Sinorhizobium meliloti BL225C Isolate Nodule
710 649633066 Mesorhizobium ciceri bv. biserrulae WSM1271 Isolate Nodule
711 8002285264 Aminobacter anthyllidis LMG 26462 Isolate Nodule
712 8003992118 Sinorhizobium meliloti RRI128 Isolate Nodule
713 8003999396 Sinorhizobium medicae WSM1115 Isolate Nodule
714 8004300914 Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 Isolate Nodule
715 8004312739 Mesorhizobium sp. M7A.F.Ca.MR.362.00.0.0 Isolate Nodule
716 8004361976 Mesorhizobium sp. M7A.F.Ca.CA.001.08.1.1 Isolate Nodule
717 8004374579 Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1 Isolate Nodule
718 8004387939 Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 Isolate Nodule
719 8004445564 Mesorhizobium sp. M1A.F.Ca.IN.020.04.1.1 Isolate Nodule
720 8004640170 Mesorhizobium sp. GbtcB19 Isolate Unclassified
721 8004695233 Mesorhizobium sp. M7A.F.Ca.US.001.01.1.1 Isolate Nodule
722 8004703790 Mesorhizobium sp. M00.F.Ca.ET.158.01.1.1 Isolate Nodule
723 8004714634 Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 Isolate Nodule
724 8004727605 Mesorhizobium sp. M7A.F.Ca.CA.004.01.1.1 Isolate Nodule
725 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
726 8005321885 Rhizobium sp. R72 Isolate Nodule
727 8005484373 Rhizobium tropici SARCC-755 Isolate Nodule
728 8005542996 Rhizobium grahamii CCGM3 Isolate Unclassified
729 8005645114 Rhizobium tropici IGFRI Rhizo-19 Isolate Rhizosphere
730 8005658619 Rhizobium terrae CC-HIH110 Isolate Unclassified
731 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified
732 8018150411 Rhizobium straminoryzae SM12 Isolate Rhizosphere
733 8046767195 Rhizobium calliandrae CCGE524 Isolate Unclassified
734 8049293176 Ensifer alkalisoli YIC4027 Isolate Nodule
735 8055617313 Mesorhizobium onobrychidis OM4 Isolate Nodule
736 8057575449 Rhizobium mayense CCGE526 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 40.71
Metatranscriptomes 0.11
Isolates 59.18

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.46
Nodule 51.06
Rhizoplane 1.11
Rhizosphere 28.92
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105240_10287399 3300009093 Bacteria 1887
2 LJNas_1000120 3300000546 Bacteria 12289
3 JGI24740J21852_10003637 3300001979 Bacteria 6723
4 JGI24739J22299_10028216 3300001989 Bacteria 1958
5 JGI24735J21928_10019579 3300002067 Bacteria 2079
6 JGI25156J39149_1013450 3300002705 Bacteria 1734
7 JGI25162J39368_1000244 3300002737 Bacteria 54424
8 JGI25162J39368_1000493 3300002737 Bacteria 29984
9 JGI25158J39367_1000756 3300002739 Bacteria 6197
10 JGI25157J39369_1000555 3300002741 Bacteria 22318
11 JGI25152J39213_1004107 3300002773 Bacteria 4706
12 JGI25159J45721_1000015 3300002987 Bacteria 142431
13 JGI25159J45721_1000338 3300002987 Bacteria 21677
14 JGI25151J46595_10033099 3300003187 Bacteria 1996
15 JGI25406J46586_10006406 3300003203 Bacteria 5426
16 JGI25165J46597_1000079 3300003214 Bacteria 179163
17 JGI25165J46597_1000553 3300003214 Bacteria 34037
18 JGI25165J46597_1000796 3300003214 Bacteria 23932
19 rootH2_10027501 3300003320 Bacteria 5291
20 rootH1_10271729 3300003323 Bacteria 1405
21 JGI25160J50197_1000003 3300003354 Bacteria 482719
22 JGI25160J50197_1000012 3300003354 Bacteria 267582
23 JGI25161J50226_1000002 3300003374 Bacteria 420324
24 JGI25161J50226_1000219 3300003374 Bacteria 35426
25 Ga0055542_1000618 3300003762 Bacteria 30135
26 Ga0055542_1001408 3300003762 Bacteria 12130
27 Ga0055529_1003209 3300003763 Bacteria 2793
28 Ga0055526_1003824 3300003771 Bacteria 9358
29 Ga0055536_1005156 3300003781 Bacteria 6460
30 Ga0055528_1021666 3300003790 Bacteria 2029
31 Ga0055540_1008648 3300003792 Bacteria 3639
32 Ga0055531_10011294 3300003794 Bacteria 4327
33 Ga0055543_1000011 3300004625 Bacteria 196089
34 Ga0055543_1000034 3300004625 Bacteria 128668
35 Ga0065165_1000025 3300005262 Bacteria 246909
36 Ga0065165_1000082 3300005262 Bacteria 158536
37 Ga0070658_10085777 3300005327 Bacteria 2590
38 Ga0070660_100079572 3300005339 Bacteria 2571
39 Ga0070660_100209391 3300005339 Bacteria 1582
40 Ga0070668_100006252 3300005347 Bacteria 8821
41 Ga0070671_100130795 3300005355 Bacteria 2114
42 Ga0070663_100068052 3300005455 Bacteria 2585
43 Ga0068853_100328096 3300005539 Bacteria 1420
44 Ga0070665_100028010 3300005548 Bacteria 5675
45 Ga0070665_100052306 3300005548 Bacteria 4097
46 Ga0070665_100079272 3300005548 Bacteria 3290
47 Ga0070665_100112308 3300005548 Bacteria 2727
48 Ga0070665_100270158 3300005548 Bacteria 1702
49 Ga0070665_100303155 3300005548 Bacteria 1600
50 Ga0070665_100628597 3300005548 Bacteria 1087
51 Ga0068855_100008160 3300005563 Bacteria 12659
52 Ga0068855_100310359 3300005563 Bacteria 1745
53 Ga0068855_100463947 3300005563 Bacteria 1381
54 Ga0068857_100206963 3300005577 Bacteria 1790
55 Ga0068854_100100728 3300005578 Bacteria 2166
56 Ga0068856_100976370 3300005614 Bacteria 865
57 Ga0068852_100191337 3300005616 Bacteria 1931
58 Ga0081540_1009710 3300005983 Bacteria 6604
59 Ga0081539_10002395 3300005985 Bacteria 26644
60 Ga0075365_10014555 3300006038 Bacteria 4736
61 Ga0075365_10154229 3300006038 Bacteria 1598
62 Ga0075365_10180082 3300006038 Bacteria 1477
63 Ga0075368_10016651 3300006042 Bacteria 2741
64 Ga0075364_10270979 3300006051 Bacteria 1155
65 Ga0075362_10034225 3300006177 Bacteria 2213
66 Ga0075367_10002953 3300006178 Bacteria 7945
67 Ga0075367_10099335 3300006178 Bacteria 1778
68 Ga0075367_10299299 3300006178 Bacteria 1012
69 Ga0075367_10371192 3300006178 Bacteria 904
70 Ga0075370_10147872 3300006353 Bacteria 1376
71 Ga0075370_10294165 3300006353 Bacteria 965
72 Ga0068871_100538950 3300006358 Bacteria 1056
73 Ga0079104_1002459 3300006946 Bacteria 9964
74 Ga0079104_1006003 3300006946 Bacteria 4704
75 Ga0105251_10009293 3300009011 Bacteria 5819
76 Ga0105240_10249534 3300009093 Bacteria 2053
77 Ga0105247_10172516 3300009101 Bacteria 1439
78 Ga0105248_10012216 3300009177 Bacteria 9469
79 Ga0105237_10038673 3300009545 Bacteria 4817
80 Ga0105237_10540323 3300009545 Bacteria 1172
81 Ga0105237_10851545 3300009545 Bacteria 918
82 Ga0105238_10040306 3300009551 Bacteria 4733
83 Ga0105239_10127612 3300010375 Bacteria 2828
84 Ga0157370_10064885 3300013104 Bacteria 3455
85 Ga0157370_10593368 3300013104 Bacteria 1014
86 Ga0157369_10006251 3300013105 Bacteria 13822
87 Ga0157369_10021348 3300013105 Bacteria 7241
88 Ga0157369_10059190 3300013105 Bacteria 4131
89 Ga0157374_10014300 3300013296 Bacteria 6945
90 Ga0157372_10022080 3300013307 Bacteria 6883
91 Ga0157372_10356875 3300013307 Bacteria 1703
92 Ga0163163_10029885 3300014325 Bacteria 5244
93 Ga0163163_10220505 3300014325 Bacteria 1945
94 Ga0182008_10042226 3300014497 Bacteria 2272
95 Ga0157376_10037849 3300014969 Bacteria 3921
96 Ga0182006_1047427 3300015261 Bacteria 1665
97 Ga0182007_10004110 3300015262 Bacteria 6690
98 Ga0182005_1007445 3300015265 Bacteria 3283
99 Ga0228711_1003057 3300022739 Bacteria 25943
100 Ga0228710_1000004 3300022740 Bacteria 250560
101 Ga0209760_101730 3300025207 Bacteria 2200
102 Ga0209436_100767 3300025208 Bacteria 13307
103 Ga0209436_115828 3300025208 Bacteria 1151
104 Ga0209563_105661 3300025230 Bacteria 2234
105 Ga0209437_100050 3300025233 Bacteria 394010
106 Ga0209437_100056 3300025233 Bacteria 363071
107 Ga0209437_107127 3300025233 Bacteria 1833
108 Ga0207425_1014638 3300025245 Bacteria 1777
109 Ga0209026_1000118 3300025250 Bacteria 130611
110 Ga0209677_102979 3300025253 Bacteria 5879
111 Ga0209148_1000212 3300025254 Bacteria 101454
112 Ga0209148_1005894 3300025254 Bacteria 2729
113 Ga0209759_1000076 3300025256 Bacteria 175911
114 Ga0209129_1001420 3300025258 Bacteria 13383
115 Ga0209233_1000037 3300025261 Bacteria 554620
116 Ga0209233_1000071 3300025261 Bacteria 363290
117 Ga0209233_1000236 3300025261 Bacteria 92446
118 Ga0209233_1000247 3300025261 Bacteria 87890
119 Ga0209233_1009599 3300025261 Bacteria 2938
120 Ga0209233_1019681 3300025261 Bacteria 1788
121 Ga0209455_1000170 3300025272 Bacteria 110681
122 Ga0209455_1021969 3300025272 Bacteria 1226
123 Ga0209673_1006659 3300025273 Bacteria 5518
124 Ga0209130_1000005 3300025284 Bacteria 599620
125 Ga0209130_1000028 3300025284 Bacteria 325668
126 Ga0209676_1003201 3300025292 Bacteria 10368
127 Ga0209025_1000105 3300025294 Bacteria 224157
128 Ga0209025_1040299 3300025294 Bacteria 2023
129 Ga0209564_1000113 3300025295 Bacteria 211564
130 Ga0209564_1009543 3300025295 Bacteria 4601
131 Ga0209758_1015666 3300025297 Bacteria 3908
132 Ga0209050_1000773 3300025298 Bacteria 45942
133 Ga0209256_1004283 3300025299 Bacteria 9094
134 Ga0209256_1019044 3300025299 Bacteria 2202
135 Ga0207426_1000012 3300025302 Bacteria 730942
136 Ga0207426_1000015 3300025302 Bacteria 599316
137 Ga0207426_1003762 3300025302 Bacteria 7907
138 Ga0207426_1022640 3300025302 Bacteria 2153
139 Ga0209051_1003420 3300025303 Bacteria 10421
140 Ga0209257_1002062 3300025304 Bacteria 21252
141 Ga0207713_1052608 3300025735 Bacteria 1610
142 Ga0207647_10009305 3300025904 Bacteria 6984
143 Ga0207647_10039889 3300025904 Bacteria 2960
144 Ga0207705_10010808 3300025909 Bacteria 6627
145 Ga0207705_10112997 3300025909 Bacteria 2008
146 Ga0207705_10426788 3300025909 Bacteria 1027
147 Ga0207654_10390094 3300025911 Bacteria 966
148 Ga0207695_10235536 3300025913 Bacteria 1733
149 Ga0207695_10309487 3300025913 Bacteria 1470
150 Ga0207695_10364520 3300025913 Bacteria 1331
151 Ga0207695_10461299 3300025913 Bacteria 1153
152 Ga0207671_10119104 3300025914 Bacteria 2017
153 Ga0207671_10618974 3300025914 Bacteria 863
154 Ga0207657_10056625 3300025919 Bacteria 3381
155 Ga0207649_10106102 3300025920 Bacteria 1868
156 Ga0207694_10008166 3300025924 Bacteria 7909
157 Ga0207659_10173312 3300025926 Bacteria 1703
158 Ga0207711_10095829 3300025941 Bacteria 2618
159 Ga0207711_10182891 3300025941 Bacteria 1907
160 Ga0207667_10012351 3300025949 Bacteria 9847
161 Ga0207668_10039475 3300025972 Bacteria 3178
162 Ga0207640_10039683 3300025981 Bacteria 2982
163 Ga0207639_10149943 3300026041 Bacteria 1952
164 Ga0207678_10036692 3300026067 Bacteria 4267
165 Ga0207702_10071810 3300026078 Bacteria 2982
166 Ga0207674_10033322 3300026116 Bacteria 5394
167 Ga0207674_10684775 3300026116 Bacteria 990
168 Ga0209281_1000134 3300027111 Bacteria 185406
169 Ga0209281_1000445 3300027111 Bacteria 59209
170 Ga0209371_1004523 3300027312 Bacteria 5986
171 Ga0209282_1000029 3300027666 Bacteria 157883
172 Ga0268266_10002316 3300028379 Bacteria 20650
173 Ga0268266_10005331 3300028379 Bacteria 12041
174 Ga0268266_10012715 3300028379 Bacteria 7274
175 Ga0268266_10018558 3300028379 Bacteria 5928
176 Ga0268266_10022478 3300028379 Bacteria 5374
177 Ga0268266_10279701 3300028379 Bacteria 1551
178 Ga0268266_10684560 3300028379 Bacteria 988
179 Ga0265338_10234800 3300028800 Bacteria 1362
180 Ga0268256_1003507 3300030500 Bacteria 7043
181 Ga0265339_10030630 3300031249 Bacteria 3046
182 Ga0265316_10052088 3300031344 Bacteria 3212
183 Ga0307513_10104308 3300031456 Bacteria 2849
184 Ga0307408_100296053 3300031548 Bacteria 1353
185 Ga0307405_10379387 3300031731 Bacteria 1100
186 Ga0307413_10193624 3300031824 Bacteria 1462
187 Ga0307406_10520473 3300031901 Bacteria 968
188 Ga0307407_10305387 3300031903 Bacteria 1111
189 Ga0307412_10308405 3300031911 Bacteria 1254
190 Ga0315914_1000004 3300031967 Bacteria 288534
191 Ga0307416_100824385 3300032002 Bacteria 1025
192 Ga0307416_101006405 3300032002 Bacteria 936
193 Ga0307414_10591751 3300032004 Bacteria 994
194 Ga0315913_1000370 3300033430 Bacteria 38384
195 Ga0315915_1000003 3300033464 Bacteria 407996
196 Ga0373926_0084441 3300035083 Bacteria 1177
197 Ga0373927_0000144 3300035695 Bacteria 55726
198 Ga0373947_0100887 3300035725 Bacteria 1814
199 Ga0316582_0067401 3300036647 Bacteria 2309
200 Ga0316582_0296719 3300036647 Bacteria 1110
201 Ga0373925_0000481 3300037068 Bacteria 39959
202 Ga0395900_0246407 3300037418 Bacteria 1790
203 Ga0395900_0253816 3300037418 Bacteria 1759
204 Ga0395905_0069723 3300037471 Bacteria 3293
205 Ga0395905_0103827 3300037471 Bacteria 2668
206 Ga0395905_0401077 3300037471 Bacteria 1266
207 Ga0395905_0642189 3300037471 Bacteria 963
208 Ga0395901_0062742 3300038443 Bacteria 3867
209 Ga0395901_0090720 3300038443 Bacteria 3199
210 Ga0395901_0279437 3300038443 Bacteria 1735
211 Ga0466972_0082084 3300044658 Bacteria 1534
212 Ga0466965_0215208 3300044683 Bacteria 1023
213 Ga0466958_0020303 3300045836 Bacteria 3873
214 Ga0495638_0002052 3300046460 Bacteria 17104
215 Ga0495650_0003032 3300046471 Bacteria 12678
216 Ga0495585_0019476 3300046492 Bacteria 3912
217 Ga0495606_0206785 3300046507 Bacteria 1115
218 Ga0495643_0025307 3300046522 Bacteria 3359
219 Ga0495645_0024585 3300046543 Bacteria 4372
220 Ga0495625_0000182 3300046660 Bacteria 98244
221 Ga0495625_0005589 3300046660 Bacteria 11404
222 Ga0495625_0025984 3300046660 Bacteria 4430
223 Ga0495625_0041200 3300046660 Bacteria 3363
224 Ga0495660_0159642 3300046810 Bacteria 1107
225 Ga0495672_0067521 3300047320 Bacteria 2036
226 Ga0495687_063021 3300047443 Bacteria 1520
227 Ga0495681_0094339 3300047470 Bacteria 1317
228 Ga0495686_0005687 3300047472 Bacteria 9748
229 Ga0495615_0103679 3300048090 Bacteria 806
230 Ga0496102_0373845 3300048905 Bacteria 1341
231 Ga0496104_0245332 3300048907 Bacteria 1704
232 Ga0496108_0099977 3300048911 Bacteria 2473
233 Ga0496112_0073729 3300048915 Bacteria 3374
234 Ga0496112_0243971 3300048915 Bacteria 1748
235 Ga0496113_0224774 3300048916 Bacteria 1496
236 Ga0496115_0090073 3300048918 Bacteria 2506
237 Ga0496116_0014048 3300048919 Bacteria 6414
238 Ga0496116_0145175 3300048919 Bacteria 1327
239 Ga0496119_0016320 3300048922 Bacteria 5659
240 Ga0496120_0002072 3300048923 Bacteria 21552
241 Ga0496120_0023868 3300048923 Bacteria 3822
242 Ga0496122_0082939 3300048925 Bacteria 2225
243 Ga0496123_0029128 3300048926 Bacteria 4075
244 Ga0496124_0166319 3300048927 Bacteria 1714
245 Ga0496125_0075313 3300048928 Bacteria 2613
246 Ga0496125_0208006 3300048928 Bacteria 1274
247 Ga0496126_0003783 3300048929 Bacteria 18780
248 Ga0496126_0155177 3300048929 Bacteria 1960
249 Ga0501031_0000002 3300049568 Bacteria 217588
250 Ga0501031_0010981 3300049568 Bacteria 5901
251 Ga0501031_0032232 3300049568 Bacteria 3417
252 Ga0501031_0175768 3300049568 Bacteria 1399
253 Ga0501031_0259214 3300049568 Bacteria 1130
254 Ga0501032_0000004 3300049569 Bacteria 310855
255 Ga0501032_0001866 3300049569 Bacteria 16660
256 Ga0501032_0051201 3300049569 Bacteria 2785
257 Ga0501033_0000016 3300049570 Bacteria 217458
258 Ga0501033_0000182 3300049570 Bacteria 60298
259 Ga0501033_0000818 3300049570 Bacteria 28395
260 Ga0501033_0009577 3300049570 Bacteria 7452
261 Ga0501033_0022586 3300049570 Bacteria 4746
262 Ga0501033_0042065 3300049570 Bacteria 3407
263 Ga0501033_0133254 3300049570 Bacteria 1799
264 Ga0501033_0282180 3300049570 Bacteria 1172
265 Ga0501034_0000011 3300049571 Bacteria 310855
266 Ga0501034_0001712 3300049571 Bacteria 28224
267 Ga0501034_0007755 3300049571 Bacteria 11413
268 Ga0501034_0158900 3300049571 Bacteria 2233
269 Ga0501036_0000001 3300049572 Bacteria 310855
270 Ga0501036_0006422 3300049572 Bacteria 9544
271 Ga0501036_0030701 3300049572 Bacteria 4539
272 Ga0501036_0185647 3300049572 Bacteria 1750
273 Ga0501036_0278911 3300049572 Bacteria 1399
274 Ga0501036_0467918 3300049572 Bacteria 1050
275 Ga0501036_0477232 3300049572 Bacteria 1038
276 Ga0501037_0000006 3300049573 Bacteria 217461
277 Ga0501037_0000142 3300049573 Bacteria 66550
278 Ga0501038_0000003 3300049574 Bacteria 310855
279 Ga0501038_0000979 3300049574 Bacteria 25625
280 Ga0501038_0071504 3300049574 Bacteria 2943
281 Ga0501038_0148296 3300049574 Bacteria 1914
282 Ga0501038_0252505 3300049574 Bacteria 1396
283 Ga0501039_0000004 3300049575 Bacteria 310855
284 Ga0501039_0070449 3300049575 Bacteria 2716
285 Ga0501039_0605123 3300049575 Bacteria 859
286 Ga0501040_0004502 3300049576 Bacteria 9045
287 Ga0501042_0068089 3300049578 Bacteria 2545
288 Ga0501043_0000066 3300049579 Bacteria 93258
289 Ga0501043_0000588 3300049579 Bacteria 32210
290 Ga0501043_0009297 3300049579 Bacteria 7723
291 Ga0501043_0332533 3300049579 Bacteria 1157
292 Ga0501046_0015684 3300049580 Bacteria 6360
293 Ga0501046_0096005 3300049580 Bacteria 2277
294 Ga0501047_0011488 3300049581 Bacteria 8382
295 Ga0501047_0024880 3300049581 Bacteria 5749
296 Ga0501047_0030377 3300049581 Bacteria 5209
297 Ga0501047_0075152 3300049581 Bacteria 3251
298 Ga0501047_0167104 3300049581 Bacteria 2070
299 Ga0501047_0423512 3300049581 Bacteria 1162
300 Ga0501048_0005100 3300049582 Bacteria 10007
301 Ga0501067_0029599 3300049583 Bacteria 3035
302 Ga0501067_0074703 3300049583 Bacteria 1878
303 Ga0501068_0005415 3300049584 Bacteria 6984
304 Ga0501068_0014507 3300049584 Bacteria 4505
305 Ga0501068_0113680 3300049584 Bacteria 1685
306 Ga0501069_0000002 3300049585 Bacteria 269636
307 Ga0501069_0008770 3300049585 Bacteria 5324
308 Ga0501069_0048007 3300049585 Bacteria 2370
309 Ga0501069_0106949 3300049585 Bacteria 1591
310 Ga0501070_0000051 3300049586 Bacteria 101897
311 Ga0501070_0002384 3300049586 Bacteria 16474
312 Ga0501070_0004526 3300049586 Bacteria 11930
313 Ga0501070_0006025 3300049586 Bacteria 10327
314 Ga0501070_0016663 3300049586 Bacteria 6172
315 Ga0501071_0085231 3300049587 Bacteria 2316
316 Ga0501071_0106162 3300049587 Bacteria 2074
317 Ga0501073_0006953 3300049589 Bacteria 8425
318 Ga0501073_0010824 3300049589 Bacteria 6680
319 Ga0501074_0001350 3300049590 Bacteria 16259
320 Ga0501074_0227658 3300049590 Bacteria 1327
321 Ga0501080_0001856 3300049742 Bacteria 18153
322 Ga0501080_0007434 3300049742 Bacteria 9889
323 Ga0501080_0042886 3300049742 Bacteria 4212
324 Ga0501080_0236362 3300049742 Bacteria 1669
325 Ga0501083_0000187 3300049744 Bacteria 39905
326 Ga0501083_0033156 3300049744 Bacteria 3538
327 Ga0501083_0110715 3300049744 Bacteria 1806
328 Ga0501035_0000009 3300049822 Bacteria 310827
329 Ga0501035_0002215 3300049822 Bacteria 19311
330 Ga0501035_0002554 3300049822 Bacteria 17805
331 Ga0501035_0002576 3300049822 Bacteria 17719
332 Ga0501035_0003955 3300049822 Bacteria 14136
333 Ga0501035_0007237 3300049822 Bacteria 10383
334 Ga0501035_0019856 3300049822 Bacteria 6172
335 Ga0501035_0045873 3300049822 Bacteria 3931
336 Ga0501035_0216599 3300049822 Bacteria 1636
337 Ga0501035_0369045 3300049822 Bacteria 1198
338 Ga0501035_0558194 3300049822 Bacteria 937
339 Ga0501044_0000005 3300049823 Bacteria 310855
340 Ga0501044_0000923 3300049823 Bacteria 35383
341 Ga0501044_0007678 3300049823 Bacteria 11859
342 Ga0501044_0010931 3300049823 Bacteria 9853
343 Ga0501044_0017045 3300049823 Bacteria 7795
344 Ga0501044_0029897 3300049823 Bacteria 5744
345 Ga0501044_0157203 3300049823 Bacteria 2252
346 Ga0501044_0517847 3300049823 Bacteria 1093
347 Ga0501045_0015261 3300049824 Bacteria 5452
348 nmdc:mga03683_7962_c1 3300050489 Bacteria 3705
349 nmdc:mga03n38_49596_c1 3300050490 Bacteria 1867
350 nmdc:mga03n38_7203_c1 3300050490 Bacteria 3921
351 nmdc:mga00v17_115493_c1 3300050491 Bacteria 1706
352 nmdc:mga00v17_12374_c1 3300050491 Bacteria 4707
353 nmdc:mga0yw44_149407_c1 3300050492 Bacteria 1523
354 nmdc:mga0yw44_76772_c1 3300050492 Bacteria 2086
355 nmdc:mga0k408_388348_c1 3300050493 Bacteria 831
356 nmdc:mga0sz30_50634_c1 3300050516 Bacteria 1761
357 nmdc:mga0sz30_57025_c1 3300050516 Bacteria 1664
358 Ga0495612_0085143 3300053078 Bacteria 1332
359 Ga0500559_0001518 3300053136 Bacteria 13013
360 Ga0500568_0000010 3300053139 Bacteria 249043
361 Ga0500604_0038969 3300053151 Bacteria 1427
362 Ga0500616_0070377 3300053153 Bacteria 1786
363 Ga0500616_0216385 3300053153 Bacteria 838
364 Ga0500620_001452 3300053155 Bacteria 4384
365 Ga0500627_0210728 3300053158 Bacteria 869
366 Ga0500611_004053 3300053727 Bacteria 1940
367 Ga0587083_0014694 3300059505 Bacteria 1353
368 2503198747 2503198000 Bacteria 6884444
369 2509114127 2508501123 Bacteria 6283661
370 2509144411 2508501127 Bacteria 7037543
371 2509368776 2509276018 Bacteria 6910194
372 2509393634 2509276022 Bacteria 6200534
373 2510308163 2510065057 Bacteria 6649661
374 2510315060 2510065059 Bacteria 6847884
375 2511137143 2510917022 Bacteria 6504556
376 2511498942 2511231052 Bacteria 6974333
377 2512933855 2512875016 Bacteria 6529530
378 2512962052 2512875024 Bacteria 7195110
379 2512973105 2512875026 Bacteria 6861065
380 2513587210 2513237086 Bacteria 7265287
381 2513604314 2513237089 Bacteria 6553624
382 2513610502 2513237090 Bacteria 7096802
383 2513616200 2513237091 Bacteria 6900273
384 2513870246 2513237138 Bacteria 7368160
385 2513882647 2513237140 Bacteria 7076289
386 2513904630 2513237143 Bacteria 6664116
387 2513911075 2513237144 Bacteria 7530820
388 2513924407 2513237146 Bacteria 7166346
389 2514008172 2513237160 Bacteria 6650282
390 2514039142 2513237164 Bacteria 7563725
391 2514417570 2513237305 Bacteria 7293571
392 2515607360 2515154107 Bacteria 6795637
393 2516895218 2516653046 Bacteria 6989037
394 2517571895 2517487022 Bacteria 7227575
395 2524450898 2524023207 Bacteria 6813453
396 2524458030 2524023209 Bacteria 6679728
397 2535514690 2534681796 Bacteria 7146037
398 2551675220 2551306084 Bacteria 8942552
399 2551686967 2551306085 Bacteria 7347181
400 2551709248 2551306089 Bacteria 7162724
401 2551743146 2551306093 Bacteria 7064773
402 2585164521 2582581283 Bacteria 6030556
403 2585273604 2582581307 Bacteria 6597605
404 2585326311 2582581315 Bacteria 7318924
405 2585330477 2582581316 Bacteria 7774528
406 2585386114 2582581865 Bacteria 6644329
407 2585398968 2582581867 Bacteria 7184437
408 2585533831 2585427527 Bacteria 7273426
409 2585553424 2585427530 Bacteria 7383882
410 2585559777 2585427531 Bacteria 6992870
411 2585818911 2585427590 Bacteria 6824633
412 2585900465 2585427608 Bacteria 6544331
413 2585906043 2585427609 Bacteria 6667127
414 2587978842 2585428125 Bacteria 6662905
415 2588519953 2588253730 Bacteria 6881675
416 2597810709 2597489875 Bacteria 7010078
417 2599419634 2599185170 Bacteria 7295545
418 2599940126 2599185301 Bacteria 6161860
419 2600197546 2599185352 Bacteria 7228948
420 2616556220 2615840698 Bacteria 7319877
421 2617380582 2617270742 Bacteria 6808054
422 2643773368 2643221550 Bacteria 4619371
423 2643839500 2643221564 Bacteria 4193379
424 2643985819 2643221595 Bacteria 6565519
425 2644004532 2643221599 Bacteria 6292121
426 2644134020 2643221623 Bacteria 5239945
427 2644144561 2643221626 Bacteria 8069654
428 2644157121 2643221627 Bacteria 6761570
429 2644196955 2643221634 Bacteria 6705461
430 2644306612 2643221655 Bacteria 7722067
431 2644330802 2643221659 Bacteria 7890716
432 2644542392 2643221698 Bacteria 7756764
433 2644612223 2643221712 Bacteria 7729434
434 2644671579 2643221723 Bacteria 7095460
435 2671113994 2667528174 Bacteria 6435400
436 2688596031 2687453392 Bacteria 6880454
437 2692317657 2690316117 Bacteria 6800650
438 2694627774 2693429783 Bacteria 7019804
439 2694636047 2693429784 Bacteria 7241525
440 2694636888 2693429784 Bacteria 7241525
441 2723573188 2721755686 Bacteria 7343952
442 2738947736 2738541317 Bacteria 5340176
443 2739309892 2738543024 Bacteria 5603683
444 2756675102 2756170246 Bacteria 7451806
445 2776269449 2775506902 Bacteria 6208009
446 2776282379 2775506904 Bacteria 5954060
447 2778173839 2775507266 Bacteria 7392367
448 2792583338 2791355082 Bacteria 5973319
449 2792625275 2791355092 Bacteria 6248105
450 2792747241 2791355123 Bacteria 8049106
451 2802718672 2802428858 Bacteria 6636079
452 2802724352 2802428859 Bacteria 6667919
453 2802729986 2802428860 Bacteria 6525526
454 2802737329 2802428861 Bacteria 6534206
455 2802742245 2802428862 Bacteria 6633353
456 2802748927 2802428863 Bacteria 6410669
457 2819608735 2818991448 Bacteria 6772224
458 2819640844 2818991453 Bacteria 7181617
459 2838029626 2838029111 Bacteria 6603031
460 2838039834 2838035591 Bacteria 7166484
461 2841736421 2841734538 Bacteria 6784580
462 2842299788 2842298080 Bacteria 6123127
463 2842359690 2842357229 Bacteria 6485165
464 2842475944 2842475841 Bacteria 6603183
465 2842486027 2842482326 Bacteria 7212537
466 2842503154 2842502639 Bacteria 6604161
467 2842513022 2842509118 Bacteria 6850950
468 2844003406 2844002411 Bacteria 7168230
469 2844010844 2844009547 Bacteria 6728125
470 2844170042 2844163670 Bacteria 7266046
471 2847421363 2847417321 Bacteria 6913799
472 2847673487 2847670302 Bacteria 6165597
473 2847689996 2847686936 Bacteria 6278406
474 2855827856 2855825444 Bacteria 6785811
475 2855843224 2855839649 Bacteria 7135830
476 2856319044 2856314179 Bacteria 6477897
477 2856323815 2856320880 Bacteria 7263508
478 2856332484 2856328259 Bacteria 6528202
479 2856337387 2856334872 Bacteria 7037011
480 2856347486 2856342000 Bacteria 7176905
481 2856350804 2856349417 Bacteria 6230045
482 2856358208 2856356410 Bacteria 6297484
483 2856369813 2856364286 Bacteria 6939991
484 2857352991 2857349434 Bacteria 7926032
485 2857370485 2857367948 Bacteria 6965560
486 2858802952 2858800743 Bacteria 6603254
487 2869166073 2869162929 Bacteria 6399702
488 2869170896 2869169390 Bacteria 6659796
489 2869235644 2869234852 Bacteria 6654993
490 2869252877 2869249662 Bacteria 6868783
491 2869261601 2869256925 Bacteria 6981691
492 2869267939 2869264136 Bacteria 6880765
493 2869272818 2869271264 Bacteria 6908218
494 2869284786 2869278585 Bacteria 7077053
495 2869290620 2869285874 Bacteria 6901219
496 2871432902 2871429161 Bacteria 6547891
497 2871443221 2871435913 Bacteria 6880295
498 2871457001 2871451962 Bacteria 7336357
499 2871462355 2871459585 Bacteria 6866887
500 2871471713 2871466892 Bacteria 6923287
501 2871477215 2871474448 Bacteria 6806570
502 2871484220 2871481445 Bacteria 6700002
503 2871489792 2871488783 Bacteria 6929816
504 2871499836 2871495908 Bacteria 6935695
505 2874107208 2874102143 Bacteria 6342645
506 2874112251 2874109183 Bacteria 6517025
507 2874118167 2874116593 Bacteria 6674494
508 2874128388 2874123672 Bacteria 7238285
509 2874131936 2874131515 Bacteria 6820270
510 2874142893 2874139085 Bacteria 7021506
511 2874153937 2874146452 Bacteria 7533118
512 2874158625 2874155637 Bacteria 6724144
513 2874165960 2874162495 Bacteria 6174670
514 2874172496 2874168670 Bacteria 8062617
515 2876363889 2876363079 Bacteria 6544991
516 2876373106 2876369609 Bacteria 6807521
517 2876379261 2876377896 Bacteria 6565995
518 2876390969 2876386047 Bacteria 6698674
519 2876396982 2876392853 Bacteria 6660880
520 2876400159 2876399893 Bacteria 6927900
521 2876413444 2876406927 Bacteria 6191900
522 2876419242 2876413966 Bacteria 6831344
523 2876427413 2876420981 Bacteria 6687741
524 2878039433 2878035449 Bacteria 6555736
525 2878741037 2878738818 Bacteria 7136951
526 2878750515 2878745973 Bacteria 6867388
527 2878754172 2878753008 Bacteria 6922523
528 2878764000 2878760144 Bacteria 6823465
529 2878771030 2878767105 Bacteria 6898628
530 2878777743 2878774303 Bacteria 6108671
531 2878785704 2878781027 Bacteria 6834456
532 2878788966 2878788777 Bacteria 6567085
533 2881148256 2881147464 Bacteria 7779814
534 2881159339 2881155292 Bacteria 6461656
535 2881165039 2881161766 Bacteria 7127907
536 2881847566 2881845957 Bacteria 6611900
537 2881855859 2881853255 Bacteria 6698367
538 2881864554 2881861095 Bacteria 7128710
539 2882636790 2882632389 Bacteria 8154593
540 2882915899 2882912400 Bacteria 6801539
541 2885306907 2885305155 Bacteria 7348390
542 2885314086 2885312484 Bacteria 6415165
543 2885320096 2885318864 Bacteria 6729568
544 2885335464 2885334103 Bacteria 7216818
545 2885344996 2885342637 Bacteria 7011821
546 2885352925 2885350715 Bacteria 6787678
547 2888343352 2888337043 Bacteria 6629336
548 2888344425 2888343758 Bacteria 6611049
549 2888353129 2888350351 Bacteria 7372807
550 2889014975 2889010040 Bacteria 6749192
551 2889019955 2889016732 Bacteria 6700763
552 2903454030 2903448605 Bacteria 7357801
553 2903497513 2903492973 Bacteria 13473544
554 2903499639 2903492973 Bacteria 13473544
555 2903513887 2903513507 Bacteria 6344008
556 2903525952 2903521522 Bacteria 6525694
557 2903532502 2903528002 Bacteria 6586099
558 2903544647 2903540706 Bacteria 7062119
559 2904663736 2904659560 Bacteria 6685615
560 2906313440 2906308376 Bacteria 6841989
561 2906326149 2906321335 Bacteria 6579571
562 2906334142 2906328253 Bacteria 6585166
563 2906355873 2906354277 Bacteria 6991324
564 2906367797 2906363423 Bacteria 6856682
565 2906371268 2906370794 Bacteria 6881062
566 2906382012 2906378014 Bacteria 6911440
567 2906390073 2906386501 Bacteria 5977019
568 2906399367 2906393657 Bacteria 6790866
569 2906405153 2906401398 Bacteria 6693206
570 2906413864 2906408224 Bacteria 6162342
571 2906419115 2906414383 Bacteria 6580790
572 2906432854 2906427513 Bacteria 6375796
573 2913311610 2913308742 Bacteria 5350706
574 2915986596 2915980308 Bacteria 6624279
575 2915993660 2915986958 Bacteria 6739310
576 2915994196 2915993759 Bacteria 7016183
577 2916004902 2916000859 Bacteria 6865702
578 2916008305 2916007675 Bacteria 6898660
579 2916015124 2916014648 Bacteria 6946486
580 2916026181 2916021584 Bacteria 6854472
581 2916035163 2916028427 Bacteria 6748433
582 2916041532 2916035215 Bacteria 6755766
583 2916047426 2916041962 Bacteria 6820487
584 2916054837 2916048683 Bacteria 6543552
585 2916058943 2916055098 Bacteria 6758838
586 2916065888 2916061851 Bacteria 6737736
587 2916071699 2916068649 Bacteria 6943657
588 2916077278 2916076590 Bacteria 6596108
589 2919408464 2919408235 Bacteria 6149349
590 2921202469 2921201388 Bacteria 6926299
591 2921209226 2921208531 Bacteria 6745326
592 2921237611 2921237296 Bacteria 6876710
593 2921249756 2921244191 Bacteria 6568419
594 2921254873 2921250672 Bacteria 6677771
595 2921263866 2921257292 Bacteria 6808382
596 2921270529 2921263974 Bacteria 6864552
597 2921283121 2921282425 Bacteria 6826397
598 2921290001 2921289301 Bacteria 7316391
599 2921301751 2921296804 Bacteria 7176999
600 2922134635 2922130491 Bacteria 7173936
601 2922157629 2922151315 Bacteria 6902399
602 2922162016 2922158528 Bacteria 6573167
603 2922175649 2922172374 Bacteria 6167644
604 2922183223 2922178524 Bacteria 6025201
605 2922188853 2922185730 Bacteria 7113964
606 2923556304 2923556063 Bacteria 6793593
607 2924146146 2924144063 Bacteria 6883928
608 2924158219 2924150972 Bacteria 7169444
609 2924164548 2924158325 Bacteria 7188855
610 2924171361 2924165586 Bacteria 7260590
611 2924179621 2924172951 Bacteria 6749356
612 2924180045 2924179722 Bacteria 6843264
613 2924186811 2924186466 Bacteria 6876637
614 2924200286 2924193448 Bacteria 6955718
615 2924202603 2924200457 Bacteria 6757188
616 2924209452 2924207177 Bacteria 6917007
617 2924216663 2924214083 Bacteria 7080103
618 2924227049 2924221636 Bacteria 7113495
619 2924234751 2924228884 Bacteria 6633132
620 2924710593 2924710171 Bacteria 6752351
621 2924720569 2924718760 Bacteria 6331356
622 2924731419 2924726620 Bacteria 6271473
623 2924734850 2924733363 Bacteria 7574837
624 2924747703 2924741084 Bacteria 6661321
625 2924752954 2924748358 Bacteria 6154725
626 2924760814 2924754689 Bacteria 6774424
627 2924766119 2924762789 Bacteria 6561353
628 2924778638 2924776078 Bacteria 7492003
629 2924784860 2924784321 Bacteria 7416538
630 2936998652 2936996657 Bacteria 6298727
631 2937006328 2937002841 Bacteria 6934057
632 2937011686 2937009748 Bacteria 6746052
633 2937018392 2937016420 Bacteria 6782579
634 2937025734 2937023124 Bacteria 6815156
635 2937033613 2937029754 Bacteria 6424026
636 2937040351 2937036028 Bacteria 6846469
637 2937044593 2937042894 Bacteria 6741576
638 2937055983 2937049772 Bacteria 6757901
639 2937057231 2937056579 Bacteria 7107896
640 2937069957 2937063883 Bacteria 7199456
641 2937078325 2937071275 Bacteria 6984483
642 2937082702 2937078374 Bacteria 6610289
643 2937088639 2937084907 Bacteria 6618516
644 2937092589 2937091812 Bacteria 6979387
645 2937106313 2937098957 Bacteria 7249374
646 2937108289 2937106411 Bacteria 6947143
647 2937118678 2937113482 Bacteria 6505872
648 2937121877 2937119839 Bacteria 6597547
649 2937129665 2937126314 Bacteria 6771275
650 2937820256 2937813078 Bacteria 7783518
651 2937822696 2937822353 Bacteria 7290551
652 2937850091 2937848649 Bacteria 6983481
653 2937867692 2937861824 Bacteria 6660327
654 2937870478 2937868953 Bacteria 6639878
655 2937878464 2937877337 Bacteria 7246526
656 2937892671 2937891427 Bacteria 6357007
657 2937974305 2937972304 Bacteria 7532020
658 2937998495 2937994558 Bacteria 7036190
659 2957377919 2957375807 Bacteria 6425588
660 2957384337 2957382221 Bacteria 6737050
661 2957393787 2957388812 Bacteria 6778072
662 2957396037 2957395598 Bacteria 6822399
663 2957405590 2957402308 Bacteria 6741770
664 2957413517 2957408893 Bacteria 6558585
665 2957422284 2957415311 Bacteria 6991633
666 2957425509 2957422303 Bacteria 7172205
667 2957434343 2957430029 Bacteria 7022557
668 2957437540 2957437181 Bacteria 6568994
669 2957450150 2957443900 Bacteria 6869977
670 2957452830 2957450854 Bacteria 6765715
671 2957458223 2957457609 Bacteria 6967680
672 2957466299 2957464669 Bacteria 6568877
673 2957474681 2957471148 Bacteria 6797643
674 2957484092 2957478035 Bacteria 6756658
675 2957485215 2957484790 Bacteria 6703082
676 2957493785 2957491536 Bacteria 6695180
677 2957499264 2957498199 Bacteria 7126688
678 2957506017 2957505466 Bacteria 7253085
679 2958041359 2958034702 Bacteria 6989922
680 2958042333 2958041894 Bacteria 13082850
681 2958046639 2958041894 Bacteria 13082850
682 2958071194 2958064165 Bacteria 7158582
683 2958077376 2958071322 Bacteria 6815895
684 2958085737 2958084443 Bacteria 7312792
685 2958106546 2958100919 Bacteria 6800575
686 2958119124 2958115193 Bacteria 6923548
687 2958123987 2958122699 Bacteria 7280457
688 2958135020 2958130278 Bacteria 6897202
689 2958141397 2958137437 Bacteria 6050276
690 2958144747 2958144490 Bacteria 6677056
691 2958164386 2958158011 Bacteria 6058449
692 2958168971 2958165035 Bacteria 6906348
693 2958177138 2958172287 Bacteria 6716688
694 2958184049 2958179912 Bacteria 6874908
695 2960584622 2960584000 Bacteria 6864594
696 2960593265 2960591022 Bacteria 6622873
697 2960603178 2960597568 Bacteria 6550735
698 2960609368 2960603979 Bacteria 6898737
699 2960615337 2960610863 Bacteria 6691244
700 2960623249 2960617483 Bacteria 6727748
701 2960624825 2960624210 Bacteria 6875384
702 2960637051 2960631154 Bacteria 6732508
703 2960638877 2960637947 Bacteria 7296468
704 2960650944 2960645483 Bacteria 7211087
705 2960659365 2960652885 Bacteria 7083688
706 2960666939 2960660292 Bacteria 7041660
707 2960670179 2960667422 Bacteria 6763020
708 2960679550 2960674078 Bacteria 6609048
709 2960685247 2960680706 Bacteria 6624464
710 2960693656 2960687367 Bacteria 6535474
711 2960697376 2960693952 Bacteria 6749742
712 2961082104 2961077736 Bacteria 7079850
713 2961119124 2961114664 Bacteria 6680456
714 2961129713 2961127735 Bacteria 7196641
715 2961139603 2961136820 Bacteria 6775228
716 2961167433 2961163497 Bacteria 6901077
717 2961176230 2961170736 Bacteria 7072258
718 2961187584 2961183825 Bacteria 6688536
719 2963645347 2963644680 Bacteria 6530403
720 2964611556 2964607997 Bacteria 7101408
721 2964621555 2964615318 Bacteria 6809089
722 2964622459 2964621998 Bacteria 6834995
723 2964634249 2964628898 Bacteria 7083044
724 2964641419 2964636051 Bacteria 7091832
725 2964644966 2964643177 Bacteria 6820887
726 2964655945 2964649959 Bacteria 6675118
727 2964657017 2964656573 Bacteria 7100150
728 2964670343 2964663802 Bacteria 7019362
729 2964672389 2964670856 Bacteria 6851364
730 2964684543 2964678106 Bacteria 6792020
731 2964685342 2964685014 Bacteria 6839111
732 2964692384 2964691889 Bacteria 6802758
733 2964705397 2964698721 Bacteria 6765331
734 2964708965 2964705432 Bacteria 7114648
735 2964713027 2964712639 Bacteria 6695970
736 2964720285 2964719344 Bacteria 7286602
737 2965022255 2965018300 Bacteria 6883036
738 2965029932 2965025482 Bacteria 6532201
739 2965035993 2965032056 Bacteria 6887443
740 2965044239 2965040258 Bacteria 6855979
741 2965052391 2965047637 Bacteria 6623551
742 2965064143 2965062239 Bacteria 7412989
743 2965094816 2965089291 Bacteria 6866420
744 2965105261 2965102966 Bacteria 6800987
745 2965115722 2965110997 Bacteria 6693150
746 2965123609 2965119406 Bacteria 6956431
747 2967665783 2967664464 Bacteria 6948836
748 2967671968 2967671571 Bacteria 7021409
749 2967679120 2967678726 Bacteria 7264382
750 2967689917 2967686174 Bacteria 6678622
751 2967695287 2967693043 Bacteria 6804451
752 2967701129 2967699805 Bacteria 6854538
753 2967707694 2967706974 Bacteria 7186053
754 2967720682 2967714385 Bacteria 7000047
755 2967728489 2967721400 Bacteria 7073753
756 2967732787 2967728569 Bacteria 6641507
757 2967741114 2967735183 Bacteria 6827012
758 2967742370 2967742019 Bacteria 6794534
759 2967749591 2967748971 Bacteria 6733771
760 2967761949 2967755722 Bacteria 6814706
761 2967768680 2967762386 Bacteria 6923502
762 2967771404 2967769361 Bacteria 6587838
763 2967776559 2967775926 Bacteria 6738189
764 2967996855 2967996073 Bacteria 6787468
765 2968004918 2968003550 Bacteria 6929263
766 2968022879 2968016561 Bacteria 7022047
767 2968089756 2968083720 Bacteria 7351627
768 2968093553 2968091066 Bacteria 6052692
769 2968101402 2968097103 Bacteria 6107094
770 2968114875 2968110612 Bacteria 6814636
771 2968122606 2968117919 Bacteria 6536078
772 2968134018 2968128360 Bacteria 6270294
773 2968143086 2968138860 Bacteria 6605449
774 2968175840 2968171901 Bacteria 6894245
775 2970020055 2970019648 Bacteria 7072033
776 2970031055 2970026789 Bacteria 6785236
777 2970046858 2970040964 Bacteria 6731123
778 2970051846 2970047711 Bacteria 7088379
779 2970060402 2970054988 Bacteria 6611507
780 2970062071 2970061556 Bacteria 7099761
781 2970082276 2970076120 Bacteria 6697332
782 2970087991 2970082768 Bacteria 6183754
783 2970091653 2970088815 Bacteria 6933825
784 2970102493 2970095765 Bacteria 6936963
785 2970108312 2970102677 Bacteria 6812532
786 2970113543 2970109326 Bacteria 6863976
787 2970121994 2970116247 Bacteria 6501857
788 2970128607 2970122695 Bacteria 6625855
789 2970135415 2970129317 Bacteria 6806560
790 2970137819 2970136068 Bacteria 7207982
791 2970149322 2970143518 Bacteria 6446480
792 2970153611 2970149975 Bacteria 6779706
793 2970157884 2970156795 Bacteria 7168044
794 2970169670 2970164137 Bacteria 6861252
795 2970174044 2970170962 Bacteria 6876229
796 2970182451 2970177841 Bacteria 6768001
797 2970187008 2970184632 Bacteria 7054431
798 2970198645 2970191845 Bacteria 7032787
799 2970475464 2970469710 Bacteria 6969209
800 2970493686 2970489779 Bacteria 6517260
801 2970508901 2970503327 Bacteria 7099517
802 2970517239 2970510686 Bacteria 7006402
803 2970526140 2970524798 Bacteria 6840927
804 2970534121 2970532167 Bacteria 6553173
805 2970553232 2970547951 Bacteria 6931819
806 2970558844 2970554993 Bacteria 6814252
807 2970599397 2970593180 Bacteria 7073582
808 2970621582 2970619444 Bacteria 6986144
809 2970630673 2970627176 Bacteria 6680862
810 2977517458 2977516862 Bacteria 6940108
811 2977530351 2977523885 Bacteria 6960446
812 2977530996 2977530762 Bacteria 6951399
813 2977538610 2977537788 Bacteria 6929320
814 2977548645 2977544691 Bacteria 6875412
815 2977554209 2977551784 Bacteria 7125765
816 2977565326 2977558990 Bacteria 6863948
817 2977569975 2977565890 Bacteria 6901543
818 2977579425 2977572785 Bacteria 6763888
819 2977584028 2977579622 Bacteria 6772100
820 2977823387 2977821940 Bacteria 6906439
821 2977835456 2977828996 Bacteria 7007971
822 2977847051 2977843712 Bacteria 6753583
823 2977855810 2977851361 Bacteria 6694324
824 2977864191 2977858184 Bacteria 6215359
825 2977868123 2977864932 Bacteria 7534097
826 2977875957 2977872689 Bacteria 7270173
827 2977899474 2977898635 Bacteria 6675551
828 2977913185 2977907340 Bacteria 6577984
829 2977920181 2977915119 Bacteria 6829656
830 2977924551 2977922695 Bacteria 6956781
831 2977941145 2977935797 Bacteria 6252826
832 2977943294 2977942078 Bacteria 7570577
833 2977952899 2977950692 Bacteria 6893264
834 2977962248 2977957713 Bacteria 6877875
835 2977976220 2977971508 Bacteria 7472917
836 2977992106 2977986579 Bacteria 6581278
837 2979710776 2979710463 Bacteria 6785254
838 2979747025 2979742915 Bacteria 7301278
839 2979765957 2979764755 Bacteria 6610066
840 2979786418 2979779861 Bacteria 6219781
841 2979794125 2979793036 Bacteria 6808957
842 2979813580 2979808191 Bacteria 7179355
843 2987641584 2987636660 Bacteria 8088555
844 2987650523 2987645492 Bacteria 6117018
845 2987656327 2987652177 Bacteria 6969023
846 2987663439 2987659509 Bacteria 6966464
847 2987667003 2987666974 Bacteria 6509233
848 2987678534 2987673487 Bacteria 6884027
849 2996311558 2996310559 Bacteria 6357320
850 2996341488 2996336353 Bacteria 5511628
851 2996341921 2996341866 Bacteria 6643098
852 2996349399 2996348954 Bacteria 7239054
853 2996387017 2996386984 Bacteria 6978667
854 2996888092 2996887358 Bacteria 5795980
855 3000137400 3000135777 Bacteria 6891109
856 3004173302 3004167301 Bacteria 8330599
857 3004192498 3004188549 Bacteria 6952365
858 3004202459 3004195979 Bacteria 6776956
859 3004209605 3004203850 Bacteria 7307914
860 3004216956 3004211236 Bacteria 7417683
861 3004225450 3004218560 Bacteria 7421728
862 3004233962 3004232784 Bacteria 6662140
863 3004240854 3004239961 Bacteria 6892290
864 3004249981 3004248173 Bacteria 6563236
865 3004271818 3004268573 Bacteria 7043476
866 3004276107 3004275668 Bacteria 7114440
867 3004337242 3004334049 Bacteria 8449246
868 3005410736 3005409236 Bacteria 7188837
869 3005423150 3005416602 Bacteria 7064308
870 3005456484 3005452660 Bacteria 5889319
871 637077018 637000159 Bacteria 7596297
872 648736679 648276728 Bacteria 6968865
873 649870598 649633066 Bacteria 6690028
874 8002286423 8002285264 Bacteria 6717907
875 8003995806 8003992118 Bacteria 7266902
876 8004003566 8003999396 Bacteria 7063185
877 8004306371 8004300914 Bacteria 6132239
878 8004318537 8004312739 Bacteria 7444653
879 8004363092 8004361976 Bacteria 6858373
880 8004375749 8004374579 Bacteria 6898112
881 8004392909 8004387939 Bacteria 7049250
882 8004449476 8004445564 Bacteria 6322258
883 8004643856 8004640170 Bacteria 6723001
884 8004699362 8004695233 Bacteria 6731676
885 8004706707 8004703790 Bacteria 8006957
886 8004719696 8004714634 Bacteria 6776161
887 8004734668 8004727605 Bacteria 6643904
888 8005315477 8005314921 Bacteria 7072929
889 8005322619 8005321885 Bacteria 5795980
890 8005484615 8005484373 Bacteria 6297373
891 8005543358 8005542996 Bacteria 7077758
892 8005649308 8005645114 Bacteria 6950293
893 8005661606 8005658619 Bacteria 4500593
894 8005685455 8005682033 Bacteria 6726518
895 8018152823 8018150411 Bacteria 5549903
896 8046769623 8046767195 Bacteria 7547379
897 8049296693 8049293176 Bacteria 6128433
898 8055617952 8055617313 Bacteria 7548464
899 8057580338 8057575449 Bacteria 7367519
900 Ga0105240_10287399
901 LJNas_1000120
902 JGI24740J21852_10003637
903 JGI24739J22299_10028216
904 JGI24735J21928_10019579
905 JGI25156J39149_1013450
906 JGI25162J39368_1000244
907 JGI25162J39368_1000493
908 JGI25158J39367_1000756
909 JGI25157J39369_1000555
910 JGI25152J39213_1004107
911 JGI25159J45721_1000015
912 JGI25159J45721_1000338
913 JGI25151J46595_10033099
914 JGI25406J46586_10006406
915 JGI25165J46597_1000079
916 JGI25165J46597_1000553
917 JGI25165J46597_1000796
918 rootH2_10027501
919 rootH1_10271729
920 JGI25160J50197_1000003
921 JGI25160J50197_1000012
922 JGI25161J50226_1000002
923 JGI25161J50226_1000219
924 Ga0055542_1000618
925 Ga0055542_1001408
926 Ga0055529_1003209
927 Ga0055526_1003824
928 Ga0055536_1005156
929 Ga0055528_1021666
930 Ga0055540_1008648
931 Ga0055531_10011294
932 Ga0055543_1000011
933 Ga0055543_1000034
934 Ga0065165_1000025
935 Ga0065165_1000082
936 Ga0070658_10085777
937 Ga0070660_100079572
938 Ga0070660_100209391
939 Ga0070668_100006252
940 Ga0070671_100130795
941 Ga0070663_100068052
942 Ga0068853_100328096
943 Ga0070665_100028010
944 Ga0070665_100052306
945 Ga0070665_100079272
946 Ga0070665_100112308
947 Ga0070665_100270158
948 Ga0070665_100303155
949 Ga0070665_100628597
950 Ga0068855_100008160
951 Ga0068855_100310359
952 Ga0068855_100463947
953 Ga0068857_100206963
954 Ga0068854_100100728
955 Ga0068856_100976370
956 Ga0068852_100191337
957 Ga0081540_1009710
958 Ga0081539_10002395
959 Ga0075365_10014555
960 Ga0075365_10154229
961 Ga0075365_10180082
962 Ga0075368_10016651
963 Ga0075364_10270979
964 Ga0075362_10034225
965 Ga0075367_10002953
966 Ga0075367_10099335
967 Ga0075367_10299299
968 Ga0075367_10371192
969 Ga0075370_10147872
970 Ga0075370_10294165
971 Ga0068871_100538950
972 Ga0079104_1002459
973 Ga0079104_1006003
974 Ga0105251_10009293
975 Ga0105240_10249534
976 Ga0105247_10172516
977 Ga0105248_10012216
978 Ga0105237_10038673
979 Ga0105237_10540323
980 Ga0105237_10851545
981 Ga0105238_10040306
982 Ga0105239_10127612
983 Ga0157370_10064885
984 Ga0157370_10593368
985 Ga0157369_10006251
986 Ga0157369_10021348
987 Ga0157369_10059190
988 Ga0157374_10014300
989 Ga0157372_10022080
990 Ga0157372_10356875
991 Ga0163163_10029885
992 Ga0163163_10220505
993 Ga0182008_10042226
994 Ga0157376_10037849
995 Ga0182006_1047427
996 Ga0182007_10004110
997 Ga0182005_1007445
998 Ga0228711_1003057
999 Ga0228710_1000004
1000 Ga0209760_101730
1001 Ga0209436_100767
1002 Ga0209436_115828
1003 Ga0209563_105661
1004 Ga0209437_100050
1005 Ga0209437_100056
1006 Ga0209437_107127
1007 Ga0207425_1014638
1008 Ga0209026_1000118
1009 Ga0209677_102979
1010 Ga0209148_1000212
1011 Ga0209148_1005894
1012 Ga0209759_1000076
1013 Ga0209129_1001420
1014 Ga0209233_1000037
1015 Ga0209233_1000071
1016 Ga0209233_1000236
1017 Ga0209233_1000247
1018 Ga0209233_1009599
1019 Ga0209233_1019681
1020 Ga0209455_1000170
1021 Ga0209455_1021969
1022 Ga0209673_1006659
1023 Ga0209130_1000005
1024 Ga0209130_1000028
1025 Ga0209676_1003201
1026 Ga0209025_1000105
1027 Ga0209025_1040299
1028 Ga0209564_1000113
1029 Ga0209564_1009543
1030 Ga0209758_1015666
1031 Ga0209050_1000773
1032 Ga0209256_1004283
1033 Ga0209256_1019044
1034 Ga0207426_1000012
1035 Ga0207426_1000015
1036 Ga0207426_1003762
1037 Ga0207426_1022640
1038 Ga0209051_1003420
1039 Ga0209257_1002062
1040 Ga0207713_1052608
1041 Ga0207647_10009305
1042 Ga0207647_10039889
1043 Ga0207705_10010808
1044 Ga0207705_10112997
1045 Ga0207705_10426788
1046 Ga0207654_10390094
1047 Ga0207695_10235536
1048 Ga0207695_10309487
1049 Ga0207695_10364520
1050 Ga0207695_10461299
1051 Ga0207671_10119104
1052 Ga0207671_10618974
1053 Ga0207657_10056625
1054 Ga0207649_10106102
1055 Ga0207694_10008166
1056 Ga0207659_10173312
1057 Ga0207711_10095829
1058 Ga0207711_10182891
1059 Ga0207667_10012351
1060 Ga0207668_10039475
1061 Ga0207640_10039683
1062 Ga0207639_10149943
1063 Ga0207678_10036692
1064 Ga0207702_10071810
1065 Ga0207674_10033322
1066 Ga0207674_10684775
1067 Ga0209281_1000134
1068 Ga0209281_1000445
1069 Ga0209371_1004523
1070 Ga0209282_1000029
1071 Ga0268266_10002316
1072 Ga0268266_10005331
1073 Ga0268266_10012715
1074 Ga0268266_10018558
1075 Ga0268266_10022478
1076 Ga0268266_10279701
1077 Ga0268266_10684560
1078 Ga0265338_10234800
1079 Ga0268256_1003507
1080 Ga0265339_10030630
1081 Ga0265316_10052088
1082 Ga0307513_10104308
1083 Ga0307408_100296053
1084 Ga0307405_10379387
1085 Ga0307413_10193624
1086 Ga0307406_10520473
1087 Ga0307407_10305387
1088 Ga0307412_10308405
1089 Ga0315914_1000004
1090 Ga0307416_100824385
1091 Ga0307416_101006405
1092 Ga0307414_10591751
1093 Ga0315913_1000370
1094 Ga0315915_1000003
1095 Ga0373926_0084441
1096 Ga0373927_0000144
1097 Ga0373947_0100887
1098 Ga0316582_0067401
1099 Ga0316582_0296719
1100 Ga0373925_0000481
1101 Ga0395900_0246407
1102 Ga0395900_0253816
1103 Ga0395905_0069723
1104 Ga0395905_0103827
1105 Ga0395905_0401077
1106 Ga0395905_0642189
1107 Ga0395901_0062742
1108 Ga0395901_0090720
1109 Ga0395901_0279437
1110 Ga0466972_0082084
1111 Ga0466965_0215208
1112 Ga0466958_0020303
1113 Ga0495638_0002052
1114 Ga0495650_0003032
1115 Ga0495585_0019476
1116 Ga0495606_0206785
1117 Ga0495643_0025307
1118 Ga0495645_0024585
1119 Ga0495625_0000182
1120 Ga0495625_0005589
1121 Ga0495625_0025984
1122 Ga0495625_0041200
1123 Ga0495660_0159642
1124 Ga0495672_0067521
1125 Ga0495687_063021
1126 Ga0495681_0094339
1127 Ga0495686_0005687
1128 Ga0495615_0103679
1129 Ga0496102_0373845
1130 Ga0496104_0245332
1131 Ga0496108_0099977
1132 Ga0496112_0073729
1133 Ga0496112_0243971
1134 Ga0496113_0224774
1135 Ga0496115_0090073
1136 Ga0496116_0014048
1137 Ga0496116_0145175
1138 Ga0496119_0016320
1139 Ga0496120_0002072
1140 Ga0496120_0023868
1141 Ga0496122_0082939
1142 Ga0496123_0029128
1143 Ga0496124_0166319
1144 Ga0496125_0075313
1145 Ga0496125_0208006
1146 Ga0496126_0003783
1147 Ga0496126_0155177
1148 Ga0501031_0000002
1149 Ga0501031_0010981
1150 Ga0501031_0032232
1151 Ga0501031_0175768
1152 Ga0501031_0259214
1153 Ga0501032_0000004
1154 Ga0501032_0001866
1155 Ga0501032_0051201
1156 Ga0501033_0000016
1157 Ga0501033_0000182
1158 Ga0501033_0000818
1159 Ga0501033_0009577
1160 Ga0501033_0022586
1161 Ga0501033_0042065
1162 Ga0501033_0133254
1163 Ga0501033_0282180
1164 Ga0501034_0000011
1165 Ga0501034_0001712
1166 Ga0501034_0007755
1167 Ga0501034_0158900
1168 Ga0501036_0000001
1169 Ga0501036_0006422
1170 Ga0501036_0030701
1171 Ga0501036_0185647
1172 Ga0501036_0278911
1173 Ga0501036_0467918
1174 Ga0501036_0477232
1175 Ga0501037_0000006
1176 Ga0501037_0000142
1177 Ga0501038_0000003
1178 Ga0501038_0000979
1179 Ga0501038_0071504
1180 Ga0501038_0148296
1181 Ga0501038_0252505
1182 Ga0501039_0000004
1183 Ga0501039_0070449
1184 Ga0501039_0605123
1185 Ga0501040_0004502
1186 Ga0501042_0068089
1187 Ga0501043_0000066
1188 Ga0501043_0000588
1189 Ga0501043_0009297
1190 Ga0501043_0332533
1191 Ga0501046_0015684
1192 Ga0501046_0096005
1193 Ga0501047_0011488
1194 Ga0501047_0024880
1195 Ga0501047_0030377
1196 Ga0501047_0075152
1197 Ga0501047_0167104
1198 Ga0501047_0423512
1199 Ga0501048_0005100
1200 Ga0501067_0029599
1201 Ga0501067_0074703
1202 Ga0501068_0005415
1203 Ga0501068_0014507
1204 Ga0501068_0113680
1205 Ga0501069_0000002
1206 Ga0501069_0008770
1207 Ga0501069_0048007
1208 Ga0501069_0106949
1209 Ga0501070_0000051
1210 Ga0501070_0002384
1211 Ga0501070_0004526
1212 Ga0501070_0006025
1213 Ga0501070_0016663
1214 Ga0501071_0085231
1215 Ga0501071_0106162
1216 Ga0501073_0006953
1217 Ga0501073_0010824
1218 Ga0501074_0001350
1219 Ga0501074_0227658
1220 Ga0501080_0001856
1221 Ga0501080_0007434
1222 Ga0501080_0042886
1223 Ga0501080_0236362
1224 Ga0501083_0000187
1225 Ga0501083_0033156
1226 Ga0501083_0110715
1227 Ga0501035_0000009
1228 Ga0501035_0002215
1229 Ga0501035_0002554
1230 Ga0501035_0002576
1231 Ga0501035_0003955
1232 Ga0501035_0007237
1233 Ga0501035_0019856
1234 Ga0501035_0045873
1235 Ga0501035_0216599
1236 Ga0501035_0369045
1237 Ga0501035_0558194
1238 Ga0501044_0000005
1239 Ga0501044_0000923
1240 Ga0501044_0007678
1241 Ga0501044_0010931
1242 Ga0501044_0017045
1243 Ga0501044_0029897
1244 Ga0501044_0157203
1245 Ga0501044_0517847
1246 Ga0501045_0015261
1247 nmdc:mga03683_7962_c1
1248 nmdc:mga03n38_49596_c1
1249 nmdc:mga03n38_7203_c1
1250 nmdc:mga00v17_115493_c1
1251 nmdc:mga00v17_12374_c1
1252 nmdc:mga0yw44_149407_c1
1253 nmdc:mga0yw44_76772_c1
1254 nmdc:mga0k408_388348_c1
1255 nmdc:mga0sz30_50634_c1
1256 nmdc:mga0sz30_57025_c1
1257 Ga0495612_0085143
1258 Ga0500559_0001518
1259 Ga0500568_0000010
1260 Ga0500604_0038969
1261 Ga0500616_0070377
1262 Ga0500616_0216385
1263 Ga0500620_001452
1264 Ga0500627_0210728
1265 Ga0500611_004053
1266 Ga0587083_0014694
1267 2503198747
1268 2509114127
1269 2509144411
1270 2509368776
1271 2509393634
1272 2510308163
1273 2510315060
1274 2511137143
1275 2511498942
1276 2512933855
1277 2512962052
1278 2512973105
1279 2513587210
1280 2513604314
1281 2513610502
1282 2513616200
1283 2513870246
1284 2513882647
1285 2513904630
1286 2513911075
1287 2513924407
1288 2514008172
1289 2514039142
1290 2514417570
1291 2515607360
1292 2516895218
1293 2517571895
1294 2524450898
1295 2524458030
1296 2535514690
1297 2551675220
1298 2551686967
1299 2551709248
1300 2551743146
1301 2585164521
1302 2585273604
1303 2585326311
1304 2585330477
1305 2585386114
1306 2585398968
1307 2585533831
1308 2585553424
1309 2585559777
1310 2585818911
1311 2585900465
1312 2585906043
1313 2587978842
1314 2588519953
1315 2597810709
1316 2599419634
1317 2599940126
1318 2600197546
1319 2616556220
1320 2617380582
1321 2643773368
1322 2643839500
1323 2643985819
1324 2644004532
1325 2644134020
1326 2644144561
1327 2644157121
1328 2644196955
1329 2644306612
1330 2644330802
1331 2644542392
1332 2644612223
1333 2644671579
1334 2671113994
1335 2688596031
1336 2692317657
1337 2694627774
1338 2694636047
1339 2694636888
1340 2723573188
1341 2738947736
1342 2739309892
1343 2756675102
1344 2776269449
1345 2776282379
1346 2778173839
1347 2792583338
1348 2792625275
1349 2792747241
1350 2802718672
1351 2802724352
1352 2802729986
1353 2802737329
1354 2802742245
1355 2802748927
1356 2819608735
1357 2819640844
1358 2838029626
1359 2838039834
1360 2841736421
1361 2842299788
1362 2842359690
1363 2842475944
1364 2842486027
1365 2842503154
1366 2842513022
1367 2844003406
1368 2844010844
1369 2844170042
1370 2847421363
1371 2847673487
1372 2847689996
1373 2855827856
1374 2855843224
1375 2856319044
1376 2856323815
1377 2856332484
1378 2856337387
1379 2856347486
1380 2856350804
1381 2856358208
1382 2856369813
1383 2857352991
1384 2857370485
1385 2858802952
1386 2869166073
1387 2869170896
1388 2869235644
1389 2869252877
1390 2869261601
1391 2869267939
1392 2869272818
1393 2869284786
1394 2869290620
1395 2871432902
1396 2871443221
1397 2871457001
1398 2871462355
1399 2871471713
1400 2871477215
1401 2871484220
1402 2871489792
1403 2871499836
1404 2874107208
1405 2874112251
1406 2874118167
1407 2874128388
1408 2874131936
1409 2874142893
1410 2874153937
1411 2874158625
1412 2874165960
1413 2874172496
1414 2876363889
1415 2876373106
1416 2876379261
1417 2876390969
1418 2876396982
1419 2876400159
1420 2876413444
1421 2876419242
1422 2876427413
1423 2878039433
1424 2878741037
1425 2878750515
1426 2878754172
1427 2878764000
1428 2878771030
1429 2878777743
1430 2878785704
1431 2878788966
1432 2881148256
1433 2881159339
1434 2881165039
1435 2881847566
1436 2881855859
1437 2881864554
1438 2882636790
1439 2882915899
1440 2885306907
1441 2885314086
1442 2885320096
1443 2885335464
1444 2885344996
1445 2885352925
1446 2888343352
1447 2888344425
1448 2888353129
1449 2889014975
1450 2889019955
1451 2903454030
1452 2903497513
1453 2903499639
1454 2903513887
1455 2903525952
1456 2903532502
1457 2903544647
1458 2904663736
1459 2906313440
1460 2906326149
1461 2906334142
1462 2906355873
1463 2906367797
1464 2906371268
1465 2906382012
1466 2906390073
1467 2906399367
1468 2906405153
1469 2906413864
1470 2906419115
1471 2906432854
1472 2913311610
1473 2915986596
1474 2915993660
1475 2915994196
1476 2916004902
1477 2916008305
1478 2916015124
1479 2916026181
1480 2916035163
1481 2916041532
1482 2916047426
1483 2916054837
1484 2916058943
1485 2916065888
1486 2916071699
1487 2916077278
1488 2919408464
1489 2921202469
1490 2921209226
1491 2921237611
1492 2921249756
1493 2921254873
1494 2921263866
1495 2921270529
1496 2921283121
1497 2921290001
1498 2921301751
1499 2922134635
1500 2922157629
1501 2922162016
1502 2922175649
1503 2922183223
1504 2922188853
1505 2923556304
1506 2924146146
1507 2924158219
1508 2924164548
1509 2924171361
1510 2924179621
1511 2924180045
1512 2924186811
1513 2924200286
1514 2924202603
1515 2924209452
1516 2924216663
1517 2924227049
1518 2924234751
1519 2924710593
1520 2924720569
1521 2924731419
1522 2924734850
1523 2924747703
1524 2924752954
1525 2924760814
1526 2924766119
1527 2924778638
1528 2924784860
1529 2936998652
1530 2937006328
1531 2937011686
1532 2937018392
1533 2937025734
1534 2937033613
1535 2937040351
1536 2937044593
1537 2937055983
1538 2937057231
1539 2937069957
1540 2937078325
1541 2937082702
1542 2937088639
1543 2937092589
1544 2937106313
1545 2937108289
1546 2937118678
1547 2937121877
1548 2937129665
1549 2937820256
1550 2937822696
1551 2937850091
1552 2937867692
1553 2937870478
1554 2937878464
1555 2937892671
1556 2937974305
1557 2937998495
1558 2957377919
1559 2957384337
1560 2957393787
1561 2957396037
1562 2957405590
1563 2957413517
1564 2957422284
1565 2957425509
1566 2957434343
1567 2957437540
1568 2957450150
1569 2957452830
1570 2957458223
1571 2957466299
1572 2957474681
1573 2957484092
1574 2957485215
1575 2957493785
1576 2957499264
1577 2957506017
1578 2958041359
1579 2958042333
1580 2958046639
1581 2958071194
1582 2958077376
1583 2958085737
1584 2958106546
1585 2958119124
1586 2958123987
1587 2958135020
1588 2958141397
1589 2958144747
1590 2958164386
1591 2958168971
1592 2958177138
1593 2958184049
1594 2960584622
1595 2960593265
1596 2960603178
1597 2960609368
1598 2960615337
1599 2960623249
1600 2960624825
1601 2960637051
1602 2960638877
1603 2960650944
1604 2960659365
1605 2960666939
1606 2960670179
1607 2960679550
1608 2960685247
1609 2960693656
1610 2960697376
1611 2961082104
1612 2961119124
1613 2961129713
1614 2961139603
1615 2961167433
1616 2961176230
1617 2961187584
1618 2963645347
1619 2964611556
1620 2964621555
1621 2964622459
1622 2964634249
1623 2964641419
1624 2964644966
1625 2964655945
1626 2964657017
1627 2964670343
1628 2964672389
1629 2964684543
1630 2964685342
1631 2964692384
1632 2964705397
1633 2964708965
1634 2964713027
1635 2964720285
1636 2965022255
1637 2965029932
1638 2965035993
1639 2965044239
1640 2965052391
1641 2965064143
1642 2965094816
1643 2965105261
1644 2965115722
1645 2965123609
1646 2967665783
1647 2967671968
1648 2967679120
1649 2967689917
1650 2967695287
1651 2967701129
1652 2967707694
1653 2967720682
1654 2967728489
1655 2967732787
1656 2967741114
1657 2967742370
1658 2967749591
1659 2967761949
1660 2967768680
1661 2967771404
1662 2967776559
1663 2967996855
1664 2968004918
1665 2968022879
1666 2968089756
1667 2968093553
1668 2968101402
1669 2968114875
1670 2968122606
1671 2968134018
1672 2968143086
1673 2968175840
1674 2970020055
1675 2970031055
1676 2970046858
1677 2970051846
1678 2970060402
1679 2970062071
1680 2970082276
1681 2970087991
1682 2970091653
1683 2970102493
1684 2970108312
1685 2970113543
1686 2970121994
1687 2970128607
1688 2970135415
1689 2970137819
1690 2970149322
1691 2970153611
1692 2970157884
1693 2970169670
1694 2970174044
1695 2970182451
1696 2970187008
1697 2970198645
1698 2970475464
1699 2970493686
1700 2970508901
1701 2970517239
1702 2970526140
1703 2970534121
1704 2970553232
1705 2970558844
1706 2970599397
1707 2970621582
1708 2970630673
1709 2977517458
1710 2977530351
1711 2977530996
1712 2977538610
1713 2977548645
1714 2977554209
1715 2977565326
1716 2977569975
1717 2977579425
1718 2977584028
1719 2977823387
1720 2977835456
1721 2977847051
1722 2977855810
1723 2977864191
1724 2977868123
1725 2977875957
1726 2977899474
1727 2977913185
1728 2977920181
1729 2977924551
1730 2977941145
1731 2977943294
1732 2977952899
1733 2977962248
1734 2977976220
1735 2977992106
1736 2979710776
1737 2979747025
1738 2979765957
1739 2979786418
1740 2979794125
1741 2979813580
1742 2987641584
1743 2987650523
1744 2987656327
1745 2987663439
1746 2987667003
1747 2987678534
1748 2996311558
1749 2996341488
1750 2996341921
1751 2996349399
1752 2996387017
1753 2996888092
1754 3000137400
1755 3004173302
1756 3004192498
1757 3004202459
1758 3004209605
1759 3004216956
1760 3004225450
1761 3004233962
1762 3004240854
1763 3004249981
1764 3004271818
1765 3004276107
1766 3004337242
1767 3005410736
1768 3005423150
1769 3005456484
1770 637077018
1771 648736679
1772 649870598
1773 8002286423
1774 8003995806
1775 8004003566
1776 8004306371
1777 8004318537
1778 8004363092
1779 8004375749
1780 8004392909
1781 8004449476
1782 8004643856
1783 8004699362
1784 8004706707
1785 8004719696
1786 8004734668
1787 8005315477
1788 8005322619
1789 8005484615
1790 8005543358
1791 8005649308
1792 8005661606
1793 8005685455
1794 8018152823
1795 8046769623
1796 8049296693
1797 8055617952
1798 8057580338

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00215

OMPdecase

Orotidine 5'-phosphate decarboxylase / HUMPS family

60

281

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
1dbt-assembly2.cif.gz_C-2 crystal structure of orotidine 5'-monophosphate decarboxylase from bacillus subtilis complexed with ump 0.9702 17 242
1jjk-assembly1.cif.gz_A selenomethionine substitution of orotidine-5'-monophosphate decarboxylase from e. coli causes a change in crystal contacts and space group 0.9604 19 241
8cso-assembly1.cif.gz_B crystal structure of orotidine 5'-phosphate decarboxylase from klebsiella pneumoniae in complex with uridine-5'-monophosphate 0.9581 18 242
3ru6-assembly2.cif.gz_C 1.8 angstrom resolution crystal structure of orotidine 5'-phosphate decarboxylase (pyrf) from campylobacter jejuni subsp. jejuni nctc 11168 0.9505 18 241
3ru6-assembly1.cif.gz_D 1.8 angstrom resolution crystal structure of orotidine 5'-phosphate decarboxylase (pyrf) from campylobacter jejuni subsp. jejuni nctc 11168 0.9457 18 240
ID Description Score Start End Superfamily
1jjkA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9476 19 241 3.20.20.70
3ru6D00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9457 18 240 3.20.20.70
3ru6D00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9331 18 240 3.20.20.70
2yyuB00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9295 18 241 3.20.20.70
1jjkA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9188 19 241 3.20.20.70
ID Description Score Start End GO Terms
AF-Q3AC06-F1-model_v4 Orotidine 5'-phosphate decarboxylase (EC 4.1.1.23) (OMP decarboxylase) (OMPDCase) (OMPdecase) 0.9825 16 243 GO:0004590
GO:0005829
GO:0006207
GO:0044205
AF-A0A7C3S5B3-F1-model_v4 Orotidine 5'-phosphate decarboxylase (EC 4.1.1.23) (OMP decarboxylase) (OMPDCase) (OMPdecase) 0.9784 15 241 GO:0004590
GO:0005829
GO:0006207
GO:0044205
AF-A0A3D1YY64-F1-model_v4 Orotidine 5'-phosphate decarboxylase (EC 4.1.1.23) (OMP decarboxylase) (OMPDCase) (OMPdecase) 0.9784 18 244 GO:0004590
GO:0005829
GO:0006207
GO:0044205
AF-A0A0F0CST2-F1-model_v4 Orotidine 5'-phosphate decarboxylase (EC 4.1.1.23) (OMP decarboxylase) (OMPDCase) (OMPdecase) 0.9772 15 242 GO:0004590
GO:0005829
GO:0006207
GO:0044205
AF-A0A2V9V226-F1-model_v4 Orotidine 5'-phosphate decarboxylase (EC 4.1.1.23) (OMP decarboxylase) (OMPDCase) (OMPdecase) 0.9767 13 241 GO:0004590
GO:0005829
GO:0006207
GO:0044205

Map