F485134
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 900 | 604 | 665 | 227 |
Family's Representative Sequence
| Representative Sequence | 3300009093|Ga0105240_10085042|Ga0105240_100850425 |
| Length | 237 |
| Sequence | MVHISKRLTKAQAAAGEPGTVYGLEDAVRLVKNNATAKFDETIEIAMNLGIDPRHADQAVRGVVQMPNGTGKTVRIAVFAKGDKAAEATAAGADVVGAEDLAEQVQAGQIDFDRCIATPDMMMLVGRLGKVLGPRGLMPNPKLGTVTPNVAEAVKSAKGGAVEFRAEKAGIVHAGIGKASFTEQALVENVKAFVNSITRAKPAGAKGTFIQKVSLSSTMGPGVKIDVGSLLSAAGSA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2507262055 | Bradyrhizobium sp. WSM1417 | Isolate | Nodule |
| 2 | 2508501009 | Bradyrhizobium sp. WSM471 | Isolate | Nodule |
| 3 | 2508501042 | Bradyrhizobium sp. WSM1253 | Isolate | Nodule |
| 4 | 2508501050 | Microvirga lupini Lut6 | Isolate | Nodule |
| 5 | 2508501114 | Microvirga lotononidis WSM3557 | Isolate | Nodule |
| 6 | 2508501128 | Bradyrhizobium sp. ARR65 | Isolate | Nodule |
| 7 | 2511231028 | Bradyrhizobium sp. YR681 | Isolate | Rhizosphere |
| 8 | 2513237092 | Bradyrhizobium sp. WSM1743 | Isolate | Nodule |
| 9 | 2513237094 | Bradyrhizobium sp. WSM3983 | Isolate | Nodule |
| 10 | 2513237095 | Bradyrhizobium diazoefficiens USDA 122 | Isolate | Nodule |
| 11 | 2513237096 | Bradyrhizobium pachyrhizi USDA 3259 | Isolate | Nodule |
| 12 | 2513237098 | Bradyrhizobium elkanii WSM2783 | Isolate | Nodule |
| 13 | 2513237102 | Bradyrhizobium japonicum USDA 135 | Isolate | Nodule |
| 14 | 2513237137 | Bradyrhizobium elkanii USDA 94 | Isolate | Nodule |
| 15 | 2513237139 | Bradyrhizobium ottawaense USDA 4 | Isolate | Nodule |
| 16 | 2513237145 | Bradyrhizobium elkanii USDA 3254 | Isolate | Nodule |
| 17 | 2513237161 | Bradyrhizobium sp. WSM2793 | Isolate | Nodule |
| 18 | 2515154112 | Bradyrhizobium sp. WSM4349 | Isolate | Nodule |
| 19 | 2517093001 | Bradyrhizobium japonicum USDA 124 | Isolate | Nodule |
| 20 | 2517572143 | Bradyrhizobium elkanii USDA 76 | Isolate | Nodule |
| 21 | 2522572158 | Azospirillum halopraeferens DSM 3675 | Isolate | Unclassified |
| 22 | 2524023205 | Bradyrhizobium sp. Cp5.3 | Isolate | Nodule |
| 23 | 2524023210 | Bradyrhizobium sp. Ai1a-2 | Isolate | Nodule |
| 24 | 2524023228 | Bradyrhizobium sp. Th.b2 | Isolate | Nodule |
| 25 | 2524023250 | Niveispirillum irakense DSM 11586 | Isolate | Unclassified |
| 26 | 2528768022 | Bradyrhizobium japonicum USDA 123 | Isolate | Nodule |
| 27 | 2545555834 | Methylobacterium sp. WSM2598 | Isolate | Nodule |
| 28 | 2617270735 | Bradyrhizobium shewense ERR11 | Isolate | Nodule |
| 29 | 2617270741 | Bradyrhizobium yuanmingense CCBAU 10071 | Isolate | Nodule |
| 30 | 2643221651 | Afipia sp. Root123D2 | Isolate | Unclassified |
| 31 | 2643221736 | Bosea sp. Root483D1 | Isolate | Unclassified |
| 32 | 2667528175 | Rhizobium tropici NFR14 | Isolate | Rhizoplane |
| 33 | 2721755755 | Bradyrhizobium icense LMTR 13 | Isolate | Nodule |
| 34 | 2744054633 | Bradyrhizobium neotropicale BR 10247 | Isolate | Unclassified |
| 35 | 2773857925 | Microvirga vignae BR3299 | Isolate | Unclassified |
| 36 | 2775506901 | Microvirga ossetica V5/3m | Isolate | Unclassified |
| 37 | 2791355196 | Bradyrhizobium sp. Y36 | Isolate | Nodule |
| 38 | 2791355197 | Bradyrhizobium sp. C9 | Isolate | Nodule |
| 39 | 2802429603 | Bradyrhizobium ottawaense L2 | Isolate | Nodule |
| 40 | 2816332527 | Bradyrhizobium diazoefficiens Y21 | Isolate | Nodule |
| 41 | 2818991467 | Bosea vestrisii 3192 | Isolate | Unclassified |
| 42 | 2824600985 | Bradyrhizobium sp.HAMBI 2135 | Isolate | Unclassified |
| 43 | 2824609381 | Bradyrhizobium sp. HAMBI 2134 | Isolate | Unclassified |
| 44 | 2824617872 | Bradyrhizobium sp. HAMBI 2133 | Isolate | Unclassified |
| 45 | 2824626560 | Bradyrhizobium sp. HAMBI 2149 | Isolate | Unclassified |
| 46 | 2824635225 | Bradyrhizobium sp. HAMBI 2136 | Isolate | Unclassified |
| 47 | 2824644064 | Bradyrhizobium sp. HAMBI 2137 | Isolate | Unclassified |
| 48 | 2824653114 | Bradyrhizobium sp. HAMBI 2142 | Isolate | Unclassified |
| 49 | 2824661429 | Bradyrhizobium sp. HAMBI 2115 | Isolate | Unclassified |
| 50 | 2824671348 | Bradyrhizobium sp. HAMBI 2125 | Isolate | Unclassified |
| 51 | 2824679649 | Bradyrhizobium sp.HAMBI 2116 | Isolate | Unclassified |
| 52 | 2824687955 | Bradyrhizobium sp. HAMBI 2126 | Isolate | Unclassified |
| 53 | 2824696289 | Bradyrhizobium sp. HAMBI 2127 | Isolate | Unclassified |
| 54 | 2824704595 | Bradyrhizobium sp. HAMBI 2150 | Isolate | Unclassified |
| 55 | 2824714736 | Bradyrhizobium sp. HAMBI 2151 | Isolate | Unclassified |
| 56 | 2824723954 | Bradyrhizobium sp. HAMBI 2152 | Isolate | Unclassified |
| 57 | 2824732956 | Bradyrhizobium sp. HAMBI 2153 | Isolate | Unclassified |
| 58 | 2824746037 | Bradyrhizobium sp. HAMBI 2299 | Isolate | Unclassified |
| 59 | 2824753945 | Bradyrhizobium sp. HAMBI 2128 | Isolate | Unclassified |
| 60 | 2824763712 | Bradyrhizobium sp. HAMBI 2129 | Isolate | Unclassified |
| 61 | 2824773399 | Bradyrhizobium sp. HAMBI 2130 | Isolate | Unclassified |
| 62 | 2835312727 | Microvirga calopogonii CCBAU 65841 | Isolate | Nodule |
| 63 | 2838122688 | Bradyrhizobium sp. CIR3A | Isolate | Nodule |
| 64 | 2841760612 | Bosea sp. Tri-49 | Isolate | Nodule |
| 65 | 2841911363 | Bosea caraganae RCAM04685 | Isolate | Nodule |
| 66 | 2841917233 | Bosea caraganae RCAM04680 | Isolate | Nodule |
| 67 | 2841941048 | Bradyrhizobium sp. SBR1B | Isolate | Nodule |
| 68 | 2841949485 | Bradyrhizobium sp. ERR14 | Isolate | Nodule |
| 69 | 2841957949 | Bradyrhizobium sp. CIR1 | Isolate | Nodule |
| 70 | 2841966195 | Bradyrhizobium sp. CIR18 | Isolate | Nodule |
| 71 | 2841974524 | Bradyrhizobium sp. CIR48 | Isolate | Nodule |
| 72 | 2841983080 | Bradyrhizobium sp. IAR9 | Isolate | Nodule |
| 73 | 2842038055 | Bradyrhizobium centrosematis SEMIA 424 | Isolate | Nodule |
| 74 | 2842045827 | Bradyrhizobium centrosematis SEMIA 431 | Isolate | Nodule |
| 75 | 2844104063 | Bosea sp. Tri-39 | Isolate | Nodule |
| 76 | 2844315083 | Bradyrhizobium guangzhouense CCBAU 51670 | Isolate | Unclassified |
| 77 | 2847930680 | Bradyrhizobium zhanjiangense CCBAU 51778 | Isolate | Unclassified |
| 78 | 2847939898 | Bradyrhizobium ottawaense OO99 | Isolate | Unclassified |
| 79 | 2849076700 | Bradyrhizobium symbiodeficiens 85S1MB | Isolate | Nodule |
| 80 | 2851246043 | Bosea sp. Tri-54 | Isolate | Nodule |
| 81 | 2857509624 | Bradyrhizobium sp. R-73088 | Isolate | Unclassified |
| 82 | 2874590934 | Bradyrhizobium canariense UBMA181 | Isolate | Nodule |
| 83 | 2874612657 | Bradyrhizobium forestalis INPA54B | Isolate | Nodule |
| 84 | 2874620515 | Bradyrhizobium nanningense CCBAU 53390 | Isolate | Unclassified |
| 85 | 2874628541 | Bradyrhizobium betae Opo-243 | Isolate | Unclassified |
| 86 | 2874645413 | Bradyrhizobium canariense UBMA122 | Isolate | Nodule |
| 87 | 2876761206 | Bradyrhizobium centrolobii BR 10245 | Isolate | Nodule |
| 88 | 2876771140 | Bradyrhizobium canariense UBMA192 | Isolate | Nodule |
| 89 | 2876808645 | Bradyrhizobium algeriense RST89 | Isolate | Unclassified |
| 90 | 2876818435 | Bradyrhizobium canariense UBMA195 | Isolate | Nodule |
| 91 | 2879074833 | Bradyrhizobium canariense UBMA171 | Isolate | Nodule |
| 92 | 2879083081 | Bradyrhizobium zhanjiangense CCBAU 51787 | Isolate | Unclassified |
| 93 | 2879099564 | Bradyrhizobium japonicum UBMA197 | Isolate | Nodule |
| 94 | 2879110137 | Bradyrhizobium algeriense RST91 | Isolate | Nodule |
| 95 | 2879127579 | Bradyrhizobium canariense UBMA052 | Isolate | Nodule |
| 96 | 2879142872 | Bradyrhizobium canariense UBMA061 | Isolate | Nodule |
| 97 | 2881364244 | Bradyrhizobium sp. RP6 | Isolate | Unclassified |
| 98 | 2881665667 | Bradyrhizobium vignae LMG 28791 | Isolate | Unclassified |
| 99 | 2882456835 | Microvirga sp. KLBC 81 | Isolate | Unclassified |
| 100 | 2885366525 | Bradyrhizobium sp. LVM 105 | Isolate | Unclassified |
| 101 | 2885374607 | Bradyrhizobium sp. NAS96.2 | Isolate | Unclassified |
| 102 | 2885383462 | Bradyrhizobium sp. Leo170 | Isolate | Unclassified |
| 103 | 2885409591 | Bradyrhizobium sp. NAS80.1 | Isolate | Unclassified |
| 104 | 2888378607 | Bradyrhizobium sp. LCT2 | Isolate | Unclassified |
| 105 | 2888419890 | Bradyrhizobium sp. 1(2017) 63S1MB | Isolate | Unclassified |
| 106 | 2891088606 | Methylosinus sp. 3S-1 | Isolate | Rhizosphere |
| 107 | 2894232714 | Microvirga tunisiensis Lmie10 | Isolate | Nodule |
| 108 | 2903727486 | Bradyrhizobium guangzhouense CCBAU 53424 | Isolate | Unclassified |
| 109 | 2903748898 | Bradyrhizobium uaiense UFLA 03-164 | Isolate | Nodule |
| 110 | 2903768456 | Bradyrhizobium sp. Leo121 | Isolate | Unclassified |
| 111 | 2904666416 | Bradyrhizobium nanningense CCBAU 51757 | Isolate | Unclassified |
| 112 | 2904699407 | |||
| 113 | 2904711408 | Bradyrhizobium sp. USDA 3456 | Isolate | Unclassified |
| 114 | 2906602504 | Bradyrhizobium guangzhouense CCBAU 53426 | Isolate | Unclassified |
| 115 | 2906610324 | |||
| 116 | 2906635258 | Bradyrhizobium sp. USDA 3458 | Isolate | Unclassified |
| 117 | 2906643746 | Bradyrhizobium genosp. SA-3 Rp7b | Isolate | Unclassified |
| 118 | 2906660503 | Bradyrhizobium brasilense UFLA 03-321 | Isolate | Unclassified |
| 119 | 2908739725 | Bradyrhizobium sp. UFLA03-84 | Isolate | Nodule |
| 120 | 2908775508 | Bradyrhizobium sp. SUTN9-2 | Isolate | Unclassified |
| 121 | 2909042592 | Labrys sp. LIt4 | Isolate | Nodule |
| 122 | 2922361189 | Bradyrhizobium australiense WSM 1791 | Isolate | Nodule |
| 123 | 2922368715 | |||
| 124 | 2922386360 | Bradyrhizobium archetypum WSM 1744 | Isolate | Nodule |
| 125 | 2922393267 | Bradyrhizobium sp. WBAH10 | Isolate | Nodule |
| 126 | 2922425934 | |||
| 127 | 2929615660 | Bradyrhizobium japonicum TXVA | Isolate | Nodule |
| 128 | 2929624759 | Bradyrhizobium japonicum TXEA | Isolate | Nodule |
| 129 | 2932784394 | Bradyrhizobium sp. S3.2.12 | Isolate | Nodule |
| 130 | 2932794094 | Bradyrhizobium sp. S3.2.6 | Isolate | Nodule |
| 131 | 2932801729 | Bradyrhizobium sp. S3.3.6 | Isolate | Nodule |
| 132 | 2932809354 | Bradyrhizobium sp. S3.5.5 | Isolate | Nodule |
| 133 | 2932818245 | Bradyrhizobium sp. S3.9.1 | Isolate | Nodule |
| 134 | 2932828146 | Bradyrhizobium sp. S3.9.2 | Isolate | Nodule |
| 135 | 2933577622 | Bradyrhizobium japonicum SEMIA 417 | Isolate | Nodule |
| 136 | 2935608549 | Bradyrhizobium sp. RT6a | Isolate | Nodule |
| 137 | 2935616580 | Bradyrhizobium sp. RT7a | Isolate | Nodule |
| 138 | 2935630451 | Bradyrhizobium sp. I1.14.4 | Isolate | Nodule |
| 139 | 2935638405 | Bradyrhizobium sp. JR19.8 | Isolate | Nodule |
| 140 | 2935648319 | Bradyrhizobium sp. JR4.3 | Isolate | Nodule |
| 141 | 2935656913 | Bradyrhizobium sp. JR5.3 | Isolate | Nodule |
| 142 | 2935665750 | Bradyrhizobium sp. JR7.2 | Isolate | Nodule |
| 143 | 2935675223 | Bradyrhizobium sp. LA2.1 | Isolate | Nodule |
| 144 | 2935684952 | Bradyrhizobium sp. LA3.X | Isolate | Nodule |
| 145 | 2935694250 | Bradyrhizobium sp. LA6.1 | Isolate | Nodule |
| 146 | 2935703347 | Bradyrhizobium sp. LA6.10 | Isolate | Nodule |
| 147 | 2935713505 | Bradyrhizobium sp. LA6.12 | Isolate | Nodule |
| 148 | 2935722832 | Bradyrhizobium sp. LA6.3 | Isolate | Nodule |
| 149 | 2935732158 | Bradyrhizobium sp. LA6.4 | Isolate | Nodule |
| 150 | 2935741537 | Bradyrhizobium sp. LA6.7 | Isolate | Nodule |
| 151 | 2935750917 | Bradyrhizobium sp. LA6.8 | Isolate | Nodule |
| 152 | 2935760218 | Bradyrhizobium sp. LA7.1 | Isolate | Nodule |
| 153 | 2935769743 | Bradyrhizobium sp. LB12.1 | Isolate | Nodule |
| 154 | 2935777560 | Bradyrhizobium sp. LB14.3 | Isolate | Nodule |
| 155 | 2935785616 | Bradyrhizobium sp. LB5.2 | Isolate | Nodule |
| 156 | 2935793552 | Bradyrhizobium sp. LB8.2 | Isolate | Nodule |
| 157 | 2935801545 | Bradyrhizobium sp. RT10b | Isolate | Nodule |
| 158 | 2935810662 | Bradyrhizobium sp. RT3a | Isolate | Nodule |
| 159 | 2935819856 | Bradyrhizobium sp. RT3b | Isolate | Nodule |
| 160 | 2935827899 | Bradyrhizobium sp. RT4a | Isolate | Nodule |
| 161 | 2935837841 | Bradyrhizobium sp. RT4b | Isolate | Nodule |
| 162 | 2935847175 | Bradyrhizobium sp. RT5a | Isolate | Nodule |
| 163 | 2935855204 | Bradyrhizobium sp. RT7b | Isolate | Nodule |
| 164 | 2935864058 | Bradyrhizobium sp. RT9a | Isolate | Nodule |
| 165 | 2935873716 | Bradyrhizobium sp. RT9b | Isolate | Nodule |
| 166 | 2935883170 | Bradyrhizobium sp. S3.12.5 | Isolate | Nodule |
| 167 | 2935908558 | Bradyrhizobium sp. F1.1.1 | Isolate | Nodule |
| 168 | 2935916978 | Bradyrhizobium sp. F1.13.3 | Isolate | Nodule |
| 169 | 2935926038 | Bradyrhizobium sp. F1.2.1 | Isolate | Nodule |
| 170 | 2935934488 | Bradyrhizobium sp. F1.2.2 | Isolate | Nodule |
| 171 | 2935942939 | Bradyrhizobium sp. F1.2.6 | Isolate | Nodule |
| 172 | 2935951376 | Bradyrhizobium sp. F1.2.8 | Isolate | Nodule |
| 173 | 2935959822 | Bradyrhizobium sp. F1.4.3 | Isolate | Nodule |
| 174 | 2935967501 | Bradyrhizobium sp. F1.6.2 | Isolate | Nodule |
| 175 | 2935975950 | Bradyrhizobium sp. GM2.2 | Isolate | Nodule |
| 176 | 2935984226 | Bradyrhizobium sp. i1.15.2 | Isolate | Nodule |
| 177 | 2935992306 | Bradyrhizobium sp. I1.7.5 | Isolate | Nodule |
| 178 | 2936002035 | Bradyrhizobium sp. I1.8.5 | Isolate | Nodule |
| 179 | 2936011229 | Bradyrhizobium sp. JR1.1 | Isolate | Nodule |
| 180 | 2936019824 | Bradyrhizobium sp. JR1.5 | Isolate | Nodule |
| 181 | 2936028420 | Bradyrhizobium sp. JR1.7 | Isolate | Nodule |
| 182 | 2936037263 | Bradyrhizobium sp. JR18.2 | Isolate | Nodule |
| 183 | 2936046547 | Bradyrhizobium sp. JR3.12 | Isolate | Nodule |
| 184 | 2936055302 | Bradyrhizobium sp. JR4.1 | Isolate | Nodule |
| 185 | 2940556831 | Bradyrhizobium sp. LA8.1 | Isolate | Nodule |
| 186 | 2941507105 | Bradyrhizobium sp. i1.12.3 | Isolate | Nodule |
| 187 | 2941515067 | Bradyrhizobium sp. i1.14.1 | Isolate | Nodule |
| 188 | 2941523033 | Bradyrhizobium sp. i1.8.4 | Isolate | Nodule |
| 189 | 2941531003 | Bradyrhizobium sp. LB11.1 | Isolate | Nodule |
| 190 | 2941538514 | Bradyrhizobium sp. RT11b | Isolate | Nodule |
| 191 | 3003665799 | Methylobacterium aquaticum BG2 | Isolate | Unclassified |
| 192 | 3005474847 | Bradyrhizobium sp. CCBAU 53421 | Isolate | Nodule |
| 193 | 3005483717 | Bradyrhizobium agreste CNPSo 4010 | Isolate | Unclassified |
| 194 | 3005506211 | Bradyrhizobium diazoefficiens SZCCT0449 | Isolate | Unclassified |
| 195 | 3005587118 | Bradyrhizobium glycinis CNPSo 4016 | Isolate | Unclassified |
| 196 | 3005594810 | Bradyrhizobium sp. CCBAU 53340 | Isolate | Nodule |
| 197 | 3005710791 | Bradyrhizobium genosp. B BDV5040 | Isolate | Unclassified |
| 198 | 3005718088 | Bradyrhizobium sp. CCBAU 53338 | Isolate | Nodule |
| 199 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 200 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 201 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 202 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 203 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 204 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 205 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 206 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 207 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 208 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 209 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 210 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 211 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 212 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 213 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 214 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 215 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 216 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 217 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 218 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 219 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 220 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 221 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 222 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 223 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 224 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 225 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 226 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 227 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 228 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 229 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 230 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 231 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 232 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 233 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 234 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 235 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 236 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 237 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 238 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 239 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 240 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 241 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 242 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 243 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 244 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 245 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 246 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 247 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 248 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 249 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 250 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 251 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 252 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 253 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 254 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 255 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 256 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 257 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 258 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 259 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 260 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 261 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 262 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 263 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 264 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 265 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 266 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 267 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 268 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 269 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 270 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 271 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 272 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 273 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 274 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 275 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 276 | 3300013250 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 | Metagenome | Rhizosphere |
| 277 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 278 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 279 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 280 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 281 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 282 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 283 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 284 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 285 | 3300021320 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 | Metagenome | Nodule |
| 286 | 3300021321 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 | Metagenome | Nodule |
| 287 | 3300021324 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 | Metagenome | Nodule |
| 288 | 3300021327 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 | Metagenome | Nodule |
| 289 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 290 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 291 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 292 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 293 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 294 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 295 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 296 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 297 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 298 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 299 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 300 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 301 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 302 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 303 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 304 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 305 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 306 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 307 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 308 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 309 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 310 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 311 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 312 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 313 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 314 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 315 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 316 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 317 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 318 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 319 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 320 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 321 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 322 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 323 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 324 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 325 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 326 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 327 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 328 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 329 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 330 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 331 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 332 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 333 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 334 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 335 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 336 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 337 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 338 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 339 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 340 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 341 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 342 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 343 | 3300027357 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 344 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 345 | 3300027363 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 346 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 347 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 348 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 349 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 350 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 351 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 352 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 353 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 354 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 355 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 356 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 357 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 358 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 359 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 360 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 361 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 362 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 363 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 364 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 365 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 366 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 367 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 368 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 369 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 370 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 371 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 372 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 373 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 374 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 375 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 376 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 377 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 378 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 379 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 380 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 381 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 382 | 3300036242 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRI5 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 383 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 384 | 3300036534 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRU5 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 385 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 386 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 387 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 388 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 389 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 390 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 391 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 392 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 393 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 394 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 395 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 396 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 397 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 398 | 3300041492 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG | Metagenome | Unclassified |
| 399 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 400 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 401 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 402 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 403 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 404 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 405 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 406 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 407 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 408 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 409 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 410 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 411 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 412 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 413 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 414 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 415 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 416 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 417 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 418 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 419 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 420 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 421 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 422 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 423 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 424 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 425 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 426 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 427 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 428 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 429 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 430 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 431 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 432 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 433 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 434 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 435 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 436 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 437 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 438 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 439 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 440 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 441 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 442 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 443 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 444 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 445 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 446 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 447 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 448 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 449 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 450 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 451 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 452 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 453 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 454 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 455 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 456 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 457 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 458 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 459 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 460 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 461 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 462 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 463 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 464 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 465 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 466 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 467 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 468 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 469 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 470 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 471 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 472 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 473 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 474 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 475 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 476 | 3300049529 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 477 | 3300049533 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 478 | 3300049534 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 479 | 3300049541 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 480 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 481 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 482 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 483 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 484 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 485 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 486 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 487 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 488 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 489 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 490 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 491 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 492 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 493 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 494 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 495 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 496 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 497 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 498 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 499 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 500 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 501 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 502 | 3300049671 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought | Metagenome | Rhizosphere |
| 503 | 3300049680 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought | Metagenome | Rhizosphere |
| 504 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 505 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 506 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 507 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 508 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 509 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 510 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 511 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 512 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 513 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 514 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 515 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 516 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 517 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 518 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 519 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 520 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 521 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 522 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 523 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 524 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 525 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 526 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 527 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 528 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 529 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 530 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 531 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 532 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 533 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 534 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 535 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 536 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 537 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 538 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 539 | 3300053105 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere | Metagenome | Endosphere |
| 540 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 541 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 542 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 543 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 544 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 545 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 546 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 547 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 548 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 549 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 550 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 551 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 552 | 3300053147 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere | Metagenome | Endosphere |
| 553 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 554 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 555 | 3300053159 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere | Metagenome | Endosphere |
| 556 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 557 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 558 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 559 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 560 | 3300053729 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere | Metagenome | Endosphere |
| 561 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 562 | 3300053731 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere | Metagenome | Endosphere |
| 563 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 564 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 565 | 3300059639 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 566 | 3300059641 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 567 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 568 | 641522639 | Methylobacterium sp. 4-46 | Isolate | Nodule |
| 569 | 643348564 | Methylobacterium nodulans ORS 2060 | Isolate | Nodule |
| 570 | 8006926726 | Bradyrhizobium guangdongense SM32 | Isolate | Unclassified |
| 571 | 8006933436 | Bradyrhizobium septentrionale 7(2017) | Isolate | Unclassified |
| 572 | 8006973647 | Bradyrhizobium septentrionale 162S2 | Isolate | Nodule |
| 573 | 8016511872 | Bradyrhizobium sp. S3.14.4 | Isolate | Nodule |
| 574 | 8016522445 | Bradyrhizobium sp. LM6.9 | Isolate | Nodule |
| 575 | 8016530956 | Bradyrhizobium sp. LM6.11 | Isolate | Nodule |
| 576 | 8016548790 | Bradyrhizobium sp. LM3.6 | Isolate | Nodule |
| 577 | 8016557553 | Bradyrhizobium sp. LM3.4 | Isolate | Nodule |
| 578 | 8016566248 | Bradyrhizobium sp. LM3.2 | Isolate | Nodule |
| 579 | 8016575299 | Bradyrhizobium sp. LM2.9 | Isolate | Nodule |
| 580 | 8016595262 | Bradyrhizobium sp. LM2.3 | Isolate | Nodule |
| 581 | 8016603502 | Bradyrhizobium sp. LB7.2 | Isolate | Nodule |
| 582 | 8016613128 | Bradyrhizobium sp. LB7.1 | Isolate | Nodule |
| 583 | 8016622563 | Bradyrhizobium sp. LB13.1 | Isolate | Nodule |
| 584 | 8016630954 | Bradyrhizobium sp. F1.13.1 | Isolate | Nodule |
| 585 | 8017057580 | Bradyrhizobium sp. S3.7.6 | Isolate | Nodule |
| 586 | 8019530166 | Bradyrhizobium sp. LM4.3 | Isolate | Nodule |
| 587 | 8019538911 | Bradyrhizobium sp. LB9.1b | Isolate | Nodule |
| 588 | 8019547302 | Bradyrhizobium sp. LB1.3 | Isolate | Nodule |
| 589 | 8019555841 | Bradyrhizobium sp. JR6.1 | Isolate | Nodule |
| 590 | 8019565922 | Bradyrhizobium sp. JR3.5 | Isolate | Nodule |
| 591 | 8019576017 | Bradyrhizobium sp. i1.7.7 | Isolate | Nodule |
| 592 | 8019586578 | Bradyrhizobium sp. i1.4.4 | Isolate | Nodule |
| 593 | 8019597564 | Bradyrhizobium sp. i1.3.6 | Isolate | Nodule |
| 594 | 8019608314 | Bradyrhizobium sp. i1.3.1 | Isolate | Nodule |
| 595 | 8019619141 | Bradyrhizobium sp. GM7.3 | Isolate | Nodule |
| 596 | 8019629233 | Bradyrhizobium sp. GM6.1 | Isolate | Nodule |
| 597 | 8019648815 | Bradyrhizobium sp. GM24.11 | Isolate | Nodule |
| 598 | 8019659431 | Bradyrhizobium sp. GM22.5 | Isolate | Nodule |
| 599 | 8019668869 | Bradyrhizobium sp. GM2.4 | Isolate | Nodule |
| 600 | 8019678201 | Bradyrhizobium sp. GM0.4 | Isolate | Nodule |
| 601 | 8019687851 | Bradyrhizobium sp. F1.13.4 | Isolate | Nodule |
| 602 | 8055742211 | Bradyrhizobium japonicum 5038 | Isolate | Nodule |
| 603 | 8056673599 | Bradyrhizobium hereditatis WSM 1738 | Isolate | Nodule |
| 604 | 8056967851 | Bradyrhizobium zhengyangense WYCCWR 12678 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 72.88 |
| Metatranscriptomes | 1.34 |
| Isolates | 25.78 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 8.22 |
| Nodule | 19.67 |
| Rhizoplane | 2.67 |
| Rhizosphere | 57.89 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 11.56 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24740J21852_10006544 | 3300001979 | Bacteria | 4810 |
| 2 | JGI24737J22298_10118900 | 3300001990 | Bacteria | 781 |
| 3 | JGI24750J21931_1007518 | 3300002070 | Bacteria | 1372 |
| 4 | JGI25159J45721_1002156 | 3300002987 | Bacteria | 7670 |
| 5 | JGI25406J46586_10015420 | 3300003203 | Bacteria | 3223 |
| 6 | JGI25406J46586_10021918 | 3300003203 | Bacteria | 2556 |
| 7 | JGI25160J50197_1020177 | 3300003354 | Bacteria | 2020 |
| 8 | Ga0055539_1002956 | 3300003752 | Bacteria | 2458 |
| 9 | Ga0055524_1051299 | 3300003775 | Bacteria | 933 |
| 10 | Ga0055531_10011502 | 3300003794 | Bacteria | 4258 |
| 11 | Ga0065165_1003133 | 3300005262 | Bacteria | 12214 |
| 12 | Ga0065165_1042814 | 3300005262 | Bacteria | 1333 |
| 13 | Ga0070683_100126479 | 3300005329 | Bacteria | 2416 |
| 14 | Ga0070683_100390406 | 3300005329 | Bacteria | 1327 |
| 15 | Ga0070680_100062342 | 3300005336 | Bacteria | 3054 |
| 16 | Ga0070680_100272848 | 3300005336 | Bacteria | 1432 |
| 17 | Ga0070682_100179802 | 3300005337 | Bacteria | 1476 |
| 18 | Ga0070660_100406991 | 3300005339 | Bacteria | 1125 |
| 19 | Ga0070671_100118236 | 3300005355 | Bacteria | 2229 |
| 20 | Ga0070659_100058667 | 3300005366 | Bacteria | 3038 |
| 21 | Ga0070667_100609141 | 3300005367 | Bacteria | 1006 |
| 22 | Ga0070709_10212069 | 3300005434 | Bacteria | 1377 |
| 23 | Ga0070714_100019282 | 3300005435 | Bacteria | 5551 |
| 24 | Ga0070714_100288594 | 3300005435 | Bacteria | 1526 |
| 25 | Ga0070714_100389456 | 3300005435 | Bacteria | 1315 |
| 26 | Ga0070714_100998064 | 3300005435 | Bacteria | 815 |
| 27 | Ga0070713_100022916 | 3300005436 | Bacteria | 4834 |
| 28 | Ga0070713_100179069 | 3300005436 | Bacteria | 1904 |
| 29 | Ga0070713_100208085 | 3300005436 | Bacteria | 1770 |
| 30 | Ga0070710_10009691 | 3300005437 | Bacteria | 4719 |
| 31 | Ga0070710_10181230 | 3300005437 | Bacteria | 1319 |
| 32 | Ga0070710_10359796 | 3300005437 | Bacteria | 965 |
| 33 | Ga0070711_100010708 | 3300005439 | Bacteria | 5684 |
| 34 | Ga0070711_100239905 | 3300005439 | Bacteria | 1417 |
| 35 | Ga0070700_100064069 | 3300005441 | Bacteria | 2327 |
| 36 | Ga0070663_100317161 | 3300005455 | Bacteria | 1252 |
| 37 | Ga0070663_100505232 | 3300005455 | Bacteria | 1004 |
| 38 | Ga0070678_100049698 | 3300005456 | Bacteria | 3028 |
| 39 | Ga0070678_100675296 | 3300005456 | Bacteria | 929 |
| 40 | Ga0070662_100292697 | 3300005457 | Bacteria | 1320 |
| 41 | Ga0070681_10106321 | 3300005458 | Bacteria | 2747 |
| 42 | Ga0070681_10248241 | 3300005458 | Bacteria | 1692 |
| 43 | Ga0070698_100070102 | 3300005471 | Bacteria | 3518 |
| 44 | Ga0070679_100118983 | 3300005530 | Bacteria | 2626 |
| 45 | Ga0070679_100152926 | 3300005530 | Bacteria | 2283 |
| 46 | Ga0070684_100034836 | 3300005535 | Bacteria | 4306 |
| 47 | Ga0070684_100441902 | 3300005535 | Bacteria | 1202 |
| 48 | Ga0070684_100520861 | 3300005535 | Bacteria | 1102 |
| 49 | Ga0070684_100973905 | 3300005535 | Bacteria | 796 |
| 50 | Ga0068853_100241007 | 3300005539 | Bacteria | 1657 |
| 51 | Ga0068853_100793681 | 3300005539 | Bacteria | 906 |
| 52 | Ga0070695_100834418 | 3300005545 | Bacteria | 741 |
| 53 | Ga0070665_100103110 | 3300005548 | Bacteria | 2856 |
| 54 | Ga0070665_100111664 | 3300005548 | Bacteria | 2736 |
| 55 | Ga0068855_100190828 | 3300005563 | Bacteria | 2311 |
| 56 | Ga0068857_100320409 | 3300005577 | Bacteria | 1432 |
| 57 | Ga0068857_100639596 | 3300005577 | Bacteria | 1007 |
| 58 | Ga0068854_100409771 | 3300005578 | Bacteria | 1123 |
| 59 | Ga0068856_100021546 | 3300005614 | Bacteria | 6264 |
| 60 | Ga0068856_100142406 | 3300005614 | Bacteria | 2405 |
| 61 | Ga0068856_100252340 | 3300005614 | Bacteria | 1779 |
| 62 | Ga0068852_100015467 | 3300005616 | Bacteria | 5921 |
| 63 | Ga0068852_100421037 | 3300005616 | Bacteria | 1317 |
| 64 | Ga0068852_100817705 | 3300005616 | Bacteria | 946 |
| 65 | Ga0068859_100342391 | 3300005617 | Bacteria | 1589 |
| 66 | Ga0068851_10027996 | 3300005834 | Bacteria | 2781 |
| 67 | Ga0068863_100371526 | 3300005841 | Bacteria | 1395 |
| 68 | Ga0068858_100835176 | 3300005842 | Bacteria | 899 |
| 69 | Ga0081455_10198820 | 3300005937 | Bacteria | 1503 |
| 70 | Ga0081540_1007542 | 3300005983 | Bacteria | 7742 |
| 71 | Ga0081540_1061654 | 3300005983 | Bacteria | 1787 |
| 72 | Ga0081539_10000203 | 3300005985 | Bacteria | 138096 |
| 73 | Ga0081539_10169214 | 3300005985 | Bacteria | 1035 |
| 74 | Ga0070717_10012865 | 3300006028 | Bacteria | 6390 |
| 75 | Ga0070717_10185149 | 3300006028 | Bacteria | 1817 |
| 76 | Ga0070717_10627211 | 3300006028 | Bacteria | 975 |
| 77 | Ga0075365_10516565 | 3300006038 | Bacteria | 844 |
| 78 | Ga0075368_10159166 | 3300006042 | Bacteria | 945 |
| 79 | Ga0075364_10123850 | 3300006051 | Bacteria | 1732 |
| 80 | Ga0070715_10211023 | 3300006163 | Bacteria | 992 |
| 81 | Ga0070716_100311633 | 3300006173 | Bacteria | 1099 |
| 82 | Ga0070716_100766704 | 3300006173 | Bacteria | 744 |
| 83 | Ga0070712_100115865 | 3300006175 | Bacteria | 2009 |
| 84 | Ga0070712_100369396 | 3300006175 | Bacteria | 1178 |
| 85 | Ga0075362_10167455 | 3300006177 | Bacteria | 1060 |
| 86 | Ga0075367_10205354 | 3300006178 | Bacteria | 1231 |
| 87 | Ga0075367_10270532 | 3300006178 | Bacteria | 1067 |
| 88 | Ga0075369_10004408 | 3300006186 | Bacteria | 5199 |
| 89 | Ga0075366_10016242 | 3300006195 | Bacteria | 4276 |
| 90 | Ga0068871_100182392 | 3300006358 | Bacteria | 1804 |
| 91 | Ga0075428_100013627 | 3300006844 | Bacteria | 9053 |
| 92 | Ga0075431_100000592 | 3300006847 | Bacteria | 30592 |
| 93 | Ga0075434_100025679 | 3300006871 | Bacteria | 5765 |
| 94 | Ga0075429_100010041 | 3300006880 | Bacteria | 8205 |
| 95 | Ga0075429_100233566 | 3300006880 | Bacteria | 1611 |
| 96 | Ga0068865_100335350 | 3300006881 | Bacteria | 1221 |
| 97 | Ga0097620_100342402 | 3300006931 | Bacteria | 1589 |
| 98 | Ga0075435_100145714 | 3300007076 | Bacteria | 1989 |
| 99 | Ga0105250_10170109 | 3300009092 | Bacteria | 912 |
| 100 | Ga0105240_10085042 | 3300009093 | Bacteria | 3877 |
| 101 | Ga0105240_10099593 | 3300009093 | Bacteria | 3538 |
| 102 | Ga0105240_10159640 | 3300009093 | Bacteria | 2679 |
| 103 | Ga0105240_10228535 | 3300009093 | Bacteria | 2164 |
| 104 | Ga0105240_10331329 | 3300009093 | Bacteria | 1732 |
| 105 | Ga0105240_10971757 | 3300009093 | Bacteria | 910 |
| 106 | Ga0111539_10015685 | 3300009094 | Bacteria | 9418 |
| 107 | Ga0105245_10040292 | 3300009098 | Bacteria | 4160 |
| 108 | Ga0105245_10351257 | 3300009098 | Bacteria | 1461 |
| 109 | Ga0105247_10006535 | 3300009101 | Bacteria | 7216 |
| 110 | Ga0105247_10197537 | 3300009101 | Bacteria | 1350 |
| 111 | Ga0114129_10005303 | 3300009147 | Bacteria | 18192 |
| 112 | Ga0114129_10139148 | 3300009147 | Bacteria | 3329 |
| 113 | Ga0105241_10019195 | 3300009174 | Bacteria | 5041 |
| 114 | Ga0105241_10051229 | 3300009174 | Bacteria | 3148 |
| 115 | Ga0105242_10213039 | 3300009176 | Bacteria | 1723 |
| 116 | Ga0105248_10875106 | 3300009177 | Bacteria | 1014 |
| 117 | Ga0105248_10935588 | 3300009177 | Bacteria | 979 |
| 118 | Ga0105237_10066390 | 3300009545 | Bacteria | 3603 |
| 119 | Ga0105238_10002712 | 3300009551 | Bacteria | 17625 |
| 120 | Ga0105238_10067377 | 3300009551 | Bacteria | 3581 |
| 121 | Ga0105238_10434856 | 3300009551 | Bacteria | 1308 |
| 122 | Ga0105238_10446065 | 3300009551 | Bacteria | 1291 |
| 123 | Ga0105239_10061953 | 3300010375 | Bacteria | 4106 |
| 124 | Ga0105239_10083384 | 3300010375 | Bacteria | 3520 |
| 125 | Ga0105239_10318764 | 3300010375 | Bacteria | 1753 |
| 126 | Ga0105239_10689815 | 3300010375 | Bacteria | 1167 |
| 127 | Ga0157369_10598080 | 3300013105 | Bacteria | 1139 |
| 128 | Ga0171462_1060 | 3300013250 | Bacteria | 19065 |
| 129 | Ga0157374_10377197 | 3300013296 | Bacteria | 1412 |
| 130 | Ga0157378_10676116 | 3300013297 | Bacteria | 1050 |
| 131 | Ga0163162_10795937 | 3300013306 | Bacteria | 1063 |
| 132 | Ga0163163_10076994 | 3300014325 | Bacteria | 3331 |
| 133 | Ga0163163_10388037 | 3300014325 | Bacteria | 1454 |
| 134 | Ga0157380_10055924 | 3300014326 | Bacteria | 3136 |
| 135 | Ga0182008_10088388 | 3300014497 | Bacteria | 1526 |
| 136 | Ga0163161_10469409 | 3300017792 | Bacteria | 1020 |
| 137 | Ga0206353_10925790 | 3300020082 | Bacteria | 1109 |
| 138 | Ga0214544_1000006 | 3300021320 | Bacteria | 380728 |
| 139 | Ga0214542_1000002 | 3300021321 | Bacteria | 720798 |
| 140 | Ga0214542_1040182 | 3300021321 | Bacteria | 1212 |
| 141 | Ga0214545_1000002 | 3300021324 | Bacteria | 727485 |
| 142 | Ga0214543_1000017 | 3300021327 | Bacteria | 290109 |
| 143 | Ga0214543_1029778 | 3300021327 | Bacteria | 2388 |
| 144 | Ga0213872_10039595 | 3300021361 | Bacteria | 2151 |
| 145 | Ga0213874_10027443 | 3300021377 | Bacteria | 1619 |
| 146 | Ga0213874_10085869 | 3300021377 | Bacteria | 1026 |
| 147 | Ga0213876_10034449 | 3300021384 | Bacteria | 2670 |
| 148 | Ga0213875_10002415 | 3300021388 | Bacteria | 11225 |
| 149 | Ga0213875_10007252 | 3300021388 | Bacteria | 5748 |
| 150 | Ga0213875_10019916 | 3300021388 | Bacteria | 3223 |
| 151 | Ga0213875_10260502 | 3300021388 | Bacteria | 818 |
| 152 | Ga0213871_10011494 | 3300021441 | Bacteria | 2035 |
| 153 | Ga0224712_10048753 | 3300022467 | Bacteria | 1636 |
| 154 | Ga0224712_10072693 | 3300022467 | Bacteria | 1401 |
| 155 | Ga0224712_10135072 | 3300022467 | Bacteria | 1080 |
| 156 | Ga0207425_1025008 | 3300025245 | Bacteria | 1235 |
| 157 | Ga0209677_100683 | 3300025253 | Bacteria | 17403 |
| 158 | Ga0209148_1000448 | 3300025254 | Bacteria | 45242 |
| 159 | Ga0209233_1004485 | 3300025261 | Bacteria | 4737 |
| 160 | Ga0209233_1027410 | 3300025261 | Bacteria | 1380 |
| 161 | Ga0209673_1023321 | 3300025273 | Bacteria | 2110 |
| 162 | Ga0209130_1000845 | 3300025284 | Bacteria | 25573 |
| 163 | Ga0209758_1000065 | 3300025297 | Bacteria | 306288 |
| 164 | Ga0209256_1008959 | 3300025299 | Bacteria | 4497 |
| 165 | Ga0207426_1013929 | 3300025302 | Bacteria | 2963 |
| 166 | Ga0209051_1014715 | 3300025303 | Bacteria | 3635 |
| 167 | Ga0209257_1000869 | 3300025304 | Bacteria | 42897 |
| 168 | Ga0207692_10000967 | 3300025898 | Bacteria | 10455 |
| 169 | Ga0207692_10042273 | 3300025898 | Bacteria | 2261 |
| 170 | Ga0207710_10049330 | 3300025900 | Bacteria | 1886 |
| 171 | Ga0207688_10006338 | 3300025901 | Bacteria | 6438 |
| 172 | Ga0207688_10217127 | 3300025901 | Bacteria | 1151 |
| 173 | Ga0207685_10001288 | 3300025905 | Bacteria | 5140 |
| 174 | Ga0207699_10035466 | 3300025906 | Bacteria | 2838 |
| 175 | Ga0207699_10055499 | 3300025906 | Bacteria | 2357 |
| 176 | Ga0207705_10134492 | 3300025909 | Bacteria | 1842 |
| 177 | Ga0207705_10156695 | 3300025909 | Bacteria | 1709 |
| 178 | Ga0207684_10198787 | 3300025910 | Bacteria | 1729 |
| 179 | Ga0207654_10000241 | 3300025911 | Bacteria | 33087 |
| 180 | Ga0207695_10000159 | 3300025913 | Bacteria | 201367 |
| 181 | Ga0207695_10001032 | 3300025913 | Bacteria | 48974 |
| 182 | Ga0207695_10061566 | 3300025913 | Bacteria | 3878 |
| 183 | Ga0207695_10477455 | 3300025913 | Bacteria | 1129 |
| 184 | Ga0207671_10033318 | 3300025914 | Bacteria | 3833 |
| 185 | Ga0207693_10001370 | 3300025915 | Bacteria | 21582 |
| 186 | Ga0207693_10196555 | 3300025915 | Bacteria | 1586 |
| 187 | Ga0207693_10287595 | 3300025915 | Bacteria | 1288 |
| 188 | Ga0207663_10000401 | 3300025916 | Bacteria | 18748 |
| 189 | Ga0207663_10124238 | 3300025916 | Bacteria | 1772 |
| 190 | Ga0207663_10455768 | 3300025916 | Bacteria | 987 |
| 191 | Ga0207663_10776895 | 3300025916 | Bacteria | 762 |
| 192 | Ga0207660_10493856 | 3300025917 | Bacteria | 993 |
| 193 | Ga0207652_10088570 | 3300025921 | Bacteria | 2716 |
| 194 | Ga0207652_10090827 | 3300025921 | Bacteria | 2684 |
| 195 | Ga0207694_10000271 | 3300025924 | Bacteria | 49284 |
| 196 | Ga0207694_10004491 | 3300025924 | Bacteria | 10887 |
| 197 | Ga0207700_10136289 | 3300025928 | Bacteria | 2011 |
| 198 | Ga0207664_10006050 | 3300025929 | Bacteria | 8287 |
| 199 | Ga0207664_10114737 | 3300025929 | Bacteria | 2245 |
| 200 | Ga0207664_10483276 | 3300025929 | Bacteria | 1108 |
| 201 | Ga0207664_10643022 | 3300025929 | Bacteria | 953 |
| 202 | Ga0207669_10440745 | 3300025937 | Bacteria | 1030 |
| 203 | Ga0207665_10244713 | 3300025939 | Bacteria | 1323 |
| 204 | Ga0207665_10525581 | 3300025939 | Bacteria | 917 |
| 205 | Ga0207711_10493382 | 3300025941 | Bacteria | 1141 |
| 206 | Ga0207711_10563542 | 3300025941 | Bacteria | 1063 |
| 207 | Ga0207711_10610209 | 3300025941 | Bacteria | 1018 |
| 208 | Ga0207661_10302349 | 3300025944 | Bacteria | 1434 |
| 209 | Ga0207667_10005212 | 3300025949 | Bacteria | 15860 |
| 210 | Ga0207667_10663621 | 3300025949 | Bacteria | 1047 |
| 211 | Ga0207651_10363665 | 3300025960 | Bacteria | 1222 |
| 212 | Ga0207712_10336703 | 3300025961 | Bacteria | 1250 |
| 213 | Ga0207668_10245757 | 3300025972 | Bacteria | 1450 |
| 214 | Ga0207640_10558438 | 3300025981 | Bacteria | 963 |
| 215 | Ga0207658_10541401 | 3300025986 | Bacteria | 1041 |
| 216 | Ga0207677_10379819 | 3300026023 | Bacteria | 1192 |
| 217 | Ga0207639_10073925 | 3300026041 | Bacteria | 2674 |
| 218 | Ga0207678_10201143 | 3300026067 | Bacteria | 1703 |
| 219 | Ga0207678_10272069 | 3300026067 | Bacteria | 1453 |
| 220 | Ga0207708_10201318 | 3300026075 | Bacteria | 1589 |
| 221 | Ga0207702_10000005 | 3300026078 | Bacteria | 420296 |
| 222 | Ga0207641_10230932 | 3300026088 | Bacteria | 1719 |
| 223 | Ga0207648_10359249 | 3300026089 | Bacteria | 1314 |
| 224 | Ga0207675_100755057 | 3300026118 | Bacteria | 984 |
| 225 | Ga0207683_10055995 | 3300026121 | Bacteria | 3458 |
| 226 | Ga0207683_10169868 | 3300026121 | Bacteria | 1974 |
| 227 | Ga0207698_10037943 | 3300026142 | Bacteria | 3554 |
| 228 | Ga0207698_10732212 | 3300026142 | Bacteria | 986 |
| 229 | Ga0209589_1000300 | 3300027357 | Bacteria | 63625 |
| 230 | Ga0209489_100906 | 3300027361 | Bacteria | 59164 |
| 231 | Ga0209489_110266 | 3300027361 | Bacteria | 10728 |
| 232 | Ga0209700_100031 | 3300027363 | Bacteria | 207349 |
| 233 | Ga0207428_10018951 | 3300027907 | Bacteria | 5869 |
| 234 | Ga0268266_10021990 | 3300028379 | Bacteria | 5436 |
| 235 | Ga0268266_10452658 | 3300028379 | Bacteria | 1220 |
| 236 | Ga0265338_10076368 | 3300028800 | Bacteria | 2838 |
| 237 | Ga0265324_10139396 | 3300029957 | Bacteria | 824 |
| 238 | Ga0265332_10214210 | 3300031238 | Bacteria | 799 |
| 239 | Ga0265328_10052526 | 3300031239 | Bacteria | 1496 |
| 240 | Ga0265325_10034182 | 3300031241 | Bacteria | 2707 |
| 241 | Ga0265325_10198984 | 3300031241 | Bacteria | 925 |
| 242 | Ga0265340_10013890 | 3300031247 | Bacteria | 4219 |
| 243 | Ga0265340_10017672 | 3300031247 | Bacteria | 3689 |
| 244 | Ga0265340_10038726 | 3300031247 | Bacteria | 2356 |
| 245 | Ga0265340_10081614 | 3300031247 | Bacteria | 1522 |
| 246 | Ga0265340_10085171 | 3300031247 | Bacteria | 1483 |
| 247 | Ga0265340_10091474 | 3300031247 | Bacteria | 1421 |
| 248 | Ga0265339_10002960 | 3300031249 | Bacteria | 11993 |
| 249 | Ga0265339_10041867 | 3300031249 | Bacteria | 2539 |
| 250 | Ga0265339_10057698 | 3300031249 | Bacteria | 2098 |
| 251 | Ga0265339_10061098 | 3300031249 | Bacteria | 2029 |
| 252 | Ga0265316_10016971 | 3300031344 | Bacteria | 6303 |
| 253 | Ga0265316_10031977 | 3300031344 | Bacteria | 4299 |
| 254 | Ga0265316_10045654 | 3300031344 | Bacteria | 3477 |
| 255 | Ga0265316_10117099 | 3300031344 | Bacteria | 2014 |
| 256 | Ga0307408_100096057 | 3300031548 | Bacteria | 2247 |
| 257 | Ga0265313_10000031 | 3300031595 | Bacteria | 128981 |
| 258 | Ga0265313_10010610 | 3300031595 | Bacteria | 5803 |
| 259 | Ga0265313_10022279 | 3300031595 | Bacteria | 3441 |
| 260 | Ga0265313_10033193 | 3300031595 | Bacteria | 2627 |
| 261 | Ga0265314_10026660 | 3300031711 | Bacteria | 4338 |
| 262 | Ga0265342_10001389 | 3300031712 | Bacteria | 22637 |
| 263 | Ga0265342_10003512 | 3300031712 | Bacteria | 12823 |
| 264 | Ga0265342_10012909 | 3300031712 | Bacteria | 5633 |
| 265 | Ga0307405_10282490 | 3300031731 | Bacteria | 1250 |
| 266 | Ga0307406_10433396 | 3300031901 | Bacteria | 1050 |
| 267 | Ga0307409_100632209 | 3300031995 | Bacteria | 1062 |
| 268 | Ga0307416_100142164 | 3300032002 | Bacteria | 2183 |
| 269 | Ga0307414_10099306 | 3300032004 | Bacteria | 2187 |
| 270 | Ga0307415_100478750 | 3300032126 | Bacteria | 1083 |
| 271 | Ga0373926_0046832 | 3300035083 | Bacteria | 1552 |
| 272 | Ga0373934_0048159 | 3300035086 | Bacteria | 1687 |
| 273 | Ga0373934_0066027 | 3300035086 | Bacteria | 1445 |
| 274 | Ga0373934_0151654 | 3300035086 | Bacteria | 949 |
| 275 | Ga0373944_0060595 | 3300035089 | Bacteria | 1213 |
| 276 | Ga0373923_0021854 | 3300035111 | Bacteria | 2502 |
| 277 | Ga0373923_0058010 | 3300035111 | Bacteria | 1638 |
| 278 | Ga0373923_0066469 | 3300035111 | Bacteria | 1541 |
| 279 | Ga0373945_0005479 | 3300035116 | Bacteria | 4063 |
| 280 | Ga0373945_0196654 | 3300035116 | Bacteria | 836 |
| 281 | Ga0373953_0006359 | 3300035117 | Bacteria | 3888 |
| 282 | Ga0373953_0044823 | 3300035117 | Bacteria | 1770 |
| 283 | Ga0373954_0006466 | 3300035118 | Bacteria | 5110 |
| 284 | Ga0373954_0029002 | 3300035118 | Bacteria | 2547 |
| 285 | Ga0373956_0027033 | 3300035119 | Bacteria | 2488 |
| 286 | Ga0373956_0028773 | 3300035119 | Bacteria | 2419 |
| 287 | Ga0373943_0060393 | 3300035170 | Bacteria | 1892 |
| 288 | Ga0373946_0026250 | 3300035171 | Bacteria | 2296 |
| 289 | Ga0373946_0045597 | 3300035171 | Bacteria | 1814 |
| 290 | Ga0373946_0103214 | 3300035171 | Bacteria | 1281 |
| 291 | Ga0373955_0012485 | 3300035172 | Bacteria | 4081 |
| 292 | Ga0373955_0057248 | 3300035172 | Bacteria | 2141 |
| 293 | Ga0373955_0066607 | 3300035172 | Bacteria | 2002 |
| 294 | Ga0373924_0014546 | 3300035410 | Bacteria | 2976 |
| 295 | Ga0373924_0019884 | 3300035410 | Bacteria | 2605 |
| 296 | Ga0373924_0118827 | 3300035410 | Bacteria | 1146 |
| 297 | Ga0373924_0160535 | 3300035410 | Bacteria | 985 |
| 298 | Ga0373935_0140146 | 3300035692 | Bacteria | 1633 |
| 299 | Ga0373935_0263836 | 3300035692 | Bacteria | 1208 |
| 300 | Ga0373927_0026088 | 3300035695 | Bacteria | 3819 |
| 301 | Ga0373927_0044850 | 3300035695 | Bacteria | 2861 |
| 302 | Ga0373927_0122464 | 3300035695 | Bacteria | 1697 |
| 303 | Ga0373927_0308230 | 3300035695 | Bacteria | 1042 |
| 304 | Ga0373933_0115895 | 3300035724 | Bacteria | 1674 |
| 305 | Ga0373933_0187259 | 3300035724 | Bacteria | 1321 |
| 306 | Ga0373947_0064960 | 3300035725 | Bacteria | 2225 |
| 307 | Ga0373947_0089911 | 3300035725 | Bacteria | 1913 |
| 308 | Ga0373947_0124596 | 3300035725 | Bacteria | 1639 |
| 309 | Ga0373947_0258886 | 3300035725 | Bacteria | 1152 |
| 310 | Ga0310104_00647 | 3300036242 | Bacteria | 2428 |
| 311 | Ga0373937_0001523 | 3300036401 | Bacteria | 19489 |
| 312 | Ga0373937_0016054 | 3300036401 | Bacteria | 6642 |
| 313 | Ga0373937_0061550 | 3300036401 | Bacteria | 3450 |
| 314 | Ga0373937_0079421 | 3300036401 | Bacteria | 3032 |
| 315 | Ga0373937_0094576 | 3300036401 | Bacteria | 2771 |
| 316 | Ga0373937_0262392 | 3300036401 | Bacteria | 1629 |
| 317 | Ga0373937_0293715 | 3300036401 | Bacteria | 1535 |
| 318 | Ga0373937_0309676 | 3300036401 | Bacteria | 1493 |
| 319 | Ga0310109_018735 | 3300036534 | Bacteria | 935 |
| 320 | Ga0373925_0010512 | 3300037068 | Bacteria | 6713 |
| 321 | Ga0373925_0060509 | 3300037068 | Bacteria | 2844 |
| 322 | Ga0373925_0091251 | 3300037068 | Bacteria | 2329 |
| 323 | Ga0395899_0273410 | 3300037312 | Bacteria | 1152 |
| 324 | Ga0395900_0143765 | 3300037418 | Bacteria | 2441 |
| 325 | Ga0395898_0320231 | 3300037466 | Bacteria | 1479 |
| 326 | Ga0395905_0025407 | 3300037471 | Bacteria | 5586 |
| 327 | Ga0395905_0077411 | 3300037471 | Bacteria | 3116 |
| 328 | Ga0395905_0090669 | 3300037471 | Bacteria | 2866 |
| 329 | Ga0436364_0037967 | 3300037853 | Bacteria | 6863 |
| 330 | Ga0436364_0151877 | 3300037853 | Bacteria | 3990 |
| 331 | Ga0436364_0222612 | 3300037853 | Bacteria | 4790 |
| 332 | Ga0436364_0543555 | 3300037853 | Bacteria | 3883 |
| 333 | Ga0436364_0710968 | 3300037853 | Bacteria | 4599 |
| 334 | Ga0436364_0729660 | 3300037853 | Bacteria | 2883 |
| 335 | Ga0436364_0785067 | 3300037853 | Bacteria | 1112 |
| 336 | Ga0395901_0104618 | 3300038443 | Bacteria | 2971 |
| 337 | Ga0395901_0198481 | 3300038443 | Bacteria | 2103 |
| 338 | Ga0395901_0337694 | 3300038443 | Bacteria | 1557 |
| 339 | Ga0436365_0019378 | 3300039437 | Bacteria | 3597 |
| 340 | Ga0436365_0601503 | 3300039437 | Bacteria | 1206 |
| 341 | Ga0436365_1173928 | 3300039437 | Bacteria | 1740 |
| 342 | Ga0436365_1218945 | 3300039437 | Bacteria | 1041 |
| 343 | Ga0436365_1478091 | 3300039437 | Bacteria | 2026 |
| 344 | Ga0436365_1531521 | 3300039437 | Bacteria | 1107 |
| 345 | Ga0436360_0755908 | 3300039438 | Bacteria | 793 |
| 346 | Ga0436360_1136386 | 3300039438 | Bacteria | 5017 |
| 347 | Ga0436361_0034599 | 3300039447 | Bacteria | 3889 |
| 348 | Ga0436361_0256683 | 3300039447 | Bacteria | 5675 |
| 349 | Ga0436361_0401767 | 3300039447 | Bacteria | 3344 |
| 350 | Ga0436363_0691096 | 3300039450 | Bacteria | 825 |
| 351 | Ga0436363_1149677 | 3300039450 | Bacteria | 2022 |
| 352 | Ga0436363_1616347 | 3300039450 | Bacteria | 2205 |
| 353 | Ga0436362_0294583 | 3300039453 | Bacteria | 953 |
| 354 | Ga0436362_0501267 | 3300039453 | Bacteria | 748 |
| 355 | Ga0451793_0379144 | 3300041452 | Bacteria | 1152 |
| 356 | Ga0451835_1046652 | 3300041492 | Bacteria | 838 |
| 357 | Ga0466969_0012702 | 3300044656 | Bacteria | 4437 |
| 358 | Ga0466965_0012547 | 3300044683 | Bacteria | 3987 |
| 359 | Ga0466965_0150110 | 3300044683 | Bacteria | 1218 |
| 360 | Ga0466966_0006998 | 3300044684 | Bacteria | 7469 |
| 361 | Ga0466961_0001042 | 3300044693 | Bacteria | 17076 |
| 362 | Ga0466963_0275149 | 3300044694 | Bacteria | 1183 |
| 363 | Ga0453684_0017854 | 3300044712 | Bacteria | 10949 |
| 364 | Ga0466960_0066674 | 3300044901 | Bacteria | 1781 |
| 365 | Ga0466960_0136510 | 3300044901 | Bacteria | 1299 |
| 366 | Ga0466959_0037237 | 3300045049 | Bacteria | 3594 |
| 367 | Ga0451576_0027584 | 3300045051 | Bacteria | 6097 |
| 368 | Ga0466967_0302098 | 3300045976 | Bacteria | 1540 |
| 369 | Ga0466967_0316952 | 3300045976 | Bacteria | 1503 |
| 370 | Ga0466967_0328941 | 3300045976 | Bacteria | 1475 |
| 371 | Ga0466967_0579619 | 3300045976 | Bacteria | 1106 |
| 372 | Ga0495592_0062965 | 3300046454 | Bacteria | 2721 |
| 373 | Ga0495592_0180668 | 3300046454 | Bacteria | 1437 |
| 374 | Ga0495629_0277038 | 3300046459 | Bacteria | 1152 |
| 375 | Ga0495651_0006487 | 3300046462 | Bacteria | 8943 |
| 376 | Ga0495651_0113460 | 3300046462 | Bacteria | 2000 |
| 377 | Ga0495651_0227101 | 3300046462 | Bacteria | 1288 |
| 378 | Ga0495580_0082513 | 3300046472 | Bacteria | 2240 |
| 379 | Ga0495639_0015064 | 3300046475 | Bacteria | 3352 |
| 380 | Ga0495639_0087237 | 3300046475 | Bacteria | 1460 |
| 381 | Ga0495662_0094943 | 3300046476 | Bacteria | 1457 |
| 382 | Ga0495664_0004097 | 3300046477 | Bacteria | 7956 |
| 383 | Ga0495664_0049176 | 3300046477 | Bacteria | 2503 |
| 384 | Ga0495664_0114614 | 3300046477 | Bacteria | 1628 |
| 385 | Ga0495664_0201628 | 3300046477 | Bacteria | 1205 |
| 386 | Ga0495594_0170758 | 3300046499 | Bacteria | 1237 |
| 387 | Ga0495606_0058293 | 3300046507 | Bacteria | 2482 |
| 388 | Ga0495608_0032272 | 3300046511 | Bacteria | 3540 |
| 389 | Ga0495608_0104518 | 3300046511 | Bacteria | 1824 |
| 390 | Ga0495608_0195792 | 3300046511 | Bacteria | 1275 |
| 391 | Ga0495608_0246995 | 3300046511 | Bacteria | 1113 |
| 392 | Ga0495618_0135034 | 3300046514 | Bacteria | 1578 |
| 393 | Ga0495618_0219611 | 3300046514 | Bacteria | 1199 |
| 394 | Ga0495628_0031219 | 3300046516 | Bacteria | 4309 |
| 395 | Ga0495628_0150744 | 3300046516 | Bacteria | 1771 |
| 396 | Ga0495628_0321290 | 3300046516 | Bacteria | 1142 |
| 397 | Ga0495628_0505334 | 3300046516 | Bacteria | 872 |
| 398 | Ga0495630_0054203 | 3300046517 | Bacteria | 3004 |
| 399 | Ga0495630_0283867 | 3300046517 | Bacteria | 1265 |
| 400 | Ga0495643_0005458 | 3300046522 | Bacteria | 8599 |
| 401 | Ga0495648_0001345 | 3300046524 | Bacteria | 24267 |
| 402 | Ga0495652_0116807 | 3300046529 | Bacteria | 2135 |
| 403 | Ga0495652_0144241 | 3300046529 | Bacteria | 1869 |
| 404 | Ga0495652_0352173 | 3300046529 | Bacteria | 1054 |
| 405 | Ga0495665_0095569 | 3300046531 | Bacteria | 1560 |
| 406 | Ga0495640_0107065 | 3300046533 | Bacteria | 1830 |
| 407 | Ga0495587_0019372 | 3300046536 | Bacteria | 4212 |
| 408 | Ga0495587_0022854 | 3300046536 | Bacteria | 3847 |
| 409 | Ga0495587_0176734 | 3300046536 | Bacteria | 1211 |
| 410 | Ga0495645_0016837 | 3300046543 | Bacteria | 5232 |
| 411 | Ga0495645_0021952 | 3300046543 | Bacteria | 4616 |
| 412 | Ga0495645_0215482 | 3300046543 | Bacteria | 1294 |
| 413 | Ga0495622_0132102 | 3300046557 | Bacteria | 1136 |
| 414 | Ga0495667_0008834 | 3300046559 | Bacteria | 6851 |
| 415 | Ga0495667_0028353 | 3300046559 | Bacteria | 3770 |
| 416 | Ga0495667_0127056 | 3300046559 | Bacteria | 1645 |
| 417 | Ga0495634_0446621 | 3300046642 | Bacteria | 763 |
| 418 | Ga0495635_0019579 | 3300046663 | Bacteria | 4716 |
| 419 | Ga0495635_0058716 | 3300046663 | Bacteria | 2646 |
| 420 | Ga0495635_0066384 | 3300046663 | Bacteria | 2474 |
| 421 | Ga0495635_0093737 | 3300046663 | Bacteria | 2053 |
| 422 | Ga0495661_0073375 | 3300046665 | Bacteria | 1994 |
| 423 | Ga0495588_0025384 | 3300046674 | Bacteria | 2952 |
| 424 | Ga0495588_0039030 | 3300046674 | Bacteria | 2418 |
| 425 | Ga0495588_0383607 | 3300046674 | Bacteria | 738 |
| 426 | Ga0495657_0006873 | 3300046675 | Bacteria | 8842 |
| 427 | Ga0495657_0010777 | 3300046675 | Bacteria | 6867 |
| 428 | Ga0495599_0286071 | 3300046678 | Bacteria | 997 |
| 429 | Ga0495623_0198251 | 3300046679 | Bacteria | 1155 |
| 430 | Ga0495646_0042905 | 3300046680 | Bacteria | 2774 |
| 431 | Ga0495646_0087678 | 3300046680 | Bacteria | 1803 |
| 432 | Ga0495613_0261537 | 3300046689 | Bacteria | 1205 |
| 433 | Ga0495624_0116424 | 3300046690 | Bacteria | 1642 |
| 434 | Ga0495671_0125023 | 3300046692 | Bacteria | 1254 |
| 435 | Ga0495600_0245595 | 3300046809 | Bacteria | 1139 |
| 436 | Ga0495604_0018557 | 3300047317 | Bacteria | 5573 |
| 437 | Ga0495604_0083680 | 3300047317 | Bacteria | 2383 |
| 438 | Ga0495604_0143675 | 3300047317 | Bacteria | 1702 |
| 439 | Ga0495674_0010957 | 3300047319 | Bacteria | 8565 |
| 440 | Ga0495674_0030102 | 3300047319 | Bacteria | 4939 |
| 441 | Ga0495674_0101947 | 3300047319 | Bacteria | 2441 |
| 442 | Ga0495676_0086785 | 3300047321 | Bacteria | 2353 |
| 443 | Ga0495676_0100978 | 3300047321 | Bacteria | 2135 |
| 444 | Ga0495680_0010280 | 3300047322 | Bacteria | 8348 |
| 445 | Ga0495680_0341914 | 3300047322 | Bacteria | 1043 |
| 446 | Ga0495687_054433 | 3300047443 | Bacteria | 1679 |
| 447 | Ga0495675_0019494 | 3300047444 | Bacteria | 4309 |
| 448 | Ga0495675_0105611 | 3300047444 | Bacteria | 1760 |
| 449 | Ga0495673_0108344 | 3300047469 | Bacteria | 1114 |
| 450 | Ga0495684_0061895 | 3300047471 | Bacteria | 2847 |
| 451 | Ga0495593_0020272 | 3300047673 | Bacteria | 3724 |
| 452 | Ga0495602_0002050 | 3300048088 | Bacteria | 20277 |
| 453 | Ga0495602_0041978 | 3300048088 | Bacteria | 4171 |
| 454 | Ga0495602_0432005 | 3300048088 | Bacteria | 933 |
| 455 | Ga0495614_0049654 | 3300048089 | Bacteria | 1799 |
| 456 | Ga0496101_0247428 | 3300048904 | Bacteria | 1388 |
| 457 | Ga0496101_0252174 | 3300048904 | Bacteria | 1375 |
| 458 | Ga0496102_0014053 | 3300048905 | Bacteria | 6952 |
| 459 | Ga0496102_0079082 | 3300048905 | Bacteria | 3028 |
| 460 | Ga0496103_0070753 | 3300048906 | Bacteria | 2182 |
| 461 | Ga0496103_0516916 | 3300048906 | Bacteria | 763 |
| 462 | Ga0496104_0001364 | 3300048907 | Bacteria | 21131 |
| 463 | Ga0496104_0868138 | 3300048907 | Bacteria | 807 |
| 464 | Ga0496105_0051861 | 3300048908 | Bacteria | 3387 |
| 465 | Ga0496105_0104291 | 3300048908 | Bacteria | 2341 |
| 466 | Ga0496106_0040983 | 3300048909 | Bacteria | 3469 |
| 467 | Ga0496107_0162776 | 3300048910 | Bacteria | 1654 |
| 468 | Ga0496108_0058629 | 3300048911 | Bacteria | 3237 |
| 469 | Ga0496109_0000583 | 3300048912 | Bacteria | 30510 |
| 470 | Ga0496110_0058210 | 3300048913 | Bacteria | 3403 |
| 471 | Ga0496111_0019415 | 3300048914 | Bacteria | 4720 |
| 472 | Ga0496112_0057666 | 3300048915 | Bacteria | 3823 |
| 473 | Ga0496112_0233004 | 3300048915 | Bacteria | 1796 |
| 474 | Ga0496113_0197920 | 3300048916 | Bacteria | 1596 |
| 475 | Ga0496114_0203809 | 3300048917 | Bacteria | 1733 |
| 476 | Ga0496115_0025413 | 3300048918 | Bacteria | 4610 |
| 477 | Ga0496115_0133482 | 3300048918 | Bacteria | 2047 |
| 478 | Ga0496116_0102459 | 3300048919 | Bacteria | 1707 |
| 479 | Ga0496117_0117952 | 3300048920 | Bacteria | 1637 |
| 480 | Ga0496118_0051579 | 3300048921 | Bacteria | 3146 |
| 481 | Ga0496118_0068478 | 3300048921 | Bacteria | 2577 |
| 482 | Ga0496118_0073236 | 3300048921 | Bacteria | 2455 |
| 483 | Ga0496119_0032055 | 3300048922 | Bacteria | 3509 |
| 484 | Ga0496121_0034197 | 3300048924 | Bacteria | 4579 |
| 485 | Ga0496121_0038417 | 3300048924 | Bacteria | 4240 |
| 486 | Ga0496121_0149530 | 3300048924 | Bacteria | 1720 |
| 487 | Ga0496126_0062852 | 3300048929 | Bacteria | 3329 |
| 488 | Ga0496126_0081188 | 3300048929 | Bacteria | 2867 |
| 489 | Ga0496126_0088742 | 3300048929 | Bacteria | 2723 |
| 490 | Ga0496126_0175147 | 3300048929 | Bacteria | 1825 |
| 491 | Ga0495682_0137662 | 3300049460 | Bacteria | 872 |
| 492 | Ga0501313_014437 | 3300049529 | Bacteria | 935 |
| 493 | Ga0501317_000605 | 3300049533 | Bacteria | 2647 |
| 494 | Ga0501318_003335 | 3300049534 | Bacteria | 1464 |
| 495 | Ga0501325_005704 | 3300049541 | Bacteria | 999 |
| 496 | Ga0501031_0033490 | 3300049568 | Bacteria | 3352 |
| 497 | Ga0501031_0476243 | 3300049568 | Bacteria | 806 |
| 498 | Ga0501032_0065064 | 3300049569 | Bacteria | 2440 |
| 499 | Ga0501032_0132961 | 3300049569 | Bacteria | 1640 |
| 500 | Ga0501032_0163202 | 3300049569 | Bacteria | 1462 |
| 501 | Ga0501032_0236737 | 3300049569 | Bacteria | 1186 |
| 502 | Ga0501032_0443390 | 3300049569 | Bacteria | 832 |
| 503 | Ga0501032_0533912 | 3300049569 | Bacteria | 748 |
| 504 | Ga0501033_0017046 | 3300049570 | Bacteria | 5491 |
| 505 | Ga0501033_0167257 | 3300049570 | Bacteria | 1580 |
| 506 | Ga0501034_0106577 | 3300049571 | Bacteria | 2795 |
| 507 | Ga0501034_0206678 | 3300049571 | Bacteria | 1919 |
| 508 | Ga0501034_0354864 | 3300049571 | Bacteria | 1394 |
| 509 | Ga0501034_0364593 | 3300049571 | Bacteria | 1371 |
| 510 | Ga0501034_0417156 | 3300049571 | Bacteria | 1264 |
| 511 | Ga0501034_0497150 | 3300049571 | Bacteria | 1133 |
| 512 | Ga0501036_0099384 | 3300049572 | Bacteria | 2461 |
| 513 | Ga0501037_0006228 | 3300049573 | Bacteria | 8725 |
| 514 | Ga0501037_0062660 | 3300049573 | Bacteria | 2711 |
| 515 | Ga0501037_0071342 | 3300049573 | Bacteria | 2527 |
| 516 | Ga0501038_0060288 | 3300049574 | Bacteria | 3247 |
| 517 | Ga0501038_0457422 | 3300049574 | Bacteria | 980 |
| 518 | Ga0501039_0132527 | 3300049575 | Bacteria | 1956 |
| 519 | Ga0501039_0367788 | 3300049575 | Bacteria | 1129 |
| 520 | Ga0501040_0544960 | 3300049576 | Bacteria | 837 |
| 521 | Ga0501042_0017621 | 3300049578 | Bacteria | 4929 |
| 522 | Ga0501042_0032164 | 3300049578 | Bacteria | 3714 |
| 523 | Ga0501042_0153686 | 3300049578 | Bacteria | 1660 |
| 524 | Ga0501043_0104989 | 3300049579 | Bacteria | 2220 |
| 525 | Ga0501043_0252396 | 3300049579 | Bacteria | 1358 |
| 526 | Ga0501043_0257633 | 3300049579 | Bacteria | 1342 |
| 527 | Ga0501043_0374450 | 3300049579 | Bacteria | 1079 |
| 528 | Ga0501043_0494517 | 3300049579 | Bacteria | 914 |
| 529 | Ga0501043_0540834 | 3300049579 | Bacteria | 866 |
| 530 | Ga0501043_0550718 | 3300049579 | Bacteria | 857 |
| 531 | Ga0501046_0037628 | 3300049580 | Bacteria | 3888 |
| 532 | Ga0501046_0087784 | 3300049580 | Bacteria | 2396 |
| 533 | Ga0501046_0386931 | 3300049580 | Bacteria | 1011 |
| 534 | Ga0501047_0042057 | 3300049581 | Bacteria | 4416 |
| 535 | Ga0501047_0050870 | 3300049581 | Bacteria | 4001 |
| 536 | Ga0501047_0228391 | 3300049581 | Bacteria | 1715 |
| 537 | Ga0501047_0393822 | 3300049581 | Bacteria | 1218 |
| 538 | Ga0501047_0428229 | 3300049581 | Bacteria | 1154 |
| 539 | Ga0501047_0501722 | 3300049581 | Bacteria | 1040 |
| 540 | Ga0501047_0723278 | 3300049581 | Bacteria | 812 |
| 541 | Ga0501067_0025975 | 3300049583 | Bacteria | 3245 |
| 542 | Ga0501067_0052548 | 3300049583 | Bacteria | 2257 |
| 543 | Ga0501069_0398237 | 3300049585 | Bacteria | 814 |
| 544 | Ga0501070_0005291 | 3300049586 | Bacteria | 11012 |
| 545 | Ga0501070_0011623 | 3300049586 | Bacteria | 7432 |
| 546 | Ga0501070_0270440 | 3300049586 | Bacteria | 1388 |
| 547 | Ga0501070_0419909 | 3300049586 | Bacteria | 1080 |
| 548 | Ga0501070_0611381 | 3300049586 | Bacteria | 868 |
| 549 | Ga0501071_0055463 | 3300049587 | Bacteria | 2861 |
| 550 | Ga0501073_0021046 | 3300049589 | Bacteria | 4705 |
| 551 | Ga0501073_0069901 | 3300049589 | Bacteria | 2446 |
| 552 | Ga0501073_0117682 | 3300049589 | Bacteria | 1841 |
| 553 | Ga0501073_0123017 | 3300049589 | Bacteria | 1798 |
| 554 | Ga0501073_0124403 | 3300049589 | Bacteria | 1787 |
| 555 | Ga0501073_0250222 | 3300049589 | Bacteria | 1223 |
| 556 | Ga0501073_0261473 | 3300049589 | Bacteria | 1194 |
| 557 | Ga0501074_0002236 | 3300049590 | Bacteria | 13434 |
| 558 | Ga0501075_0618678 | 3300049591 | Bacteria | 826 |
| 559 | Ga0501076_0025959 | 3300049592 | Bacteria | 4535 |
| 560 | Ga0501077_0062919 | 3300049593 | Bacteria | 2354 |
| 561 | Ga0501238_002463 | 3300049671 | Bacteria | 2216 |
| 562 | Ga0501250_019988 | 3300049680 | Bacteria | 860 |
| 563 | Ga0501079_0286319 | 3300049741 | Bacteria | 1288 |
| 564 | Ga0501080_0006112 | 3300049742 | Bacteria | 10794 |
| 565 | Ga0501080_0040617 | 3300049742 | Bacteria | 4338 |
| 566 | Ga0501080_0335811 | 3300049742 | Bacteria | 1366 |
| 567 | Ga0501081_0675195 | 3300049743 | Bacteria | 775 |
| 568 | Ga0501083_0026188 | 3300049744 | Bacteria | 4032 |
| 569 | Ga0501083_0078012 | 3300049744 | Bacteria | 2197 |
| 570 | Ga0501035_0031318 | 3300049822 | Bacteria | 4844 |
| 571 | Ga0501035_0046134 | 3300049822 | Bacteria | 3919 |
| 572 | Ga0501035_0163890 | 3300049822 | Bacteria | 1923 |
| 573 | Ga0501035_0407934 | 3300049822 | Bacteria | 1129 |
| 574 | Ga0501035_0415041 | 3300049822 | Bacteria | 1118 |
| 575 | Ga0501044_0026591 | 3300049823 | Bacteria | 6125 |
| 576 | Ga0501044_0042664 | 3300049823 | Bacteria | 4717 |
| 577 | Ga0501044_0043456 | 3300049823 | Bacteria | 4667 |
| 578 | Ga0501044_0062308 | 3300049823 | Bacteria | 3812 |
| 579 | Ga0501044_0066525 | 3300049823 | Bacteria | 3674 |
| 580 | Ga0501044_0121256 | 3300049823 | Bacteria | 2615 |
| 581 | Ga0501044_0174818 | 3300049823 | Bacteria | 2117 |
| 582 | Ga0501044_0176929 | 3300049823 | Bacteria | 2102 |
| 583 | Ga0501044_0242990 | 3300049823 | Bacteria | 1743 |
| 584 | Ga0501044_0300728 | 3300049823 | Bacteria | 1533 |
| 585 | Ga0501044_0307150 | 3300049823 | Bacteria | 1513 |
| 586 | Ga0501044_0508266 | 3300049823 | Bacteria | 1105 |
| 587 | Ga0501044_0538145 | 3300049823 | Bacteria | 1066 |
| 588 | Ga0501044_0549649 | 3300049823 | Bacteria | 1052 |
| 589 | Ga0501044_0683934 | 3300049823 | Bacteria | 912 |
| 590 | Ga0501045_0517217 | 3300049824 | Bacteria | 886 |
| 591 | nmdc:mga03683_119094_c1 | 3300050489 | Bacteria | 1173 |
| 592 | nmdc:mga03683_201550_c1 | 3300050489 | Bacteria | 913 |
| 593 | nmdc:mga03n38_81694_c1 | 3300050490 | Bacteria | 1520 |
| 594 | nmdc:mga0yw44_9723_c1 | 3300050492 | Bacteria | 4882 |
| 595 | nmdc:mga06z11_5686_c1 | 3300050494 | Bacteria | 5023 |
| 596 | nmdc:mga04h51_6599_c1 | 3300050495 | Bacteria | 3018 |
| 597 | nmdc:mga07m45_122292_c1 | 3300050496 | Bacteria | 1504 |
| 598 | nmdc:mga05p37_1686_c1 | 3300050507 | Bacteria | 25707 |
| 599 | nmdc:mga05p37_57360_c1 | 3300050507 | Bacteria | 4796 |
| 600 | nmdc:mga09592_49714_c1 | 3300050508 | Bacteria | 3535 |
| 601 | nmdc:mga09592_9760_c1 | 3300050508 | Bacteria | 7800 |
| 602 | nmdc:mga0qj67_948226_c1 | 3300050509 | Bacteria | 677 |
| 603 | nmdc:mga06r32_37775_c1 | 3300050510 | Bacteria | 4569 |
| 604 | nmdc:mga08y16_11167_c1 | 3300050511 | Bacteria | 9433 |
| 605 | nmdc:mga08y16_275826_c1 | 3300050511 | Bacteria | 1735 |
| 606 | nmdc:mga0n895_17709_c1 | 3300050512 | Bacteria | 6573 |
| 607 | nmdc:mga0rr50_126499_c1 | 3300050513 | Bacteria | 2041 |
| 608 | nmdc:mga0sz30_4401_c1 | 3300050516 | Bacteria | 5086 |
| 609 | nmdc:mga0sz30_59009_c1 | 3300050516 | Bacteria | 1637 |
| 610 | nmdc:mga0sz30_6678_c1 | 3300050516 | Bacteria | 4298 |
| 611 | Ga0495601_0012741 | 3300053077 | Bacteria | 5046 |
| 612 | Ga0495612_0088296 | 3300053078 | Bacteria | 1309 |
| 613 | Ga0500635_0033363 | 3300053080 | Bacteria | 1679 |
| 614 | Ga0495655_0059215 | 3300053083 | Bacteria | 1040 |
| 615 | Ga0495595_0013111 | 3300053084 | Bacteria | 3497 |
| 616 | Ga0495595_0088473 | 3300053084 | Bacteria | 1483 |
| 617 | Ga0495619_0009229 | 3300053085 | Bacteria | 6233 |
| 618 | Ga0495619_0054013 | 3300053085 | Bacteria | 2658 |
| 619 | Ga0495619_0080463 | 3300053085 | Bacteria | 2192 |
| 620 | Ga0495619_0166775 | 3300053085 | Bacteria | 1522 |
| 621 | Ga0495619_0263531 | 3300053085 | Bacteria | 1194 |
| 622 | Ga0500578_0338260 | 3300053086 | Bacteria | 883 |
| 623 | Ga0500643_000335 | 3300053087 | Bacteria | 37421 |
| 624 | Ga0500646_0024974 | 3300053090 | Bacteria | 1611 |
| 625 | Ga0500647_0085818 | 3300053091 | Bacteria | 1509 |
| 626 | Ga0500647_0152877 | 3300053091 | Bacteria | 1076 |
| 627 | Ga0500651_0030743 | 3300053093 | Bacteria | 3380 |
| 628 | Ga0500651_0094767 | 3300053093 | Bacteria | 1835 |
| 629 | Ga0500566_0004695 | 3300053094 | Bacteria | 8132 |
| 630 | Ga0500650_0282310 | 3300053098 | Bacteria | 738 |
| 631 | Ga0500555_011238 | 3300053103 | Bacteria | 2571 |
| 632 | Ga0500557_000010 | 3300053105 | Bacteria | 118251 |
| 633 | Ga0500572_000157 | 3300053111 | Bacteria | 23703 |
| 634 | Ga0500594_0037558 | 3300053118 | Bacteria | 1308 |
| 635 | Ga0500595_008185 | 3300053119 | Bacteria | 4289 |
| 636 | Ga0500607_076810 | 3300053121 | Bacteria | 1711 |
| 637 | Ga0500608_011045 | 3300053122 | Bacteria | 3904 |
| 638 | Ga0500614_036280 | 3300053123 | Bacteria | 1232 |
| 639 | Ga0500642_0003300 | 3300053130 | Bacteria | 4861 |
| 640 | Ga0500652_010380 | 3300053131 | Bacteria | 3189 |
| 641 | Ga0500559_0020416 | 3300053136 | Bacteria | 2801 |
| 642 | Ga0500559_0029313 | 3300053136 | Bacteria | 2355 |
| 643 | Ga0500564_089383 | 3300053138 | Bacteria | 1372 |
| 644 | Ga0500577_0091766 | 3300053142 | Bacteria | 1228 |
| 645 | Ga0500588_0009440 | 3300053146 | Bacteria | 2319 |
| 646 | Ga0500589_124742 | 3300053147 | Bacteria | 1085 |
| 647 | Ga0500603_000497 | 3300053150 | Bacteria | 10047 |
| 648 | Ga0500619_005307 | 3300053154 | Bacteria | 2861 |
| 649 | Ga0500630_001586 | 3300053159 | Bacteria | 10878 |
| 650 | Ga0500634_0125458 | 3300053161 | Bacteria | 1242 |
| 651 | Ga0500638_110860 | 3300053162 | Bacteria | 1267 |
| 652 | Ga0500639_000002 | 3300053163 | Bacteria | 233548 |
| 653 | Ga0500637_0221176 | 3300053178 | Bacteria | 1070 |
| 654 | Ga0500625_013421 | 3300053729 | Bacteria | 3767 |
| 655 | Ga0500645_021926 | 3300053730 | Bacteria | 1968 |
| 656 | Ga0500609_009425 | 3300053731 | Bacteria | 1316 |
| 657 | Ga0500596_002194 | 3300053735 | Bacteria | 3870 |
| 658 | Ga0501084_0017007 | 3300054114 | Bacteria | 6042 |
| 659 | Ga0501084_0319314 | 3300054114 | Bacteria | 1312 |
| 660 | Ga0501084_0337004 | 3300054114 | Bacteria | 1274 |
| 661 | Ga0587062_018598 | 3300059639 | Bacteria | 962 |
| 662 | Ga0587068_044644 | 3300059641 | Bacteria | 812 |
| 663 | Ga0501082_0112475 | 3300060353 | Bacteria | 2357 |
| 664 | Ga0501082_0159588 | 3300060353 | Bacteria | 1959 |
| 665 | Ga0501082_0326837 | 3300060353 | Bacteria | 1336 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005439 | Ga0070711_100239905 | Ga0070711_1002399051 | 198 |
| 2 | 3300005535 | Ga0070684_100520861 | Ga0070684_1005208612 | 198 |
| 3 | 3300014325 | Ga0163163_10076994 | Ga0163163_100769941 | 198 |
| 4 | 3300025916 | Ga0207663_10455768 | Ga0207663_104557682 | 198 |
| 5 | 3300035116 | Ga0373945_0196654 | Ga0373945_0196654_34_741 | 198 |
| 6 | 3300035695 | Ga0373927_0308230 | Ga0373927_0308230_19_726 | 198 |
| 7 | 3300035725 | Ga0373947_0124596 | Ga0373947_0124596_560_1267 | 198 |
| 8 | 3300037068 | Ga0373925_0060509 | Ga0373925_0060509_622_1329 | 198 |
| 9 | 3300046499 | Ga0495594_0170758 | Ga0495594_0170758_423_1130 | 198 |
| 10 | 3300046674 | Ga0495588_0039030 | Ga0495588_0039030_1222_1929 | 198 |
| 11 | 3300047321 | Ga0495676_0100978 | Ga0495676_0100978_252_959 | 198 |
| 12 | 3300048904 | Ga0496101_0252174 | Ga0496101_0252174_21_728 | 198 |
| 13 | 3300048905 | Ga0496102_0079082 | Ga0496102_0079082_2248_2955 | 198 |
| 14 | 3300048907 | Ga0496104_0001364 | Ga0496104_0001364_2435_3142 | 198 |
| 15 | 3300048908 | Ga0496105_0051861 | Ga0496105_0051861_415_1122 | 198 |
| 16 | 3300048910 | Ga0496107_0162776 | Ga0496107_0162776_833_1540 | 198 |
| 17 | 3300048911 | Ga0496108_0058629 | Ga0496108_0058629_1990_2697 | 198 |
| 18 | 3300048912 | Ga0496109_0000583 | Ga0496109_0000583_28130_28837 | 198 |
| 19 | 3300048913 | Ga0496110_0058210 | Ga0496110_0058210_2283_2990 | 198 |
| 20 | 3300048914 | Ga0496111_0019415 | Ga0496111_0019415_1759_2466 | 198 |
| 21 | 3300048915 | Ga0496112_0057666 | Ga0496112_0057666_2284_2991 | 198 |
| 22 | 3300048916 | Ga0496113_0197920 | Ga0496113_0197920_185_892 | 198 |
| 23 | 3300048917 | Ga0496114_0203809 | Ga0496114_0203809_386_1093 | 198 |
| 24 | 3300048918 | Ga0496115_0025413 | Ga0496115_0025413_58_765 | 198 |
| 25 | 3300046511 | Ga0495608_0195792 | Ga0495608_0195792_14_625 | 203 |
| 26 | 3300046674 | Ga0495588_0383607 | Ga0495588_0383607_116_727 | 203 |
| 27 | 3300049576 | Ga0501040_0544960 | Ga0501040_0544960_201_815 | 203 |
| 28 | 3300049586 | Ga0501070_0419909 | Ga0501070_0419909_20_652 | 203 |
| 29 | 3300049589 | Ga0501073_0069901 | Ga0501073_0069901_1813_2436 | 203 |
| 30 | 3300050489 | nmdc:mga03683_201550_c1 | nmdc:mga03683_201550_c1_10_621 | 203 |
| 31 | 3300050509 | nmdc:mga0qj67_948226_c1 | nmdc:mga0qj67_948226_c1_13_630 | 203 |
| 32 | 3300049579 | Ga0501043_0374450 | Ga0501043_0374450_191_880 | 210 |
| 33 | 3300049822 | Ga0501035_0163890 | Ga0501035_0163890_1020_1709 | 210 |
| 34 | 3300049823 | Ga0501044_0026591 | Ga0501044_0026591_1933_2622 | 210 |
| 35 | 3300046475 | Ga0495639_0087237 | Ga0495639_0087237_440_1147 | 211 |
| 36 | 3300021377 | Ga0213874_10085869 | Ga0213874_100858692 | 212 |
| 37 | 3300039450 | Ga0436363_1616347 | Ga0436363_1616347_1453_2148 | 212 |
| 38 | 3300022467 | Ga0224712_10135072 | Ga0224712_101350722 | 213 |
| 39 | 3300002070 | JGI24750J21931_1007518 | JGI24750J21931_10075182 | 214 |
| 40 | 3300039453 | Ga0436362_0501267 | Ga0436362_0501267_94_738 | 214 |
| 41 | 3300031247 | Ga0265340_10085171 | Ga0265340_100851711 | 216 |
| 42 | 3300031712 | Ga0265342_10003512 | Ga0265342_1000351215 | 216 |
| 43 | 3300053085 | Ga0495619_0054013 | Ga0495619_0054013_108_800 | 216 |
| 44 | 3300049569 | Ga0501032_0163202 | Ga0501032_0163202_540_1232 | 217 |
| 45 | 3300049570 | Ga0501033_0017046 | Ga0501033_0017046_2497_3189 | 217 |
| 46 | 3300049573 | Ga0501037_0006228 | Ga0501037_0006228_1883_2575 | 217 |
| 47 | 3300049574 | Ga0501038_0060288 | Ga0501038_0060288_2493_3185 | 217 |
| 48 | 3300049575 | Ga0501039_0132527 | Ga0501039_0132527_74_766 | 217 |
| 49 | 3300049578 | Ga0501042_0153686 | Ga0501042_0153686_305_997 | 217 |
| 50 | 3300049579 | Ga0501043_0104989 | Ga0501043_0104989_943_1635 | 217 |
| 51 | 3300049580 | Ga0501046_0386931 | Ga0501046_0386931_40_732 | 217 |
| 52 | 3300049589 | Ga0501073_0261473 | Ga0501073_0261473_298_990 | 217 |
| 53 | 3300049593 | Ga0501077_0062919 | Ga0501077_0062919_945_1637 | 217 |
| 54 | 3300049742 | Ga0501080_0335811 | Ga0501080_0335811_472_1164 | 217 |
| 55 | 3300049743 | Ga0501081_0675195 | Ga0501081_0675195_44_736 | 217 |
| 56 | 3300049822 | Ga0501035_0031318 | Ga0501035_0031318_922_1614 | 217 |
| 57 | 3300049823 | Ga0501044_0043456 | Ga0501044_0043456_1903_2595 | 217 |
| 58 | 3300053118 | Ga0500594_0037558 | Ga0500594_0037558_492_1184 | 217 |
| 59 | 3300006880 | Ga0075429_100233566 | Ga0075429_1002335662 | 218 |
| 60 | 3300009147 | Ga0114129_10139148 | Ga0114129_101391484 | 218 |
| 61 | 3300039437 | Ga0436365_0601503 | Ga0436365_0601503_122_829 | 218 |
| 62 | 3300049533 | Ga0501317_000605 | Ga0501317_000605_203_868 | 218 |
| 63 | 3300049579 | Ga0501043_0550718 | Ga0501043_0550718_86_778 | 218 |
| 64 | 3300050507 | nmdc:mga05p37_57360_c1 | nmdc:mga05p37_57360_c1_558_1253 | 218 |
| 65 | 3300050508 | nmdc:mga09592_49714_c1 | nmdc:mga09592_49714_c1_2179_2874 | 218 |
| 66 | iso_pu_bacteria | 2824600985 | 2824602100 | 220 |
| 67 | iso_pu_bacteria | 2824609381 | 2824610088 | 220 |
| 68 | iso_pu_bacteria | 2824617872 | 2824620104 | 220 |
| 69 | iso_pu_bacteria | 2824626560 | 2824627685 | 220 |
| 70 | iso_pu_bacteria | 2824635225 | 2824636746 | 220 |
| 71 | iso_pu_bacteria | 2824644064 | 2824645039 | 220 |
| 72 | iso_pu_bacteria | 2824653114 | 2824654944 | 220 |
| 73 | iso_pu_bacteria | 2824661429 | 2824662341 | 220 |
| 74 | iso_pu_bacteria | 2824671348 | 2824672590 | 220 |
| 75 | iso_pu_bacteria | 2824679649 | 2824680860 | 220 |
| 76 | iso_pu_bacteria | 2824687955 | 2824689077 | 220 |
| 77 | iso_pu_bacteria | 2824696289 | 2824697444 | 220 |
| 78 | iso_pu_bacteria | 2824704595 | 2824706657 | 220 |
| 79 | iso_pu_bacteria | 2824714736 | 2824715399 | 220 |
| 80 | iso_pu_bacteria | 2824723954 | 2824724746 | 220 |
| 81 | iso_pu_bacteria | 2824732956 | 2824733574 | 220 |
| 82 | iso_pu_bacteria | 2824746037 | 2824746949 | 220 |
| 83 | iso_pu_bacteria | 2824753945 | 2824759399 | 220 |
| 84 | iso_pu_bacteria | 2824763712 | 2824769635 | 220 |
| 85 | iso_pu_bacteria | 2824773399 | 2824774053 | 220 |
| 86 | iso_pu_bacteria | 2838122688 | 2838130101 | 220 |
| 87 | iso_pu_bacteria | 2841941048 | 2841941258 | 220 |
| 88 | iso_pu_bacteria | 2841949485 | 2841952715 | 220 |
| 89 | iso_pu_bacteria | 2841957949 | 2841962226 | 220 |
| 90 | iso_pu_bacteria | 2841966195 | 2841967413 | 220 |
| 91 | iso_pu_bacteria | 2841974524 | 2841979189 | 220 |
| 92 | iso_pu_bacteria | 2841983080 | 2841990765 | 220 |
| 93 | iso_pu_bacteria | 2842038055 | 2842038605 | 220 |
| 94 | iso_pu_bacteria | 2842045827 | 2842048450 | 220 |
| 95 | iso_pu_bacteria | 2844315083 | 2844318001 | 220 |
| 96 | iso_pu_bacteria | 2847930680 | 2847934814 | 220 |
| 97 | iso_pu_bacteria | 2847939898 | 2847945378 | 220 |
| 98 | iso_pu_bacteria | 2849076700 | 2849080434 | 220 |
| 99 | iso_pu_bacteria | 2857509624 | 2857510213 | 220 |
| 100 | iso_pu_bacteria | 2874590934 | 2874595095 | 220 |
| 101 | iso_pu_bacteria | 2874612657 | 2874615671 | 220 |
| 102 | iso_pu_bacteria | 2874620515 | 2874621695 | 220 |
| 103 | iso_pu_bacteria | 2874628541 | 2874632671 | 220 |
| 104 | iso_pu_bacteria | 2874645413 | 2874650956 | 220 |
| 105 | iso_pu_bacteria | 2876761206 | 2876765709 | 220 |
| 106 | iso_pu_bacteria | 2876771140 | 2876775031 | 220 |
| 107 | iso_pu_bacteria | 2876818435 | 2876823846 | 220 |
| 108 | iso_pu_bacteria | 2879074833 | 2879080474 | 220 |
| 109 | iso_pu_bacteria | 2879083081 | 2879089261 | 220 |
| 110 | iso_pu_bacteria | 2879099564 | 2879109322 | 220 |
| 111 | iso_pu_bacteria | 2879127579 | 2879134920 | 220 |
| 112 | iso_pu_bacteria | 2879142872 | 2879149230 | 220 |
| 113 | iso_pu_bacteria | 2881364244 | 2881366208 | 220 |
| 114 | iso_pu_bacteria | 2881665667 | 2881671549 | 220 |
| 115 | iso_pu_bacteria | 2885366525 | 2885372801 | 220 |
| 116 | iso_pu_bacteria | 2885409591 | 2885413081 | 220 |
| 117 | iso_pu_bacteria | 2888378607 | 2888382799 | 220 |
| 118 | iso_pu_bacteria | 2888419890 | 2888423279 | 220 |
| 119 | iso_pu_bacteria | 2903727486 | 2903729689 | 220 |
| 120 | iso_pu_bacteria | 2904666416 | 2904668588 | 220 |
| 121 | iso_pu_bacteria | 2904711408 | 2904716691 | 220 |
| 122 | iso_pu_bacteria | 2906602504 | 2906605838 | 220 |
| 123 | iso_pu_bacteria | 2906643746 | 2906644181 | 220 |
| 124 | iso_pu_bacteria | 2908775508 | 2908778922 | 220 |
| 125 | iso_pu_bacteria | 2922368715 | 2922375241 | 220 |
| 126 | iso_pu_bacteria | 2922393267 | 2922395208 | 220 |
| 127 | iso_pu_bacteria | 2929615660 | 2929615929 | 220 |
| 128 | iso_pu_bacteria | 2929624759 | 2929630542 | 220 |
| 129 | 3300005437 | Ga0070710_10009691 | Ga0070710_100096914 | 224 |
| 130 | 3300006028 | Ga0070717_10012865 | Ga0070717_100128657 | 224 |
| 131 | 3300009093 | Ga0105240_10331329 | Ga0105240_103313292 | 224 |
| 132 | 3300009551 | Ga0105238_10067377 | Ga0105238_100673775 | 224 |
| 133 | 3300025898 | Ga0207692_10000967 | Ga0207692_1000096719 | 224 |
| 134 | 3300025905 | Ga0207685_10001288 | Ga0207685_100012883 | 224 |
| 135 | 3300025906 | Ga0207699_10055499 | Ga0207699_100554992 | 224 |
| 136 | 3300025916 | Ga0207663_10000401 | Ga0207663_100004018 | 224 |
| 137 | 3300025929 | Ga0207664_10006050 | Ga0207664_100060505 | 224 |
| 138 | 3300035086 | Ga0373934_0151654 | Ga0373934_0151654_30_722 | 224 |
| 139 | 3300035089 | Ga0373944_0060595 | Ga0373944_0060595_528_1202 | 224 |
| 140 | 3300035111 | Ga0373923_0066469 | Ga0373923_0066469_500_1192 | 224 |
| 141 | 3300035119 | Ga0373956_0027033 | Ga0373956_0027033_1685_2377 | 224 |
| 142 | 3300035172 | Ga0373955_0066607 | Ga0373955_0066607_618_1310 | 224 |
| 143 | 3300035410 | Ga0373924_0160535 | Ga0373924_0160535_177_869 | 224 |
| 144 | 3300036401 | Ga0373937_0293715 | Ga0373937_0293715_597_1289 | 224 |
| 145 | 3300046454 | Ga0495592_0180668 | Ga0495592_0180668_134_826 | 224 |
| 146 | 3300046462 | Ga0495651_0113460 | Ga0495651_0113460_902_1594 | 224 |
| 147 | 3300046477 | Ga0495664_0201628 | Ga0495664_0201628_374_1066 | 224 |
| 148 | 3300046511 | Ga0495608_0246995 | Ga0495608_0246995_338_1030 | 224 |
| 149 | 3300046514 | Ga0495618_0135034 | Ga0495618_0135034_667_1359 | 224 |
| 150 | 3300046516 | Ga0495628_0150744 | Ga0495628_0150744_657_1349 | 224 |
| 151 | 3300046529 | Ga0495652_0352173 | Ga0495652_0352173_134_826 | 224 |
| 152 | 3300046536 | Ga0495587_0176734 | Ga0495587_0176734_251_943 | 224 |
| 153 | 3300046543 | Ga0495645_0215482 | Ga0495645_0215482_61_753 | 224 |
| 154 | 3300046559 | Ga0495667_0008834 | Ga0495667_0008834_3134_3826 | 224 |
| 155 | 3300046663 | Ga0495635_0058716 | Ga0495635_0058716_254_946 | 224 |
| 156 | 3300046675 | Ga0495657_0010777 | Ga0495657_0010777_31_723 | 224 |
| 157 | 3300046678 | Ga0495599_0286071 | Ga0495599_0286071_35_727 | 224 |
| 158 | 3300046680 | Ga0495646_0087678 | Ga0495646_0087678_505_1197 | 224 |
| 159 | 3300046809 | Ga0495600_0245595 | Ga0495600_0245595_114_806 | 224 |
| 160 | 3300047317 | Ga0495604_0143675 | Ga0495604_0143675_650_1342 | 224 |
| 161 | 3300047319 | Ga0495674_0101947 | Ga0495674_0101947_1307_1999 | 224 |
| 162 | 3300047322 | Ga0495680_0341914 | Ga0495680_0341914_218_910 | 224 |
| 163 | 3300047444 | Ga0495675_0019494 | Ga0495675_0019494_2962_3654 | 224 |
| 164 | 3300048088 | Ga0495602_0041978 | Ga0495602_0041978_132_824 | 224 |
| 165 | 3300049581 | Ga0501047_0723278 | Ga0501047_0723278_64_750 | 224 |
| 166 | 3300049822 | Ga0501035_0415041 | Ga0501035_0415041_123_809 | 224 |
| 167 | 3300049823 | Ga0501044_0538145 | Ga0501044_0538145_307_993 | 224 |
| 168 | 3300053084 | Ga0495595_0088473 | Ga0495595_0088473_134_826 | 224 |
| 169 | 3300053085 | Ga0495619_0080463 | Ga0495619_0080463_1335_2027 | 224 |
| 170 | 3300053098 | Ga0500650_0282310 | Ga0500650_0282310_49_723 | 224 |
| 171 | 3300053146 | Ga0500588_0009440 | Ga0500588_0009440_571_1263 | 224 |
| 172 | 3300009093 | Ga0105240_10971757 | Ga0105240_109717571 | 225 |
| 173 | 3300047317 | Ga0495604_0083680 | Ga0495604_0083680_154_831 | 225 |
| 174 | iso_pu_bacteria | 2507262055 | 2507509796 | 226 |
| 175 | iso_pu_bacteria | 2508501009 | 2508543812 | 226 |
| 176 | iso_pu_bacteria | 2508501042 | 2508698400 | 226 |
| 177 | iso_pu_bacteria | 2508501128 | 2509149655 | 226 |
| 178 | iso_pu_bacteria | 2511231028 | 2511396996 | 226 |
| 179 | iso_pu_bacteria | 2513237092 | 2513625255 | 226 |
| 180 | iso_pu_bacteria | 2513237094 | 2513644571 | 226 |
| 181 | iso_pu_bacteria | 2513237095 | 2513646138 | 226 |
| 182 | iso_pu_bacteria | 2513237096 | 2513658371 | 226 |
| 183 | iso_pu_bacteria | 2513237098 | 2513679089 | 226 |
| 184 | iso_pu_bacteria | 2513237102 | 2513701018 | 226 |
| 185 | iso_pu_bacteria | 2513237137 | 2513857553 | 226 |
| 186 | iso_pu_bacteria | 2513237139 | 2513875874 | 226 |
| 187 | iso_pu_bacteria | 2513237145 | 2513920137 | 226 |
| 188 | iso_pu_bacteria | 2513237161 | 2514011460 | 226 |
| 189 | iso_pu_bacteria | 2515154112 | 2515629992 | 226 |
| 190 | iso_pu_bacteria | 2517093001 | 2517103504 | 226 |
| 191 | iso_pu_bacteria | 2517572143 | 2517893505 | 226 |
| 192 | iso_pu_bacteria | 2524023205 | 2524441013 | 226 |
| 193 | iso_pu_bacteria | 2524023210 | 2524469955 | 226 |
| 194 | iso_pu_bacteria | 2524023228 | 2524538011 | 226 |
| 195 | iso_pu_bacteria | 2524023250 | 2524609623 | 226 |
| 196 | iso_pu_bacteria | 2528768022 | 2528856308 | 226 |
| 197 | iso_pu_bacteria | 2617270735 | 2617349320 | 226 |
| 198 | iso_pu_bacteria | 2617270741 | 2617378158 | 226 |
| 199 | iso_pu_bacteria | 2643221651 | 2644287935 | 226 |
| 200 | iso_pu_bacteria | 2667528175 | 2671118141 | 226 |
| 201 | iso_pu_bacteria | 2721755755 | 2723846188 | 226 |
| 202 | iso_pu_bacteria | 2744054633 | 2745082464 | 226 |
| 203 | iso_pu_bacteria | 2791355196 | 2793060231 | 226 |
| 204 | iso_pu_bacteria | 2791355197 | 2793071740 | 226 |
| 205 | iso_pu_bacteria | 2802429603 | 2805917596 | 226 |
| 206 | iso_pu_bacteria | 2816332527 | 2818241523 | 226 |
| 207 | iso_pu_bacteria | 2876808645 | 2876810409 | 226 |
| 208 | iso_pu_bacteria | 2879110137 | 2879110512 | 226 |
| 209 | iso_pu_bacteria | 2885374607 | 2885380964 | 226 |
| 210 | iso_pu_bacteria | 2885383462 | 2885384463 | 226 |
| 211 | iso_pu_bacteria | 2903748898 | 2903758281 | 226 |
| 212 | iso_pu_bacteria | 2903768456 | 2903770882 | 226 |
| 213 | iso_pu_bacteria | 2904699407 | 2904701635 | 226 |
| 214 | iso_pu_bacteria | 2906610324 | 2906610388 | 226 |
| 215 | iso_pu_bacteria | 2906635258 | 2906642806 | 226 |
| 216 | iso_pu_bacteria | 2906660503 | 2906665941 | 226 |
| 217 | iso_pu_bacteria | 2908739725 | 2908743909 | 226 |
| 218 | iso_pu_bacteria | 2922361189 | 2922361988 | 226 |
| 219 | iso_pu_bacteria | 2922386360 | 2922392004 | 226 |
| 220 | iso_pu_bacteria | 2922425934 | 2922428973 | 226 |
| 221 | iso_pu_bacteria | 2932784394 | 2932792433 | 226 |
| 222 | iso_pu_bacteria | 2932794094 | 2932800421 | 226 |
| 223 | iso_pu_bacteria | 2932801729 | 2932804595 | 226 |
| 224 | iso_pu_bacteria | 2932809354 | 2932813932 | 226 |
| 225 | iso_pu_bacteria | 2932818245 | 2932819556 | 226 |
| 226 | iso_pu_bacteria | 2932828146 | 2932833738 | 226 |
| 227 | iso_pu_bacteria | 2933577622 | 2933578785 | 226 |
| 228 | iso_pu_bacteria | 2935608549 | 2935611345 | 226 |
| 229 | iso_pu_bacteria | 2935616580 | 2935618758 | 226 |
| 230 | iso_pu_bacteria | 2935630451 | 2935637764 | 226 |
| 231 | iso_pu_bacteria | 2935638405 | 2935644402 | 226 |
| 232 | iso_pu_bacteria | 2935648319 | 2935648729 | 226 |
| 233 | iso_pu_bacteria | 2935656913 | 2935657188 | 226 |
| 234 | iso_pu_bacteria | 2935665750 | 2935674140 | 226 |
| 235 | iso_pu_bacteria | 2935675223 | 2935678578 | 226 |
| 236 | iso_pu_bacteria | 2935684952 | 2935687925 | 226 |
| 237 | iso_pu_bacteria | 2935694250 | 2935701463 | 226 |
| 238 | iso_pu_bacteria | 2935703347 | 2935708259 | 226 |
| 239 | iso_pu_bacteria | 2935713505 | 2935714945 | 226 |
| 240 | iso_pu_bacteria | 2935722832 | 2935726490 | 226 |
| 241 | iso_pu_bacteria | 2935732158 | 2935733763 | 226 |
| 242 | iso_pu_bacteria | 2935741537 | 2935743142 | 226 |
| 243 | iso_pu_bacteria | 2935750917 | 2935754819 | 226 |
| 244 | iso_pu_bacteria | 2935760218 | 2935765527 | 226 |
| 245 | iso_pu_bacteria | 2935769743 | 2935775280 | 226 |
| 246 | iso_pu_bacteria | 2935777560 | 2935779519 | 226 |
| 247 | iso_pu_bacteria | 2935785616 | 2935791522 | 226 |
| 248 | iso_pu_bacteria | 2935793552 | 2935799834 | 226 |
| 249 | iso_pu_bacteria | 2935801545 | 2935805480 | 226 |
| 250 | iso_pu_bacteria | 2935810662 | 2935816774 | 226 |
| 251 | iso_pu_bacteria | 2935819856 | 2935820822 | 226 |
| 252 | iso_pu_bacteria | 2935827899 | 2935833849 | 226 |
| 253 | iso_pu_bacteria | 2935837841 | 2935839466 | 226 |
| 254 | iso_pu_bacteria | 2935847175 | 2935850918 | 226 |
| 255 | iso_pu_bacteria | 2935855204 | 2935857123 | 226 |
| 256 | iso_pu_bacteria | 2935864058 | 2935864667 | 226 |
| 257 | iso_pu_bacteria | 2935873716 | 2935876445 | 226 |
| 258 | iso_pu_bacteria | 2935883170 | 2935889788 | 226 |
| 259 | iso_pu_bacteria | 2935908558 | 2935913715 | 226 |
| 260 | iso_pu_bacteria | 2935916978 | 2935920295 | 226 |
| 261 | iso_pu_bacteria | 2935926038 | 2935930634 | 226 |
| 262 | iso_pu_bacteria | 2935934488 | 2935939393 | 226 |
| 263 | iso_pu_bacteria | 2935942939 | 2935946342 | 226 |
| 264 | iso_pu_bacteria | 2935951376 | 2935955819 | 226 |
| 265 | iso_pu_bacteria | 2935959822 | 2935966975 | 226 |
| 266 | iso_pu_bacteria | 2935967501 | 2935972471 | 226 |
| 267 | iso_pu_bacteria | 2935975950 | 2935981698 | 226 |
| 268 | iso_pu_bacteria | 2935984226 | 2935991073 | 226 |
| 269 | iso_pu_bacteria | 2935992306 | 2935997586 | 226 |
| 270 | iso_pu_bacteria | 2936002035 | 2936007104 | 226 |
| 271 | iso_pu_bacteria | 2936011229 | 2936011639 | 226 |
| 272 | iso_pu_bacteria | 2936019824 | 2936020234 | 226 |
| 273 | iso_pu_bacteria | 2936028420 | 2936028929 | 226 |
| 274 | iso_pu_bacteria | 2936037263 | 2936042964 | 226 |
| 275 | iso_pu_bacteria | 2936046547 | 2936046957 | 226 |
| 276 | iso_pu_bacteria | 2936055302 | 2936058163 | 226 |
| 277 | iso_pu_bacteria | 2940556831 | 2940559804 | 226 |
| 278 | iso_pu_bacteria | 2941507105 | 2941514437 | 226 |
| 279 | iso_pu_bacteria | 2941515067 | 2941522333 | 226 |
| 280 | iso_pu_bacteria | 2941523033 | 2941530148 | 226 |
| 281 | iso_pu_bacteria | 2941531003 | 2941536106 | 226 |
| 282 | iso_pu_bacteria | 2941538514 | 2941540155 | 226 |
| 283 | iso_pu_bacteria | 3005474847 | 3005479118 | 226 |
| 284 | iso_pu_bacteria | 3005483717 | 3005488128 | 226 |
| 285 | iso_pu_bacteria | 3005506211 | 3005512724 | 226 |
| 286 | iso_pu_bacteria | 3005587118 | 3005590491 | 226 |
| 287 | iso_pu_bacteria | 3005594810 | 3005598052 | 226 |
| 288 | iso_pu_bacteria | 3005710791 | 3005713731 | 226 |
| 289 | iso_pu_bacteria | 3005718088 | 3005721242 | 226 |
| 290 | iso_pu_bacteria | 8006926726 | 8006930040 | 226 |
| 291 | iso_pu_bacteria | 8006933436 | 8006942233 | 226 |
| 292 | iso_pu_bacteria | 8006973647 | 8006981967 | 226 |
| 293 | iso_pu_bacteria | 8016511872 | 8016514703 | 226 |
| 294 | iso_pu_bacteria | 8016522445 | 8016530802 | 226 |
| 295 | iso_pu_bacteria | 8016530956 | 8016536092 | 226 |
| 296 | iso_pu_bacteria | 8016548790 | 8016552861 | 226 |
| 297 | iso_pu_bacteria | 8016557553 | 8016561238 | 226 |
| 298 | iso_pu_bacteria | 8016566248 | 8016574442 | 226 |
| 299 | iso_pu_bacteria | 8016575299 | 8016578537 | 226 |
| 300 | iso_pu_bacteria | 8016595262 | 8016599097 | 226 |
| 301 | iso_pu_bacteria | 8016603502 | 8016611954 | 226 |
| 302 | iso_pu_bacteria | 8016613128 | 8016621851 | 226 |
| 303 | iso_pu_bacteria | 8016622563 | 8016628002 | 226 |
| 304 | iso_pu_bacteria | 8016630954 | 8016632325 | 226 |
| 305 | iso_pu_bacteria | 8017057580 | 8017061735 | 226 |
| 306 | iso_pu_bacteria | 8019530166 | 8019535817 | 226 |
| 307 | iso_pu_bacteria | 8019538911 | 8019543660 | 226 |
| 308 | iso_pu_bacteria | 8019547302 | 8019555115 | 226 |
| 309 | iso_pu_bacteria | 8019555841 | 8019557955 | 226 |
| 310 | iso_pu_bacteria | 8019565922 | 8019567330 | 226 |
| 311 | iso_pu_bacteria | 8019576017 | 8019581233 | 226 |
| 312 | iso_pu_bacteria | 8019586578 | 8019588860 | 226 |
| 313 | iso_pu_bacteria | 8019597564 | 8019602372 | 226 |
| 314 | iso_pu_bacteria | 8019608314 | 8019616186 | 226 |
| 315 | iso_pu_bacteria | 8019619141 | 8019626803 | 226 |
| 316 | iso_pu_bacteria | 8019629233 | 8019635706 | 226 |
| 317 | iso_pu_bacteria | 8019648815 | 8019656978 | 226 |
| 318 | iso_pu_bacteria | 8019659431 | 8019663504 | 226 |
| 319 | iso_pu_bacteria | 8019668869 | 8019673116 | 226 |
| 320 | iso_pu_bacteria | 8019678201 | 8019683022 | 226 |
| 321 | iso_pu_bacteria | 8019687851 | 8019688724 | 226 |
| 322 | iso_pu_bacteria | 8055742211 | 8055747576 | 226 |
| 323 | iso_pu_bacteria | 8056673599 | 8056680444 | 226 |
| 324 | iso_pu_bacteria | 8056967851 | 8056972347 | 226 |
| 325 | iso_pu_bacteria | 2522572158 | 2523104025 | 227 |
| 326 | iso_pu_bacteria | 2545555834 | 2545677338 | 227 |
| 327 | iso_pu_bacteria | 2643221736 | 2644744415 | 227 |
| 328 | iso_pu_bacteria | 2773857925 | 2774874185 | 227 |
| 329 | iso_pu_bacteria | 2818991467 | 2819720910 | 227 |
| 330 | iso_pu_bacteria | 2841760612 | 2841761365 | 227 |
| 331 | iso_pu_bacteria | 2841911363 | 2841913368 | 227 |
| 332 | iso_pu_bacteria | 2841917233 | 2841919115 | 227 |
| 333 | iso_pu_bacteria | 2844104063 | 2844104390 | 227 |
| 334 | iso_pu_bacteria | 2851246043 | 2851247378 | 227 |
| 335 | iso_pu_bacteria | 2882456835 | 2882462583 | 227 |
| 336 | iso_pu_bacteria | 2891088606 | 2891092096 | 227 |
| 337 | iso_pu_bacteria | 2909042592 | 2909043585 | 227 |
| 338 | iso_pu_bacteria | 3003665799 | 3003667727 | 227 |
| 339 | iso_pu_bacteria | 641522639 | 641640693 | 227 |
| 340 | iso_pu_bacteria | 643348564 | 643599631 | 227 |
| 341 | 3300009177 | Ga0105248_10875106 | Ga0105248_108751062 | 228 |
| 342 | 3300021361 | Ga0213872_10039595 | Ga0213872_100395953 | 228 |
| 343 | 3300021377 | Ga0213874_10027443 | Ga0213874_100274432 | 228 |
| 344 | 3300037853 | Ga0436364_0151877 | Ga0436364_0151877_895_1584 | 228 |
| 345 | 3300037853 | Ga0436364_0710968 | Ga0436364_0710968_3505_4194 | 228 |
| 346 | 3300039437 | Ga0436365_0019378 | Ga0436365_0019378_11_700 | 228 |
| 347 | 3300039447 | Ga0436361_0401767 | Ga0436361_0401767_678_1367 | 228 |
| 348 | iso_pu_bacteria | 2508501050 | 2508735848 | 228 |
| 349 | iso_pu_bacteria | 2508501114 | 2509078172 | 228 |
| 350 | iso_pu_bacteria | 2775506901 | 2776259121 | 228 |
| 351 | iso_pu_bacteria | 2835312727 | 2835319217 | 228 |
| 352 | iso_pu_bacteria | 2894232714 | 2894240339 | 228 |
| 353 | 3300005329 | Ga0070683_100390406 | Ga0070683_1003904061 | 229 |
| 354 | 3300005336 | Ga0070680_100272848 | Ga0070680_1002728482 | 229 |
| 355 | 3300005434 | Ga0070709_10212069 | Ga0070709_102120691 | 229 |
| 356 | 3300005435 | Ga0070714_100019282 | Ga0070714_1000192824 | 229 |
| 357 | 3300005435 | Ga0070714_100389456 | Ga0070714_1003894561 | 229 |
| 358 | 3300005436 | Ga0070713_100022916 | Ga0070713_1000229169 | 229 |
| 359 | 3300005436 | Ga0070713_100179069 | Ga0070713_1001790692 | 229 |
| 360 | 3300005436 | Ga0070713_100208085 | Ga0070713_1002080852 | 229 |
| 361 | 3300005437 | Ga0070710_10181230 | Ga0070710_101812302 | 229 |
| 362 | 3300005439 | Ga0070711_100010708 | Ga0070711_1000107085 | 229 |
| 363 | 3300005456 | Ga0070678_100049698 | Ga0070678_1000496983 | 229 |
| 364 | 3300005535 | Ga0070684_100973905 | Ga0070684_1009739051 | 229 |
| 365 | 3300005548 | Ga0070665_100103110 | Ga0070665_1001031105 | 229 |
| 366 | 3300005548 | Ga0070665_100111664 | Ga0070665_1001116642 | 229 |
| 367 | 3300005563 | Ga0068855_100190828 | Ga0068855_1001908283 | 229 |
| 368 | 3300005614 | Ga0068856_100142406 | Ga0068856_1001424061 | 229 |
| 369 | 3300006028 | Ga0070717_10185149 | Ga0070717_101851493 | 229 |
| 370 | 3300006173 | Ga0070716_100311633 | Ga0070716_1003116331 | 229 |
| 371 | 3300006173 | Ga0070716_100766704 | Ga0070716_1007667041 | 229 |
| 372 | 3300006175 | Ga0070712_100115865 | Ga0070712_1001158652 | 229 |
| 373 | 3300009098 | Ga0105245_10040292 | Ga0105245_100402921 | 229 |
| 374 | 3300009177 | Ga0105248_10935588 | Ga0105248_109355882 | 229 |
| 375 | 3300010375 | Ga0105239_10083384 | Ga0105239_100833842 | 229 |
| 376 | 3300013105 | Ga0157369_10598080 | Ga0157369_105980802 | 229 |
| 377 | 3300013306 | Ga0163162_10795937 | Ga0163162_107959371 | 229 |
| 378 | 3300014325 | Ga0163163_10388037 | Ga0163163_103880372 | 229 |
| 379 | 3300020082 | Ga0206353_10925790 | Ga0206353_109257901 | 229 |
| 380 | 3300021388 | Ga0213875_10002415 | Ga0213875_100024154 | 229 |
| 381 | 3300021388 | Ga0213875_10007252 | Ga0213875_100072524 | 229 |
| 382 | 3300021388 | Ga0213875_10260502 | Ga0213875_102605022 | 229 |
| 383 | 3300022467 | Ga0224712_10072693 | Ga0224712_100726932 | 229 |
| 384 | 3300025906 | Ga0207699_10035466 | Ga0207699_100354664 | 229 |
| 385 | 3300025916 | Ga0207663_10124238 | Ga0207663_101242383 | 229 |
| 386 | 3300025916 | Ga0207663_10776895 | Ga0207663_107768951 | 229 |
| 387 | 3300025917 | Ga0207660_10493856 | Ga0207660_104938561 | 229 |
| 388 | 3300025924 | Ga0207694_10004491 | Ga0207694_100044914 | 229 |
| 389 | 3300025929 | Ga0207664_10643022 | Ga0207664_106430221 | 229 |
| 390 | 3300025937 | Ga0207669_10440745 | Ga0207669_104407451 | 229 |
| 391 | 3300025939 | Ga0207665_10244713 | Ga0207665_102447132 | 229 |
| 392 | 3300025941 | Ga0207711_10563542 | Ga0207711_105635422 | 229 |
| 393 | 3300025941 | Ga0207711_10610209 | Ga0207711_106102092 | 229 |
| 394 | 3300025949 | Ga0207667_10663621 | Ga0207667_106636212 | 229 |
| 395 | 3300025986 | Ga0207658_10541401 | Ga0207658_105414011 | 229 |
| 396 | 3300026121 | Ga0207683_10055995 | Ga0207683_100559952 | 229 |
| 397 | 3300028379 | Ga0268266_10021990 | Ga0268266_100219903 | 229 |
| 398 | 3300029957 | Ga0265324_10139396 | Ga0265324_101393961 | 229 |
| 399 | 3300035086 | Ga0373934_0066027 | Ga0373934_0066027_583_1278 | 229 |
| 400 | 3300035111 | Ga0373923_0058010 | Ga0373923_0058010_403_1098 | 229 |
| 401 | 3300035117 | Ga0373953_0006359 | Ga0373953_0006359_1934_2629 | 229 |
| 402 | 3300035118 | Ga0373954_0029002 | Ga0373954_0029002_817_1512 | 229 |
| 403 | 3300035171 | Ga0373946_0026250 | Ga0373946_0026250_259_954 | 229 |
| 404 | 3300035171 | Ga0373946_0103214 | Ga0373946_0103214_505_1200 | 229 |
| 405 | 3300035172 | Ga0373955_0012485 | Ga0373955_0012485_392_1087 | 229 |
| 406 | 3300035172 | Ga0373955_0057248 | Ga0373955_0057248_1252_1947 | 229 |
| 407 | 3300035410 | Ga0373924_0019884 | Ga0373924_0019884_935_1630 | 229 |
| 408 | 3300035410 | Ga0373924_0118827 | Ga0373924_0118827_298_993 | 229 |
| 409 | 3300035692 | Ga0373935_0140146 | Ga0373935_0140146_219_914 | 229 |
| 410 | 3300035695 | Ga0373927_0026088 | Ga0373927_0026088_393_1088 | 229 |
| 411 | 3300035695 | Ga0373927_0044850 | Ga0373927_0044850_1356_2051 | 229 |
| 412 | 3300035724 | Ga0373933_0187259 | Ga0373933_0187259_97_792 | 229 |
| 413 | 3300035725 | Ga0373947_0089911 | Ga0373947_0089911_1190_1885 | 229 |
| 414 | 3300035725 | Ga0373947_0258886 | Ga0373947_0258886_404_1099 | 229 |
| 415 | 3300036401 | Ga0373937_0001523 | Ga0373937_0001523_18154_18849 | 229 |
| 416 | 3300036401 | Ga0373937_0016054 | Ga0373937_0016054_3415_4110 | 229 |
| 417 | 3300036401 | Ga0373937_0061550 | Ga0373937_0061550_2376_3071 | 229 |
| 418 | 3300036401 | Ga0373937_0079421 | Ga0373937_0079421_1221_1916 | 229 |
| 419 | 3300036401 | Ga0373937_0094576 | Ga0373937_0094576_1913_2608 | 229 |
| 420 | 3300037068 | Ga0373925_0091251 | Ga0373925_0091251_1018_1713 | 229 |
| 421 | 3300037312 | Ga0395899_0273410 | Ga0395899_0273410_420_1124 | 229 |
| 422 | 3300037418 | Ga0395900_0143765 | Ga0395900_0143765_69_773 | 229 |
| 423 | 3300037466 | Ga0395898_0320231 | Ga0395898_0320231_459_1148 | 229 |
| 424 | 3300037853 | Ga0436364_0037967 | Ga0436364_0037967_3463_4155 | 229 |
| 425 | 3300037853 | Ga0436364_0222612 | Ga0436364_0222612_957_1649 | 229 |
| 426 | 3300037853 | Ga0436364_0543555 | Ga0436364_0543555_1830_2522 | 229 |
| 427 | 3300037853 | Ga0436364_0729660 | Ga0436364_0729660_277_969 | 229 |
| 428 | 3300038443 | Ga0395901_0198481 | Ga0395901_0198481_953_1657 | 229 |
| 429 | 3300039437 | Ga0436365_1218945 | Ga0436365_1218945_12_704 | 229 |
| 430 | 3300039437 | Ga0436365_1478091 | Ga0436365_1478091_162_857 | 229 |
| 431 | 3300039447 | Ga0436361_0256683 | Ga0436361_0256683_3656_4348 | 229 |
| 432 | 3300044694 | Ga0466963_0275149 | Ga0466963_0275149_164_856 | 229 |
| 433 | 3300046459 | Ga0495629_0277038 | Ga0495629_0277038_22_717 | 229 |
| 434 | 3300046477 | Ga0495664_0004097 | Ga0495664_0004097_6674_7369 | 229 |
| 435 | 3300046511 | Ga0495608_0032272 | Ga0495608_0032272_85_780 | 229 |
| 436 | 3300046516 | Ga0495628_0505334 | Ga0495628_0505334_21_713 | 229 |
| 437 | 3300046517 | Ga0495630_0283867 | Ga0495630_0283867_552_1247 | 229 |
| 438 | 3300046529 | Ga0495652_0144241 | Ga0495652_0144241_866_1561 | 229 |
| 439 | 3300046536 | Ga0495587_0022854 | Ga0495587_0022854_1319_2014 | 229 |
| 440 | 3300046543 | Ga0495645_0021952 | Ga0495645_0021952_3622_4317 | 229 |
| 441 | 3300046559 | Ga0495667_0028353 | Ga0495667_0028353_368_1063 | 229 |
| 442 | 3300046559 | Ga0495667_0127056 | Ga0495667_0127056_500_1192 | 229 |
| 443 | 3300046663 | Ga0495635_0019579 | Ga0495635_0019579_2071_2766 | 229 |
| 444 | 3300046663 | Ga0495635_0093737 | Ga0495635_0093737_1027_1719 | 229 |
| 445 | 3300046680 | Ga0495646_0042905 | Ga0495646_0042905_2062_2757 | 229 |
| 446 | 3300047444 | Ga0495675_0105611 | Ga0495675_0105611_351_1046 | 229 |
| 447 | 3300047471 | Ga0495684_0061895 | Ga0495684_0061895_19_711 | 229 |
| 448 | 3300048088 | Ga0495602_0002050 | Ga0495602_0002050_19254_19949 | 229 |
| 449 | 3300048088 | Ga0495602_0432005 | Ga0495602_0432005_208_903 | 229 |
| 450 | 3300048915 | Ga0496112_0233004 | Ga0496112_0233004_440_1132 | 229 |
| 451 | 3300049589 | Ga0501073_0123017 | Ga0501073_0123017_227_919 | 229 |
| 452 | 3300053077 | Ga0495601_0012741 | Ga0495601_0012741_797_1492 | 229 |
| 453 | 3300053078 | Ga0495612_0088296 | Ga0495612_0088296_219_914 | 229 |
| 454 | 3300053084 | Ga0495595_0013111 | Ga0495595_0013111_2247_2942 | 229 |
| 455 | 3300053085 | Ga0495619_0009229 | Ga0495619_0009229_5371_6066 | 229 |
| 456 | 3300053085 | Ga0495619_0263531 | Ga0495619_0263531_454_1149 | 229 |
| 457 | 3300053091 | Ga0500647_0085818 | Ga0500647_0085818_383_1093 | 229 |
| 458 | 3300053119 | Ga0500595_008185 | Ga0500595_008185_3269_3973 | 229 |
| 459 | 3300059639 | Ga0587062_018598 | Ga0587062_018598_263_952 | 229 |
| 460 | 3300001979 | JGI24740J21852_10006544 | JGI24740J21852_100065441 | 230 |
| 461 | 3300001990 | JGI24737J22298_10118900 | JGI24737J22298_101189001 | 230 |
| 462 | 3300002987 | JGI25159J45721_1002156 | JGI25159J45721_10021564 | 230 |
| 463 | 3300003203 | JGI25406J46586_10015420 | JGI25406J46586_100154203 | 230 |
| 464 | 3300003203 | JGI25406J46586_10021918 | JGI25406J46586_100219183 | 230 |
| 465 | 3300003354 | JGI25160J50197_1020177 | JGI25160J50197_10201772 | 230 |
| 466 | 3300003752 | Ga0055539_1002956 | Ga0055539_10029562 | 230 |
| 467 | 3300003775 | Ga0055524_1051299 | Ga0055524_10512992 | 230 |
| 468 | 3300003794 | Ga0055531_10011502 | Ga0055531_100115025 | 230 |
| 469 | 3300005262 | Ga0065165_1003133 | Ga0065165_100313314 | 230 |
| 470 | 3300005262 | Ga0065165_1042814 | Ga0065165_10428142 | 230 |
| 471 | 3300005329 | Ga0070683_100126479 | Ga0070683_1001264792 | 230 |
| 472 | 3300005336 | Ga0070680_100062342 | Ga0070680_1000623426 | 230 |
| 473 | 3300005337 | Ga0070682_100179802 | Ga0070682_1001798022 | 230 |
| 474 | 3300005339 | Ga0070660_100406991 | Ga0070660_1004069912 | 230 |
| 475 | 3300005355 | Ga0070671_100118236 | Ga0070671_1001182362 | 230 |
| 476 | 3300005366 | Ga0070659_100058667 | Ga0070659_1000586676 | 230 |
| 477 | 3300005367 | Ga0070667_100609141 | Ga0070667_1006091411 | 230 |
| 478 | 3300005435 | Ga0070714_100288594 | Ga0070714_1002885942 | 230 |
| 479 | 3300005435 | Ga0070714_100998064 | Ga0070714_1009980641 | 230 |
| 480 | 3300005437 | Ga0070710_10359796 | Ga0070710_103597962 | 230 |
| 481 | 3300005441 | Ga0070700_100064069 | Ga0070700_1000640692 | 230 |
| 482 | 3300005455 | Ga0070663_100317161 | Ga0070663_1003171612 | 230 |
| 483 | 3300005455 | Ga0070663_100505232 | Ga0070663_1005052322 | 230 |
| 484 | 3300005456 | Ga0070678_100675296 | Ga0070678_1006752961 | 230 |
| 485 | 3300005457 | Ga0070662_100292697 | Ga0070662_1002926972 | 230 |
| 486 | 3300005458 | Ga0070681_10106321 | Ga0070681_101063211 | 230 |
| 487 | 3300005458 | Ga0070681_10248241 | Ga0070681_102482412 | 230 |
| 488 | 3300005471 | Ga0070698_100070102 | Ga0070698_1000701023 | 230 |
| 489 | 3300005530 | Ga0070679_100118983 | Ga0070679_1001189834 | 230 |
| 490 | 3300005530 | Ga0070679_100152926 | Ga0070679_1001529263 | 230 |
| 491 | 3300005535 | Ga0070684_100034836 | Ga0070684_1000348362 | 230 |
| 492 | 3300005535 | Ga0070684_100441902 | Ga0070684_1004419022 | 230 |
| 493 | 3300005539 | Ga0068853_100241007 | Ga0068853_1002410072 | 230 |
| 494 | 3300005539 | Ga0068853_100793681 | Ga0068853_1007936811 | 230 |
| 495 | 3300005545 | Ga0070695_100834418 | Ga0070695_1008344181 | 230 |
| 496 | 3300005577 | Ga0068857_100320409 | Ga0068857_1003204092 | 230 |
| 497 | 3300005577 | Ga0068857_100639596 | Ga0068857_1006395962 | 230 |
| 498 | 3300005578 | Ga0068854_100409771 | Ga0068854_1004097712 | 230 |
| 499 | 3300005614 | Ga0068856_100021546 | Ga0068856_1000215462 | 230 |
| 500 | 3300005614 | Ga0068856_100252340 | Ga0068856_1002523402 | 230 |
| 501 | 3300005616 | Ga0068852_100015467 | Ga0068852_1000154679 | 230 |
| 502 | 3300005616 | Ga0068852_100421037 | Ga0068852_1004210372 | 230 |
| 503 | 3300005616 | Ga0068852_100817705 | Ga0068852_1008177051 | 230 |
| 504 | 3300005617 | Ga0068859_100342391 | Ga0068859_1003423913 | 230 |
| 505 | 3300005834 | Ga0068851_10027996 | Ga0068851_100279962 | 230 |
| 506 | 3300005841 | Ga0068863_100371526 | Ga0068863_1003715262 | 230 |
| 507 | 3300005842 | Ga0068858_100835176 | Ga0068858_1008351761 | 230 |
| 508 | 3300005937 | Ga0081455_10198820 | Ga0081455_101988203 | 230 |
| 509 | 3300005983 | Ga0081540_1007542 | Ga0081540_10075426 | 230 |
| 510 | 3300005983 | Ga0081540_1061654 | Ga0081540_10616542 | 230 |
| 511 | 3300005985 | Ga0081539_10000203 | Ga0081539_100002032 | 230 |
| 512 | 3300005985 | Ga0081539_10169214 | Ga0081539_101692141 | 230 |
| 513 | 3300006028 | Ga0070717_10627211 | Ga0070717_106272112 | 230 |
| 514 | 3300006038 | Ga0075365_10516565 | Ga0075365_105165651 | 230 |
| 515 | 3300006042 | Ga0075368_10159166 | Ga0075368_101591662 | 230 |
| 516 | 3300006051 | Ga0075364_10123850 | Ga0075364_101238502 | 230 |
| 517 | 3300006163 | Ga0070715_10211023 | Ga0070715_102110232 | 230 |
| 518 | 3300006175 | Ga0070712_100369396 | Ga0070712_1003693961 | 230 |
| 519 | 3300006177 | Ga0075362_10167455 | Ga0075362_101674552 | 230 |
| 520 | 3300006178 | Ga0075367_10205354 | Ga0075367_102053542 | 230 |
| 521 | 3300006178 | Ga0075367_10270532 | Ga0075367_102705322 | 230 |
| 522 | 3300006186 | Ga0075369_10004408 | Ga0075369_100044083 | 230 |
| 523 | 3300006195 | Ga0075366_10016242 | Ga0075366_100162422 | 230 |
| 524 | 3300006358 | Ga0068871_100182392 | Ga0068871_1001823922 | 230 |
| 525 | 3300006844 | Ga0075428_100013627 | Ga0075428_1000136277 | 230 |
| 526 | 3300006847 | Ga0075431_100000592 | Ga0075431_10000059211 | 230 |
| 527 | 3300006871 | Ga0075434_100025679 | Ga0075434_1000256796 | 230 |
| 528 | 3300006880 | Ga0075429_100010041 | Ga0075429_1000100416 | 230 |
| 529 | 3300006881 | Ga0068865_100335350 | Ga0068865_1003353502 | 230 |
| 530 | 3300006931 | Ga0097620_100342402 | Ga0097620_1003424021 | 230 |
| 531 | 3300007076 | Ga0075435_100145714 | Ga0075435_1001457142 | 230 |
| 532 | 3300009092 | Ga0105250_10170109 | Ga0105250_101701092 | 230 |
| 533 | 3300009093 | Ga0105240_10085042 | Ga0105240_100850425 | 230 |
| 534 | 3300009093 | Ga0105240_10099593 | Ga0105240_100995935 | 230 |
| 535 | 3300009093 | Ga0105240_10159640 | Ga0105240_101596403 | 230 |
| 536 | 3300009093 | Ga0105240_10228535 | Ga0105240_102285353 | 230 |
| 537 | 3300009094 | Ga0111539_10015685 | Ga0111539_1001568512 | 230 |
| 538 | 3300009098 | Ga0105245_10351257 | Ga0105245_103512572 | 230 |
| 539 | 3300009101 | Ga0105247_10006535 | Ga0105247_100065358 | 230 |
| 540 | 3300009101 | Ga0105247_10197537 | Ga0105247_101975372 | 230 |
| 541 | 3300009147 | Ga0114129_10005303 | Ga0114129_100053036 | 230 |
| 542 | 3300009174 | Ga0105241_10019195 | Ga0105241_100191952 | 230 |
| 543 | 3300009174 | Ga0105241_10051229 | Ga0105241_100512295 | 230 |
| 544 | 3300009176 | Ga0105242_10213039 | Ga0105242_102130391 | 230 |
| 545 | 3300009545 | Ga0105237_10066390 | Ga0105237_100663904 | 230 |
| 546 | 3300009551 | Ga0105238_10002712 | Ga0105238_100027125 | 230 |
| 547 | 3300009551 | Ga0105238_10434856 | Ga0105238_104348562 | 230 |
| 548 | 3300009551 | Ga0105238_10446065 | Ga0105238_104460652 | 230 |
| 549 | 3300010375 | Ga0105239_10061953 | Ga0105239_100619532 | 230 |
| 550 | 3300010375 | Ga0105239_10318764 | Ga0105239_103187642 | 230 |
| 551 | 3300010375 | Ga0105239_10689815 | Ga0105239_106898152 | 230 |
| 552 | 3300013250 | Ga0171462_1060 | Ga0171462_106010 | 230 |
| 553 | 3300013296 | Ga0157374_10377197 | Ga0157374_103771972 | 230 |
| 554 | 3300013297 | Ga0157378_10676116 | Ga0157378_106761161 | 230 |
| 555 | 3300014326 | Ga0157380_10055924 | Ga0157380_100559246 | 230 |
| 556 | 3300014497 | Ga0182008_10088388 | Ga0182008_100883882 | 230 |
| 557 | 3300017792 | Ga0163161_10469409 | Ga0163161_104694092 | 230 |
| 558 | 3300021320 | Ga0214544_1000006 | Ga0214544_1000006198 | 230 |
| 559 | 3300021321 | Ga0214542_1000002 | Ga0214542_1000002177 | 230 |
| 560 | 3300021321 | Ga0214542_1040182 | Ga0214542_10401822 | 230 |
| 561 | 3300021324 | Ga0214545_1000002 | Ga0214545_1000002542 | 230 |
| 562 | 3300021327 | Ga0214543_1000017 | Ga0214543_1000017146 | 230 |
| 563 | 3300021327 | Ga0214543_1029778 | Ga0214543_10297781 | 230 |
| 564 | 3300021384 | Ga0213876_10034449 | Ga0213876_100344492 | 230 |
| 565 | 3300021388 | Ga0213875_10019916 | Ga0213875_100199166 | 230 |
| 566 | 3300021441 | Ga0213871_10011494 | Ga0213871_100114942 | 230 |
| 567 | 3300022467 | Ga0224712_10048753 | Ga0224712_100487531 | 230 |
| 568 | 3300025245 | Ga0207425_1025008 | Ga0207425_10250082 | 230 |
| 569 | 3300025253 | Ga0209677_100683 | Ga0209677_1006838 | 230 |
| 570 | 3300025254 | Ga0209148_1000448 | Ga0209148_100044813 | 230 |
| 571 | 3300025261 | Ga0209233_1004485 | Ga0209233_10044854 | 230 |
| 572 | 3300025261 | Ga0209233_1027410 | Ga0209233_10274102 | 230 |
| 573 | 3300025273 | Ga0209673_1023321 | Ga0209673_10233212 | 230 |
| 574 | 3300025284 | Ga0209130_1000845 | Ga0209130_100084514 | 230 |
| 575 | 3300025297 | Ga0209758_1000065 | Ga0209758_1000065332 | 230 |
| 576 | 3300025299 | Ga0209256_1008959 | Ga0209256_10089592 | 230 |
| 577 | 3300025302 | Ga0207426_1013929 | Ga0207426_10139293 | 230 |
| 578 | 3300025303 | Ga0209051_1014715 | Ga0209051_10147153 | 230 |
| 579 | 3300025304 | Ga0209257_1000869 | Ga0209257_10008695 | 230 |
| 580 | 3300025898 | Ga0207692_10042273 | Ga0207692_100422733 | 230 |
| 581 | 3300025900 | Ga0207710_10049330 | Ga0207710_100493302 | 230 |
| 582 | 3300025901 | Ga0207688_10006338 | Ga0207688_100063386 | 230 |
| 583 | 3300025901 | Ga0207688_10217127 | Ga0207688_102171272 | 230 |
| 584 | 3300025909 | Ga0207705_10134492 | Ga0207705_101344922 | 230 |
| 585 | 3300025909 | Ga0207705_10156695 | Ga0207705_101566952 | 230 |
| 586 | 3300025910 | Ga0207684_10198787 | Ga0207684_101987872 | 230 |
| 587 | 3300025911 | Ga0207654_10000241 | Ga0207654_1000024113 | 230 |
| 588 | 3300025913 | Ga0207695_10000159 | Ga0207695_10000159164 | 230 |
| 589 | 3300025913 | Ga0207695_10001032 | Ga0207695_1000103245 | 230 |
| 590 | 3300025913 | Ga0207695_10061566 | Ga0207695_100615662 | 230 |
| 591 | 3300025913 | Ga0207695_10477455 | Ga0207695_104774552 | 230 |
| 592 | 3300025914 | Ga0207671_10033318 | Ga0207671_100333183 | 230 |
| 593 | 3300025915 | Ga0207693_10001370 | Ga0207693_100013706 | 230 |
| 594 | 3300025915 | Ga0207693_10196555 | Ga0207693_101965552 | 230 |
| 595 | 3300025915 | Ga0207693_10287595 | Ga0207693_102875952 | 230 |
| 596 | 3300025921 | Ga0207652_10088570 | Ga0207652_100885702 | 230 |
| 597 | 3300025921 | Ga0207652_10090827 | Ga0207652_100908274 | 230 |
| 598 | 3300025924 | Ga0207694_10000271 | Ga0207694_1000027135 | 230 |
| 599 | 3300025928 | Ga0207700_10136289 | Ga0207700_101362893 | 230 |
| 600 | 3300025929 | Ga0207664_10114737 | Ga0207664_101147372 | 230 |
| 601 | 3300025929 | Ga0207664_10483276 | Ga0207664_104832761 | 230 |
| 602 | 3300025939 | Ga0207665_10525581 | Ga0207665_105255811 | 230 |
| 603 | 3300025941 | Ga0207711_10493382 | Ga0207711_104933822 | 230 |
| 604 | 3300025944 | Ga0207661_10302349 | Ga0207661_103023492 | 230 |
| 605 | 3300025949 | Ga0207667_10005212 | Ga0207667_1000521218 | 230 |
| 606 | 3300025960 | Ga0207651_10363665 | Ga0207651_103636652 | 230 |
| 607 | 3300025961 | Ga0207712_10336703 | Ga0207712_103367032 | 230 |
| 608 | 3300025972 | Ga0207668_10245757 | Ga0207668_102457572 | 230 |
| 609 | 3300025981 | Ga0207640_10558438 | Ga0207640_105584381 | 230 |
| 610 | 3300026023 | Ga0207677_10379819 | Ga0207677_103798192 | 230 |
| 611 | 3300026041 | Ga0207639_10073925 | Ga0207639_100739255 | 230 |
| 612 | 3300026067 | Ga0207678_10201143 | Ga0207678_102011432 | 230 |
| 613 | 3300026067 | Ga0207678_10272069 | Ga0207678_102720692 | 230 |
| 614 | 3300026075 | Ga0207708_10201318 | Ga0207708_102013181 | 230 |
| 615 | 3300026078 | Ga0207702_10000005 | Ga0207702_10000005219 | 230 |
| 616 | 3300026088 | Ga0207641_10230932 | Ga0207641_102309321 | 230 |
| 617 | 3300026089 | Ga0207648_10359249 | Ga0207648_103592492 | 230 |
| 618 | 3300026118 | Ga0207675_100755057 | Ga0207675_1007550571 | 230 |
| 619 | 3300026121 | Ga0207683_10169868 | Ga0207683_101698682 | 230 |
| 620 | 3300026142 | Ga0207698_10037943 | Ga0207698_100379434 | 230 |
| 621 | 3300026142 | Ga0207698_10732212 | Ga0207698_107322122 | 230 |
| 622 | 3300027357 | Ga0209589_1000300 | Ga0209589_10003005 | 230 |
| 623 | 3300027361 | Ga0209489_100906 | Ga0209489_10090613 | 230 |
| 624 | 3300027361 | Ga0209489_110266 | Ga0209489_1102666 | 230 |
| 625 | 3300027363 | Ga0209700_100031 | Ga0209700_100031150 | 230 |
| 626 | 3300027907 | Ga0207428_10018951 | Ga0207428_100189518 | 230 |
| 627 | 3300028379 | Ga0268266_10452658 | Ga0268266_104526582 | 230 |
| 628 | 3300028800 | Ga0265338_10076368 | Ga0265338_100763682 | 230 |
| 629 | 3300031238 | Ga0265332_10214210 | Ga0265332_102142101 | 230 |
| 630 | 3300031239 | Ga0265328_10052526 | Ga0265328_100525262 | 230 |
| 631 | 3300031241 | Ga0265325_10034182 | Ga0265325_100341823 | 230 |
| 632 | 3300031241 | Ga0265325_10198984 | Ga0265325_101989842 | 230 |
| 633 | 3300031247 | Ga0265340_10013890 | Ga0265340_100138903 | 230 |
| 634 | 3300031247 | Ga0265340_10017672 | Ga0265340_100176723 | 230 |
| 635 | 3300031247 | Ga0265340_10038726 | Ga0265340_100387262 | 230 |
| 636 | 3300031247 | Ga0265340_10081614 | Ga0265340_100816142 | 230 |
| 637 | 3300031247 | Ga0265340_10091474 | Ga0265340_100914742 | 230 |
| 638 | 3300031249 | Ga0265339_10002960 | Ga0265339_100029602 | 230 |
| 639 | 3300031249 | Ga0265339_10041867 | Ga0265339_100418673 | 230 |
| 640 | 3300031249 | Ga0265339_10057698 | Ga0265339_100576982 | 230 |
| 641 | 3300031249 | Ga0265339_10061098 | Ga0265339_100610983 | 230 |
| 642 | 3300031344 | Ga0265316_10016971 | Ga0265316_100169718 | 230 |
| 643 | 3300031344 | Ga0265316_10031977 | Ga0265316_100319774 | 230 |
| 644 | 3300031344 | Ga0265316_10045654 | Ga0265316_100456544 | 230 |
| 645 | 3300031344 | Ga0265316_10117099 | Ga0265316_101170993 | 230 |
| 646 | 3300031548 | Ga0307408_100096057 | Ga0307408_1000960572 | 230 |
| 647 | 3300031595 | Ga0265313_10000031 | Ga0265313_1000003168 | 230 |
| 648 | 3300031595 | Ga0265313_10010610 | Ga0265313_100106101 | 230 |
| 649 | 3300031595 | Ga0265313_10022279 | Ga0265313_100222793 | 230 |
| 650 | 3300031595 | Ga0265313_10033193 | Ga0265313_100331933 | 230 |
| 651 | 3300031711 | Ga0265314_10026660 | Ga0265314_100266604 | 230 |
| 652 | 3300031712 | Ga0265342_10001389 | Ga0265342_100013895 | 230 |
| 653 | 3300031712 | Ga0265342_10012909 | Ga0265342_100129097 | 230 |
| 654 | 3300031731 | Ga0307405_10282490 | Ga0307405_102824901 | 230 |
| 655 | 3300031901 | Ga0307406_10433396 | Ga0307406_104333962 | 230 |
| 656 | 3300031995 | Ga0307409_100632209 | Ga0307409_1006322092 | 230 |
| 657 | 3300032002 | Ga0307416_100142164 | Ga0307416_1001421643 | 230 |
| 658 | 3300032004 | Ga0307414_10099306 | Ga0307414_100993064 | 230 |
| 659 | 3300032126 | Ga0307415_100478750 | Ga0307415_1004787502 | 230 |
| 660 | 3300035083 | Ga0373926_0046832 | Ga0373926_0046832_753_1445 | 230 |
| 661 | 3300035086 | Ga0373934_0048159 | Ga0373934_0048159_675_1367 | 230 |
| 662 | 3300035111 | Ga0373923_0021854 | Ga0373923_0021854_1110_1802 | 230 |
| 663 | 3300035116 | Ga0373945_0005479 | Ga0373945_0005479_2714_3406 | 230 |
| 664 | 3300035117 | Ga0373953_0044823 | Ga0373953_0044823_1058_1750 | 230 |
| 665 | 3300035118 | Ga0373954_0006466 | Ga0373954_0006466_1912_2604 | 230 |
| 666 | 3300035119 | Ga0373956_0028773 | Ga0373956_0028773_1658_2350 | 230 |
| 667 | 3300035170 | Ga0373943_0060393 | Ga0373943_0060393_57_749 | 230 |
| 668 | 3300035171 | Ga0373946_0045597 | Ga0373946_0045597_1066_1758 | 230 |
| 669 | 3300035410 | Ga0373924_0014546 | Ga0373924_0014546_1070_1762 | 230 |
| 670 | 3300035692 | Ga0373935_0263836 | Ga0373935_0263836_96_788 | 230 |
| 671 | 3300035695 | Ga0373927_0122464 | Ga0373927_0122464_492_1184 | 230 |
| 672 | 3300035724 | Ga0373933_0115895 | Ga0373933_0115895_22_714 | 230 |
| 673 | 3300035725 | Ga0373947_0064960 | Ga0373947_0064960_662_1354 | 230 |
| 674 | 3300036242 | Ga0310104_00647 | Ga0310104_00647_173_865 | 230 |
| 675 | 3300036401 | Ga0373937_0262392 | Ga0373937_0262392_695_1387 | 230 |
| 676 | 3300036401 | Ga0373937_0309676 | Ga0373937_0309676_368_1060 | 230 |
| 677 | 3300036534 | Ga0310109_018735 | Ga0310109_018735_132_824 | 230 |
| 678 | 3300037068 | Ga0373925_0010512 | Ga0373925_0010512_5485_6177 | 230 |
| 679 | 3300037471 | Ga0395905_0025407 | Ga0395905_0025407_1535_2227 | 230 |
| 680 | 3300037471 | Ga0395905_0077411 | Ga0395905_0077411_1894_2586 | 230 |
| 681 | 3300037471 | Ga0395905_0090669 | Ga0395905_0090669_365_1063 | 230 |
| 682 | 3300037853 | Ga0436364_0785067 | Ga0436364_0785067_388_1080 | 230 |
| 683 | 3300038443 | Ga0395901_0104618 | Ga0395901_0104618_689_1381 | 230 |
| 684 | 3300038443 | Ga0395901_0337694 | Ga0395901_0337694_722_1414 | 230 |
| 685 | 3300039437 | Ga0436365_1173928 | Ga0436365_1173928_287_979 | 230 |
| 686 | 3300039437 | Ga0436365_1531521 | Ga0436365_1531521_72_764 | 230 |
| 687 | 3300039438 | Ga0436360_0755908 | Ga0436360_0755908_49_762 | 230 |
| 688 | 3300039438 | Ga0436360_1136386 | Ga0436360_1136386_1728_2423 | 230 |
| 689 | 3300039447 | Ga0436361_0034599 | Ga0436361_0034599_965_1678 | 230 |
| 690 | 3300039450 | Ga0436363_0691096 | Ga0436363_0691096_15_716 | 230 |
| 691 | 3300039450 | Ga0436363_1149677 | Ga0436363_1149677_880_1572 | 230 |
| 692 | 3300039453 | Ga0436362_0294583 | Ga0436362_0294583_216_911 | 230 |
| 693 | 3300041452 | Ga0451793_0379144 | Ga0451793_0379144_145_837 | 230 |
| 694 | 3300041492 | Ga0451835_1046652 | Ga0451835_1046652_116_811 | 230 |
| 695 | 3300044656 | Ga0466969_0012702 | Ga0466969_0012702_3398_4090 | 230 |
| 696 | 3300044683 | Ga0466965_0012547 | Ga0466965_0012547_1092_1784 | 230 |
| 697 | 3300044683 | Ga0466965_0150110 | Ga0466965_0150110_273_977 | 230 |
| 698 | 3300044684 | Ga0466966_0006998 | Ga0466966_0006998_573_1265 | 230 |
| 699 | 3300044693 | Ga0466961_0001042 | Ga0466961_0001042_3298_3990 | 230 |
| 700 | 3300044712 | Ga0453684_0017854 | Ga0453684_0017854_8528_9232 | 230 |
| 701 | 3300044901 | Ga0466960_0066674 | Ga0466960_0066674_917_1615 | 230 |
| 702 | 3300044901 | Ga0466960_0136510 | Ga0466960_0136510_206_904 | 230 |
| 703 | 3300045049 | Ga0466959_0037237 | Ga0466959_0037237_2207_2899 | 230 |
| 704 | 3300045051 | Ga0451576_0027584 | Ga0451576_0027584_4387_5091 | 230 |
| 705 | 3300045976 | Ga0466967_0302098 | Ga0466967_0302098_430_1131 | 230 |
| 706 | 3300045976 | Ga0466967_0316952 | Ga0466967_0316952_39_734 | 230 |
| 707 | 3300045976 | Ga0466967_0328941 | Ga0466967_0328941_337_1029 | 230 |
| 708 | 3300045976 | Ga0466967_0579619 | Ga0466967_0579619_347_1051 | 230 |
| 709 | 3300046454 | Ga0495592_0062965 | Ga0495592_0062965_1312_2004 | 230 |
| 710 | 3300046462 | Ga0495651_0006487 | Ga0495651_0006487_1751_2443 | 230 |
| 711 | 3300046462 | Ga0495651_0227101 | Ga0495651_0227101_177_869 | 230 |
| 712 | 3300046472 | Ga0495580_0082513 | Ga0495580_0082513_1015_1707 | 230 |
| 713 | 3300046475 | Ga0495639_0015064 | Ga0495639_0015064_1316_2008 | 230 |
| 714 | 3300046476 | Ga0495662_0094943 | Ga0495662_0094943_377_1069 | 230 |
| 715 | 3300046477 | Ga0495664_0049176 | Ga0495664_0049176_78_770 | 230 |
| 716 | 3300046477 | Ga0495664_0114614 | Ga0495664_0114614_122_814 | 230 |
| 717 | 3300046507 | Ga0495606_0058293 | Ga0495606_0058293_76_768 | 230 |
| 718 | 3300046511 | Ga0495608_0104518 | Ga0495608_0104518_431_1123 | 230 |
| 719 | 3300046514 | Ga0495618_0219611 | Ga0495618_0219611_475_1167 | 230 |
| 720 | 3300046516 | Ga0495628_0031219 | Ga0495628_0031219_1814_2506 | 230 |
| 721 | 3300046516 | Ga0495628_0321290 | Ga0495628_0321290_381_1073 | 230 |
| 722 | 3300046517 | Ga0495630_0054203 | Ga0495630_0054203_1955_2647 | 230 |
| 723 | 3300046522 | Ga0495643_0005458 | Ga0495643_0005458_4588_5280 | 230 |
| 724 | 3300046524 | Ga0495648_0001345 | Ga0495648_0001345_2516_3208 | 230 |
| 725 | 3300046529 | Ga0495652_0116807 | Ga0495652_0116807_1062_1754 | 230 |
| 726 | 3300046531 | Ga0495665_0095569 | Ga0495665_0095569_450_1142 | 230 |
| 727 | 3300046533 | Ga0495640_0107065 | Ga0495640_0107065_449_1141 | 230 |
| 728 | 3300046536 | Ga0495587_0019372 | Ga0495587_0019372_2094_2786 | 230 |
| 729 | 3300046543 | Ga0495645_0016837 | Ga0495645_0016837_1660_2352 | 230 |
| 730 | 3300046557 | Ga0495622_0132102 | Ga0495622_0132102_376_1068 | 230 |
| 731 | 3300046642 | Ga0495634_0446621 | Ga0495634_0446621_23_715 | 230 |
| 732 | 3300046663 | Ga0495635_0066384 | Ga0495635_0066384_58_750 | 230 |
| 733 | 3300046665 | Ga0495661_0073375 | Ga0495661_0073375_62_754 | 230 |
| 734 | 3300046674 | Ga0495588_0025384 | Ga0495588_0025384_487_1179 | 230 |
| 735 | 3300046675 | Ga0495657_0006873 | Ga0495657_0006873_1788_2480 | 230 |
| 736 | 3300046679 | Ga0495623_0198251 | Ga0495623_0198251_137_829 | 230 |
| 737 | 3300046689 | Ga0495613_0261537 | Ga0495613_0261537_466_1158 | 230 |
| 738 | 3300046690 | Ga0495624_0116424 | Ga0495624_0116424_594_1286 | 230 |
| 739 | 3300046692 | Ga0495671_0125023 | Ga0495671_0125023_275_967 | 230 |
| 740 | 3300047317 | Ga0495604_0018557 | Ga0495604_0018557_2651_3343 | 230 |
| 741 | 3300047319 | Ga0495674_0010957 | Ga0495674_0010957_2397_3089 | 230 |
| 742 | 3300047319 | Ga0495674_0030102 | Ga0495674_0030102_2160_2852 | 230 |
| 743 | 3300047321 | Ga0495676_0086785 | Ga0495676_0086785_1087_1779 | 230 |
| 744 | 3300047322 | Ga0495680_0010280 | Ga0495680_0010280_4544_5236 | 230 |
| 745 | 3300047443 | Ga0495687_054433 | Ga0495687_054433_589_1281 | 230 |
| 746 | 3300047469 | Ga0495673_0108344 | Ga0495673_0108344_238_930 | 230 |
| 747 | 3300047673 | Ga0495593_0020272 | Ga0495593_0020272_1327_2019 | 230 |
| 748 | 3300048089 | Ga0495614_0049654 | Ga0495614_0049654_47_739 | 230 |
| 749 | 3300048904 | Ga0496101_0247428 | Ga0496101_0247428_191_883 | 230 |
| 750 | 3300048905 | Ga0496102_0014053 | Ga0496102_0014053_991_1683 | 230 |
| 751 | 3300048906 | Ga0496103_0070753 | Ga0496103_0070753_1017_1709 | 230 |
| 752 | 3300048906 | Ga0496103_0516916 | Ga0496103_0516916_57_749 | 230 |
| 753 | 3300048907 | Ga0496104_0868138 | Ga0496104_0868138_65_757 | 230 |
| 754 | 3300048908 | Ga0496105_0104291 | Ga0496105_0104291_345_1037 | 230 |
| 755 | 3300048909 | Ga0496106_0040983 | Ga0496106_0040983_2718_3410 | 230 |
| 756 | 3300048918 | Ga0496115_0133482 | Ga0496115_0133482_558_1256 | 230 |
| 757 | 3300048919 | Ga0496116_0102459 | Ga0496116_0102459_847_1539 | 230 |
| 758 | 3300048920 | Ga0496117_0117952 | Ga0496117_0117952_438_1130 | 230 |
| 759 | 3300048921 | Ga0496118_0051579 | Ga0496118_0051579_105_797 | 230 |
| 760 | 3300048921 | Ga0496118_0068478 | Ga0496118_0068478_650_1342 | 230 |
| 761 | 3300048921 | Ga0496118_0073236 | Ga0496118_0073236_323_1015 | 230 |
| 762 | 3300048922 | Ga0496119_0032055 | Ga0496119_0032055_1875_2567 | 230 |
| 763 | 3300048924 | Ga0496121_0034197 | Ga0496121_0034197_2514_3206 | 230 |
| 764 | 3300048924 | Ga0496121_0038417 | Ga0496121_0038417_3469_4161 | 230 |
| 765 | 3300048924 | Ga0496121_0149530 | Ga0496121_0149530_595_1287 | 230 |
| 766 | 3300048929 | Ga0496126_0062852 | Ga0496126_0062852_1245_1937 | 230 |
| 767 | 3300048929 | Ga0496126_0081188 | Ga0496126_0081188_1668_2360 | 230 |
| 768 | 3300048929 | Ga0496126_0088742 | Ga0496126_0088742_706_1398 | 230 |
| 769 | 3300048929 | Ga0496126_0175147 | Ga0496126_0175147_896_1597 | 230 |
| 770 | 3300049460 | Ga0495682_0137662 | Ga0495682_0137662_50_742 | 230 |
| 771 | 3300049529 | Ga0501313_014437 | Ga0501313_014437_217_921 | 230 |
| 772 | 3300049534 | Ga0501318_003335 | Ga0501318_003335_652_1350 | 230 |
| 773 | 3300049541 | Ga0501325_005704 | Ga0501325_005704_283_984 | 230 |
| 774 | 3300049568 | Ga0501031_0033490 | Ga0501031_0033490_540_1241 | 230 |
| 775 | 3300049568 | Ga0501031_0476243 | Ga0501031_0476243_20_712 | 230 |
| 776 | 3300049569 | Ga0501032_0065064 | Ga0501032_0065064_1590_2285 | 230 |
| 777 | 3300049569 | Ga0501032_0132961 | Ga0501032_0132961_327_1019 | 230 |
| 778 | 3300049569 | Ga0501032_0236737 | Ga0501032_0236737_230_922 | 230 |
| 779 | 3300049569 | Ga0501032_0443390 | Ga0501032_0443390_30_722 | 230 |
| 780 | 3300049569 | Ga0501032_0533912 | Ga0501032_0533912_29_721 | 230 |
| 781 | 3300049570 | Ga0501033_0167257 | Ga0501033_0167257_659_1351 | 230 |
| 782 | 3300049571 | Ga0501034_0106577 | Ga0501034_0106577_1639_2334 | 230 |
| 783 | 3300049571 | Ga0501034_0206678 | Ga0501034_0206678_450_1145 | 230 |
| 784 | 3300049571 | Ga0501034_0354864 | Ga0501034_0354864_425_1120 | 230 |
| 785 | 3300049571 | Ga0501034_0364593 | Ga0501034_0364593_380_1084 | 230 |
| 786 | 3300049571 | Ga0501034_0417156 | Ga0501034_0417156_376_1071 | 230 |
| 787 | 3300049571 | Ga0501034_0497150 | Ga0501034_0497150_83_778 | 230 |
| 788 | 3300049572 | Ga0501036_0099384 | Ga0501036_0099384_262_957 | 230 |
| 789 | 3300049573 | Ga0501037_0062660 | Ga0501037_0062660_739_1434 | 230 |
| 790 | 3300049573 | Ga0501037_0071342 | Ga0501037_0071342_1548_2246 | 230 |
| 791 | 3300049574 | Ga0501038_0457422 | Ga0501038_0457422_172_864 | 230 |
| 792 | 3300049575 | Ga0501039_0367788 | Ga0501039_0367788_370_1062 | 230 |
| 793 | 3300049578 | Ga0501042_0017621 | Ga0501042_0017621_170_862 | 230 |
| 794 | 3300049578 | Ga0501042_0032164 | Ga0501042_0032164_839_1540 | 230 |
| 795 | 3300049579 | Ga0501043_0252396 | Ga0501043_0252396_425_1126 | 230 |
| 796 | 3300049579 | Ga0501043_0257633 | Ga0501043_0257633_162_854 | 230 |
| 797 | 3300049579 | Ga0501043_0494517 | Ga0501043_0494517_163_858 | 230 |
| 798 | 3300049579 | Ga0501043_0540834 | Ga0501043_0540834_59_751 | 230 |
| 799 | 3300049580 | Ga0501046_0037628 | Ga0501046_0037628_2285_2977 | 230 |
| 800 | 3300049580 | Ga0501046_0087784 | Ga0501046_0087784_729_1424 | 230 |
| 801 | 3300049581 | Ga0501047_0042057 | Ga0501047_0042057_677_1381 | 230 |
| 802 | 3300049581 | Ga0501047_0050870 | Ga0501047_0050870_2262_2957 | 230 |
| 803 | 3300049581 | Ga0501047_0228391 | Ga0501047_0228391_863_1558 | 230 |
| 804 | 3300049581 | Ga0501047_0393822 | Ga0501047_0393822_52_747 | 230 |
| 805 | 3300049581 | Ga0501047_0428229 | Ga0501047_0428229_320_1015 | 230 |
| 806 | 3300049581 | Ga0501047_0501722 | Ga0501047_0501722_285_977 | 230 |
| 807 | 3300049583 | Ga0501067_0025975 | Ga0501067_0025975_1374_2069 | 230 |
| 808 | 3300049583 | Ga0501067_0052548 | Ga0501067_0052548_891_1586 | 230 |
| 809 | 3300049585 | Ga0501069_0398237 | Ga0501069_0398237_52_747 | 230 |
| 810 | 3300049586 | Ga0501070_0005291 | Ga0501070_0005291_3337_4032 | 230 |
| 811 | 3300049586 | Ga0501070_0011623 | Ga0501070_0011623_6616_7308 | 230 |
| 812 | 3300049586 | Ga0501070_0270440 | Ga0501070_0270440_673_1365 | 230 |
| 813 | 3300049586 | Ga0501070_0611381 | Ga0501070_0611381_158_850 | 230 |
| 814 | 3300049587 | Ga0501071_0055463 | Ga0501071_0055463_1429_2130 | 230 |
| 815 | 3300049589 | Ga0501073_0021046 | Ga0501073_0021046_501_1196 | 230 |
| 816 | 3300049589 | Ga0501073_0117682 | Ga0501073_0117682_1018_1713 | 230 |
| 817 | 3300049589 | Ga0501073_0124403 | Ga0501073_0124403_599_1291 | 230 |
| 818 | 3300049589 | Ga0501073_0250222 | Ga0501073_0250222_519_1211 | 230 |
| 819 | 3300049590 | Ga0501074_0002236 | Ga0501074_0002236_7673_8368 | 230 |
| 820 | 3300049591 | Ga0501075_0618678 | Ga0501075_0618678_95_787 | 230 |
| 821 | 3300049592 | Ga0501076_0025959 | Ga0501076_0025959_1767_2468 | 230 |
| 822 | 3300049671 | Ga0501238_002463 | Ga0501238_002463_1475_2173 | 230 |
| 823 | 3300049680 | Ga0501250_019988 | Ga0501250_019988_15_719 | 230 |
| 824 | 3300049741 | Ga0501079_0286319 | Ga0501079_0286319_62_757 | 230 |
| 825 | 3300049742 | Ga0501080_0006112 | Ga0501080_0006112_3464_4159 | 230 |
| 826 | 3300049742 | Ga0501080_0040617 | Ga0501080_0040617_1435_2130 | 230 |
| 827 | 3300049744 | Ga0501083_0026188 | Ga0501083_0026188_989_1684 | 230 |
| 828 | 3300049744 | Ga0501083_0078012 | Ga0501083_0078012_287_982 | 230 |
| 829 | 3300049822 | Ga0501035_0046134 | Ga0501035_0046134_2049_2744 | 230 |
| 830 | 3300049822 | Ga0501035_0407934 | Ga0501035_0407934_68_760 | 230 |
| 831 | 3300049823 | Ga0501044_0042664 | Ga0501044_0042664_2309_3001 | 230 |
| 832 | 3300049823 | Ga0501044_0062308 | Ga0501044_0062308_308_1003 | 230 |
| 833 | 3300049823 | Ga0501044_0066525 | Ga0501044_0066525_1517_2212 | 230 |
| 834 | 3300049823 | Ga0501044_0121256 | Ga0501044_0121256_1888_2580 | 230 |
| 835 | 3300049823 | Ga0501044_0174818 | Ga0501044_0174818_151_846 | 230 |
| 836 | 3300049823 | Ga0501044_0176929 | Ga0501044_0176929_331_1023 | 230 |
| 837 | 3300049823 | Ga0501044_0242990 | Ga0501044_0242990_380_1084 | 230 |
| 838 | 3300049823 | Ga0501044_0300728 | Ga0501044_0300728_652_1344 | 230 |
| 839 | 3300049823 | Ga0501044_0307150 | Ga0501044_0307150_786_1478 | 230 |
| 840 | 3300049823 | Ga0501044_0508266 | Ga0501044_0508266_52_747 | 230 |
| 841 | 3300049823 | Ga0501044_0549649 | Ga0501044_0549649_219_911 | 230 |
| 842 | 3300049823 | Ga0501044_0683934 | Ga0501044_0683934_144_836 | 230 |
| 843 | 3300049824 | Ga0501045_0517217 | Ga0501045_0517217_181_873 | 230 |
| 844 | 3300050489 | nmdc:mga03683_119094_c1 | nmdc:mga03683_119094_c1_342_1034 | 230 |
| 845 | 3300050490 | nmdc:mga03n38_81694_c1 | nmdc:mga03n38_81694_c1_589_1281 | 230 |
| 846 | 3300050492 | nmdc:mga0yw44_9723_c1 | nmdc:mga0yw44_9723_c1_457_1149 | 230 |
| 847 | 3300050494 | nmdc:mga06z11_5686_c1 | nmdc:mga06z11_5686_c1_3746_4438 | 230 |
| 848 | 3300050495 | nmdc:mga04h51_6599_c1 | nmdc:mga04h51_6599_c1_1830_2522 | 230 |
| 849 | 3300050496 | nmdc:mga07m45_122292_c1 | nmdc:mga07m45_122292_c1_372_1064 | 230 |
| 850 | 3300050507 | nmdc:mga05p37_1686_c1 | nmdc:mga05p37_1686_c1_12964_13674 | 230 |
| 851 | 3300050508 | nmdc:mga09592_9760_c1 | nmdc:mga09592_9760_c1_3061_3771 | 230 |
| 852 | 3300050510 | nmdc:mga06r32_37775_c1 | nmdc:mga06r32_37775_c1_2489_3199 | 230 |
| 853 | 3300050511 | nmdc:mga08y16_11167_c1 | nmdc:mga08y16_11167_c1_6357_7067 | 230 |
| 854 | 3300050511 | nmdc:mga08y16_275826_c1 | nmdc:mga08y16_275826_c1_244_936 | 230 |
| 855 | 3300050512 | nmdc:mga0n895_17709_c1 | nmdc:mga0n895_17709_c1_3327_4019 | 230 |
| 856 | 3300050513 | nmdc:mga0rr50_126499_c1 | nmdc:mga0rr50_126499_c1_935_1627 | 230 |
| 857 | 3300050516 | nmdc:mga0sz30_4401_c1 | nmdc:mga0sz30_4401_c1_746_1447 | 230 |
| 858 | 3300050516 | nmdc:mga0sz30_59009_c1 | nmdc:mga0sz30_59009_c1_162_854 | 230 |
| 859 | 3300050516 | nmdc:mga0sz30_6678_c1 | nmdc:mga0sz30_6678_c1_947_1639 | 230 |
| 860 | 3300053080 | Ga0500635_0033363 | Ga0500635_0033363_720_1412 | 230 |
| 861 | 3300053083 | Ga0495655_0059215 | Ga0495655_0059215_58_750 | 230 |
| 862 | 3300053085 | Ga0495619_0166775 | Ga0495619_0166775_385_1077 | 230 |
| 863 | 3300053086 | Ga0500578_0338260 | Ga0500578_0338260_63_755 | 230 |
| 864 | 3300053087 | Ga0500643_000335 | Ga0500643_000335_13829_14521 | 230 |
| 865 | 3300053090 | Ga0500646_0024974 | Ga0500646_0024974_578_1270 | 230 |
| 866 | 3300053091 | Ga0500647_0152877 | Ga0500647_0152877_349_1041 | 230 |
| 867 | 3300053093 | Ga0500651_0030743 | Ga0500651_0030743_1142_1834 | 230 |
| 868 | 3300053093 | Ga0500651_0094767 | Ga0500651_0094767_1116_1808 | 230 |
| 869 | 3300053094 | Ga0500566_0004695 | Ga0500566_0004695_2759_3451 | 230 |
| 870 | 3300053103 | Ga0500555_011238 | Ga0500555_011238_756_1448 | 230 |
| 871 | 3300053105 | Ga0500557_000010 | Ga0500557_000010_23644_24336 | 230 |
| 872 | 3300053111 | Ga0500572_000157 | Ga0500572_000157_21511_22203 | 230 |
| 873 | 3300053121 | Ga0500607_076810 | Ga0500607_076810_196_888 | 230 |
| 874 | 3300053122 | Ga0500608_011045 | Ga0500608_011045_414_1106 | 230 |
| 875 | 3300053123 | Ga0500614_036280 | Ga0500614_036280_331_1023 | 230 |
| 876 | 3300053130 | Ga0500642_0003300 | Ga0500642_0003300_263_955 | 230 |
| 877 | 3300053131 | Ga0500652_010380 | Ga0500652_010380_1072_1764 | 230 |
| 878 | 3300053136 | Ga0500559_0020416 | Ga0500559_0020416_1516_2208 | 230 |
| 879 | 3300053136 | Ga0500559_0029313 | Ga0500559_0029313_144_836 | 230 |
| 880 | 3300053138 | Ga0500564_089383 | Ga0500564_089383_58_750 | 230 |
| 881 | 3300053142 | Ga0500577_0091766 | Ga0500577_0091766_503_1195 | 230 |
| 882 | 3300053147 | Ga0500589_124742 | Ga0500589_124742_344_1036 | 230 |
| 883 | 3300053150 | Ga0500603_000497 | Ga0500603_000497_844_1536 | 230 |
| 884 | 3300053154 | Ga0500619_005307 | Ga0500619_005307_1147_1839 | 230 |
| 885 | 3300053159 | Ga0500630_001586 | Ga0500630_001586_8693_9385 | 230 |
| 886 | 3300053161 | Ga0500634_0125458 | Ga0500634_0125458_410_1102 | 230 |
| 887 | 3300053162 | Ga0500638_110860 | Ga0500638_110860_515_1207 | 230 |
| 888 | 3300053163 | Ga0500639_000002 | Ga0500639_000002_231335_232027 | 230 |
| 889 | 3300053178 | Ga0500637_0221176 | Ga0500637_0221176_187_879 | 230 |
| 890 | 3300053729 | Ga0500625_013421 | Ga0500625_013421_1330_2022 | 230 |
| 891 | 3300053730 | Ga0500645_021926 | Ga0500645_021926_534_1229 | 230 |
| 892 | 3300053731 | Ga0500609_009425 | Ga0500609_009425_156_848 | 230 |
| 893 | 3300053735 | Ga0500596_002194 | Ga0500596_002194_342_1034 | 230 |
| 894 | 3300054114 | Ga0501084_0017007 | Ga0501084_0017007_24_719 | 230 |
| 895 | 3300054114 | Ga0501084_0319314 | Ga0501084_0319314_434_1129 | 230 |
| 896 | 3300054114 | Ga0501084_0337004 | Ga0501084_0337004_295_990 | 230 |
| 897 | 3300059641 | Ga0587068_044644 | Ga0587068_044644_110_802 | 230 |
| 898 | 3300060353 | Ga0501082_0112475 | Ga0501082_0112475_897_1592 | 230 |
| 899 | 3300060353 | Ga0501082_0159588 | Ga0501082_0159588_1175_1870 | 230 |
| 900 | 3300060353 | Ga0501082_0326837 | Ga0501082_0326837_451_1146 | 230 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5npm-assembly1.cif.gz_A | crystal structure of mutant ribosomal protein tthl1 lacking 8 n-terminal residues in complex with 80nt 23s rna from thermus thermophilus | 0.9546 | 18 | 226 |
| 4v5f-assembly1.cif.gz_BC | error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) | 0.9511 | 4 | 225 |
| 4qg3-assembly1.cif.gz_A | crystal structure of mutant ribosomal protein g219v tthl1 in complex with 80nt 23s rna from thermus thermophilus | 0.9502 | 4 | 226 |
| 4v9h-assembly1.cif.gz_BC | crystal structure of the ribosome bound to elongation factor g in the guanosine triphosphatase state | 0.9474 | 4 | 225 |
| 4v8y-assembly1.cif.gz_CL | cryo-em reconstruction of the 80s-eif5b-met-itrnamet eukaryotic translation initiation complex | 0.9469 | 4 | 225 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q60E59_194_280_3.40.50.790 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Ribosomal protein L1/L10, domain II | 0.9719 | 73 | 158 | 3.40.50.790 |
| af_P9WHC7_16_229_3.30.190.20 | Alpha Beta;2-Layer Sandwich;Ribulose 1,5 Bisphosphate Carboxylase/Oxygenase;Ribosomal protein L1/L10, rRNA-binding domain | 0.9606 | 15 | 225 | 3.30.190.20 |
| af_Q9P6M9_97_182_3.40.50.790 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Ribosomal protein L1/L10, domain II | 0.9598 | 72 | 155 | 3.40.50.790 |
| af_Q60E59_194_280_3.40.50.790 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Ribosomal protein L1/L10, domain II | 0.9504 | 73 | 158 | 3.40.50.790 |
| af_I1L5L1_126_340_3.30.190.20 | Alpha Beta;2-Layer Sandwich;Ribulose 1,5 Bisphosphate Carboxylase/Oxygenase;Ribosomal protein L1/L10, rRNA-binding domain | 0.944 | 18 | 228 | 3.30.190.20 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A538KKK0-F1-model_v4 | Large ribosomal subunit protein uL1 (50S ribosomal protein L1) | 0.9805 | 58 | 229 |
GO:0000049
GO:0003735 GO:0006412 GO:0006417 GO:0015934 GO:0019843 |
| AF-A0A4R1R9H9-F1-model_v4 | Large ribosomal subunit protein uL1 | 0.9803 | 1 | 230 |
GO:0000049
GO:0003735 GO:0006412 GO:0006417 GO:0019843 GO:0022625 |
| AF-A0A8A7AR21-F1-model_v4 | deleted | 0.9802 | 1 | 230 |
|
| AF-B9JDR8-F1-model_v4 | Large ribosomal subunit protein uL1 (50S ribosomal protein L1) | 0.9797 | 5 | 230 |
GO:0000049
GO:0003735 GO:0006412 GO:0006417 GO:0019843 GO:0022625 |
| AF-B0UHY1-F1-model_v4 | Large ribosomal subunit protein uL1 (50S ribosomal protein L1) | 0.9796 | 4 | 228 |
GO:0000049
GO:0003735 GO:0006412 GO:0006417 GO:0019843 GO:0022625 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar