F485134

General Info

Members Datasets Scaffolds Average Seq Length
900 604 665 227

Family's Representative Sequence

Representative Sequence 3300009093|Ga0105240_10085042|Ga0105240_100850425
Length 237
Sequence MVHISKRLTKAQAAAGEPGTVYGLEDAVRLVKNNATAKFDETIEIAMNLGIDPRHADQAVRGVVQMPNGTGKTVRIAVFAKGDKAAEATAAGADVVGAEDLAEQVQAGQIDFDRCIATPDMMMLVGRLGKVLGPRGLMPNPKLGTVTPNVAEAVKSAKGGAVEFRAEKAGIVHAGIGKASFTEQALVENVKAFVNSITRAKPAGAKGTFIQKVSLSSTMGPGVKIDVGSLLSAAGSA

Samples

Sample ID Description Type Environment
1 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
2 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
3 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
4 2508501050 Microvirga lupini Lut6 Isolate Nodule
5 2508501114 Microvirga lotononidis WSM3557 Isolate Nodule
6 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
7 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
8 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
9 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
10 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
11 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
12 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
13 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
14 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
15 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
16 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
17 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
18 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
19 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
20 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
21 2522572158 Azospirillum halopraeferens DSM 3675 Isolate Unclassified
22 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
23 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
24 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
25 2524023250 Niveispirillum irakense DSM 11586 Isolate Unclassified
26 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
27 2545555834 Methylobacterium sp. WSM2598 Isolate Nodule
28 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
29 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
30 2643221651 Afipia sp. Root123D2 Isolate Unclassified
31 2643221736 Bosea sp. Root483D1 Isolate Unclassified
32 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
33 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
34 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
35 2773857925 Microvirga vignae BR3299 Isolate Unclassified
36 2775506901 Microvirga ossetica V5/3m Isolate Unclassified
37 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
38 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
39 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
40 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
41 2818991467 Bosea vestrisii 3192 Isolate Unclassified
42 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
43 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
44 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
45 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
46 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
47 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
48 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
49 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
50 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
51 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
52 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
53 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
54 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
55 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
56 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
57 2824732956 Bradyrhizobium sp. HAMBI 2153 Isolate Unclassified
58 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
59 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
60 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
61 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
62 2835312727 Microvirga calopogonii CCBAU 65841 Isolate Nodule
63 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
64 2841760612 Bosea sp. Tri-49 Isolate Nodule
65 2841911363 Bosea caraganae RCAM04685 Isolate Nodule
66 2841917233 Bosea caraganae RCAM04680 Isolate Nodule
67 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
68 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
69 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
70 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
71 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
72 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
73 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
74 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
75 2844104063 Bosea sp. Tri-39 Isolate Nodule
76 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
77 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
78 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
79 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
80 2851246043 Bosea sp. Tri-54 Isolate Nodule
81 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
82 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
83 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
84 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
85 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
86 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
87 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
88 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
89 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
90 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
91 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
92 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
93 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
94 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
95 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
96 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
97 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
98 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
99 2882456835 Microvirga sp. KLBC 81 Isolate Unclassified
100 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
101 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
102 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
103 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
104 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
105 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
106 2891088606 Methylosinus sp. 3S-1 Isolate Rhizosphere
107 2894232714 Microvirga tunisiensis Lmie10 Isolate Nodule
108 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
109 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
110 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
111 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
112 2904699407
113 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
114 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
115 2906610324
116 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
117 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
118 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
119 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
120 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
121 2909042592 Labrys sp. LIt4 Isolate Nodule
122 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
123 2922368715
124 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
125 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
126 2922425934
127 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
128 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
129 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
130 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
131 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
132 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
133 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
134 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
135 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
136 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
137 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
138 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
139 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
140 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
141 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
142 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
143 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
144 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
145 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
146 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
147 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
148 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
149 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
150 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
151 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
152 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
153 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
154 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
155 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
156 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
157 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
158 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
159 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
160 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
161 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
162 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
163 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
164 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
165 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
166 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
167 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
168 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
169 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
170 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
171 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
172 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
173 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
174 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
175 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
176 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
177 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
178 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
179 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
180 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
181 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
182 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
183 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
184 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
185 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
186 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
187 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
188 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
189 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
190 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
191 3003665799 Methylobacterium aquaticum BG2 Isolate Unclassified
192 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
193 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
194 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
195 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified
196 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
197 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
198 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
199 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
200 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
201 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
202 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
203 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
204 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
205 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
206 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
207 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
208 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
209 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
210 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
211 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
212 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
213 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
214 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
215 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
216 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
217 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
218 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
219 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
220 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
221 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
222 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
223 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
224 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
225 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
226 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
227 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
228 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
229 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
230 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
231 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
232 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
233 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
234 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
235 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
236 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
237 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
238 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
239 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
240 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
241 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
242 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
243 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
244 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
245 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
246 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
247 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
248 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
249 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
250 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
251 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
252 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
253 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
254 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
255 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
256 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
257 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
258 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
259 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
260 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
261 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
262 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
263 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
264 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
265 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
266 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
267 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
268 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
269 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
270 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
271 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
272 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
273 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
274 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
275 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
276 3300013250 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 Metagenome Rhizosphere
277 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
278 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
279 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
280 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
281 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
282 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
283 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
284 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
285 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
286 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
287 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
288 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
289 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
290 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
291 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
292 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
293 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
294 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
295 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
296 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
297 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
298 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
299 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
300 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
301 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
302 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
303 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
304 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
305 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
306 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
307 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
308 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
309 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
310 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
311 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
312 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
313 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
314 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
315 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
316 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
317 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
318 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
319 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
320 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
321 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
322 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
323 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
324 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
325 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
326 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
327 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
328 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
329 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
330 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
331 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
332 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
333 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
334 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
335 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
336 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
337 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
338 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
339 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
340 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
341 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
342 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
343 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
344 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
345 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
346 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
347 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
348 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
349 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
350 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
351 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
352 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
353 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
354 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
355 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
356 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
357 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
358 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
359 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
360 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
361 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
362 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
363 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
364 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
365 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
366 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
367 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
368 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
369 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
370 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
371 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
372 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
373 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
374 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
375 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
376 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
377 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
378 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
379 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
380 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
381 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
382 3300036242 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRI5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
383 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
384 3300036534 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRU5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
385 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
386 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
387 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
388 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
389 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
390 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
391 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
392 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
393 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
394 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
395 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
396 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
397 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
398 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
399 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
400 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
401 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
402 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
403 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
404 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
405 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
406 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
407 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
408 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
409 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
410 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
411 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
412 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
413 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
414 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
415 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
416 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
417 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
418 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
419 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
420 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
421 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
422 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
423 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
424 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
425 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
426 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
427 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
428 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
429 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
430 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
431 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
432 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
433 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
434 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
435 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
436 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
437 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
438 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
439 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
440 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
441 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
442 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
443 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
444 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
445 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
446 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
447 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
448 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
449 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
450 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
451 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
452 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
453 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
454 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
455 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
456 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
457 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
458 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
459 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
460 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
461 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
462 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
463 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
464 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
465 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
466 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
467 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
468 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
469 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
470 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
471 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
472 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
473 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
474 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
475 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
476 3300049529 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
477 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
478 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
479 3300049541 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
480 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
481 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
482 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
483 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
484 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
485 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
486 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
487 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
488 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
489 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
490 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
491 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
492 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
493 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
494 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
495 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
496 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
497 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
498 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
499 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
500 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
501 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
502 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
503 3300049680 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought Metagenome Rhizosphere
504 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
505 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
506 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
507 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
508 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
509 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
510 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
511 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
512 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
513 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
514 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
515 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
516 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
517 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
518 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
519 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
520 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
521 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
522 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
523 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
524 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
525 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
526 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
527 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
528 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
529 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
530 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
531 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
532 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
533 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
534 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
535 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
536 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
537 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
538 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
539 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
540 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
541 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
542 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
543 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
544 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
545 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
546 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
547 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
548 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
549 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
550 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
551 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
552 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
553 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
554 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
555 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
556 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
557 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
558 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
559 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
560 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
561 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
562 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
563 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
564 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
565 3300059639 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
566 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
567 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
568 641522639 Methylobacterium sp. 4-46 Isolate Nodule
569 643348564 Methylobacterium nodulans ORS 2060 Isolate Nodule
570 8006926726 Bradyrhizobium guangdongense SM32 Isolate Unclassified
571 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
572 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
573 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
574 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
575 8016530956 Bradyrhizobium sp. LM6.11 Isolate Nodule
576 8016548790 Bradyrhizobium sp. LM3.6 Isolate Nodule
577 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
578 8016566248 Bradyrhizobium sp. LM3.2 Isolate Nodule
579 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
580 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
581 8016603502 Bradyrhizobium sp. LB7.2 Isolate Nodule
582 8016613128 Bradyrhizobium sp. LB7.1 Isolate Nodule
583 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
584 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
585 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
586 8019530166 Bradyrhizobium sp. LM4.3 Isolate Nodule
587 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
588 8019547302 Bradyrhizobium sp. LB1.3 Isolate Nodule
589 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
590 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
591 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
592 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
593 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
594 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
595 8019619141 Bradyrhizobium sp. GM7.3 Isolate Nodule
596 8019629233 Bradyrhizobium sp. GM6.1 Isolate Nodule
597 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
598 8019659431 Bradyrhizobium sp. GM22.5 Isolate Nodule
599 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
600 8019678201 Bradyrhizobium sp. GM0.4 Isolate Nodule
601 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
602 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
603 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule
604 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 72.88
Metatranscriptomes 1.34
Isolates 25.78

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.22
Nodule 19.67
Rhizoplane 2.67
Rhizosphere 57.89
Stem 0
Stem Tuber 0
Unclassified 11.56

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10006544 3300001979 Bacteria 4810
2 JGI24737J22298_10118900 3300001990 Bacteria 781
3 JGI24750J21931_1007518 3300002070 Bacteria 1372
4 JGI25159J45721_1002156 3300002987 Bacteria 7670
5 JGI25406J46586_10015420 3300003203 Bacteria 3223
6 JGI25406J46586_10021918 3300003203 Bacteria 2556
7 JGI25160J50197_1020177 3300003354 Bacteria 2020
8 Ga0055539_1002956 3300003752 Bacteria 2458
9 Ga0055524_1051299 3300003775 Bacteria 933
10 Ga0055531_10011502 3300003794 Bacteria 4258
11 Ga0065165_1003133 3300005262 Bacteria 12214
12 Ga0065165_1042814 3300005262 Bacteria 1333
13 Ga0070683_100126479 3300005329 Bacteria 2416
14 Ga0070683_100390406 3300005329 Bacteria 1327
15 Ga0070680_100062342 3300005336 Bacteria 3054
16 Ga0070680_100272848 3300005336 Bacteria 1432
17 Ga0070682_100179802 3300005337 Bacteria 1476
18 Ga0070660_100406991 3300005339 Bacteria 1125
19 Ga0070671_100118236 3300005355 Bacteria 2229
20 Ga0070659_100058667 3300005366 Bacteria 3038
21 Ga0070667_100609141 3300005367 Bacteria 1006
22 Ga0070709_10212069 3300005434 Bacteria 1377
23 Ga0070714_100019282 3300005435 Bacteria 5551
24 Ga0070714_100288594 3300005435 Bacteria 1526
25 Ga0070714_100389456 3300005435 Bacteria 1315
26 Ga0070714_100998064 3300005435 Bacteria 815
27 Ga0070713_100022916 3300005436 Bacteria 4834
28 Ga0070713_100179069 3300005436 Bacteria 1904
29 Ga0070713_100208085 3300005436 Bacteria 1770
30 Ga0070710_10009691 3300005437 Bacteria 4719
31 Ga0070710_10181230 3300005437 Bacteria 1319
32 Ga0070710_10359796 3300005437 Bacteria 965
33 Ga0070711_100010708 3300005439 Bacteria 5684
34 Ga0070711_100239905 3300005439 Bacteria 1417
35 Ga0070700_100064069 3300005441 Bacteria 2327
36 Ga0070663_100317161 3300005455 Bacteria 1252
37 Ga0070663_100505232 3300005455 Bacteria 1004
38 Ga0070678_100049698 3300005456 Bacteria 3028
39 Ga0070678_100675296 3300005456 Bacteria 929
40 Ga0070662_100292697 3300005457 Bacteria 1320
41 Ga0070681_10106321 3300005458 Bacteria 2747
42 Ga0070681_10248241 3300005458 Bacteria 1692
43 Ga0070698_100070102 3300005471 Bacteria 3518
44 Ga0070679_100118983 3300005530 Bacteria 2626
45 Ga0070679_100152926 3300005530 Bacteria 2283
46 Ga0070684_100034836 3300005535 Bacteria 4306
47 Ga0070684_100441902 3300005535 Bacteria 1202
48 Ga0070684_100520861 3300005535 Bacteria 1102
49 Ga0070684_100973905 3300005535 Bacteria 796
50 Ga0068853_100241007 3300005539 Bacteria 1657
51 Ga0068853_100793681 3300005539 Bacteria 906
52 Ga0070695_100834418 3300005545 Bacteria 741
53 Ga0070665_100103110 3300005548 Bacteria 2856
54 Ga0070665_100111664 3300005548 Bacteria 2736
55 Ga0068855_100190828 3300005563 Bacteria 2311
56 Ga0068857_100320409 3300005577 Bacteria 1432
57 Ga0068857_100639596 3300005577 Bacteria 1007
58 Ga0068854_100409771 3300005578 Bacteria 1123
59 Ga0068856_100021546 3300005614 Bacteria 6264
60 Ga0068856_100142406 3300005614 Bacteria 2405
61 Ga0068856_100252340 3300005614 Bacteria 1779
62 Ga0068852_100015467 3300005616 Bacteria 5921
63 Ga0068852_100421037 3300005616 Bacteria 1317
64 Ga0068852_100817705 3300005616 Bacteria 946
65 Ga0068859_100342391 3300005617 Bacteria 1589
66 Ga0068851_10027996 3300005834 Bacteria 2781
67 Ga0068863_100371526 3300005841 Bacteria 1395
68 Ga0068858_100835176 3300005842 Bacteria 899
69 Ga0081455_10198820 3300005937 Bacteria 1503
70 Ga0081540_1007542 3300005983 Bacteria 7742
71 Ga0081540_1061654 3300005983 Bacteria 1787
72 Ga0081539_10000203 3300005985 Bacteria 138096
73 Ga0081539_10169214 3300005985 Bacteria 1035
74 Ga0070717_10012865 3300006028 Bacteria 6390
75 Ga0070717_10185149 3300006028 Bacteria 1817
76 Ga0070717_10627211 3300006028 Bacteria 975
77 Ga0075365_10516565 3300006038 Bacteria 844
78 Ga0075368_10159166 3300006042 Bacteria 945
79 Ga0075364_10123850 3300006051 Bacteria 1732
80 Ga0070715_10211023 3300006163 Bacteria 992
81 Ga0070716_100311633 3300006173 Bacteria 1099
82 Ga0070716_100766704 3300006173 Bacteria 744
83 Ga0070712_100115865 3300006175 Bacteria 2009
84 Ga0070712_100369396 3300006175 Bacteria 1178
85 Ga0075362_10167455 3300006177 Bacteria 1060
86 Ga0075367_10205354 3300006178 Bacteria 1231
87 Ga0075367_10270532 3300006178 Bacteria 1067
88 Ga0075369_10004408 3300006186 Bacteria 5199
89 Ga0075366_10016242 3300006195 Bacteria 4276
90 Ga0068871_100182392 3300006358 Bacteria 1804
91 Ga0075428_100013627 3300006844 Bacteria 9053
92 Ga0075431_100000592 3300006847 Bacteria 30592
93 Ga0075434_100025679 3300006871 Bacteria 5765
94 Ga0075429_100010041 3300006880 Bacteria 8205
95 Ga0075429_100233566 3300006880 Bacteria 1611
96 Ga0068865_100335350 3300006881 Bacteria 1221
97 Ga0097620_100342402 3300006931 Bacteria 1589
98 Ga0075435_100145714 3300007076 Bacteria 1989
99 Ga0105250_10170109 3300009092 Bacteria 912
100 Ga0105240_10085042 3300009093 Bacteria 3877
101 Ga0105240_10099593 3300009093 Bacteria 3538
102 Ga0105240_10159640 3300009093 Bacteria 2679
103 Ga0105240_10228535 3300009093 Bacteria 2164
104 Ga0105240_10331329 3300009093 Bacteria 1732
105 Ga0105240_10971757 3300009093 Bacteria 910
106 Ga0111539_10015685 3300009094 Bacteria 9418
107 Ga0105245_10040292 3300009098 Bacteria 4160
108 Ga0105245_10351257 3300009098 Bacteria 1461
109 Ga0105247_10006535 3300009101 Bacteria 7216
110 Ga0105247_10197537 3300009101 Bacteria 1350
111 Ga0114129_10005303 3300009147 Bacteria 18192
112 Ga0114129_10139148 3300009147 Bacteria 3329
113 Ga0105241_10019195 3300009174 Bacteria 5041
114 Ga0105241_10051229 3300009174 Bacteria 3148
115 Ga0105242_10213039 3300009176 Bacteria 1723
116 Ga0105248_10875106 3300009177 Bacteria 1014
117 Ga0105248_10935588 3300009177 Bacteria 979
118 Ga0105237_10066390 3300009545 Bacteria 3603
119 Ga0105238_10002712 3300009551 Bacteria 17625
120 Ga0105238_10067377 3300009551 Bacteria 3581
121 Ga0105238_10434856 3300009551 Bacteria 1308
122 Ga0105238_10446065 3300009551 Bacteria 1291
123 Ga0105239_10061953 3300010375 Bacteria 4106
124 Ga0105239_10083384 3300010375 Bacteria 3520
125 Ga0105239_10318764 3300010375 Bacteria 1753
126 Ga0105239_10689815 3300010375 Bacteria 1167
127 Ga0157369_10598080 3300013105 Bacteria 1139
128 Ga0171462_1060 3300013250 Bacteria 19065
129 Ga0157374_10377197 3300013296 Bacteria 1412
130 Ga0157378_10676116 3300013297 Bacteria 1050
131 Ga0163162_10795937 3300013306 Bacteria 1063
132 Ga0163163_10076994 3300014325 Bacteria 3331
133 Ga0163163_10388037 3300014325 Bacteria 1454
134 Ga0157380_10055924 3300014326 Bacteria 3136
135 Ga0182008_10088388 3300014497 Bacteria 1526
136 Ga0163161_10469409 3300017792 Bacteria 1020
137 Ga0206353_10925790 3300020082 Bacteria 1109
138 Ga0214544_1000006 3300021320 Bacteria 380728
139 Ga0214542_1000002 3300021321 Bacteria 720798
140 Ga0214542_1040182 3300021321 Bacteria 1212
141 Ga0214545_1000002 3300021324 Bacteria 727485
142 Ga0214543_1000017 3300021327 Bacteria 290109
143 Ga0214543_1029778 3300021327 Bacteria 2388
144 Ga0213872_10039595 3300021361 Bacteria 2151
145 Ga0213874_10027443 3300021377 Bacteria 1619
146 Ga0213874_10085869 3300021377 Bacteria 1026
147 Ga0213876_10034449 3300021384 Bacteria 2670
148 Ga0213875_10002415 3300021388 Bacteria 11225
149 Ga0213875_10007252 3300021388 Bacteria 5748
150 Ga0213875_10019916 3300021388 Bacteria 3223
151 Ga0213875_10260502 3300021388 Bacteria 818
152 Ga0213871_10011494 3300021441 Bacteria 2035
153 Ga0224712_10048753 3300022467 Bacteria 1636
154 Ga0224712_10072693 3300022467 Bacteria 1401
155 Ga0224712_10135072 3300022467 Bacteria 1080
156 Ga0207425_1025008 3300025245 Bacteria 1235
157 Ga0209677_100683 3300025253 Bacteria 17403
158 Ga0209148_1000448 3300025254 Bacteria 45242
159 Ga0209233_1004485 3300025261 Bacteria 4737
160 Ga0209233_1027410 3300025261 Bacteria 1380
161 Ga0209673_1023321 3300025273 Bacteria 2110
162 Ga0209130_1000845 3300025284 Bacteria 25573
163 Ga0209758_1000065 3300025297 Bacteria 306288
164 Ga0209256_1008959 3300025299 Bacteria 4497
165 Ga0207426_1013929 3300025302 Bacteria 2963
166 Ga0209051_1014715 3300025303 Bacteria 3635
167 Ga0209257_1000869 3300025304 Bacteria 42897
168 Ga0207692_10000967 3300025898 Bacteria 10455
169 Ga0207692_10042273 3300025898 Bacteria 2261
170 Ga0207710_10049330 3300025900 Bacteria 1886
171 Ga0207688_10006338 3300025901 Bacteria 6438
172 Ga0207688_10217127 3300025901 Bacteria 1151
173 Ga0207685_10001288 3300025905 Bacteria 5140
174 Ga0207699_10035466 3300025906 Bacteria 2838
175 Ga0207699_10055499 3300025906 Bacteria 2357
176 Ga0207705_10134492 3300025909 Bacteria 1842
177 Ga0207705_10156695 3300025909 Bacteria 1709
178 Ga0207684_10198787 3300025910 Bacteria 1729
179 Ga0207654_10000241 3300025911 Bacteria 33087
180 Ga0207695_10000159 3300025913 Bacteria 201367
181 Ga0207695_10001032 3300025913 Bacteria 48974
182 Ga0207695_10061566 3300025913 Bacteria 3878
183 Ga0207695_10477455 3300025913 Bacteria 1129
184 Ga0207671_10033318 3300025914 Bacteria 3833
185 Ga0207693_10001370 3300025915 Bacteria 21582
186 Ga0207693_10196555 3300025915 Bacteria 1586
187 Ga0207693_10287595 3300025915 Bacteria 1288
188 Ga0207663_10000401 3300025916 Bacteria 18748
189 Ga0207663_10124238 3300025916 Bacteria 1772
190 Ga0207663_10455768 3300025916 Bacteria 987
191 Ga0207663_10776895 3300025916 Bacteria 762
192 Ga0207660_10493856 3300025917 Bacteria 993
193 Ga0207652_10088570 3300025921 Bacteria 2716
194 Ga0207652_10090827 3300025921 Bacteria 2684
195 Ga0207694_10000271 3300025924 Bacteria 49284
196 Ga0207694_10004491 3300025924 Bacteria 10887
197 Ga0207700_10136289 3300025928 Bacteria 2011
198 Ga0207664_10006050 3300025929 Bacteria 8287
199 Ga0207664_10114737 3300025929 Bacteria 2245
200 Ga0207664_10483276 3300025929 Bacteria 1108
201 Ga0207664_10643022 3300025929 Bacteria 953
202 Ga0207669_10440745 3300025937 Bacteria 1030
203 Ga0207665_10244713 3300025939 Bacteria 1323
204 Ga0207665_10525581 3300025939 Bacteria 917
205 Ga0207711_10493382 3300025941 Bacteria 1141
206 Ga0207711_10563542 3300025941 Bacteria 1063
207 Ga0207711_10610209 3300025941 Bacteria 1018
208 Ga0207661_10302349 3300025944 Bacteria 1434
209 Ga0207667_10005212 3300025949 Bacteria 15860
210 Ga0207667_10663621 3300025949 Bacteria 1047
211 Ga0207651_10363665 3300025960 Bacteria 1222
212 Ga0207712_10336703 3300025961 Bacteria 1250
213 Ga0207668_10245757 3300025972 Bacteria 1450
214 Ga0207640_10558438 3300025981 Bacteria 963
215 Ga0207658_10541401 3300025986 Bacteria 1041
216 Ga0207677_10379819 3300026023 Bacteria 1192
217 Ga0207639_10073925 3300026041 Bacteria 2674
218 Ga0207678_10201143 3300026067 Bacteria 1703
219 Ga0207678_10272069 3300026067 Bacteria 1453
220 Ga0207708_10201318 3300026075 Bacteria 1589
221 Ga0207702_10000005 3300026078 Bacteria 420296
222 Ga0207641_10230932 3300026088 Bacteria 1719
223 Ga0207648_10359249 3300026089 Bacteria 1314
224 Ga0207675_100755057 3300026118 Bacteria 984
225 Ga0207683_10055995 3300026121 Bacteria 3458
226 Ga0207683_10169868 3300026121 Bacteria 1974
227 Ga0207698_10037943 3300026142 Bacteria 3554
228 Ga0207698_10732212 3300026142 Bacteria 986
229 Ga0209589_1000300 3300027357 Bacteria 63625
230 Ga0209489_100906 3300027361 Bacteria 59164
231 Ga0209489_110266 3300027361 Bacteria 10728
232 Ga0209700_100031 3300027363 Bacteria 207349
233 Ga0207428_10018951 3300027907 Bacteria 5869
234 Ga0268266_10021990 3300028379 Bacteria 5436
235 Ga0268266_10452658 3300028379 Bacteria 1220
236 Ga0265338_10076368 3300028800 Bacteria 2838
237 Ga0265324_10139396 3300029957 Bacteria 824
238 Ga0265332_10214210 3300031238 Bacteria 799
239 Ga0265328_10052526 3300031239 Bacteria 1496
240 Ga0265325_10034182 3300031241 Bacteria 2707
241 Ga0265325_10198984 3300031241 Bacteria 925
242 Ga0265340_10013890 3300031247 Bacteria 4219
243 Ga0265340_10017672 3300031247 Bacteria 3689
244 Ga0265340_10038726 3300031247 Bacteria 2356
245 Ga0265340_10081614 3300031247 Bacteria 1522
246 Ga0265340_10085171 3300031247 Bacteria 1483
247 Ga0265340_10091474 3300031247 Bacteria 1421
248 Ga0265339_10002960 3300031249 Bacteria 11993
249 Ga0265339_10041867 3300031249 Bacteria 2539
250 Ga0265339_10057698 3300031249 Bacteria 2098
251 Ga0265339_10061098 3300031249 Bacteria 2029
252 Ga0265316_10016971 3300031344 Bacteria 6303
253 Ga0265316_10031977 3300031344 Bacteria 4299
254 Ga0265316_10045654 3300031344 Bacteria 3477
255 Ga0265316_10117099 3300031344 Bacteria 2014
256 Ga0307408_100096057 3300031548 Bacteria 2247
257 Ga0265313_10000031 3300031595 Bacteria 128981
258 Ga0265313_10010610 3300031595 Bacteria 5803
259 Ga0265313_10022279 3300031595 Bacteria 3441
260 Ga0265313_10033193 3300031595 Bacteria 2627
261 Ga0265314_10026660 3300031711 Bacteria 4338
262 Ga0265342_10001389 3300031712 Bacteria 22637
263 Ga0265342_10003512 3300031712 Bacteria 12823
264 Ga0265342_10012909 3300031712 Bacteria 5633
265 Ga0307405_10282490 3300031731 Bacteria 1250
266 Ga0307406_10433396 3300031901 Bacteria 1050
267 Ga0307409_100632209 3300031995 Bacteria 1062
268 Ga0307416_100142164 3300032002 Bacteria 2183
269 Ga0307414_10099306 3300032004 Bacteria 2187
270 Ga0307415_100478750 3300032126 Bacteria 1083
271 Ga0373926_0046832 3300035083 Bacteria 1552
272 Ga0373934_0048159 3300035086 Bacteria 1687
273 Ga0373934_0066027 3300035086 Bacteria 1445
274 Ga0373934_0151654 3300035086 Bacteria 949
275 Ga0373944_0060595 3300035089 Bacteria 1213
276 Ga0373923_0021854 3300035111 Bacteria 2502
277 Ga0373923_0058010 3300035111 Bacteria 1638
278 Ga0373923_0066469 3300035111 Bacteria 1541
279 Ga0373945_0005479 3300035116 Bacteria 4063
280 Ga0373945_0196654 3300035116 Bacteria 836
281 Ga0373953_0006359 3300035117 Bacteria 3888
282 Ga0373953_0044823 3300035117 Bacteria 1770
283 Ga0373954_0006466 3300035118 Bacteria 5110
284 Ga0373954_0029002 3300035118 Bacteria 2547
285 Ga0373956_0027033 3300035119 Bacteria 2488
286 Ga0373956_0028773 3300035119 Bacteria 2419
287 Ga0373943_0060393 3300035170 Bacteria 1892
288 Ga0373946_0026250 3300035171 Bacteria 2296
289 Ga0373946_0045597 3300035171 Bacteria 1814
290 Ga0373946_0103214 3300035171 Bacteria 1281
291 Ga0373955_0012485 3300035172 Bacteria 4081
292 Ga0373955_0057248 3300035172 Bacteria 2141
293 Ga0373955_0066607 3300035172 Bacteria 2002
294 Ga0373924_0014546 3300035410 Bacteria 2976
295 Ga0373924_0019884 3300035410 Bacteria 2605
296 Ga0373924_0118827 3300035410 Bacteria 1146
297 Ga0373924_0160535 3300035410 Bacteria 985
298 Ga0373935_0140146 3300035692 Bacteria 1633
299 Ga0373935_0263836 3300035692 Bacteria 1208
300 Ga0373927_0026088 3300035695 Bacteria 3819
301 Ga0373927_0044850 3300035695 Bacteria 2861
302 Ga0373927_0122464 3300035695 Bacteria 1697
303 Ga0373927_0308230 3300035695 Bacteria 1042
304 Ga0373933_0115895 3300035724 Bacteria 1674
305 Ga0373933_0187259 3300035724 Bacteria 1321
306 Ga0373947_0064960 3300035725 Bacteria 2225
307 Ga0373947_0089911 3300035725 Bacteria 1913
308 Ga0373947_0124596 3300035725 Bacteria 1639
309 Ga0373947_0258886 3300035725 Bacteria 1152
310 Ga0310104_00647 3300036242 Bacteria 2428
311 Ga0373937_0001523 3300036401 Bacteria 19489
312 Ga0373937_0016054 3300036401 Bacteria 6642
313 Ga0373937_0061550 3300036401 Bacteria 3450
314 Ga0373937_0079421 3300036401 Bacteria 3032
315 Ga0373937_0094576 3300036401 Bacteria 2771
316 Ga0373937_0262392 3300036401 Bacteria 1629
317 Ga0373937_0293715 3300036401 Bacteria 1535
318 Ga0373937_0309676 3300036401 Bacteria 1493
319 Ga0310109_018735 3300036534 Bacteria 935
320 Ga0373925_0010512 3300037068 Bacteria 6713
321 Ga0373925_0060509 3300037068 Bacteria 2844
322 Ga0373925_0091251 3300037068 Bacteria 2329
323 Ga0395899_0273410 3300037312 Bacteria 1152
324 Ga0395900_0143765 3300037418 Bacteria 2441
325 Ga0395898_0320231 3300037466 Bacteria 1479
326 Ga0395905_0025407 3300037471 Bacteria 5586
327 Ga0395905_0077411 3300037471 Bacteria 3116
328 Ga0395905_0090669 3300037471 Bacteria 2866
329 Ga0436364_0037967 3300037853 Bacteria 6863
330 Ga0436364_0151877 3300037853 Bacteria 3990
331 Ga0436364_0222612 3300037853 Bacteria 4790
332 Ga0436364_0543555 3300037853 Bacteria 3883
333 Ga0436364_0710968 3300037853 Bacteria 4599
334 Ga0436364_0729660 3300037853 Bacteria 2883
335 Ga0436364_0785067 3300037853 Bacteria 1112
336 Ga0395901_0104618 3300038443 Bacteria 2971
337 Ga0395901_0198481 3300038443 Bacteria 2103
338 Ga0395901_0337694 3300038443 Bacteria 1557
339 Ga0436365_0019378 3300039437 Bacteria 3597
340 Ga0436365_0601503 3300039437 Bacteria 1206
341 Ga0436365_1173928 3300039437 Bacteria 1740
342 Ga0436365_1218945 3300039437 Bacteria 1041
343 Ga0436365_1478091 3300039437 Bacteria 2026
344 Ga0436365_1531521 3300039437 Bacteria 1107
345 Ga0436360_0755908 3300039438 Bacteria 793
346 Ga0436360_1136386 3300039438 Bacteria 5017
347 Ga0436361_0034599 3300039447 Bacteria 3889
348 Ga0436361_0256683 3300039447 Bacteria 5675
349 Ga0436361_0401767 3300039447 Bacteria 3344
350 Ga0436363_0691096 3300039450 Bacteria 825
351 Ga0436363_1149677 3300039450 Bacteria 2022
352 Ga0436363_1616347 3300039450 Bacteria 2205
353 Ga0436362_0294583 3300039453 Bacteria 953
354 Ga0436362_0501267 3300039453 Bacteria 748
355 Ga0451793_0379144 3300041452 Bacteria 1152
356 Ga0451835_1046652 3300041492 Bacteria 838
357 Ga0466969_0012702 3300044656 Bacteria 4437
358 Ga0466965_0012547 3300044683 Bacteria 3987
359 Ga0466965_0150110 3300044683 Bacteria 1218
360 Ga0466966_0006998 3300044684 Bacteria 7469
361 Ga0466961_0001042 3300044693 Bacteria 17076
362 Ga0466963_0275149 3300044694 Bacteria 1183
363 Ga0453684_0017854 3300044712 Bacteria 10949
364 Ga0466960_0066674 3300044901 Bacteria 1781
365 Ga0466960_0136510 3300044901 Bacteria 1299
366 Ga0466959_0037237 3300045049 Bacteria 3594
367 Ga0451576_0027584 3300045051 Bacteria 6097
368 Ga0466967_0302098 3300045976 Bacteria 1540
369 Ga0466967_0316952 3300045976 Bacteria 1503
370 Ga0466967_0328941 3300045976 Bacteria 1475
371 Ga0466967_0579619 3300045976 Bacteria 1106
372 Ga0495592_0062965 3300046454 Bacteria 2721
373 Ga0495592_0180668 3300046454 Bacteria 1437
374 Ga0495629_0277038 3300046459 Bacteria 1152
375 Ga0495651_0006487 3300046462 Bacteria 8943
376 Ga0495651_0113460 3300046462 Bacteria 2000
377 Ga0495651_0227101 3300046462 Bacteria 1288
378 Ga0495580_0082513 3300046472 Bacteria 2240
379 Ga0495639_0015064 3300046475 Bacteria 3352
380 Ga0495639_0087237 3300046475 Bacteria 1460
381 Ga0495662_0094943 3300046476 Bacteria 1457
382 Ga0495664_0004097 3300046477 Bacteria 7956
383 Ga0495664_0049176 3300046477 Bacteria 2503
384 Ga0495664_0114614 3300046477 Bacteria 1628
385 Ga0495664_0201628 3300046477 Bacteria 1205
386 Ga0495594_0170758 3300046499 Bacteria 1237
387 Ga0495606_0058293 3300046507 Bacteria 2482
388 Ga0495608_0032272 3300046511 Bacteria 3540
389 Ga0495608_0104518 3300046511 Bacteria 1824
390 Ga0495608_0195792 3300046511 Bacteria 1275
391 Ga0495608_0246995 3300046511 Bacteria 1113
392 Ga0495618_0135034 3300046514 Bacteria 1578
393 Ga0495618_0219611 3300046514 Bacteria 1199
394 Ga0495628_0031219 3300046516 Bacteria 4309
395 Ga0495628_0150744 3300046516 Bacteria 1771
396 Ga0495628_0321290 3300046516 Bacteria 1142
397 Ga0495628_0505334 3300046516 Bacteria 872
398 Ga0495630_0054203 3300046517 Bacteria 3004
399 Ga0495630_0283867 3300046517 Bacteria 1265
400 Ga0495643_0005458 3300046522 Bacteria 8599
401 Ga0495648_0001345 3300046524 Bacteria 24267
402 Ga0495652_0116807 3300046529 Bacteria 2135
403 Ga0495652_0144241 3300046529 Bacteria 1869
404 Ga0495652_0352173 3300046529 Bacteria 1054
405 Ga0495665_0095569 3300046531 Bacteria 1560
406 Ga0495640_0107065 3300046533 Bacteria 1830
407 Ga0495587_0019372 3300046536 Bacteria 4212
408 Ga0495587_0022854 3300046536 Bacteria 3847
409 Ga0495587_0176734 3300046536 Bacteria 1211
410 Ga0495645_0016837 3300046543 Bacteria 5232
411 Ga0495645_0021952 3300046543 Bacteria 4616
412 Ga0495645_0215482 3300046543 Bacteria 1294
413 Ga0495622_0132102 3300046557 Bacteria 1136
414 Ga0495667_0008834 3300046559 Bacteria 6851
415 Ga0495667_0028353 3300046559 Bacteria 3770
416 Ga0495667_0127056 3300046559 Bacteria 1645
417 Ga0495634_0446621 3300046642 Bacteria 763
418 Ga0495635_0019579 3300046663 Bacteria 4716
419 Ga0495635_0058716 3300046663 Bacteria 2646
420 Ga0495635_0066384 3300046663 Bacteria 2474
421 Ga0495635_0093737 3300046663 Bacteria 2053
422 Ga0495661_0073375 3300046665 Bacteria 1994
423 Ga0495588_0025384 3300046674 Bacteria 2952
424 Ga0495588_0039030 3300046674 Bacteria 2418
425 Ga0495588_0383607 3300046674 Bacteria 738
426 Ga0495657_0006873 3300046675 Bacteria 8842
427 Ga0495657_0010777 3300046675 Bacteria 6867
428 Ga0495599_0286071 3300046678 Bacteria 997
429 Ga0495623_0198251 3300046679 Bacteria 1155
430 Ga0495646_0042905 3300046680 Bacteria 2774
431 Ga0495646_0087678 3300046680 Bacteria 1803
432 Ga0495613_0261537 3300046689 Bacteria 1205
433 Ga0495624_0116424 3300046690 Bacteria 1642
434 Ga0495671_0125023 3300046692 Bacteria 1254
435 Ga0495600_0245595 3300046809 Bacteria 1139
436 Ga0495604_0018557 3300047317 Bacteria 5573
437 Ga0495604_0083680 3300047317 Bacteria 2383
438 Ga0495604_0143675 3300047317 Bacteria 1702
439 Ga0495674_0010957 3300047319 Bacteria 8565
440 Ga0495674_0030102 3300047319 Bacteria 4939
441 Ga0495674_0101947 3300047319 Bacteria 2441
442 Ga0495676_0086785 3300047321 Bacteria 2353
443 Ga0495676_0100978 3300047321 Bacteria 2135
444 Ga0495680_0010280 3300047322 Bacteria 8348
445 Ga0495680_0341914 3300047322 Bacteria 1043
446 Ga0495687_054433 3300047443 Bacteria 1679
447 Ga0495675_0019494 3300047444 Bacteria 4309
448 Ga0495675_0105611 3300047444 Bacteria 1760
449 Ga0495673_0108344 3300047469 Bacteria 1114
450 Ga0495684_0061895 3300047471 Bacteria 2847
451 Ga0495593_0020272 3300047673 Bacteria 3724
452 Ga0495602_0002050 3300048088 Bacteria 20277
453 Ga0495602_0041978 3300048088 Bacteria 4171
454 Ga0495602_0432005 3300048088 Bacteria 933
455 Ga0495614_0049654 3300048089 Bacteria 1799
456 Ga0496101_0247428 3300048904 Bacteria 1388
457 Ga0496101_0252174 3300048904 Bacteria 1375
458 Ga0496102_0014053 3300048905 Bacteria 6952
459 Ga0496102_0079082 3300048905 Bacteria 3028
460 Ga0496103_0070753 3300048906 Bacteria 2182
461 Ga0496103_0516916 3300048906 Bacteria 763
462 Ga0496104_0001364 3300048907 Bacteria 21131
463 Ga0496104_0868138 3300048907 Bacteria 807
464 Ga0496105_0051861 3300048908 Bacteria 3387
465 Ga0496105_0104291 3300048908 Bacteria 2341
466 Ga0496106_0040983 3300048909 Bacteria 3469
467 Ga0496107_0162776 3300048910 Bacteria 1654
468 Ga0496108_0058629 3300048911 Bacteria 3237
469 Ga0496109_0000583 3300048912 Bacteria 30510
470 Ga0496110_0058210 3300048913 Bacteria 3403
471 Ga0496111_0019415 3300048914 Bacteria 4720
472 Ga0496112_0057666 3300048915 Bacteria 3823
473 Ga0496112_0233004 3300048915 Bacteria 1796
474 Ga0496113_0197920 3300048916 Bacteria 1596
475 Ga0496114_0203809 3300048917 Bacteria 1733
476 Ga0496115_0025413 3300048918 Bacteria 4610
477 Ga0496115_0133482 3300048918 Bacteria 2047
478 Ga0496116_0102459 3300048919 Bacteria 1707
479 Ga0496117_0117952 3300048920 Bacteria 1637
480 Ga0496118_0051579 3300048921 Bacteria 3146
481 Ga0496118_0068478 3300048921 Bacteria 2577
482 Ga0496118_0073236 3300048921 Bacteria 2455
483 Ga0496119_0032055 3300048922 Bacteria 3509
484 Ga0496121_0034197 3300048924 Bacteria 4579
485 Ga0496121_0038417 3300048924 Bacteria 4240
486 Ga0496121_0149530 3300048924 Bacteria 1720
487 Ga0496126_0062852 3300048929 Bacteria 3329
488 Ga0496126_0081188 3300048929 Bacteria 2867
489 Ga0496126_0088742 3300048929 Bacteria 2723
490 Ga0496126_0175147 3300048929 Bacteria 1825
491 Ga0495682_0137662 3300049460 Bacteria 872
492 Ga0501313_014437 3300049529 Bacteria 935
493 Ga0501317_000605 3300049533 Bacteria 2647
494 Ga0501318_003335 3300049534 Bacteria 1464
495 Ga0501325_005704 3300049541 Bacteria 999
496 Ga0501031_0033490 3300049568 Bacteria 3352
497 Ga0501031_0476243 3300049568 Bacteria 806
498 Ga0501032_0065064 3300049569 Bacteria 2440
499 Ga0501032_0132961 3300049569 Bacteria 1640
500 Ga0501032_0163202 3300049569 Bacteria 1462
501 Ga0501032_0236737 3300049569 Bacteria 1186
502 Ga0501032_0443390 3300049569 Bacteria 832
503 Ga0501032_0533912 3300049569 Bacteria 748
504 Ga0501033_0017046 3300049570 Bacteria 5491
505 Ga0501033_0167257 3300049570 Bacteria 1580
506 Ga0501034_0106577 3300049571 Bacteria 2795
507 Ga0501034_0206678 3300049571 Bacteria 1919
508 Ga0501034_0354864 3300049571 Bacteria 1394
509 Ga0501034_0364593 3300049571 Bacteria 1371
510 Ga0501034_0417156 3300049571 Bacteria 1264
511 Ga0501034_0497150 3300049571 Bacteria 1133
512 Ga0501036_0099384 3300049572 Bacteria 2461
513 Ga0501037_0006228 3300049573 Bacteria 8725
514 Ga0501037_0062660 3300049573 Bacteria 2711
515 Ga0501037_0071342 3300049573 Bacteria 2527
516 Ga0501038_0060288 3300049574 Bacteria 3247
517 Ga0501038_0457422 3300049574 Bacteria 980
518 Ga0501039_0132527 3300049575 Bacteria 1956
519 Ga0501039_0367788 3300049575 Bacteria 1129
520 Ga0501040_0544960 3300049576 Bacteria 837
521 Ga0501042_0017621 3300049578 Bacteria 4929
522 Ga0501042_0032164 3300049578 Bacteria 3714
523 Ga0501042_0153686 3300049578 Bacteria 1660
524 Ga0501043_0104989 3300049579 Bacteria 2220
525 Ga0501043_0252396 3300049579 Bacteria 1358
526 Ga0501043_0257633 3300049579 Bacteria 1342
527 Ga0501043_0374450 3300049579 Bacteria 1079
528 Ga0501043_0494517 3300049579 Bacteria 914
529 Ga0501043_0540834 3300049579 Bacteria 866
530 Ga0501043_0550718 3300049579 Bacteria 857
531 Ga0501046_0037628 3300049580 Bacteria 3888
532 Ga0501046_0087784 3300049580 Bacteria 2396
533 Ga0501046_0386931 3300049580 Bacteria 1011
534 Ga0501047_0042057 3300049581 Bacteria 4416
535 Ga0501047_0050870 3300049581 Bacteria 4001
536 Ga0501047_0228391 3300049581 Bacteria 1715
537 Ga0501047_0393822 3300049581 Bacteria 1218
538 Ga0501047_0428229 3300049581 Bacteria 1154
539 Ga0501047_0501722 3300049581 Bacteria 1040
540 Ga0501047_0723278 3300049581 Bacteria 812
541 Ga0501067_0025975 3300049583 Bacteria 3245
542 Ga0501067_0052548 3300049583 Bacteria 2257
543 Ga0501069_0398237 3300049585 Bacteria 814
544 Ga0501070_0005291 3300049586 Bacteria 11012
545 Ga0501070_0011623 3300049586 Bacteria 7432
546 Ga0501070_0270440 3300049586 Bacteria 1388
547 Ga0501070_0419909 3300049586 Bacteria 1080
548 Ga0501070_0611381 3300049586 Bacteria 868
549 Ga0501071_0055463 3300049587 Bacteria 2861
550 Ga0501073_0021046 3300049589 Bacteria 4705
551 Ga0501073_0069901 3300049589 Bacteria 2446
552 Ga0501073_0117682 3300049589 Bacteria 1841
553 Ga0501073_0123017 3300049589 Bacteria 1798
554 Ga0501073_0124403 3300049589 Bacteria 1787
555 Ga0501073_0250222 3300049589 Bacteria 1223
556 Ga0501073_0261473 3300049589 Bacteria 1194
557 Ga0501074_0002236 3300049590 Bacteria 13434
558 Ga0501075_0618678 3300049591 Bacteria 826
559 Ga0501076_0025959 3300049592 Bacteria 4535
560 Ga0501077_0062919 3300049593 Bacteria 2354
561 Ga0501238_002463 3300049671 Bacteria 2216
562 Ga0501250_019988 3300049680 Bacteria 860
563 Ga0501079_0286319 3300049741 Bacteria 1288
564 Ga0501080_0006112 3300049742 Bacteria 10794
565 Ga0501080_0040617 3300049742 Bacteria 4338
566 Ga0501080_0335811 3300049742 Bacteria 1366
567 Ga0501081_0675195 3300049743 Bacteria 775
568 Ga0501083_0026188 3300049744 Bacteria 4032
569 Ga0501083_0078012 3300049744 Bacteria 2197
570 Ga0501035_0031318 3300049822 Bacteria 4844
571 Ga0501035_0046134 3300049822 Bacteria 3919
572 Ga0501035_0163890 3300049822 Bacteria 1923
573 Ga0501035_0407934 3300049822 Bacteria 1129
574 Ga0501035_0415041 3300049822 Bacteria 1118
575 Ga0501044_0026591 3300049823 Bacteria 6125
576 Ga0501044_0042664 3300049823 Bacteria 4717
577 Ga0501044_0043456 3300049823 Bacteria 4667
578 Ga0501044_0062308 3300049823 Bacteria 3812
579 Ga0501044_0066525 3300049823 Bacteria 3674
580 Ga0501044_0121256 3300049823 Bacteria 2615
581 Ga0501044_0174818 3300049823 Bacteria 2117
582 Ga0501044_0176929 3300049823 Bacteria 2102
583 Ga0501044_0242990 3300049823 Bacteria 1743
584 Ga0501044_0300728 3300049823 Bacteria 1533
585 Ga0501044_0307150 3300049823 Bacteria 1513
586 Ga0501044_0508266 3300049823 Bacteria 1105
587 Ga0501044_0538145 3300049823 Bacteria 1066
588 Ga0501044_0549649 3300049823 Bacteria 1052
589 Ga0501044_0683934 3300049823 Bacteria 912
590 Ga0501045_0517217 3300049824 Bacteria 886
591 nmdc:mga03683_119094_c1 3300050489 Bacteria 1173
592 nmdc:mga03683_201550_c1 3300050489 Bacteria 913
593 nmdc:mga03n38_81694_c1 3300050490 Bacteria 1520
594 nmdc:mga0yw44_9723_c1 3300050492 Bacteria 4882
595 nmdc:mga06z11_5686_c1 3300050494 Bacteria 5023
596 nmdc:mga04h51_6599_c1 3300050495 Bacteria 3018
597 nmdc:mga07m45_122292_c1 3300050496 Bacteria 1504
598 nmdc:mga05p37_1686_c1 3300050507 Bacteria 25707
599 nmdc:mga05p37_57360_c1 3300050507 Bacteria 4796
600 nmdc:mga09592_49714_c1 3300050508 Bacteria 3535
601 nmdc:mga09592_9760_c1 3300050508 Bacteria 7800
602 nmdc:mga0qj67_948226_c1 3300050509 Bacteria 677
603 nmdc:mga06r32_37775_c1 3300050510 Bacteria 4569
604 nmdc:mga08y16_11167_c1 3300050511 Bacteria 9433
605 nmdc:mga08y16_275826_c1 3300050511 Bacteria 1735
606 nmdc:mga0n895_17709_c1 3300050512 Bacteria 6573
607 nmdc:mga0rr50_126499_c1 3300050513 Bacteria 2041
608 nmdc:mga0sz30_4401_c1 3300050516 Bacteria 5086
609 nmdc:mga0sz30_59009_c1 3300050516 Bacteria 1637
610 nmdc:mga0sz30_6678_c1 3300050516 Bacteria 4298
611 Ga0495601_0012741 3300053077 Bacteria 5046
612 Ga0495612_0088296 3300053078 Bacteria 1309
613 Ga0500635_0033363 3300053080 Bacteria 1679
614 Ga0495655_0059215 3300053083 Bacteria 1040
615 Ga0495595_0013111 3300053084 Bacteria 3497
616 Ga0495595_0088473 3300053084 Bacteria 1483
617 Ga0495619_0009229 3300053085 Bacteria 6233
618 Ga0495619_0054013 3300053085 Bacteria 2658
619 Ga0495619_0080463 3300053085 Bacteria 2192
620 Ga0495619_0166775 3300053085 Bacteria 1522
621 Ga0495619_0263531 3300053085 Bacteria 1194
622 Ga0500578_0338260 3300053086 Bacteria 883
623 Ga0500643_000335 3300053087 Bacteria 37421
624 Ga0500646_0024974 3300053090 Bacteria 1611
625 Ga0500647_0085818 3300053091 Bacteria 1509
626 Ga0500647_0152877 3300053091 Bacteria 1076
627 Ga0500651_0030743 3300053093 Bacteria 3380
628 Ga0500651_0094767 3300053093 Bacteria 1835
629 Ga0500566_0004695 3300053094 Bacteria 8132
630 Ga0500650_0282310 3300053098 Bacteria 738
631 Ga0500555_011238 3300053103 Bacteria 2571
632 Ga0500557_000010 3300053105 Bacteria 118251
633 Ga0500572_000157 3300053111 Bacteria 23703
634 Ga0500594_0037558 3300053118 Bacteria 1308
635 Ga0500595_008185 3300053119 Bacteria 4289
636 Ga0500607_076810 3300053121 Bacteria 1711
637 Ga0500608_011045 3300053122 Bacteria 3904
638 Ga0500614_036280 3300053123 Bacteria 1232
639 Ga0500642_0003300 3300053130 Bacteria 4861
640 Ga0500652_010380 3300053131 Bacteria 3189
641 Ga0500559_0020416 3300053136 Bacteria 2801
642 Ga0500559_0029313 3300053136 Bacteria 2355
643 Ga0500564_089383 3300053138 Bacteria 1372
644 Ga0500577_0091766 3300053142 Bacteria 1228
645 Ga0500588_0009440 3300053146 Bacteria 2319
646 Ga0500589_124742 3300053147 Bacteria 1085
647 Ga0500603_000497 3300053150 Bacteria 10047
648 Ga0500619_005307 3300053154 Bacteria 2861
649 Ga0500630_001586 3300053159 Bacteria 10878
650 Ga0500634_0125458 3300053161 Bacteria 1242
651 Ga0500638_110860 3300053162 Bacteria 1267
652 Ga0500639_000002 3300053163 Bacteria 233548
653 Ga0500637_0221176 3300053178 Bacteria 1070
654 Ga0500625_013421 3300053729 Bacteria 3767
655 Ga0500645_021926 3300053730 Bacteria 1968
656 Ga0500609_009425 3300053731 Bacteria 1316
657 Ga0500596_002194 3300053735 Bacteria 3870
658 Ga0501084_0017007 3300054114 Bacteria 6042
659 Ga0501084_0319314 3300054114 Bacteria 1312
660 Ga0501084_0337004 3300054114 Bacteria 1274
661 Ga0587062_018598 3300059639 Bacteria 962
662 Ga0587068_044644 3300059641 Bacteria 812
663 Ga0501082_0112475 3300060353 Bacteria 2357
664 Ga0501082_0159588 3300060353 Bacteria 1959
665 Ga0501082_0326837 3300060353 Bacteria 1336

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005439 Ga0070711_100239905 Ga0070711_1002399051 198
2 3300005535 Ga0070684_100520861 Ga0070684_1005208612 198
3 3300014325 Ga0163163_10076994 Ga0163163_100769941 198
4 3300025916 Ga0207663_10455768 Ga0207663_104557682 198
5 3300035116 Ga0373945_0196654 Ga0373945_0196654_34_741 198
6 3300035695 Ga0373927_0308230 Ga0373927_0308230_19_726 198
7 3300035725 Ga0373947_0124596 Ga0373947_0124596_560_1267 198
8 3300037068 Ga0373925_0060509 Ga0373925_0060509_622_1329 198
9 3300046499 Ga0495594_0170758 Ga0495594_0170758_423_1130 198
10 3300046674 Ga0495588_0039030 Ga0495588_0039030_1222_1929 198
11 3300047321 Ga0495676_0100978 Ga0495676_0100978_252_959 198
12 3300048904 Ga0496101_0252174 Ga0496101_0252174_21_728 198
13 3300048905 Ga0496102_0079082 Ga0496102_0079082_2248_2955 198
14 3300048907 Ga0496104_0001364 Ga0496104_0001364_2435_3142 198
15 3300048908 Ga0496105_0051861 Ga0496105_0051861_415_1122 198
16 3300048910 Ga0496107_0162776 Ga0496107_0162776_833_1540 198
17 3300048911 Ga0496108_0058629 Ga0496108_0058629_1990_2697 198
18 3300048912 Ga0496109_0000583 Ga0496109_0000583_28130_28837 198
19 3300048913 Ga0496110_0058210 Ga0496110_0058210_2283_2990 198
20 3300048914 Ga0496111_0019415 Ga0496111_0019415_1759_2466 198
21 3300048915 Ga0496112_0057666 Ga0496112_0057666_2284_2991 198
22 3300048916 Ga0496113_0197920 Ga0496113_0197920_185_892 198
23 3300048917 Ga0496114_0203809 Ga0496114_0203809_386_1093 198
24 3300048918 Ga0496115_0025413 Ga0496115_0025413_58_765 198
25 3300046511 Ga0495608_0195792 Ga0495608_0195792_14_625 203
26 3300046674 Ga0495588_0383607 Ga0495588_0383607_116_727 203
27 3300049576 Ga0501040_0544960 Ga0501040_0544960_201_815 203
28 3300049586 Ga0501070_0419909 Ga0501070_0419909_20_652 203
29 3300049589 Ga0501073_0069901 Ga0501073_0069901_1813_2436 203
30 3300050489 nmdc:mga03683_201550_c1 nmdc:mga03683_201550_c1_10_621 203
31 3300050509 nmdc:mga0qj67_948226_c1 nmdc:mga0qj67_948226_c1_13_630 203
32 3300049579 Ga0501043_0374450 Ga0501043_0374450_191_880 210
33 3300049822 Ga0501035_0163890 Ga0501035_0163890_1020_1709 210
34 3300049823 Ga0501044_0026591 Ga0501044_0026591_1933_2622 210
35 3300046475 Ga0495639_0087237 Ga0495639_0087237_440_1147 211
36 3300021377 Ga0213874_10085869 Ga0213874_100858692 212
37 3300039450 Ga0436363_1616347 Ga0436363_1616347_1453_2148 212
38 3300022467 Ga0224712_10135072 Ga0224712_101350722 213
39 3300002070 JGI24750J21931_1007518 JGI24750J21931_10075182 214
40 3300039453 Ga0436362_0501267 Ga0436362_0501267_94_738 214
41 3300031247 Ga0265340_10085171 Ga0265340_100851711 216
42 3300031712 Ga0265342_10003512 Ga0265342_1000351215 216
43 3300053085 Ga0495619_0054013 Ga0495619_0054013_108_800 216
44 3300049569 Ga0501032_0163202 Ga0501032_0163202_540_1232 217
45 3300049570 Ga0501033_0017046 Ga0501033_0017046_2497_3189 217
46 3300049573 Ga0501037_0006228 Ga0501037_0006228_1883_2575 217
47 3300049574 Ga0501038_0060288 Ga0501038_0060288_2493_3185 217
48 3300049575 Ga0501039_0132527 Ga0501039_0132527_74_766 217
49 3300049578 Ga0501042_0153686 Ga0501042_0153686_305_997 217
50 3300049579 Ga0501043_0104989 Ga0501043_0104989_943_1635 217
51 3300049580 Ga0501046_0386931 Ga0501046_0386931_40_732 217
52 3300049589 Ga0501073_0261473 Ga0501073_0261473_298_990 217
53 3300049593 Ga0501077_0062919 Ga0501077_0062919_945_1637 217
54 3300049742 Ga0501080_0335811 Ga0501080_0335811_472_1164 217
55 3300049743 Ga0501081_0675195 Ga0501081_0675195_44_736 217
56 3300049822 Ga0501035_0031318 Ga0501035_0031318_922_1614 217
57 3300049823 Ga0501044_0043456 Ga0501044_0043456_1903_2595 217
58 3300053118 Ga0500594_0037558 Ga0500594_0037558_492_1184 217
59 3300006880 Ga0075429_100233566 Ga0075429_1002335662 218
60 3300009147 Ga0114129_10139148 Ga0114129_101391484 218
61 3300039437 Ga0436365_0601503 Ga0436365_0601503_122_829 218
62 3300049533 Ga0501317_000605 Ga0501317_000605_203_868 218
63 3300049579 Ga0501043_0550718 Ga0501043_0550718_86_778 218
64 3300050507 nmdc:mga05p37_57360_c1 nmdc:mga05p37_57360_c1_558_1253 218
65 3300050508 nmdc:mga09592_49714_c1 nmdc:mga09592_49714_c1_2179_2874 218
66 iso_pu_bacteria 2824600985 2824602100 220
67 iso_pu_bacteria 2824609381 2824610088 220
68 iso_pu_bacteria 2824617872 2824620104 220
69 iso_pu_bacteria 2824626560 2824627685 220
70 iso_pu_bacteria 2824635225 2824636746 220
71 iso_pu_bacteria 2824644064 2824645039 220
72 iso_pu_bacteria 2824653114 2824654944 220
73 iso_pu_bacteria 2824661429 2824662341 220
74 iso_pu_bacteria 2824671348 2824672590 220
75 iso_pu_bacteria 2824679649 2824680860 220
76 iso_pu_bacteria 2824687955 2824689077 220
77 iso_pu_bacteria 2824696289 2824697444 220
78 iso_pu_bacteria 2824704595 2824706657 220
79 iso_pu_bacteria 2824714736 2824715399 220
80 iso_pu_bacteria 2824723954 2824724746 220
81 iso_pu_bacteria 2824732956 2824733574 220
82 iso_pu_bacteria 2824746037 2824746949 220
83 iso_pu_bacteria 2824753945 2824759399 220
84 iso_pu_bacteria 2824763712 2824769635 220
85 iso_pu_bacteria 2824773399 2824774053 220
86 iso_pu_bacteria 2838122688 2838130101 220
87 iso_pu_bacteria 2841941048 2841941258 220
88 iso_pu_bacteria 2841949485 2841952715 220
89 iso_pu_bacteria 2841957949 2841962226 220
90 iso_pu_bacteria 2841966195 2841967413 220
91 iso_pu_bacteria 2841974524 2841979189 220
92 iso_pu_bacteria 2841983080 2841990765 220
93 iso_pu_bacteria 2842038055 2842038605 220
94 iso_pu_bacteria 2842045827 2842048450 220
95 iso_pu_bacteria 2844315083 2844318001 220
96 iso_pu_bacteria 2847930680 2847934814 220
97 iso_pu_bacteria 2847939898 2847945378 220
98 iso_pu_bacteria 2849076700 2849080434 220
99 iso_pu_bacteria 2857509624 2857510213 220
100 iso_pu_bacteria 2874590934 2874595095 220
101 iso_pu_bacteria 2874612657 2874615671 220
102 iso_pu_bacteria 2874620515 2874621695 220
103 iso_pu_bacteria 2874628541 2874632671 220
104 iso_pu_bacteria 2874645413 2874650956 220
105 iso_pu_bacteria 2876761206 2876765709 220
106 iso_pu_bacteria 2876771140 2876775031 220
107 iso_pu_bacteria 2876818435 2876823846 220
108 iso_pu_bacteria 2879074833 2879080474 220
109 iso_pu_bacteria 2879083081 2879089261 220
110 iso_pu_bacteria 2879099564 2879109322 220
111 iso_pu_bacteria 2879127579 2879134920 220
112 iso_pu_bacteria 2879142872 2879149230 220
113 iso_pu_bacteria 2881364244 2881366208 220
114 iso_pu_bacteria 2881665667 2881671549 220
115 iso_pu_bacteria 2885366525 2885372801 220
116 iso_pu_bacteria 2885409591 2885413081 220
117 iso_pu_bacteria 2888378607 2888382799 220
118 iso_pu_bacteria 2888419890 2888423279 220
119 iso_pu_bacteria 2903727486 2903729689 220
120 iso_pu_bacteria 2904666416 2904668588 220
121 iso_pu_bacteria 2904711408 2904716691 220
122 iso_pu_bacteria 2906602504 2906605838 220
123 iso_pu_bacteria 2906643746 2906644181 220
124 iso_pu_bacteria 2908775508 2908778922 220
125 iso_pu_bacteria 2922368715 2922375241 220
126 iso_pu_bacteria 2922393267 2922395208 220
127 iso_pu_bacteria 2929615660 2929615929 220
128 iso_pu_bacteria 2929624759 2929630542 220
129 3300005437 Ga0070710_10009691 Ga0070710_100096914 224
130 3300006028 Ga0070717_10012865 Ga0070717_100128657 224
131 3300009093 Ga0105240_10331329 Ga0105240_103313292 224
132 3300009551 Ga0105238_10067377 Ga0105238_100673775 224
133 3300025898 Ga0207692_10000967 Ga0207692_1000096719 224
134 3300025905 Ga0207685_10001288 Ga0207685_100012883 224
135 3300025906 Ga0207699_10055499 Ga0207699_100554992 224
136 3300025916 Ga0207663_10000401 Ga0207663_100004018 224
137 3300025929 Ga0207664_10006050 Ga0207664_100060505 224
138 3300035086 Ga0373934_0151654 Ga0373934_0151654_30_722 224
139 3300035089 Ga0373944_0060595 Ga0373944_0060595_528_1202 224
140 3300035111 Ga0373923_0066469 Ga0373923_0066469_500_1192 224
141 3300035119 Ga0373956_0027033 Ga0373956_0027033_1685_2377 224
142 3300035172 Ga0373955_0066607 Ga0373955_0066607_618_1310 224
143 3300035410 Ga0373924_0160535 Ga0373924_0160535_177_869 224
144 3300036401 Ga0373937_0293715 Ga0373937_0293715_597_1289 224
145 3300046454 Ga0495592_0180668 Ga0495592_0180668_134_826 224
146 3300046462 Ga0495651_0113460 Ga0495651_0113460_902_1594 224
147 3300046477 Ga0495664_0201628 Ga0495664_0201628_374_1066 224
148 3300046511 Ga0495608_0246995 Ga0495608_0246995_338_1030 224
149 3300046514 Ga0495618_0135034 Ga0495618_0135034_667_1359 224
150 3300046516 Ga0495628_0150744 Ga0495628_0150744_657_1349 224
151 3300046529 Ga0495652_0352173 Ga0495652_0352173_134_826 224
152 3300046536 Ga0495587_0176734 Ga0495587_0176734_251_943 224
153 3300046543 Ga0495645_0215482 Ga0495645_0215482_61_753 224
154 3300046559 Ga0495667_0008834 Ga0495667_0008834_3134_3826 224
155 3300046663 Ga0495635_0058716 Ga0495635_0058716_254_946 224
156 3300046675 Ga0495657_0010777 Ga0495657_0010777_31_723 224
157 3300046678 Ga0495599_0286071 Ga0495599_0286071_35_727 224
158 3300046680 Ga0495646_0087678 Ga0495646_0087678_505_1197 224
159 3300046809 Ga0495600_0245595 Ga0495600_0245595_114_806 224
160 3300047317 Ga0495604_0143675 Ga0495604_0143675_650_1342 224
161 3300047319 Ga0495674_0101947 Ga0495674_0101947_1307_1999 224
162 3300047322 Ga0495680_0341914 Ga0495680_0341914_218_910 224
163 3300047444 Ga0495675_0019494 Ga0495675_0019494_2962_3654 224
164 3300048088 Ga0495602_0041978 Ga0495602_0041978_132_824 224
165 3300049581 Ga0501047_0723278 Ga0501047_0723278_64_750 224
166 3300049822 Ga0501035_0415041 Ga0501035_0415041_123_809 224
167 3300049823 Ga0501044_0538145 Ga0501044_0538145_307_993 224
168 3300053084 Ga0495595_0088473 Ga0495595_0088473_134_826 224
169 3300053085 Ga0495619_0080463 Ga0495619_0080463_1335_2027 224
170 3300053098 Ga0500650_0282310 Ga0500650_0282310_49_723 224
171 3300053146 Ga0500588_0009440 Ga0500588_0009440_571_1263 224
172 3300009093 Ga0105240_10971757 Ga0105240_109717571 225
173 3300047317 Ga0495604_0083680 Ga0495604_0083680_154_831 225
174 iso_pu_bacteria 2507262055 2507509796 226
175 iso_pu_bacteria 2508501009 2508543812 226
176 iso_pu_bacteria 2508501042 2508698400 226
177 iso_pu_bacteria 2508501128 2509149655 226
178 iso_pu_bacteria 2511231028 2511396996 226
179 iso_pu_bacteria 2513237092 2513625255 226
180 iso_pu_bacteria 2513237094 2513644571 226
181 iso_pu_bacteria 2513237095 2513646138 226
182 iso_pu_bacteria 2513237096 2513658371 226
183 iso_pu_bacteria 2513237098 2513679089 226
184 iso_pu_bacteria 2513237102 2513701018 226
185 iso_pu_bacteria 2513237137 2513857553 226
186 iso_pu_bacteria 2513237139 2513875874 226
187 iso_pu_bacteria 2513237145 2513920137 226
188 iso_pu_bacteria 2513237161 2514011460 226
189 iso_pu_bacteria 2515154112 2515629992 226
190 iso_pu_bacteria 2517093001 2517103504 226
191 iso_pu_bacteria 2517572143 2517893505 226
192 iso_pu_bacteria 2524023205 2524441013 226
193 iso_pu_bacteria 2524023210 2524469955 226
194 iso_pu_bacteria 2524023228 2524538011 226
195 iso_pu_bacteria 2524023250 2524609623 226
196 iso_pu_bacteria 2528768022 2528856308 226
197 iso_pu_bacteria 2617270735 2617349320 226
198 iso_pu_bacteria 2617270741 2617378158 226
199 iso_pu_bacteria 2643221651 2644287935 226
200 iso_pu_bacteria 2667528175 2671118141 226
201 iso_pu_bacteria 2721755755 2723846188 226
202 iso_pu_bacteria 2744054633 2745082464 226
203 iso_pu_bacteria 2791355196 2793060231 226
204 iso_pu_bacteria 2791355197 2793071740 226
205 iso_pu_bacteria 2802429603 2805917596 226
206 iso_pu_bacteria 2816332527 2818241523 226
207 iso_pu_bacteria 2876808645 2876810409 226
208 iso_pu_bacteria 2879110137 2879110512 226
209 iso_pu_bacteria 2885374607 2885380964 226
210 iso_pu_bacteria 2885383462 2885384463 226
211 iso_pu_bacteria 2903748898 2903758281 226
212 iso_pu_bacteria 2903768456 2903770882 226
213 iso_pu_bacteria 2904699407 2904701635 226
214 iso_pu_bacteria 2906610324 2906610388 226
215 iso_pu_bacteria 2906635258 2906642806 226
216 iso_pu_bacteria 2906660503 2906665941 226
217 iso_pu_bacteria 2908739725 2908743909 226
218 iso_pu_bacteria 2922361189 2922361988 226
219 iso_pu_bacteria 2922386360 2922392004 226
220 iso_pu_bacteria 2922425934 2922428973 226
221 iso_pu_bacteria 2932784394 2932792433 226
222 iso_pu_bacteria 2932794094 2932800421 226
223 iso_pu_bacteria 2932801729 2932804595 226
224 iso_pu_bacteria 2932809354 2932813932 226
225 iso_pu_bacteria 2932818245 2932819556 226
226 iso_pu_bacteria 2932828146 2932833738 226
227 iso_pu_bacteria 2933577622 2933578785 226
228 iso_pu_bacteria 2935608549 2935611345 226
229 iso_pu_bacteria 2935616580 2935618758 226
230 iso_pu_bacteria 2935630451 2935637764 226
231 iso_pu_bacteria 2935638405 2935644402 226
232 iso_pu_bacteria 2935648319 2935648729 226
233 iso_pu_bacteria 2935656913 2935657188 226
234 iso_pu_bacteria 2935665750 2935674140 226
235 iso_pu_bacteria 2935675223 2935678578 226
236 iso_pu_bacteria 2935684952 2935687925 226
237 iso_pu_bacteria 2935694250 2935701463 226
238 iso_pu_bacteria 2935703347 2935708259 226
239 iso_pu_bacteria 2935713505 2935714945 226
240 iso_pu_bacteria 2935722832 2935726490 226
241 iso_pu_bacteria 2935732158 2935733763 226
242 iso_pu_bacteria 2935741537 2935743142 226
243 iso_pu_bacteria 2935750917 2935754819 226
244 iso_pu_bacteria 2935760218 2935765527 226
245 iso_pu_bacteria 2935769743 2935775280 226
246 iso_pu_bacteria 2935777560 2935779519 226
247 iso_pu_bacteria 2935785616 2935791522 226
248 iso_pu_bacteria 2935793552 2935799834 226
249 iso_pu_bacteria 2935801545 2935805480 226
250 iso_pu_bacteria 2935810662 2935816774 226
251 iso_pu_bacteria 2935819856 2935820822 226
252 iso_pu_bacteria 2935827899 2935833849 226
253 iso_pu_bacteria 2935837841 2935839466 226
254 iso_pu_bacteria 2935847175 2935850918 226
255 iso_pu_bacteria 2935855204 2935857123 226
256 iso_pu_bacteria 2935864058 2935864667 226
257 iso_pu_bacteria 2935873716 2935876445 226
258 iso_pu_bacteria 2935883170 2935889788 226
259 iso_pu_bacteria 2935908558 2935913715 226
260 iso_pu_bacteria 2935916978 2935920295 226
261 iso_pu_bacteria 2935926038 2935930634 226
262 iso_pu_bacteria 2935934488 2935939393 226
263 iso_pu_bacteria 2935942939 2935946342 226
264 iso_pu_bacteria 2935951376 2935955819 226
265 iso_pu_bacteria 2935959822 2935966975 226
266 iso_pu_bacteria 2935967501 2935972471 226
267 iso_pu_bacteria 2935975950 2935981698 226
268 iso_pu_bacteria 2935984226 2935991073 226
269 iso_pu_bacteria 2935992306 2935997586 226
270 iso_pu_bacteria 2936002035 2936007104 226
271 iso_pu_bacteria 2936011229 2936011639 226
272 iso_pu_bacteria 2936019824 2936020234 226
273 iso_pu_bacteria 2936028420 2936028929 226
274 iso_pu_bacteria 2936037263 2936042964 226
275 iso_pu_bacteria 2936046547 2936046957 226
276 iso_pu_bacteria 2936055302 2936058163 226
277 iso_pu_bacteria 2940556831 2940559804 226
278 iso_pu_bacteria 2941507105 2941514437 226
279 iso_pu_bacteria 2941515067 2941522333 226
280 iso_pu_bacteria 2941523033 2941530148 226
281 iso_pu_bacteria 2941531003 2941536106 226
282 iso_pu_bacteria 2941538514 2941540155 226
283 iso_pu_bacteria 3005474847 3005479118 226
284 iso_pu_bacteria 3005483717 3005488128 226
285 iso_pu_bacteria 3005506211 3005512724 226
286 iso_pu_bacteria 3005587118 3005590491 226
287 iso_pu_bacteria 3005594810 3005598052 226
288 iso_pu_bacteria 3005710791 3005713731 226
289 iso_pu_bacteria 3005718088 3005721242 226
290 iso_pu_bacteria 8006926726 8006930040 226
291 iso_pu_bacteria 8006933436 8006942233 226
292 iso_pu_bacteria 8006973647 8006981967 226
293 iso_pu_bacteria 8016511872 8016514703 226
294 iso_pu_bacteria 8016522445 8016530802 226
295 iso_pu_bacteria 8016530956 8016536092 226
296 iso_pu_bacteria 8016548790 8016552861 226
297 iso_pu_bacteria 8016557553 8016561238 226
298 iso_pu_bacteria 8016566248 8016574442 226
299 iso_pu_bacteria 8016575299 8016578537 226
300 iso_pu_bacteria 8016595262 8016599097 226
301 iso_pu_bacteria 8016603502 8016611954 226
302 iso_pu_bacteria 8016613128 8016621851 226
303 iso_pu_bacteria 8016622563 8016628002 226
304 iso_pu_bacteria 8016630954 8016632325 226
305 iso_pu_bacteria 8017057580 8017061735 226
306 iso_pu_bacteria 8019530166 8019535817 226
307 iso_pu_bacteria 8019538911 8019543660 226
308 iso_pu_bacteria 8019547302 8019555115 226
309 iso_pu_bacteria 8019555841 8019557955 226
310 iso_pu_bacteria 8019565922 8019567330 226
311 iso_pu_bacteria 8019576017 8019581233 226
312 iso_pu_bacteria 8019586578 8019588860 226
313 iso_pu_bacteria 8019597564 8019602372 226
314 iso_pu_bacteria 8019608314 8019616186 226
315 iso_pu_bacteria 8019619141 8019626803 226
316 iso_pu_bacteria 8019629233 8019635706 226
317 iso_pu_bacteria 8019648815 8019656978 226
318 iso_pu_bacteria 8019659431 8019663504 226
319 iso_pu_bacteria 8019668869 8019673116 226
320 iso_pu_bacteria 8019678201 8019683022 226
321 iso_pu_bacteria 8019687851 8019688724 226
322 iso_pu_bacteria 8055742211 8055747576 226
323 iso_pu_bacteria 8056673599 8056680444 226
324 iso_pu_bacteria 8056967851 8056972347 226
325 iso_pu_bacteria 2522572158 2523104025 227
326 iso_pu_bacteria 2545555834 2545677338 227
327 iso_pu_bacteria 2643221736 2644744415 227
328 iso_pu_bacteria 2773857925 2774874185 227
329 iso_pu_bacteria 2818991467 2819720910 227
330 iso_pu_bacteria 2841760612 2841761365 227
331 iso_pu_bacteria 2841911363 2841913368 227
332 iso_pu_bacteria 2841917233 2841919115 227
333 iso_pu_bacteria 2844104063 2844104390 227
334 iso_pu_bacteria 2851246043 2851247378 227
335 iso_pu_bacteria 2882456835 2882462583 227
336 iso_pu_bacteria 2891088606 2891092096 227
337 iso_pu_bacteria 2909042592 2909043585 227
338 iso_pu_bacteria 3003665799 3003667727 227
339 iso_pu_bacteria 641522639 641640693 227
340 iso_pu_bacteria 643348564 643599631 227
341 3300009177 Ga0105248_10875106 Ga0105248_108751062 228
342 3300021361 Ga0213872_10039595 Ga0213872_100395953 228
343 3300021377 Ga0213874_10027443 Ga0213874_100274432 228
344 3300037853 Ga0436364_0151877 Ga0436364_0151877_895_1584 228
345 3300037853 Ga0436364_0710968 Ga0436364_0710968_3505_4194 228
346 3300039437 Ga0436365_0019378 Ga0436365_0019378_11_700 228
347 3300039447 Ga0436361_0401767 Ga0436361_0401767_678_1367 228
348 iso_pu_bacteria 2508501050 2508735848 228
349 iso_pu_bacteria 2508501114 2509078172 228
350 iso_pu_bacteria 2775506901 2776259121 228
351 iso_pu_bacteria 2835312727 2835319217 228
352 iso_pu_bacteria 2894232714 2894240339 228
353 3300005329 Ga0070683_100390406 Ga0070683_1003904061 229
354 3300005336 Ga0070680_100272848 Ga0070680_1002728482 229
355 3300005434 Ga0070709_10212069 Ga0070709_102120691 229
356 3300005435 Ga0070714_100019282 Ga0070714_1000192824 229
357 3300005435 Ga0070714_100389456 Ga0070714_1003894561 229
358 3300005436 Ga0070713_100022916 Ga0070713_1000229169 229
359 3300005436 Ga0070713_100179069 Ga0070713_1001790692 229
360 3300005436 Ga0070713_100208085 Ga0070713_1002080852 229
361 3300005437 Ga0070710_10181230 Ga0070710_101812302 229
362 3300005439 Ga0070711_100010708 Ga0070711_1000107085 229
363 3300005456 Ga0070678_100049698 Ga0070678_1000496983 229
364 3300005535 Ga0070684_100973905 Ga0070684_1009739051 229
365 3300005548 Ga0070665_100103110 Ga0070665_1001031105 229
366 3300005548 Ga0070665_100111664 Ga0070665_1001116642 229
367 3300005563 Ga0068855_100190828 Ga0068855_1001908283 229
368 3300005614 Ga0068856_100142406 Ga0068856_1001424061 229
369 3300006028 Ga0070717_10185149 Ga0070717_101851493 229
370 3300006173 Ga0070716_100311633 Ga0070716_1003116331 229
371 3300006173 Ga0070716_100766704 Ga0070716_1007667041 229
372 3300006175 Ga0070712_100115865 Ga0070712_1001158652 229
373 3300009098 Ga0105245_10040292 Ga0105245_100402921 229
374 3300009177 Ga0105248_10935588 Ga0105248_109355882 229
375 3300010375 Ga0105239_10083384 Ga0105239_100833842 229
376 3300013105 Ga0157369_10598080 Ga0157369_105980802 229
377 3300013306 Ga0163162_10795937 Ga0163162_107959371 229
378 3300014325 Ga0163163_10388037 Ga0163163_103880372 229
379 3300020082 Ga0206353_10925790 Ga0206353_109257901 229
380 3300021388 Ga0213875_10002415 Ga0213875_100024154 229
381 3300021388 Ga0213875_10007252 Ga0213875_100072524 229
382 3300021388 Ga0213875_10260502 Ga0213875_102605022 229
383 3300022467 Ga0224712_10072693 Ga0224712_100726932 229
384 3300025906 Ga0207699_10035466 Ga0207699_100354664 229
385 3300025916 Ga0207663_10124238 Ga0207663_101242383 229
386 3300025916 Ga0207663_10776895 Ga0207663_107768951 229
387 3300025917 Ga0207660_10493856 Ga0207660_104938561 229
388 3300025924 Ga0207694_10004491 Ga0207694_100044914 229
389 3300025929 Ga0207664_10643022 Ga0207664_106430221 229
390 3300025937 Ga0207669_10440745 Ga0207669_104407451 229
391 3300025939 Ga0207665_10244713 Ga0207665_102447132 229
392 3300025941 Ga0207711_10563542 Ga0207711_105635422 229
393 3300025941 Ga0207711_10610209 Ga0207711_106102092 229
394 3300025949 Ga0207667_10663621 Ga0207667_106636212 229
395 3300025986 Ga0207658_10541401 Ga0207658_105414011 229
396 3300026121 Ga0207683_10055995 Ga0207683_100559952 229
397 3300028379 Ga0268266_10021990 Ga0268266_100219903 229
398 3300029957 Ga0265324_10139396 Ga0265324_101393961 229
399 3300035086 Ga0373934_0066027 Ga0373934_0066027_583_1278 229
400 3300035111 Ga0373923_0058010 Ga0373923_0058010_403_1098 229
401 3300035117 Ga0373953_0006359 Ga0373953_0006359_1934_2629 229
402 3300035118 Ga0373954_0029002 Ga0373954_0029002_817_1512 229
403 3300035171 Ga0373946_0026250 Ga0373946_0026250_259_954 229
404 3300035171 Ga0373946_0103214 Ga0373946_0103214_505_1200 229
405 3300035172 Ga0373955_0012485 Ga0373955_0012485_392_1087 229
406 3300035172 Ga0373955_0057248 Ga0373955_0057248_1252_1947 229
407 3300035410 Ga0373924_0019884 Ga0373924_0019884_935_1630 229
408 3300035410 Ga0373924_0118827 Ga0373924_0118827_298_993 229
409 3300035692 Ga0373935_0140146 Ga0373935_0140146_219_914 229
410 3300035695 Ga0373927_0026088 Ga0373927_0026088_393_1088 229
411 3300035695 Ga0373927_0044850 Ga0373927_0044850_1356_2051 229
412 3300035724 Ga0373933_0187259 Ga0373933_0187259_97_792 229
413 3300035725 Ga0373947_0089911 Ga0373947_0089911_1190_1885 229
414 3300035725 Ga0373947_0258886 Ga0373947_0258886_404_1099 229
415 3300036401 Ga0373937_0001523 Ga0373937_0001523_18154_18849 229
416 3300036401 Ga0373937_0016054 Ga0373937_0016054_3415_4110 229
417 3300036401 Ga0373937_0061550 Ga0373937_0061550_2376_3071 229
418 3300036401 Ga0373937_0079421 Ga0373937_0079421_1221_1916 229
419 3300036401 Ga0373937_0094576 Ga0373937_0094576_1913_2608 229
420 3300037068 Ga0373925_0091251 Ga0373925_0091251_1018_1713 229
421 3300037312 Ga0395899_0273410 Ga0395899_0273410_420_1124 229
422 3300037418 Ga0395900_0143765 Ga0395900_0143765_69_773 229
423 3300037466 Ga0395898_0320231 Ga0395898_0320231_459_1148 229
424 3300037853 Ga0436364_0037967 Ga0436364_0037967_3463_4155 229
425 3300037853 Ga0436364_0222612 Ga0436364_0222612_957_1649 229
426 3300037853 Ga0436364_0543555 Ga0436364_0543555_1830_2522 229
427 3300037853 Ga0436364_0729660 Ga0436364_0729660_277_969 229
428 3300038443 Ga0395901_0198481 Ga0395901_0198481_953_1657 229
429 3300039437 Ga0436365_1218945 Ga0436365_1218945_12_704 229
430 3300039437 Ga0436365_1478091 Ga0436365_1478091_162_857 229
431 3300039447 Ga0436361_0256683 Ga0436361_0256683_3656_4348 229
432 3300044694 Ga0466963_0275149 Ga0466963_0275149_164_856 229
433 3300046459 Ga0495629_0277038 Ga0495629_0277038_22_717 229
434 3300046477 Ga0495664_0004097 Ga0495664_0004097_6674_7369 229
435 3300046511 Ga0495608_0032272 Ga0495608_0032272_85_780 229
436 3300046516 Ga0495628_0505334 Ga0495628_0505334_21_713 229
437 3300046517 Ga0495630_0283867 Ga0495630_0283867_552_1247 229
438 3300046529 Ga0495652_0144241 Ga0495652_0144241_866_1561 229
439 3300046536 Ga0495587_0022854 Ga0495587_0022854_1319_2014 229
440 3300046543 Ga0495645_0021952 Ga0495645_0021952_3622_4317 229
441 3300046559 Ga0495667_0028353 Ga0495667_0028353_368_1063 229
442 3300046559 Ga0495667_0127056 Ga0495667_0127056_500_1192 229
443 3300046663 Ga0495635_0019579 Ga0495635_0019579_2071_2766 229
444 3300046663 Ga0495635_0093737 Ga0495635_0093737_1027_1719 229
445 3300046680 Ga0495646_0042905 Ga0495646_0042905_2062_2757 229
446 3300047444 Ga0495675_0105611 Ga0495675_0105611_351_1046 229
447 3300047471 Ga0495684_0061895 Ga0495684_0061895_19_711 229
448 3300048088 Ga0495602_0002050 Ga0495602_0002050_19254_19949 229
449 3300048088 Ga0495602_0432005 Ga0495602_0432005_208_903 229
450 3300048915 Ga0496112_0233004 Ga0496112_0233004_440_1132 229
451 3300049589 Ga0501073_0123017 Ga0501073_0123017_227_919 229
452 3300053077 Ga0495601_0012741 Ga0495601_0012741_797_1492 229
453 3300053078 Ga0495612_0088296 Ga0495612_0088296_219_914 229
454 3300053084 Ga0495595_0013111 Ga0495595_0013111_2247_2942 229
455 3300053085 Ga0495619_0009229 Ga0495619_0009229_5371_6066 229
456 3300053085 Ga0495619_0263531 Ga0495619_0263531_454_1149 229
457 3300053091 Ga0500647_0085818 Ga0500647_0085818_383_1093 229
458 3300053119 Ga0500595_008185 Ga0500595_008185_3269_3973 229
459 3300059639 Ga0587062_018598 Ga0587062_018598_263_952 229
460 3300001979 JGI24740J21852_10006544 JGI24740J21852_100065441 230
461 3300001990 JGI24737J22298_10118900 JGI24737J22298_101189001 230
462 3300002987 JGI25159J45721_1002156 JGI25159J45721_10021564 230
463 3300003203 JGI25406J46586_10015420 JGI25406J46586_100154203 230
464 3300003203 JGI25406J46586_10021918 JGI25406J46586_100219183 230
465 3300003354 JGI25160J50197_1020177 JGI25160J50197_10201772 230
466 3300003752 Ga0055539_1002956 Ga0055539_10029562 230
467 3300003775 Ga0055524_1051299 Ga0055524_10512992 230
468 3300003794 Ga0055531_10011502 Ga0055531_100115025 230
469 3300005262 Ga0065165_1003133 Ga0065165_100313314 230
470 3300005262 Ga0065165_1042814 Ga0065165_10428142 230
471 3300005329 Ga0070683_100126479 Ga0070683_1001264792 230
472 3300005336 Ga0070680_100062342 Ga0070680_1000623426 230
473 3300005337 Ga0070682_100179802 Ga0070682_1001798022 230
474 3300005339 Ga0070660_100406991 Ga0070660_1004069912 230
475 3300005355 Ga0070671_100118236 Ga0070671_1001182362 230
476 3300005366 Ga0070659_100058667 Ga0070659_1000586676 230
477 3300005367 Ga0070667_100609141 Ga0070667_1006091411 230
478 3300005435 Ga0070714_100288594 Ga0070714_1002885942 230
479 3300005435 Ga0070714_100998064 Ga0070714_1009980641 230
480 3300005437 Ga0070710_10359796 Ga0070710_103597962 230
481 3300005441 Ga0070700_100064069 Ga0070700_1000640692 230
482 3300005455 Ga0070663_100317161 Ga0070663_1003171612 230
483 3300005455 Ga0070663_100505232 Ga0070663_1005052322 230
484 3300005456 Ga0070678_100675296 Ga0070678_1006752961 230
485 3300005457 Ga0070662_100292697 Ga0070662_1002926972 230
486 3300005458 Ga0070681_10106321 Ga0070681_101063211 230
487 3300005458 Ga0070681_10248241 Ga0070681_102482412 230
488 3300005471 Ga0070698_100070102 Ga0070698_1000701023 230
489 3300005530 Ga0070679_100118983 Ga0070679_1001189834 230
490 3300005530 Ga0070679_100152926 Ga0070679_1001529263 230
491 3300005535 Ga0070684_100034836 Ga0070684_1000348362 230
492 3300005535 Ga0070684_100441902 Ga0070684_1004419022 230
493 3300005539 Ga0068853_100241007 Ga0068853_1002410072 230
494 3300005539 Ga0068853_100793681 Ga0068853_1007936811 230
495 3300005545 Ga0070695_100834418 Ga0070695_1008344181 230
496 3300005577 Ga0068857_100320409 Ga0068857_1003204092 230
497 3300005577 Ga0068857_100639596 Ga0068857_1006395962 230
498 3300005578 Ga0068854_100409771 Ga0068854_1004097712 230
499 3300005614 Ga0068856_100021546 Ga0068856_1000215462 230
500 3300005614 Ga0068856_100252340 Ga0068856_1002523402 230
501 3300005616 Ga0068852_100015467 Ga0068852_1000154679 230
502 3300005616 Ga0068852_100421037 Ga0068852_1004210372 230
503 3300005616 Ga0068852_100817705 Ga0068852_1008177051 230
504 3300005617 Ga0068859_100342391 Ga0068859_1003423913 230
505 3300005834 Ga0068851_10027996 Ga0068851_100279962 230
506 3300005841 Ga0068863_100371526 Ga0068863_1003715262 230
507 3300005842 Ga0068858_100835176 Ga0068858_1008351761 230
508 3300005937 Ga0081455_10198820 Ga0081455_101988203 230
509 3300005983 Ga0081540_1007542 Ga0081540_10075426 230
510 3300005983 Ga0081540_1061654 Ga0081540_10616542 230
511 3300005985 Ga0081539_10000203 Ga0081539_100002032 230
512 3300005985 Ga0081539_10169214 Ga0081539_101692141 230
513 3300006028 Ga0070717_10627211 Ga0070717_106272112 230
514 3300006038 Ga0075365_10516565 Ga0075365_105165651 230
515 3300006042 Ga0075368_10159166 Ga0075368_101591662 230
516 3300006051 Ga0075364_10123850 Ga0075364_101238502 230
517 3300006163 Ga0070715_10211023 Ga0070715_102110232 230
518 3300006175 Ga0070712_100369396 Ga0070712_1003693961 230
519 3300006177 Ga0075362_10167455 Ga0075362_101674552 230
520 3300006178 Ga0075367_10205354 Ga0075367_102053542 230
521 3300006178 Ga0075367_10270532 Ga0075367_102705322 230
522 3300006186 Ga0075369_10004408 Ga0075369_100044083 230
523 3300006195 Ga0075366_10016242 Ga0075366_100162422 230
524 3300006358 Ga0068871_100182392 Ga0068871_1001823922 230
525 3300006844 Ga0075428_100013627 Ga0075428_1000136277 230
526 3300006847 Ga0075431_100000592 Ga0075431_10000059211 230
527 3300006871 Ga0075434_100025679 Ga0075434_1000256796 230
528 3300006880 Ga0075429_100010041 Ga0075429_1000100416 230
529 3300006881 Ga0068865_100335350 Ga0068865_1003353502 230
530 3300006931 Ga0097620_100342402 Ga0097620_1003424021 230
531 3300007076 Ga0075435_100145714 Ga0075435_1001457142 230
532 3300009092 Ga0105250_10170109 Ga0105250_101701092 230
533 3300009093 Ga0105240_10085042 Ga0105240_100850425 230
534 3300009093 Ga0105240_10099593 Ga0105240_100995935 230
535 3300009093 Ga0105240_10159640 Ga0105240_101596403 230
536 3300009093 Ga0105240_10228535 Ga0105240_102285353 230
537 3300009094 Ga0111539_10015685 Ga0111539_1001568512 230
538 3300009098 Ga0105245_10351257 Ga0105245_103512572 230
539 3300009101 Ga0105247_10006535 Ga0105247_100065358 230
540 3300009101 Ga0105247_10197537 Ga0105247_101975372 230
541 3300009147 Ga0114129_10005303 Ga0114129_100053036 230
542 3300009174 Ga0105241_10019195 Ga0105241_100191952 230
543 3300009174 Ga0105241_10051229 Ga0105241_100512295 230
544 3300009176 Ga0105242_10213039 Ga0105242_102130391 230
545 3300009545 Ga0105237_10066390 Ga0105237_100663904 230
546 3300009551 Ga0105238_10002712 Ga0105238_100027125 230
547 3300009551 Ga0105238_10434856 Ga0105238_104348562 230
548 3300009551 Ga0105238_10446065 Ga0105238_104460652 230
549 3300010375 Ga0105239_10061953 Ga0105239_100619532 230
550 3300010375 Ga0105239_10318764 Ga0105239_103187642 230
551 3300010375 Ga0105239_10689815 Ga0105239_106898152 230
552 3300013250 Ga0171462_1060 Ga0171462_106010 230
553 3300013296 Ga0157374_10377197 Ga0157374_103771972 230
554 3300013297 Ga0157378_10676116 Ga0157378_106761161 230
555 3300014326 Ga0157380_10055924 Ga0157380_100559246 230
556 3300014497 Ga0182008_10088388 Ga0182008_100883882 230
557 3300017792 Ga0163161_10469409 Ga0163161_104694092 230
558 3300021320 Ga0214544_1000006 Ga0214544_1000006198 230
559 3300021321 Ga0214542_1000002 Ga0214542_1000002177 230
560 3300021321 Ga0214542_1040182 Ga0214542_10401822 230
561 3300021324 Ga0214545_1000002 Ga0214545_1000002542 230
562 3300021327 Ga0214543_1000017 Ga0214543_1000017146 230
563 3300021327 Ga0214543_1029778 Ga0214543_10297781 230
564 3300021384 Ga0213876_10034449 Ga0213876_100344492 230
565 3300021388 Ga0213875_10019916 Ga0213875_100199166 230
566 3300021441 Ga0213871_10011494 Ga0213871_100114942 230
567 3300022467 Ga0224712_10048753 Ga0224712_100487531 230
568 3300025245 Ga0207425_1025008 Ga0207425_10250082 230
569 3300025253 Ga0209677_100683 Ga0209677_1006838 230
570 3300025254 Ga0209148_1000448 Ga0209148_100044813 230
571 3300025261 Ga0209233_1004485 Ga0209233_10044854 230
572 3300025261 Ga0209233_1027410 Ga0209233_10274102 230
573 3300025273 Ga0209673_1023321 Ga0209673_10233212 230
574 3300025284 Ga0209130_1000845 Ga0209130_100084514 230
575 3300025297 Ga0209758_1000065 Ga0209758_1000065332 230
576 3300025299 Ga0209256_1008959 Ga0209256_10089592 230
577 3300025302 Ga0207426_1013929 Ga0207426_10139293 230
578 3300025303 Ga0209051_1014715 Ga0209051_10147153 230
579 3300025304 Ga0209257_1000869 Ga0209257_10008695 230
580 3300025898 Ga0207692_10042273 Ga0207692_100422733 230
581 3300025900 Ga0207710_10049330 Ga0207710_100493302 230
582 3300025901 Ga0207688_10006338 Ga0207688_100063386 230
583 3300025901 Ga0207688_10217127 Ga0207688_102171272 230
584 3300025909 Ga0207705_10134492 Ga0207705_101344922 230
585 3300025909 Ga0207705_10156695 Ga0207705_101566952 230
586 3300025910 Ga0207684_10198787 Ga0207684_101987872 230
587 3300025911 Ga0207654_10000241 Ga0207654_1000024113 230
588 3300025913 Ga0207695_10000159 Ga0207695_10000159164 230
589 3300025913 Ga0207695_10001032 Ga0207695_1000103245 230
590 3300025913 Ga0207695_10061566 Ga0207695_100615662 230
591 3300025913 Ga0207695_10477455 Ga0207695_104774552 230
592 3300025914 Ga0207671_10033318 Ga0207671_100333183 230
593 3300025915 Ga0207693_10001370 Ga0207693_100013706 230
594 3300025915 Ga0207693_10196555 Ga0207693_101965552 230
595 3300025915 Ga0207693_10287595 Ga0207693_102875952 230
596 3300025921 Ga0207652_10088570 Ga0207652_100885702 230
597 3300025921 Ga0207652_10090827 Ga0207652_100908274 230
598 3300025924 Ga0207694_10000271 Ga0207694_1000027135 230
599 3300025928 Ga0207700_10136289 Ga0207700_101362893 230
600 3300025929 Ga0207664_10114737 Ga0207664_101147372 230
601 3300025929 Ga0207664_10483276 Ga0207664_104832761 230
602 3300025939 Ga0207665_10525581 Ga0207665_105255811 230
603 3300025941 Ga0207711_10493382 Ga0207711_104933822 230
604 3300025944 Ga0207661_10302349 Ga0207661_103023492 230
605 3300025949 Ga0207667_10005212 Ga0207667_1000521218 230
606 3300025960 Ga0207651_10363665 Ga0207651_103636652 230
607 3300025961 Ga0207712_10336703 Ga0207712_103367032 230
608 3300025972 Ga0207668_10245757 Ga0207668_102457572 230
609 3300025981 Ga0207640_10558438 Ga0207640_105584381 230
610 3300026023 Ga0207677_10379819 Ga0207677_103798192 230
611 3300026041 Ga0207639_10073925 Ga0207639_100739255 230
612 3300026067 Ga0207678_10201143 Ga0207678_102011432 230
613 3300026067 Ga0207678_10272069 Ga0207678_102720692 230
614 3300026075 Ga0207708_10201318 Ga0207708_102013181 230
615 3300026078 Ga0207702_10000005 Ga0207702_10000005219 230
616 3300026088 Ga0207641_10230932 Ga0207641_102309321 230
617 3300026089 Ga0207648_10359249 Ga0207648_103592492 230
618 3300026118 Ga0207675_100755057 Ga0207675_1007550571 230
619 3300026121 Ga0207683_10169868 Ga0207683_101698682 230
620 3300026142 Ga0207698_10037943 Ga0207698_100379434 230
621 3300026142 Ga0207698_10732212 Ga0207698_107322122 230
622 3300027357 Ga0209589_1000300 Ga0209589_10003005 230
623 3300027361 Ga0209489_100906 Ga0209489_10090613 230
624 3300027361 Ga0209489_110266 Ga0209489_1102666 230
625 3300027363 Ga0209700_100031 Ga0209700_100031150 230
626 3300027907 Ga0207428_10018951 Ga0207428_100189518 230
627 3300028379 Ga0268266_10452658 Ga0268266_104526582 230
628 3300028800 Ga0265338_10076368 Ga0265338_100763682 230
629 3300031238 Ga0265332_10214210 Ga0265332_102142101 230
630 3300031239 Ga0265328_10052526 Ga0265328_100525262 230
631 3300031241 Ga0265325_10034182 Ga0265325_100341823 230
632 3300031241 Ga0265325_10198984 Ga0265325_101989842 230
633 3300031247 Ga0265340_10013890 Ga0265340_100138903 230
634 3300031247 Ga0265340_10017672 Ga0265340_100176723 230
635 3300031247 Ga0265340_10038726 Ga0265340_100387262 230
636 3300031247 Ga0265340_10081614 Ga0265340_100816142 230
637 3300031247 Ga0265340_10091474 Ga0265340_100914742 230
638 3300031249 Ga0265339_10002960 Ga0265339_100029602 230
639 3300031249 Ga0265339_10041867 Ga0265339_100418673 230
640 3300031249 Ga0265339_10057698 Ga0265339_100576982 230
641 3300031249 Ga0265339_10061098 Ga0265339_100610983 230
642 3300031344 Ga0265316_10016971 Ga0265316_100169718 230
643 3300031344 Ga0265316_10031977 Ga0265316_100319774 230
644 3300031344 Ga0265316_10045654 Ga0265316_100456544 230
645 3300031344 Ga0265316_10117099 Ga0265316_101170993 230
646 3300031548 Ga0307408_100096057 Ga0307408_1000960572 230
647 3300031595 Ga0265313_10000031 Ga0265313_1000003168 230
648 3300031595 Ga0265313_10010610 Ga0265313_100106101 230
649 3300031595 Ga0265313_10022279 Ga0265313_100222793 230
650 3300031595 Ga0265313_10033193 Ga0265313_100331933 230
651 3300031711 Ga0265314_10026660 Ga0265314_100266604 230
652 3300031712 Ga0265342_10001389 Ga0265342_100013895 230
653 3300031712 Ga0265342_10012909 Ga0265342_100129097 230
654 3300031731 Ga0307405_10282490 Ga0307405_102824901 230
655 3300031901 Ga0307406_10433396 Ga0307406_104333962 230
656 3300031995 Ga0307409_100632209 Ga0307409_1006322092 230
657 3300032002 Ga0307416_100142164 Ga0307416_1001421643 230
658 3300032004 Ga0307414_10099306 Ga0307414_100993064 230
659 3300032126 Ga0307415_100478750 Ga0307415_1004787502 230
660 3300035083 Ga0373926_0046832 Ga0373926_0046832_753_1445 230
661 3300035086 Ga0373934_0048159 Ga0373934_0048159_675_1367 230
662 3300035111 Ga0373923_0021854 Ga0373923_0021854_1110_1802 230
663 3300035116 Ga0373945_0005479 Ga0373945_0005479_2714_3406 230
664 3300035117 Ga0373953_0044823 Ga0373953_0044823_1058_1750 230
665 3300035118 Ga0373954_0006466 Ga0373954_0006466_1912_2604 230
666 3300035119 Ga0373956_0028773 Ga0373956_0028773_1658_2350 230
667 3300035170 Ga0373943_0060393 Ga0373943_0060393_57_749 230
668 3300035171 Ga0373946_0045597 Ga0373946_0045597_1066_1758 230
669 3300035410 Ga0373924_0014546 Ga0373924_0014546_1070_1762 230
670 3300035692 Ga0373935_0263836 Ga0373935_0263836_96_788 230
671 3300035695 Ga0373927_0122464 Ga0373927_0122464_492_1184 230
672 3300035724 Ga0373933_0115895 Ga0373933_0115895_22_714 230
673 3300035725 Ga0373947_0064960 Ga0373947_0064960_662_1354 230
674 3300036242 Ga0310104_00647 Ga0310104_00647_173_865 230
675 3300036401 Ga0373937_0262392 Ga0373937_0262392_695_1387 230
676 3300036401 Ga0373937_0309676 Ga0373937_0309676_368_1060 230
677 3300036534 Ga0310109_018735 Ga0310109_018735_132_824 230
678 3300037068 Ga0373925_0010512 Ga0373925_0010512_5485_6177 230
679 3300037471 Ga0395905_0025407 Ga0395905_0025407_1535_2227 230
680 3300037471 Ga0395905_0077411 Ga0395905_0077411_1894_2586 230
681 3300037471 Ga0395905_0090669 Ga0395905_0090669_365_1063 230
682 3300037853 Ga0436364_0785067 Ga0436364_0785067_388_1080 230
683 3300038443 Ga0395901_0104618 Ga0395901_0104618_689_1381 230
684 3300038443 Ga0395901_0337694 Ga0395901_0337694_722_1414 230
685 3300039437 Ga0436365_1173928 Ga0436365_1173928_287_979 230
686 3300039437 Ga0436365_1531521 Ga0436365_1531521_72_764 230
687 3300039438 Ga0436360_0755908 Ga0436360_0755908_49_762 230
688 3300039438 Ga0436360_1136386 Ga0436360_1136386_1728_2423 230
689 3300039447 Ga0436361_0034599 Ga0436361_0034599_965_1678 230
690 3300039450 Ga0436363_0691096 Ga0436363_0691096_15_716 230
691 3300039450 Ga0436363_1149677 Ga0436363_1149677_880_1572 230
692 3300039453 Ga0436362_0294583 Ga0436362_0294583_216_911 230
693 3300041452 Ga0451793_0379144 Ga0451793_0379144_145_837 230
694 3300041492 Ga0451835_1046652 Ga0451835_1046652_116_811 230
695 3300044656 Ga0466969_0012702 Ga0466969_0012702_3398_4090 230
696 3300044683 Ga0466965_0012547 Ga0466965_0012547_1092_1784 230
697 3300044683 Ga0466965_0150110 Ga0466965_0150110_273_977 230
698 3300044684 Ga0466966_0006998 Ga0466966_0006998_573_1265 230
699 3300044693 Ga0466961_0001042 Ga0466961_0001042_3298_3990 230
700 3300044712 Ga0453684_0017854 Ga0453684_0017854_8528_9232 230
701 3300044901 Ga0466960_0066674 Ga0466960_0066674_917_1615 230
702 3300044901 Ga0466960_0136510 Ga0466960_0136510_206_904 230
703 3300045049 Ga0466959_0037237 Ga0466959_0037237_2207_2899 230
704 3300045051 Ga0451576_0027584 Ga0451576_0027584_4387_5091 230
705 3300045976 Ga0466967_0302098 Ga0466967_0302098_430_1131 230
706 3300045976 Ga0466967_0316952 Ga0466967_0316952_39_734 230
707 3300045976 Ga0466967_0328941 Ga0466967_0328941_337_1029 230
708 3300045976 Ga0466967_0579619 Ga0466967_0579619_347_1051 230
709 3300046454 Ga0495592_0062965 Ga0495592_0062965_1312_2004 230
710 3300046462 Ga0495651_0006487 Ga0495651_0006487_1751_2443 230
711 3300046462 Ga0495651_0227101 Ga0495651_0227101_177_869 230
712 3300046472 Ga0495580_0082513 Ga0495580_0082513_1015_1707 230
713 3300046475 Ga0495639_0015064 Ga0495639_0015064_1316_2008 230
714 3300046476 Ga0495662_0094943 Ga0495662_0094943_377_1069 230
715 3300046477 Ga0495664_0049176 Ga0495664_0049176_78_770 230
716 3300046477 Ga0495664_0114614 Ga0495664_0114614_122_814 230
717 3300046507 Ga0495606_0058293 Ga0495606_0058293_76_768 230
718 3300046511 Ga0495608_0104518 Ga0495608_0104518_431_1123 230
719 3300046514 Ga0495618_0219611 Ga0495618_0219611_475_1167 230
720 3300046516 Ga0495628_0031219 Ga0495628_0031219_1814_2506 230
721 3300046516 Ga0495628_0321290 Ga0495628_0321290_381_1073 230
722 3300046517 Ga0495630_0054203 Ga0495630_0054203_1955_2647 230
723 3300046522 Ga0495643_0005458 Ga0495643_0005458_4588_5280 230
724 3300046524 Ga0495648_0001345 Ga0495648_0001345_2516_3208 230
725 3300046529 Ga0495652_0116807 Ga0495652_0116807_1062_1754 230
726 3300046531 Ga0495665_0095569 Ga0495665_0095569_450_1142 230
727 3300046533 Ga0495640_0107065 Ga0495640_0107065_449_1141 230
728 3300046536 Ga0495587_0019372 Ga0495587_0019372_2094_2786 230
729 3300046543 Ga0495645_0016837 Ga0495645_0016837_1660_2352 230
730 3300046557 Ga0495622_0132102 Ga0495622_0132102_376_1068 230
731 3300046642 Ga0495634_0446621 Ga0495634_0446621_23_715 230
732 3300046663 Ga0495635_0066384 Ga0495635_0066384_58_750 230
733 3300046665 Ga0495661_0073375 Ga0495661_0073375_62_754 230
734 3300046674 Ga0495588_0025384 Ga0495588_0025384_487_1179 230
735 3300046675 Ga0495657_0006873 Ga0495657_0006873_1788_2480 230
736 3300046679 Ga0495623_0198251 Ga0495623_0198251_137_829 230
737 3300046689 Ga0495613_0261537 Ga0495613_0261537_466_1158 230
738 3300046690 Ga0495624_0116424 Ga0495624_0116424_594_1286 230
739 3300046692 Ga0495671_0125023 Ga0495671_0125023_275_967 230
740 3300047317 Ga0495604_0018557 Ga0495604_0018557_2651_3343 230
741 3300047319 Ga0495674_0010957 Ga0495674_0010957_2397_3089 230
742 3300047319 Ga0495674_0030102 Ga0495674_0030102_2160_2852 230
743 3300047321 Ga0495676_0086785 Ga0495676_0086785_1087_1779 230
744 3300047322 Ga0495680_0010280 Ga0495680_0010280_4544_5236 230
745 3300047443 Ga0495687_054433 Ga0495687_054433_589_1281 230
746 3300047469 Ga0495673_0108344 Ga0495673_0108344_238_930 230
747 3300047673 Ga0495593_0020272 Ga0495593_0020272_1327_2019 230
748 3300048089 Ga0495614_0049654 Ga0495614_0049654_47_739 230
749 3300048904 Ga0496101_0247428 Ga0496101_0247428_191_883 230
750 3300048905 Ga0496102_0014053 Ga0496102_0014053_991_1683 230
751 3300048906 Ga0496103_0070753 Ga0496103_0070753_1017_1709 230
752 3300048906 Ga0496103_0516916 Ga0496103_0516916_57_749 230
753 3300048907 Ga0496104_0868138 Ga0496104_0868138_65_757 230
754 3300048908 Ga0496105_0104291 Ga0496105_0104291_345_1037 230
755 3300048909 Ga0496106_0040983 Ga0496106_0040983_2718_3410 230
756 3300048918 Ga0496115_0133482 Ga0496115_0133482_558_1256 230
757 3300048919 Ga0496116_0102459 Ga0496116_0102459_847_1539 230
758 3300048920 Ga0496117_0117952 Ga0496117_0117952_438_1130 230
759 3300048921 Ga0496118_0051579 Ga0496118_0051579_105_797 230
760 3300048921 Ga0496118_0068478 Ga0496118_0068478_650_1342 230
761 3300048921 Ga0496118_0073236 Ga0496118_0073236_323_1015 230
762 3300048922 Ga0496119_0032055 Ga0496119_0032055_1875_2567 230
763 3300048924 Ga0496121_0034197 Ga0496121_0034197_2514_3206 230
764 3300048924 Ga0496121_0038417 Ga0496121_0038417_3469_4161 230
765 3300048924 Ga0496121_0149530 Ga0496121_0149530_595_1287 230
766 3300048929 Ga0496126_0062852 Ga0496126_0062852_1245_1937 230
767 3300048929 Ga0496126_0081188 Ga0496126_0081188_1668_2360 230
768 3300048929 Ga0496126_0088742 Ga0496126_0088742_706_1398 230
769 3300048929 Ga0496126_0175147 Ga0496126_0175147_896_1597 230
770 3300049460 Ga0495682_0137662 Ga0495682_0137662_50_742 230
771 3300049529 Ga0501313_014437 Ga0501313_014437_217_921 230
772 3300049534 Ga0501318_003335 Ga0501318_003335_652_1350 230
773 3300049541 Ga0501325_005704 Ga0501325_005704_283_984 230
774 3300049568 Ga0501031_0033490 Ga0501031_0033490_540_1241 230
775 3300049568 Ga0501031_0476243 Ga0501031_0476243_20_712 230
776 3300049569 Ga0501032_0065064 Ga0501032_0065064_1590_2285 230
777 3300049569 Ga0501032_0132961 Ga0501032_0132961_327_1019 230
778 3300049569 Ga0501032_0236737 Ga0501032_0236737_230_922 230
779 3300049569 Ga0501032_0443390 Ga0501032_0443390_30_722 230
780 3300049569 Ga0501032_0533912 Ga0501032_0533912_29_721 230
781 3300049570 Ga0501033_0167257 Ga0501033_0167257_659_1351 230
782 3300049571 Ga0501034_0106577 Ga0501034_0106577_1639_2334 230
783 3300049571 Ga0501034_0206678 Ga0501034_0206678_450_1145 230
784 3300049571 Ga0501034_0354864 Ga0501034_0354864_425_1120 230
785 3300049571 Ga0501034_0364593 Ga0501034_0364593_380_1084 230
786 3300049571 Ga0501034_0417156 Ga0501034_0417156_376_1071 230
787 3300049571 Ga0501034_0497150 Ga0501034_0497150_83_778 230
788 3300049572 Ga0501036_0099384 Ga0501036_0099384_262_957 230
789 3300049573 Ga0501037_0062660 Ga0501037_0062660_739_1434 230
790 3300049573 Ga0501037_0071342 Ga0501037_0071342_1548_2246 230
791 3300049574 Ga0501038_0457422 Ga0501038_0457422_172_864 230
792 3300049575 Ga0501039_0367788 Ga0501039_0367788_370_1062 230
793 3300049578 Ga0501042_0017621 Ga0501042_0017621_170_862 230
794 3300049578 Ga0501042_0032164 Ga0501042_0032164_839_1540 230
795 3300049579 Ga0501043_0252396 Ga0501043_0252396_425_1126 230
796 3300049579 Ga0501043_0257633 Ga0501043_0257633_162_854 230
797 3300049579 Ga0501043_0494517 Ga0501043_0494517_163_858 230
798 3300049579 Ga0501043_0540834 Ga0501043_0540834_59_751 230
799 3300049580 Ga0501046_0037628 Ga0501046_0037628_2285_2977 230
800 3300049580 Ga0501046_0087784 Ga0501046_0087784_729_1424 230
801 3300049581 Ga0501047_0042057 Ga0501047_0042057_677_1381 230
802 3300049581 Ga0501047_0050870 Ga0501047_0050870_2262_2957 230
803 3300049581 Ga0501047_0228391 Ga0501047_0228391_863_1558 230
804 3300049581 Ga0501047_0393822 Ga0501047_0393822_52_747 230
805 3300049581 Ga0501047_0428229 Ga0501047_0428229_320_1015 230
806 3300049581 Ga0501047_0501722 Ga0501047_0501722_285_977 230
807 3300049583 Ga0501067_0025975 Ga0501067_0025975_1374_2069 230
808 3300049583 Ga0501067_0052548 Ga0501067_0052548_891_1586 230
809 3300049585 Ga0501069_0398237 Ga0501069_0398237_52_747 230
810 3300049586 Ga0501070_0005291 Ga0501070_0005291_3337_4032 230
811 3300049586 Ga0501070_0011623 Ga0501070_0011623_6616_7308 230
812 3300049586 Ga0501070_0270440 Ga0501070_0270440_673_1365 230
813 3300049586 Ga0501070_0611381 Ga0501070_0611381_158_850 230
814 3300049587 Ga0501071_0055463 Ga0501071_0055463_1429_2130 230
815 3300049589 Ga0501073_0021046 Ga0501073_0021046_501_1196 230
816 3300049589 Ga0501073_0117682 Ga0501073_0117682_1018_1713 230
817 3300049589 Ga0501073_0124403 Ga0501073_0124403_599_1291 230
818 3300049589 Ga0501073_0250222 Ga0501073_0250222_519_1211 230
819 3300049590 Ga0501074_0002236 Ga0501074_0002236_7673_8368 230
820 3300049591 Ga0501075_0618678 Ga0501075_0618678_95_787 230
821 3300049592 Ga0501076_0025959 Ga0501076_0025959_1767_2468 230
822 3300049671 Ga0501238_002463 Ga0501238_002463_1475_2173 230
823 3300049680 Ga0501250_019988 Ga0501250_019988_15_719 230
824 3300049741 Ga0501079_0286319 Ga0501079_0286319_62_757 230
825 3300049742 Ga0501080_0006112 Ga0501080_0006112_3464_4159 230
826 3300049742 Ga0501080_0040617 Ga0501080_0040617_1435_2130 230
827 3300049744 Ga0501083_0026188 Ga0501083_0026188_989_1684 230
828 3300049744 Ga0501083_0078012 Ga0501083_0078012_287_982 230
829 3300049822 Ga0501035_0046134 Ga0501035_0046134_2049_2744 230
830 3300049822 Ga0501035_0407934 Ga0501035_0407934_68_760 230
831 3300049823 Ga0501044_0042664 Ga0501044_0042664_2309_3001 230
832 3300049823 Ga0501044_0062308 Ga0501044_0062308_308_1003 230
833 3300049823 Ga0501044_0066525 Ga0501044_0066525_1517_2212 230
834 3300049823 Ga0501044_0121256 Ga0501044_0121256_1888_2580 230
835 3300049823 Ga0501044_0174818 Ga0501044_0174818_151_846 230
836 3300049823 Ga0501044_0176929 Ga0501044_0176929_331_1023 230
837 3300049823 Ga0501044_0242990 Ga0501044_0242990_380_1084 230
838 3300049823 Ga0501044_0300728 Ga0501044_0300728_652_1344 230
839 3300049823 Ga0501044_0307150 Ga0501044_0307150_786_1478 230
840 3300049823 Ga0501044_0508266 Ga0501044_0508266_52_747 230
841 3300049823 Ga0501044_0549649 Ga0501044_0549649_219_911 230
842 3300049823 Ga0501044_0683934 Ga0501044_0683934_144_836 230
843 3300049824 Ga0501045_0517217 Ga0501045_0517217_181_873 230
844 3300050489 nmdc:mga03683_119094_c1 nmdc:mga03683_119094_c1_342_1034 230
845 3300050490 nmdc:mga03n38_81694_c1 nmdc:mga03n38_81694_c1_589_1281 230
846 3300050492 nmdc:mga0yw44_9723_c1 nmdc:mga0yw44_9723_c1_457_1149 230
847 3300050494 nmdc:mga06z11_5686_c1 nmdc:mga06z11_5686_c1_3746_4438 230
848 3300050495 nmdc:mga04h51_6599_c1 nmdc:mga04h51_6599_c1_1830_2522 230
849 3300050496 nmdc:mga07m45_122292_c1 nmdc:mga07m45_122292_c1_372_1064 230
850 3300050507 nmdc:mga05p37_1686_c1 nmdc:mga05p37_1686_c1_12964_13674 230
851 3300050508 nmdc:mga09592_9760_c1 nmdc:mga09592_9760_c1_3061_3771 230
852 3300050510 nmdc:mga06r32_37775_c1 nmdc:mga06r32_37775_c1_2489_3199 230
853 3300050511 nmdc:mga08y16_11167_c1 nmdc:mga08y16_11167_c1_6357_7067 230
854 3300050511 nmdc:mga08y16_275826_c1 nmdc:mga08y16_275826_c1_244_936 230
855 3300050512 nmdc:mga0n895_17709_c1 nmdc:mga0n895_17709_c1_3327_4019 230
856 3300050513 nmdc:mga0rr50_126499_c1 nmdc:mga0rr50_126499_c1_935_1627 230
857 3300050516 nmdc:mga0sz30_4401_c1 nmdc:mga0sz30_4401_c1_746_1447 230
858 3300050516 nmdc:mga0sz30_59009_c1 nmdc:mga0sz30_59009_c1_162_854 230
859 3300050516 nmdc:mga0sz30_6678_c1 nmdc:mga0sz30_6678_c1_947_1639 230
860 3300053080 Ga0500635_0033363 Ga0500635_0033363_720_1412 230
861 3300053083 Ga0495655_0059215 Ga0495655_0059215_58_750 230
862 3300053085 Ga0495619_0166775 Ga0495619_0166775_385_1077 230
863 3300053086 Ga0500578_0338260 Ga0500578_0338260_63_755 230
864 3300053087 Ga0500643_000335 Ga0500643_000335_13829_14521 230
865 3300053090 Ga0500646_0024974 Ga0500646_0024974_578_1270 230
866 3300053091 Ga0500647_0152877 Ga0500647_0152877_349_1041 230
867 3300053093 Ga0500651_0030743 Ga0500651_0030743_1142_1834 230
868 3300053093 Ga0500651_0094767 Ga0500651_0094767_1116_1808 230
869 3300053094 Ga0500566_0004695 Ga0500566_0004695_2759_3451 230
870 3300053103 Ga0500555_011238 Ga0500555_011238_756_1448 230
871 3300053105 Ga0500557_000010 Ga0500557_000010_23644_24336 230
872 3300053111 Ga0500572_000157 Ga0500572_000157_21511_22203 230
873 3300053121 Ga0500607_076810 Ga0500607_076810_196_888 230
874 3300053122 Ga0500608_011045 Ga0500608_011045_414_1106 230
875 3300053123 Ga0500614_036280 Ga0500614_036280_331_1023 230
876 3300053130 Ga0500642_0003300 Ga0500642_0003300_263_955 230
877 3300053131 Ga0500652_010380 Ga0500652_010380_1072_1764 230
878 3300053136 Ga0500559_0020416 Ga0500559_0020416_1516_2208 230
879 3300053136 Ga0500559_0029313 Ga0500559_0029313_144_836 230
880 3300053138 Ga0500564_089383 Ga0500564_089383_58_750 230
881 3300053142 Ga0500577_0091766 Ga0500577_0091766_503_1195 230
882 3300053147 Ga0500589_124742 Ga0500589_124742_344_1036 230
883 3300053150 Ga0500603_000497 Ga0500603_000497_844_1536 230
884 3300053154 Ga0500619_005307 Ga0500619_005307_1147_1839 230
885 3300053159 Ga0500630_001586 Ga0500630_001586_8693_9385 230
886 3300053161 Ga0500634_0125458 Ga0500634_0125458_410_1102 230
887 3300053162 Ga0500638_110860 Ga0500638_110860_515_1207 230
888 3300053163 Ga0500639_000002 Ga0500639_000002_231335_232027 230
889 3300053178 Ga0500637_0221176 Ga0500637_0221176_187_879 230
890 3300053729 Ga0500625_013421 Ga0500625_013421_1330_2022 230
891 3300053730 Ga0500645_021926 Ga0500645_021926_534_1229 230
892 3300053731 Ga0500609_009425 Ga0500609_009425_156_848 230
893 3300053735 Ga0500596_002194 Ga0500596_002194_342_1034 230
894 3300054114 Ga0501084_0017007 Ga0501084_0017007_24_719 230
895 3300054114 Ga0501084_0319314 Ga0501084_0319314_434_1129 230
896 3300054114 Ga0501084_0337004 Ga0501084_0337004_295_990 230
897 3300059641 Ga0587068_044644 Ga0587068_044644_110_802 230
898 3300060353 Ga0501082_0112475 Ga0501082_0112475_897_1592 230
899 3300060353 Ga0501082_0159588 Ga0501082_0159588_1175_1870 230
900 3300060353 Ga0501082_0326837 Ga0501082_0326837_451_1146 230

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00687

Ribosomal_L1

Ribosomal protein L1p/L10e family

31

221

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
5npm-assembly1.cif.gz_A crystal structure of mutant ribosomal protein tthl1 lacking 8 n-terminal residues in complex with 80nt 23s rna from thermus thermophilus 0.9546 18 226
4v5f-assembly1.cif.gz_BC error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.9511 4 225
4qg3-assembly1.cif.gz_A crystal structure of mutant ribosomal protein g219v tthl1 in complex with 80nt 23s rna from thermus thermophilus 0.9502 4 226
4v9h-assembly1.cif.gz_BC crystal structure of the ribosome bound to elongation factor g in the guanosine triphosphatase state 0.9474 4 225
4v8y-assembly1.cif.gz_CL cryo-em reconstruction of the 80s-eif5b-met-itrnamet eukaryotic translation initiation complex 0.9469 4 225
ID Description Score Start End Superfamily
af_Q60E59_194_280_3.40.50.790 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Ribosomal protein L1/L10, domain II 0.9719 73 158 3.40.50.790
af_P9WHC7_16_229_3.30.190.20 Alpha Beta;2-Layer Sandwich;Ribulose 1,5 Bisphosphate Carboxylase/Oxygenase;Ribosomal protein L1/L10, rRNA-binding domain 0.9606 15 225 3.30.190.20
af_Q9P6M9_97_182_3.40.50.790 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Ribosomal protein L1/L10, domain II 0.9598 72 155 3.40.50.790
af_Q60E59_194_280_3.40.50.790 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Ribosomal protein L1/L10, domain II 0.9504 73 158 3.40.50.790
af_I1L5L1_126_340_3.30.190.20 Alpha Beta;2-Layer Sandwich;Ribulose 1,5 Bisphosphate Carboxylase/Oxygenase;Ribosomal protein L1/L10, rRNA-binding domain 0.944 18 228 3.30.190.20
ID Description Score Start End GO Terms
AF-A0A538KKK0-F1-model_v4 Large ribosomal subunit protein uL1 (50S ribosomal protein L1) 0.9805 58 229 GO:0000049
GO:0003735
GO:0006412
GO:0006417
GO:0015934
GO:0019843
AF-A0A4R1R9H9-F1-model_v4 Large ribosomal subunit protein uL1 0.9803 1 230 GO:0000049
GO:0003735
GO:0006412
GO:0006417
GO:0019843
GO:0022625
AF-A0A8A7AR21-F1-model_v4 deleted 0.9802 1 230
AF-B9JDR8-F1-model_v4 Large ribosomal subunit protein uL1 (50S ribosomal protein L1) 0.9797 5 230 GO:0000049
GO:0003735
GO:0006412
GO:0006417
GO:0019843
GO:0022625
AF-B0UHY1-F1-model_v4 Large ribosomal subunit protein uL1 (50S ribosomal protein L1) 0.9796 4 228 GO:0000049
GO:0003735
GO:0006412
GO:0006417
GO:0019843
GO:0022625

Feature Viewer

pLDDT pTM Quality
89.15 0.82 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map