F485144

General Info

Members Datasets Scaffolds Average Seq Length
900 301 900 165

Family's Representative Sequence

Representative Sequence 3300013307|Ga0157372_10933286|Ga0157372_109332861
Length 181
Sequence VKTELLPTPQERERKFMKMELIQPFINAADAVLSQGLQGTTKVGNLTMEEDAYRRKGVAGMIALTGDIEGRIILDLEPQTAVKVASHYAGTDLPESDELIKETIFELANQVVGNAVSALNDQGFHFRVHPPLLLTAQEGDKTSEDTEALMICFETSLGSVFMNVALRYNKKRMADHAAVGA

Samples

Sample ID Description Type Environment
1 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
2 3300000546 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled Metagenome Rhizosphere
3 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
4 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
5 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
6 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
7 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
8 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
11 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
12 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
15 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
16 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
17 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
18 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
19 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
20 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
21 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
22 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
23 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
24 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
25 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
26 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
27 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
28 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
29 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
30 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
31 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
32 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
33 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
34 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
35 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
36 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
37 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
38 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
39 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
40 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
41 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
42 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
43 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
44 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
45 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
46 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
47 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
48 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
49 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
50 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
51 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
52 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
53 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
54 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
55 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
56 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
57 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
58 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
59 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
60 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
61 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
62 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
63 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
64 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
65 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
66 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
67 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
68 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
69 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
70 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
71 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
72 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
73 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
74 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
75 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
76 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
77 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
78 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
79 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
80 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
81 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
82 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
83 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
84 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
85 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
86 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
87 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
88 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
89 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
90 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
91 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
92 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
93 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
94 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
95 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
96 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
97 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
98 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
99 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
100 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
101 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
102 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
103 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
104 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
105 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
106 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
107 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
108 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
109 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
110 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
111 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
112 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
113 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
114 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
115 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
116 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
117 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
118 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
119 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
120 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
121 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
122 3300019181 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZI3 metaT (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
123 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
124 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
125 3300022730 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU2 Metagenome Rhizosphere
126 3300022732 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU1 Metagenome Rhizosphere
127 3300022734 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU3 Metagenome Rhizosphere
128 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
129 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
130 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300028016 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 Metagenome Rhizosphere
197 3300028017 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 Metagenome Rhizosphere
198 3300028023 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 Metagenome Rhizosphere
199 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
203 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
204 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
205 3300030762 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
206 3300030836 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
207 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
208 3300030879 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
209 3300031010 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
210 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
211 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
212 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
213 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
214 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
215 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
216 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
217 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
218 3300033545 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4 Metagenome Unclassified
219 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
220 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
221 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
222 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
223 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
224 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
225 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
226 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
227 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
228 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
229 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
230 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
231 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
232 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
233 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
234 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
235 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
236 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
237 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
238 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
239 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
240 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
241 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
242 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
243 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
244 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
245 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
246 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
247 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
248 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
249 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
250 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
251 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
252 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
253 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
254 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
255 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
256 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
257 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
258 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
259 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
260 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
261 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
262 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
263 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
264 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
265 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
266 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
267 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
268 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
269 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
270 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
271 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
272 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
273 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
274 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
275 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
276 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
277 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
278 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
279 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
280 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
281 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
282 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
283 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
284 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
285 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
286 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
287 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
288 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
289 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
290 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
291 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
292 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
293 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
294 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
295 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
296 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
297 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
298 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
299 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
300 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
301 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.33
Metatranscriptomes 1.67
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 6.11
Rhizosphere 93.33
Stem 0
Stem Tuber 0
Unclassified 0.56

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MBSR1b_contig_12373736 2162886012 Unclassified 1080
2 LJNas_1000607 3300000546 Bacteria 6099
3 JGI24743J22301_10000326 3300001991 Bacteria 5243
4 JGI24749J21850_1013365 3300002076 Bacteria 1152
5 JGI24033J26618_1034833 3300002155 Bacteria 687
6 JGI24034J26672_10001510 3300002239 Bacteria 3094
7 JGI24751J29686_10021546 3300002459 Bacteria 1336
8 Ga0065715_10091638 3300005293 Bacteria 5634
9 Ga0070658_10333721 3300005327 Bacteria 1296
10 Ga0070658_10969985 3300005327 Unclassified 739
11 Ga0070676_10010579 3300005328 Bacteria 5005
12 Ga0070676_10073015 3300005328 Unclassified 2064
13 Ga0070683_100008507 3300005329 Bacteria 8718
14 Ga0070683_100029649 3300005329 Bacteria 4957
15 Ga0070683_100505160 3300005329 Unclassified 1155
16 Ga0070690_100026557 3300005330 Bacteria 3573
17 Ga0070690_100454794 3300005330 Unclassified 950
18 Ga0070670_100014317 3300005331 Bacteria 6805
19 Ga0070670_100134527 3300005331 Bacteria 2136
20 Ga0070677_10013347 3300005333 Bacteria 2872
21 Ga0070677_10548777 3300005333 Bacteria 633
22 Ga0068869_100014661 3300005334 Bacteria 5241
23 Ga0070666_10028525 3300005335 Bacteria 3663
24 Ga0070666_10175835 3300005335 Unclassified 1501
25 Ga0070666_10206556 3300005335 Unclassified 1382
26 Ga0070680_100256127 3300005336 Unclassified 1480
27 Ga0070680_101260006 3300005336 Bacteria 640
28 Ga0070680_101373755 3300005336 Unclassified 611
29 Ga0070682_100021304 3300005337 Bacteria 3823
30 Ga0070682_101578708 3300005337 Unclassified 566
31 Ga0068868_100048560 3300005338 Bacteria 3329
32 Ga0068868_100232874 3300005338 Unclassified 1546
33 Ga0070660_100016361 3300005339 Bacteria 5382
34 Ga0070660_100162634 3300005339 Bacteria 1799
35 Ga0070689_100013364 3300005340 Bacteria 5938
36 Ga0070691_10112169 3300005341 Bacteria 1365
37 Ga0070687_100027361 3300005343 Bacteria 2754
38 Ga0070661_100012448 3300005344 Bacteria 5950
39 Ga0070661_100018311 3300005344 Unclassified 4978
40 Ga0070661_100216493 3300005344 Bacteria 1468
41 Ga0070668_100009738 3300005347 Bacteria 7125
42 Ga0070668_100049564 3300005347 Bacteria 3231
43 Ga0070669_100012969 3300005353 Bacteria 5920
44 Ga0070669_100183475 3300005353 Bacteria 1638
45 Ga0070675_100019172 3300005354 Bacteria 5449
46 Ga0070671_100219132 3300005355 Bacteria 1614
47 Ga0070674_100027611 3300005356 Bacteria 3720
48 Ga0070674_101901762 3300005356 Unclassified 541
49 Ga0070673_100010535 3300005364 Bacteria 6261
50 Ga0070688_100006794 3300005365 Bacteria 6136
51 Ga0070688_100089223 3300005365 Bacteria 2012
52 Ga0070659_100005924 3300005366 Bacteria 8812
53 Ga0070659_100134094 3300005366 Unclassified 2013
54 Ga0070667_100018445 3300005367 Bacteria 5786
55 Ga0070667_100205060 3300005367 Bacteria 1750
56 Ga0070709_10001876 3300005434 Bacteria 11392
57 Ga0070709_10006738 3300005434 Bacteria 6271
58 Ga0070709_10011458 3300005434 Bacteria 4942
59 Ga0070709_10012421 3300005434 Bacteria 4768
60 Ga0070709_10035701 3300005434 Bacteria 3023
61 Ga0070709_10076982 3300005434 Bacteria 2168
62 Ga0070709_10687645 3300005434 Bacteria 795
63 Ga0070709_10876434 3300005434 Unclassified 709
64 Ga0070714_100000172 3300005435 Bacteria 52540
65 Ga0070714_100046805 3300005435 Bacteria 3671
66 Ga0070714_100084131 3300005435 Bacteria 2775
67 Ga0070714_100310781 3300005435 Bacteria 1471
68 Ga0070714_100371348 3300005435 Bacteria 1347
69 Ga0070714_100688409 3300005435 Unclassified 986
70 Ga0070714_100726817 3300005435 Unclassified 959
71 Ga0070713_100000342 3300005436 Bacteria 30393
72 Ga0070713_100000449 3300005436 Bacteria 26293
73 Ga0070713_100000510 3300005436 Bacteria 24756
74 Ga0070713_100013833 3300005436 Bacteria 5972
75 Ga0070713_100045317 3300005436 Bacteria 3603
76 Ga0070713_100065002 3300005436 Bacteria 3063
77 Ga0070713_100101831 3300005436 Unclassified 2489
78 Ga0070713_100144760 3300005436 Bacteria 2108
79 Ga0070713_100198026 3300005436 Bacteria 1813
80 Ga0070713_100230160 3300005436 Bacteria 1684
81 Ga0070713_100413481 3300005436 Bacteria 1262
82 Ga0070713_100444628 3300005436 Bacteria 1217
83 Ga0070713_100446898 3300005436 Unclassified 1213
84 Ga0070713_100530247 3300005436 Bacteria 1113
85 Ga0070713_100567926 3300005436 Bacteria 1075
86 Ga0070713_100875083 3300005436 Bacteria 863
87 Ga0070710_10032513 3300005437 Bacteria 2827
88 Ga0070710_10109687 3300005437 Unclassified 1656
89 Ga0070710_10119208 3300005437 Unclassified 1595
90 Ga0070710_10294543 3300005437 Bacteria 1057
91 Ga0070710_10309313 3300005437 Bacteria 1034
92 Ga0070710_10362018 3300005437 Unclassified 963
93 Ga0070710_10394409 3300005437 Unclassified 926
94 Ga0070710_10782788 3300005437 Bacteria 680
95 Ga0070711_100000099 3300005439 Bacteria 45540
96 Ga0070711_100002049 3300005439 Bacteria 11371
97 Ga0070711_100017979 3300005439 Bacteria 4507
98 Ga0070711_100046051 3300005439 Bacteria 2970
99 Ga0070711_100072690 3300005439 Unclassified 2427
100 Ga0070711_100099388 3300005439 Bacteria 2114
101 Ga0070711_100140575 3300005439 Bacteria 1809
102 Ga0070711_100610301 3300005439 Bacteria 911
103 Ga0070711_100746168 3300005439 Unclassified 827
104 Ga0070694_100271550 3300005444 Bacteria 1290
105 Ga0070708_100000418 3300005445 Bacteria 31903
106 Ga0070708_100001401 3300005445 Bacteria 18432
107 Ga0070708_100002020 3300005445 Bacteria 15621
108 Ga0070708_100016302 3300005445 Bacteria 6163
109 Ga0070708_100044220 3300005445 Bacteria 3915
110 Ga0070708_100044658 3300005445 Bacteria 3898
111 Ga0070708_100095844 3300005445 Bacteria 2709
112 Ga0070708_100163052 3300005445 Bacteria 2078
113 Ga0070708_100164013 3300005445 Bacteria 2072
114 Ga0070708_100625578 3300005445 Bacteria 1015
115 Ga0070708_100962316 3300005445 Unclassified 801
116 Ga0070663_100010754 3300005455 Bacteria 5714
117 Ga0070663_100047085 3300005455 Bacteria 3054
118 Ga0070678_100022210 3300005456 Bacteria 4199
119 Ga0070678_100054141 3300005456 Bacteria 2921
120 Ga0070662_100003783 3300005457 Bacteria 9469
121 Ga0070662_100023119 3300005457 Bacteria 4266
122 Ga0070662_100071465 3300005457 Bacteria 2559
123 Ga0070681_10115544 3300005458 Bacteria 2621
124 Ga0070681_10535497 3300005458 Bacteria 1085
125 Ga0070681_10570204 3300005458 Unclassified 1046
126 Ga0070681_10723022 3300005458 Bacteria 912
127 Ga0068867_100011942 3300005459 Bacteria 6136
128 Ga0068867_100065906 3300005459 Bacteria 2696
129 Ga0070685_10005938 3300005466 Bacteria 6213
130 Ga0070685_10146971 3300005466 Bacteria 1490
131 Ga0070706_100000173 3300005467 Bacteria 81500
132 Ga0070706_100001295 3300005467 Bacteria 26667
133 Ga0070706_100013420 3300005467 Bacteria 7574
134 Ga0070706_100018639 3300005467 Bacteria 6398
135 Ga0070706_100060551 3300005467 Unclassified 3495
136 Ga0070706_100511527 3300005467 Bacteria 1117
137 Ga0070706_100538555 3300005467 Bacteria 1086
138 Ga0070707_100000719 3300005468 Bacteria 33081
139 Ga0070707_100002543 3300005468 Bacteria 17343
140 Ga0070707_100012053 3300005468 Bacteria 8070
141 Ga0070707_100057506 3300005468 Bacteria 3731
142 Ga0070707_100057513 3300005468 Bacteria 3730
143 Ga0070707_100297759 3300005468 Bacteria 1567
144 Ga0070698_100000162 3300005471 Bacteria 61345
145 Ga0070698_100007167 3300005471 Bacteria 12080
146 Ga0070698_100128893 3300005471 Bacteria 2486
147 Ga0070698_100136048 3300005471 Bacteria 2411
148 Ga0070698_100166556 3300005471 Bacteria 2146
149 Ga0070699_100001096 3300005518 Bacteria 25207
150 Ga0070699_100002540 3300005518 Bacteria 16392
151 Ga0070699_100004218 3300005518 Bacteria 12713
152 Ga0070699_100012258 3300005518 Bacteria 7396
153 Ga0070699_100048438 3300005518 Unclassified 3678
154 Ga0070699_100096093 3300005518 Unclassified 2595
155 Ga0070699_100158928 3300005518 Unclassified 2000
156 Ga0070699_100592358 3300005518 Unclassified 1011
157 Ga0070699_100625638 3300005518 Bacteria 982
158 Ga0070699_100752106 3300005518 Bacteria 891
159 Ga0070679_100256332 3300005530 Bacteria 1705
160 Ga0070679_100322810 3300005530 Bacteria 1493
161 Ga0070679_100978251 3300005530 Unclassified 790
162 Ga0070684_100006304 3300005535 Bacteria 9166
163 Ga0070684_100160446 3300005535 Unclassified 2040
164 Ga0070684_100820120 3300005535 Bacteria 870
165 Ga0070697_100000554 3300005536 Bacteria 28090
166 Ga0070697_100000872 3300005536 Bacteria 22677
167 Ga0070697_100001177 3300005536 Bacteria 19808
168 Ga0070697_100001505 3300005536 Bacteria 17701
169 Ga0070697_100002639 3300005536 Bacteria 13795
170 Ga0070697_100024244 3300005536 Bacteria 4829
171 Ga0070697_100174118 3300005536 Unclassified 1822
172 Ga0070697_100212204 3300005536 Bacteria 1648
173 Ga0068853_100016415 3300005539 Bacteria 6093
174 Ga0068853_100035889 3300005539 Bacteria 4213
175 Ga0068853_100035951 3300005539 Bacteria 4209
176 Ga0070672_100019833 3300005543 Bacteria 4891
177 Ga0070686_100030276 3300005544 Bacteria 3300
178 Ga0070686_100062316 3300005544 Bacteria 2413
179 Ga0070695_100161859 3300005545 Bacteria 1571
180 Ga0070695_100572691 3300005545 Unclassified 883
181 Ga0070696_100308363 3300005546 Bacteria 1214
182 Ga0070693_100117514 3300005547 Bacteria 1645
183 Ga0070693_100256189 3300005547 Unclassified 1162
184 Ga0070665_100384352 3300005548 Bacteria 1411
185 Ga0068855_100028151 3300005563 Bacteria 6721
186 Ga0068855_100082032 3300005563 Bacteria 3737
187 Ga0068855_100826772 3300005563 Bacteria 983
188 Ga0068855_101094456 3300005563 Unclassified 833
189 Ga0070664_100012980 3300005564 Bacteria 6778
190 Ga0070664_100017362 3300005564 Bacteria 5909
191 Ga0070664_100173686 3300005564 Bacteria 1912
192 Ga0068857_100002662 3300005577 Bacteria 14661
193 Ga0068857_100060124 3300005577 Bacteria 3376
194 Ga0068854_100009708 3300005578 Bacteria 6219
195 Ga0068854_100460332 3300005578 Bacteria 1064
196 Ga0068856_100019084 3300005614 Bacteria 6654
197 Ga0068856_100034355 3300005614 Bacteria 4966
198 Ga0068856_100035602 3300005614 Bacteria 4879
199 Ga0068856_100060078 3300005614 Bacteria 3756
200 Ga0068856_100060970 3300005614 Bacteria 3726
201 Ga0068856_100096241 3300005614 Bacteria 2949
202 Ga0070702_100138308 3300005615 Bacteria 1548
203 Ga0068852_100006784 3300005616 Bacteria 8307
204 Ga0068852_100015554 3300005616 Bacteria 5907
205 Ga0068852_100116529 3300005616 Bacteria 2438
206 Ga0068859_100037215 3300005617 Bacteria 4884
207 Ga0068864_100203828 3300005618 Bacteria 1818
208 Ga0068864_100462302 3300005618 Unclassified 1215
209 Ga0068864_100987147 3300005618 Unclassified 835
210 Ga0068866_10001944 3300005718 Bacteria 8612
211 Ga0068866_10326929 3300005718 Bacteria 966
212 Ga0068861_100009145 3300005719 Bacteria 6834
213 Ga0068851_10006235 3300005834 Bacteria 5441
214 Ga0068851_10017023 3300005834 Bacteria 3486
215 Ga0068851_10029284 3300005834 Bacteria 2726
216 Ga0068870_10012560 3300005840 Bacteria 3961
217 Ga0068863_100084025 3300005841 Bacteria 3017
218 Ga0068863_100112243 3300005841 Unclassified 2596
219 Ga0068863_100169230 3300005841 Bacteria 2095
220 Ga0068863_100335151 3300005841 Bacteria 1471
221 Ga0068858_100018536 3300005842 Bacteria 6516
222 Ga0068858_100818521 3300005842 Bacteria 909
223 Ga0068860_100033462 3300005843 Bacteria 4931
224 Ga0068860_100286630 3300005843 Bacteria 1610
225 Ga0068860_100462065 3300005843 Bacteria 1263
226 Ga0068862_100024154 3300005844 Bacteria 5098
227 Ga0068862_100125918 3300005844 Bacteria 2262
228 Ga0070717_10000612 3300006028 Bacteria 22915
229 Ga0070717_10000837 3300006028 Bacteria 20360
230 Ga0070717_10001449 3300006028 Bacteria 16366
231 Ga0070717_10005741 3300006028 Bacteria 9085
232 Ga0070717_10024145 3300006028 Bacteria 4824
233 Ga0070717_10045843 3300006028 Bacteria 3575
234 Ga0070717_10137148 3300006028 Bacteria 2108
235 Ga0070717_10146046 3300006028 Bacteria 2043
236 Ga0070717_10147941 3300006028 Bacteria 2030
237 Ga0070717_10224306 3300006028 Bacteria 1653
238 Ga0070717_10252654 3300006028 Bacteria 1558
239 Ga0070717_10496403 3300006028 Unclassified 1103
240 Ga0070717_10743396 3300006028 Bacteria 892
241 Ga0070717_10984018 3300006028 Bacteria 768
242 Ga0070715_10090802 3300006163 Bacteria 1405
243 Ga0070715_10095244 3300006163 Unclassified 1378
244 Ga0070716_100000315 3300006173 Bacteria 19472
245 Ga0070716_100002096 3300006173 Bacteria 9152
246 Ga0070716_100014273 3300006173 Bacteria 4067
247 Ga0070716_100037106 3300006173 Bacteria 2691
248 Ga0070716_100042111 3300006173 Bacteria 2548
249 Ga0070716_100092424 3300006173 Bacteria 1834
250 Ga0070716_100097798 3300006173 Bacteria 1792
251 Ga0070716_100120575 3300006173 Bacteria 1641
252 Ga0070716_100191504 3300006173 Bacteria 1352
253 Ga0070716_100281838 3300006173 Unclassified 1147
254 Ga0070716_100339825 3300006173 Bacteria 1059
255 Ga0070716_100449359 3300006173 Unclassified 939
256 Ga0070716_100530529 3300006173 Bacteria 874
257 Ga0070716_100880373 3300006173 Bacteria 699
258 Ga0070712_100000546 3300006175 Bacteria 21742
259 Ga0070712_100002960 3300006175 Bacteria 10514
260 Ga0070712_100003075 3300006175 Bacteria 10319
261 Ga0070712_100005278 3300006175 Bacteria 7994
262 Ga0070712_100031299 3300006175 Bacteria 3583
263 Ga0070712_100061623 3300006175 Bacteria 2651
264 Ga0070712_100233313 3300006175 Bacteria 1462
265 Ga0070712_100464965 3300006175 Bacteria 1055
266 Ga0070712_100505911 3300006175 Unclassified 1013
267 Ga0070712_100635624 3300006175 Bacteria 906
268 Ga0070712_100709718 3300006175 Unclassified 858
269 Ga0097621_100008160 3300006237 Bacteria 7529
270 Ga0097621_100190616 3300006237 Bacteria 1775
271 Ga0097621_100327422 3300006237 Bacteria 1358
272 Ga0097621_100404318 3300006237 Unclassified 1223
273 Ga0097621_100610893 3300006237 Unclassified 997
274 Ga0068871_100007947 3300006358 Bacteria 7605
275 Ga0068871_100040074 3300006358 Bacteria 3751
276 Ga0068871_100188544 3300006358 Bacteria 1775
277 Ga0068871_100256279 3300006358 Bacteria 1525
278 Ga0068871_100488464 3300006358 Bacteria 1108
279 Ga0075433_10001164 3300006852 Bacteria 19108
280 Ga0075433_10001954 3300006852 Bacteria 15504
281 Ga0075433_10572342 3300006852 Unclassified 992
282 Ga0075434_100000041 3300006871 Bacteria 59536
283 Ga0075434_100002766 3300006871 Bacteria 15521
284 Ga0075434_100008051 3300006871 Bacteria 9775
285 Ga0068865_100032569 3300006881 Bacteria 3483
286 Ga0068865_100296483 3300006881 Bacteria 1292
287 Ga0075436_100000526 3300006914 Bacteria 24961
288 Ga0075436_100006992 3300006914 Bacteria 7726
289 Ga0075436_100016670 3300006914 Bacteria 5029
290 Ga0075436_100070745 3300006914 Unclassified 2412
291 Ga0075436_100277786 3300006914 Bacteria 1197
292 Ga0075436_100734257 3300006914 Bacteria 733
293 Ga0097620_100037214 3300006931 Bacteria 4884
294 Ga0075435_100000105 3300007076 Bacteria 45736
295 Ga0075435_100023020 3300007076 Bacteria 4811
296 Ga0075435_100037240 3300007076 Bacteria 3872
297 Ga0075435_100347524 3300007076 Bacteria 1271
298 Ga0075435_100552641 3300007076 Unclassified 997
299 Ga0099794_10008610 3300007265 Bacteria 4247
300 Ga0099794_10111802 3300007265 Bacteria 1369
301 Ga0099794_10168120 3300007265 Unclassified 1117
302 Ga0099794_10236851 3300007265 Unclassified 940
303 Ga0099795_10036881 3300007788 Bacteria 1718
304 Ga0099795_10101684 3300007788 Bacteria 1128
305 Ga0105240_10074313 3300009093 Bacteria 4196
306 Ga0105240_10181112 3300009093 Bacteria 2486
307 Ga0105240_10256517 3300009093 Bacteria 2019
308 Ga0105240_10263184 3300009093 Unclassified 1989
309 Ga0105240_10593662 3300009093 Bacteria 1220
310 Ga0105240_11617565 3300009093 Unclassified 677
311 Ga0105240_12166851 3300009093 Unclassified 577
312 Ga0105245_10030920 3300009098 Bacteria 4736
313 Ga0105245_10140939 3300009098 Bacteria 2271
314 Ga0105245_10165140 3300009098 Bacteria 2104
315 Ga0105245_11021681 3300009098 Unclassified 872
316 Ga0105247_10006289 3300009101 Bacteria 7361
317 Ga0105247_10026851 3300009101 Bacteria 3480
318 Ga0105247_11103034 3300009101 Unclassified 626
319 Ga0114129_11407360 3300009147 Bacteria 860
320 Ga0105243_10058571 3300009148 Bacteria 3070
321 Ga0105243_11199285 3300009148 Bacteria 772
322 Ga0105241_10000916 3300009174 Bacteria 22311
323 Ga0105241_10013091 3300009174 Bacteria 6084
324 Ga0105241_10241944 3300009174 Bacteria 1526
325 Ga0105241_10328554 3300009174 Bacteria 1321
326 Ga0105241_10736991 3300009174 Bacteria 902
327 Ga0105241_10748814 3300009174 Unclassified 896
328 Ga0105241_11130602 3300009174 Unclassified 739
329 Ga0105242_10068669 3300009176 Bacteria 2933
330 Ga0105248_10010789 3300009177 Bacteria 10087
331 Ga0105248_10070138 3300009177 Bacteria 3936
332 Ga0105248_10610461 3300009177 Bacteria 1231
333 Ga0105248_11216137 3300009177 Bacteria 852
334 Ga0105237_10062864 3300009545 Bacteria 3711
335 Ga0105237_10617226 3300009545 Bacteria 1091
336 Ga0105237_10785869 3300009545 Bacteria 959
337 Ga0105237_11087867 3300009545 Bacteria 806
338 Ga0105237_11755320 3300009545 Unclassified 628
339 Ga0105238_10030598 3300009551 Bacteria 5481
340 Ga0105238_10091469 3300009551 Bacteria 3030
341 Ga0105238_10278522 3300009551 Bacteria 1653
342 Ga0105249_10011376 3300009553 Bacteria 7814
343 Ga0105249_10033432 3300009553 Bacteria 4655
344 Ga0105249_10118256 3300009553 Bacteria 2515
345 Ga0105249_11371650 3300009553 Unclassified 779
346 Ga0105239_10117684 3300010375 Bacteria 2949
347 Ga0105239_10460080 3300010375 Bacteria 1444
348 Ga0105239_10691320 3300010375 Unclassified 1166
349 Ga0105239_10768567 3300010375 Bacteria 1103
350 Ga0105239_12520334 3300010375 Unclassified 599
351 Ga0105246_10009260 3300011119 Bacteria 6066
352 Ga0105246_11729674 3300011119 Unclassified 595
353 Ga0157373_10000288 3300013100 Bacteria 40421
354 Ga0157373_10004158 3300013100 Bacteria 10914
355 Ga0157373_10112556 3300013100 Bacteria 1913
356 Ga0157373_10207528 3300013100 Bacteria 1381
357 Ga0157371_10031378 3300013102 Bacteria 3828
358 Ga0157371_10271571 3300013102 Unclassified 1224
359 Ga0157370_10045720 3300013104 Bacteria 4199
360 Ga0157370_10085697 3300013104 Unclassified 2960
361 Ga0157370_10677144 3300013104 Bacteria 942
362 Ga0157369_10008623 3300013105 Bacteria 11692
363 Ga0157369_10032939 3300013105 Bacteria 5695
364 Ga0157369_10048103 3300013105 Bacteria 4629
365 Ga0157369_10102365 3300013105 Bacteria 3052
366 Ga0157369_10119587 3300013105 Bacteria 2795
367 Ga0157374_10014241 3300013296 Bacteria 6954
368 Ga0157374_10049285 3300013296 Bacteria 3912
369 Ga0157374_10053326 3300013296 Bacteria 3770
370 Ga0157374_10186316 3300013296 Bacteria 2029
371 Ga0157374_10224493 3300013296 Bacteria 1844
372 Ga0157374_10288743 3300013296 Bacteria 1620
373 Ga0157374_11001050 3300013296 Bacteria 855
374 Ga0157378_10010049 3300013297 Bacteria 8247
375 Ga0157378_10103061 3300013297 Bacteria 2607
376 Ga0157378_10310375 3300013297 Bacteria 1529
377 Ga0163162_10029047 3300013306 Bacteria 5472
378 Ga0163162_10294833 3300013306 Bacteria 1753
379 Ga0163162_11370766 3300013306 Bacteria 804
380 Ga0157372_10015183 3300013307 Bacteria 8245
381 Ga0157372_10015214 3300013307 Bacteria 8240
382 Ga0157372_10072578 3300013307 Bacteria 3879
383 Ga0157372_10076790 3300013307 Bacteria 3772
384 Ga0157372_10242027 3300013307 Bacteria 2093
385 Ga0157372_10428455 3300013307 Bacteria 1542
386 Ga0157372_10933286 3300013307 Bacteria 1006
387 Ga0157372_11143669 3300013307 Unclassified 900
388 Ga0157375_10027190 3300013308 Bacteria 5344
389 Ga0163163_10007476 3300014325 Bacteria 9642
390 Ga0163163_10011914 3300014325 Bacteria 7911
391 Ga0163163_10020058 3300014325 Bacteria 6291
392 Ga0163163_10022148 3300014325 Bacteria 6011
393 Ga0182008_10019449 3300014497 Bacteria 3504
394 Ga0182008_10107349 3300014497 Bacteria 1382
395 Ga0157377_10001020 3300014745 Bacteria 11815
396 Ga0157379_10007715 3300014968 Bacteria 9316
397 Ga0157379_10014150 3300014968 Bacteria 6996
398 Ga0157379_10653514 3300014968 Unclassified 984
399 Ga0157379_10692323 3300014968 Unclassified 956
400 Ga0157376_10009736 3300014969 Bacteria 6997
401 Ga0157376_10017009 3300014969 Bacteria 5536
402 Ga0157376_10035919 3300014969 Bacteria 4011
403 Ga0157376_10397162 3300014969 Bacteria 1332
404 Ga0157376_11458188 3300014969 Bacteria 717
405 Ga0182007_10005070 3300015262 Bacteria 5851
406 Ga0182007_10103770 3300015262 Bacteria 943
407 Ga0182005_1009626 3300015265 Bacteria 2805
408 Ga0163161_10019548 3300017792 Bacteria 4753
409 Ga0184594_100472 3300019181 Bacteria 1155
410 Ga0213873_10136317 3300021358 Unclassified 730
411 Ga0213874_10090537 3300021377 Unclassified 1004
412 Ga0224570_100064 3300022730 Bacteria 5809
413 Ga0224569_100403 3300022732 Bacteria 3665
414 Ga0224571_102100 3300022734 Bacteria 1262
415 Ga0224572_1005998 3300024225 Bacteria 2186
416 Ga0224572_1018321 3300024225 Unclassified 1345
417 Ga0228598_1000222 3300024227 Bacteria 10731
418 Ga0228598_1000502 3300024227 Bacteria 8089
419 Ga0228598_1000816 3300024227 Bacteria 6714
420 Ga0228598_1027302 3300024227 Unclassified 1122
421 Ga0228598_1041734 3300024227 Unclassified 906
422 Ga0207697_10007772 3300025315 Bacteria 4750
423 Ga0207656_10037664 3300025321 Bacteria 2036
424 Ga0207656_10211485 3300025321 Bacteria 940
425 Ga0207682_10029528 3300025893 Bacteria 2192
426 Ga0207682_10416653 3300025893 Bacteria 635
427 Ga0207692_10006597 3300025898 Bacteria 4715
428 Ga0207692_10068299 3300025898 Bacteria 1863
429 Ga0207692_10089120 3300025898 Unclassified 1669
430 Ga0207692_10325901 3300025898 Bacteria 941
431 Ga0207692_10391074 3300025898 Bacteria 865
432 Ga0207642_10104851 3300025899 Unclassified 1427
433 Ga0207642_10386144 3300025899 Bacteria 834
434 Ga0207710_10348901 3300025900 Unclassified 754
435 Ga0207688_10145853 3300025901 Bacteria 1395
436 Ga0207680_10015571 3300025903 Bacteria 3971
437 Ga0207680_10663459 3300025903 Bacteria 747
438 Ga0207647_10003441 3300025904 Bacteria 11878
439 Ga0207647_10085312 3300025904 Bacteria 1889
440 Ga0207685_10040513 3300025905 Bacteria 1736
441 Ga0207699_10001324 3300025906 Bacteria 11774
442 Ga0207699_10015400 3300025906 Bacteria 3970
443 Ga0207699_10020214 3300025906 Bacteria 3563
444 Ga0207699_10058713 3300025906 Bacteria 2302
445 Ga0207699_10060749 3300025906 Bacteria 2271
446 Ga0207699_10061138 3300025906 Bacteria 2265
447 Ga0207699_10094983 3300025906 Unclassified 1879
448 Ga0207699_10264602 3300025906 Bacteria 1190
449 Ga0207699_10362925 3300025906 Bacteria 1025
450 Ga0207699_10446256 3300025906 Bacteria 927
451 Ga0207699_10656955 3300025906 Unclassified 766
452 Ga0207699_10767960 3300025906 Bacteria 708
453 Ga0207645_10000181 3300025907 Bacteria 50200
454 Ga0207645_10019336 3300025907 Bacteria 4466
455 Ga0207643_10001458 3300025908 Bacteria 13565
456 Ga0207643_10109875 3300025908 Bacteria 1624
457 Ga0207705_10045425 3300025909 Bacteria 3157
458 Ga0207684_10000217 3300025910 Bacteria 88691
459 Ga0207684_10000267 3300025910 Bacteria 77172
460 Ga0207684_10004181 3300025910 Bacteria 13709
461 Ga0207684_10498628 3300025910 Bacteria 1044
462 Ga0207684_10779951 3300025910 Bacteria 809
463 Ga0207654_10006062 3300025911 Bacteria 6077
464 Ga0207654_10055269 3300025911 Bacteria 2298
465 Ga0207654_10058367 3300025911 Bacteria 2246
466 Ga0207654_10092107 3300025911 Bacteria 1850
467 Ga0207654_10166552 3300025911 Bacteria 1428
468 Ga0207654_10246661 3300025911 Bacteria 1195
469 Ga0207654_10548815 3300025911 Bacteria 821
470 Ga0207707_10015984 3300025912 Bacteria 6545
471 Ga0207707_10175218 3300025912 Unclassified 1873
472 Ga0207707_10470183 3300025912 Bacteria 1075
473 Ga0207707_10510704 3300025912 Bacteria 1024
474 Ga0207695_10027763 3300025913 Bacteria 6297
475 Ga0207695_10064718 3300025913 Bacteria 3763
476 Ga0207695_10299030 3300025913 Bacteria 1501
477 Ga0207695_10307560 3300025913 Bacteria 1475
478 Ga0207695_10545532 3300025913 Bacteria 1041
479 Ga0207695_10905542 3300025913 Bacteria 762
480 Ga0207671_10122728 3300025914 Bacteria 1987
481 Ga0207671_10125768 3300025914 Unclassified 1964
482 Ga0207671_10537801 3300025914 Bacteria 931
483 Ga0207693_10000089 3300025915 Bacteria 81143
484 Ga0207693_10000106 3300025915 Bacteria 75776
485 Ga0207693_10009582 3300025915 Bacteria 7887
486 Ga0207693_10013836 3300025915 Bacteria 6498
487 Ga0207693_10029134 3300025915 Bacteria 4363
488 Ga0207693_10075950 3300025915 Bacteria 2631
489 Ga0207693_10209793 3300025915 Bacteria 1531
490 Ga0207693_10286481 3300025915 Bacteria 1291
491 Ga0207693_10374723 3300025915 Bacteria 1113
492 Ga0207693_10761346 3300025915 Bacteria 748
493 Ga0207663_10002155 3300025916 Bacteria 9394
494 Ga0207663_10059922 3300025916 Bacteria 2410
495 Ga0207663_10079355 3300025916 Bacteria 2143
496 Ga0207663_10085695 3300025916 Bacteria 2075
497 Ga0207663_10124631 3300025916 Bacteria 1770
498 Ga0207663_10160137 3300025916 Bacteria 1588
499 Ga0207663_10320556 3300025916 Bacteria 1164
500 Ga0207663_10788727 3300025916 Unclassified 756
501 Ga0207660_10379430 3300025917 Bacteria 1136
502 Ga0207660_10761743 3300025917 Bacteria 790
503 Ga0207662_10026172 3300025918 Bacteria 3364
504 Ga0207657_10000535 3300025919 Bacteria 40427
505 Ga0207657_10001828 3300025919 Bacteria 22959
506 Ga0207657_10010586 3300025919 Bacteria 9195
507 Ga0207649_10000350 3300025920 Bacteria 34881
508 Ga0207649_10020780 3300025920 Unclassified 3769
509 Ga0207649_10114548 3300025920 Bacteria 1807
510 Ga0207652_10144604 3300025921 Bacteria 2127
511 Ga0207652_10471230 3300025921 Unclassified 1131
512 Ga0207646_10000296 3300025922 Bacteria 67683
513 Ga0207646_10001311 3300025922 Bacteria 30882
514 Ga0207646_10095550 3300025922 Bacteria 2662
515 Ga0207646_10132679 3300025922 Bacteria 2242
516 Ga0207646_10209420 3300025922 Bacteria 1761
517 Ga0207646_10272895 3300025922 Bacteria 1529
518 Ga0207646_10300814 3300025922 Bacteria 1449
519 Ga0207681_10079583 3300025923 Bacteria 2309
520 Ga0207694_10144453 3300025924 Bacteria 1914
521 Ga0207694_10182398 3300025924 Unclassified 1703
522 Ga0207694_10502618 3300025924 Unclassified 1015
523 Ga0207650_10000223 3300025925 Bacteria 64087
524 Ga0207650_10140577 3300025925 Bacteria 1898
525 Ga0207659_10007479 3300025926 Bacteria 6721
526 Ga0207687_10018290 3300025927 Bacteria 4624
527 Ga0207687_10077263 3300025927 Bacteria 2394
528 Ga0207700_10000289 3300025928 Bacteria 29760
529 Ga0207700_10000888 3300025928 Bacteria 17211
530 Ga0207700_10025835 3300025928 Bacteria 4086
531 Ga0207700_10030601 3300025928 Bacteria 3814
532 Ga0207700_10077108 3300025928 Bacteria 2588
533 Ga0207700_10153261 3300025928 Bacteria 1906
534 Ga0207700_10161029 3300025928 Unclassified 1864
535 Ga0207700_10255286 3300025928 Unclassified 1499
536 Ga0207700_10263812 3300025928 Bacteria 1476
537 Ga0207700_10301690 3300025928 Bacteria 1383
538 Ga0207700_10517468 3300025928 Bacteria 1057
539 Ga0207700_10618550 3300025928 Bacteria 964
540 Ga0207700_10657352 3300025928 Bacteria 935
541 Ga0207700_10737072 3300025928 Unclassified 880
542 Ga0207700_10845813 3300025928 Bacteria 819
543 Ga0207664_10000118 3300025929 Bacteria 69258
544 Ga0207664_10022203 3300025929 Bacteria 4735
545 Ga0207664_10141500 3300025929 Unclassified 2035
546 Ga0207664_10191181 3300025929 Bacteria 1762
547 Ga0207664_10234103 3300025929 Bacteria 1597
548 Ga0207664_10320035 3300025929 Bacteria 1369
549 Ga0207664_10332482 3300025929 Unclassified 1342
550 Ga0207664_10550611 3300025929 Unclassified 1035
551 Ga0207664_10650565 3300025929 Bacteria 947
552 Ga0207644_10011249 3300025931 Bacteria 5915
553 Ga0207644_10049864 3300025931 Unclassified 2999
554 Ga0207690_10029853 3300025932 Bacteria 3471
555 Ga0207690_10387278 3300025932 Bacteria 1112
556 Ga0207706_10000670 3300025933 Bacteria 35982
557 Ga0207706_10009803 3300025933 Bacteria 8789
558 Ga0207706_10014729 3300025933 Bacteria 7082
559 Ga0207709_10108511 3300025935 Bacteria 1851
560 Ga0207709_10823662 3300025935 Bacteria 750
561 Ga0207670_10015700 3300025936 Bacteria 4531
562 Ga0207669_10863890 3300025937 Unclassified 754
563 Ga0207704_10067564 3300025938 Bacteria 2249
564 Ga0207704_10176675 3300025938 Bacteria 1538
565 Ga0207665_10001480 3300025939 Bacteria 15799
566 Ga0207665_10001526 3300025939 Bacteria 15570
567 Ga0207665_10008599 3300025939 Bacteria 6720
568 Ga0207665_10044443 3300025939 Bacteria 2973
569 Ga0207665_10079547 3300025939 Bacteria 2253
570 Ga0207665_10138043 3300025939 Bacteria 1736
571 Ga0207665_10229042 3300025939 Bacteria 1365
572 Ga0207665_10255058 3300025939 Bacteria 1297
573 Ga0207665_10317031 3300025939 Bacteria 1169
574 Ga0207665_10347153 3300025939 Unclassified 1120
575 Ga0207665_10347731 3300025939 Bacteria 1119
576 Ga0207665_10883279 3300025939 Unclassified 709
577 Ga0207691_10000345 3300025940 Bacteria 46775
578 Ga0207711_10029037 3300025941 Bacteria 4661
579 Ga0207689_10000499 3300025942 Bacteria 37043
580 Ga0207689_10076620 3300025942 Bacteria 2749
581 Ga0207661_10059699 3300025944 Bacteria 3074
582 Ga0207661_10125076 3300025944 Unclassified 2195
583 Ga0207661_10357834 3300025944 Bacteria 1318
584 Ga0207679_10000115 3300025945 Bacteria 64466
585 Ga0207679_10192010 3300025945 Bacteria 1699
586 Ga0207679_10250551 3300025945 Bacteria 1505
587 Ga0207667_10040938 3300025949 Bacteria 4931
588 Ga0207667_10246893 3300025949 Unclassified 1826
589 Ga0207667_11555893 3300025949 Viruses 631
590 Ga0207651_10003270 3300025960 Bacteria 7932
591 Ga0207712_10030933 3300025961 Bacteria 3602
592 Ga0207712_10141863 3300025961 Bacteria 1845
593 Ga0207668_10029993 3300025972 Bacteria 3570
594 Ga0207668_10780986 3300025972 Unclassified 844
595 Ga0207640_10154868 3300025981 Bacteria 1688
596 Ga0207640_10416205 3300025981 Bacteria 1099
597 Ga0207640_10595314 3300025981 Unclassified 935
598 Ga0207658_10018432 3300025986 Bacteria 4819
599 Ga0207658_10385427 3300025986 Bacteria 1228
600 Ga0207677_10016957 3300026023 Bacteria 4328
601 Ga0207677_10033304 3300026023 Bacteria 3323
602 Ga0207677_10368197 3300026023 Bacteria 1209
603 Ga0207703_10020915 3300026035 Bacteria 5118
604 Ga0207703_10221807 3300026035 Bacteria 1691
605 Ga0207703_10261335 3300026035 Bacteria 1565
606 Ga0207639_10028794 3300026041 Bacteria 4059
607 Ga0207678_10000130 3300026067 Bacteria 63279
608 Ga0207678_10001418 3300026067 Bacteria 21972
609 Ga0207678_10105876 3300026067 Unclassified 2399
610 Ga0207678_11605438 3300026067 Unclassified 573
611 Ga0207708_10088371 3300026075 Bacteria 2387
612 Ga0207702_10002571 3300026078 Bacteria 17059
613 Ga0207702_10023735 3300026078 Bacteria 5088
614 Ga0207702_10109070 3300026078 Unclassified 2457
615 Ga0207702_10257982 3300026078 Bacteria 1640
616 Ga0207702_10291844 3300026078 Bacteria 1545
617 Ga0207702_10622993 3300026078 Unclassified 1060
618 Ga0207702_10627342 3300026078 Bacteria 1056
619 Ga0207641_10000287 3300026088 Bacteria 63251
620 Ga0207641_10233097 3300026088 Bacteria 1712
621 Ga0207641_10648956 3300026088 Bacteria 1036
622 Ga0207641_10830731 3300026088 Bacteria 915
623 Ga0207641_11057882 3300026088 Unclassified 809
624 Ga0207648_10001253 3300026089 Bacteria 28381
625 Ga0207648_10031139 3300026089 Bacteria 4717
626 Ga0207676_10019296 3300026095 Bacteria 4971
627 Ga0207676_10156803 3300026095 Bacteria 1968
628 Ga0207676_10433215 3300026095 Unclassified 1236
629 Ga0207674_10020692 3300026116 Bacteria 7100
630 Ga0207674_10025502 3300026116 Bacteria 6304
631 Ga0207674_10027829 3300026116 Bacteria 5973
632 Ga0207675_100008545 3300026118 Bacteria 9630
633 Ga0207675_100147149 3300026118 Bacteria 2240
634 Ga0207683_10000217 3300026121 Bacteria 50192
635 Ga0207683_10028620 3300026121 Bacteria 4820
636 Ga0207698_10057434 3300026142 Bacteria 3011
637 Ga0207698_10102194 3300026142 Bacteria 2379
638 Ga0207698_10249849 3300026142 Bacteria 1622
639 Ga0265354_1004182 3300028016 Bacteria 1536
640 Ga0265356_1000336 3300028017 Bacteria 8653
641 Ga0265356_1010488 3300028017 Bacteria 1032
642 Ga0265357_1018582 3300028023 Unclassified 751
643 Ga0268266_10008412 3300028379 Bacteria 9174
644 Ga0268266_10575144 3300028379 Bacteria 1081
645 Ga0268266_10937589 3300028379 Bacteria 837
646 Ga0268266_11726430 3300028379 Unclassified 601
647 Ga0268265_10044706 3300028380 Bacteria 3300
648 Ga0268265_10048037 3300028380 Bacteria 3201
649 Ga0268265_10450156 3300028380 Bacteria 1202
650 Ga0268264_10025038 3300028381 Bacteria 4876
651 Ga0268264_10029486 3300028381 Bacteria 4494
652 Ga0268264_10077395 3300028381 Bacteria 2833
653 Ga0268264_10814500 3300028381 Bacteria 933
654 Ga0265336_10044137 3300028666 Unclassified 1357
655 Ga0265338_10010626 3300028800 Bacteria 10759
656 Ga0265338_10012546 3300028800 Bacteria 9652
657 Ga0265338_10173197 3300028800 Unclassified 1652
658 Ga0265762_1002825 3300030760 Bacteria 3108
659 Ga0265762_1013435 3300030760 Bacteria 1474
660 Ga0265762_1020484 3300030760 Bacteria 1216
661 Ga0265775_103190 3300030762 Bacteria 879
662 Ga0265767_101478 3300030836 Bacteria 1159
663 Ga0265770_1003844 3300030878 Bacteria 2043
664 Ga0265770_1015093 3300030878 Bacteria 1172
665 Ga0265770_1085108 3300030878 Bacteria 623
666 Ga0265765_1009051 3300030879 Bacteria 1091
667 Ga0265771_1003369 3300031010 Bacteria 916
668 Ga0265760_10000331 3300031090 Bacteria 13250
669 Ga0265760_10001481 3300031090 Bacteria 6917
670 Ga0265760_10081793 3300031090 Unclassified 1001
671 Ga0265760_10092507 3300031090 Bacteria 948
672 Ga0265325_10010836 3300031241 Bacteria 5257
673 Ga0265325_10086051 3300031241 Bacteria 1556
674 Ga0265340_10078248 3300031247 Bacteria 1560
675 Ga0265340_10160945 3300031247 Bacteria 1020
676 Ga0265339_10015242 3300031249 Bacteria 4613
677 Ga0265339_10068251 3300031249 Bacteria 1900
678 Ga0265339_10161471 3300031249 Bacteria 1127
679 Ga0265316_10019190 3300031344 Bacteria 5855
680 Ga0265316_10568181 3300031344 Unclassified 806
681 Ga0265314_10114275 3300031711 Unclassified 1710
682 Ga0265342_10160925 3300031712 Bacteria 1241
683 Ga0307416_100551502 3300032002 Bacteria 1226
684 Ga0316214_1007710 3300033545 Bacteria 1441
685 Ga0373930_0127190 3300034816 Unclassified 625
686 Ga0373958_0017263 3300034819 Bacteria 1295
687 Ga0373938_0015032 3300034957 Bacteria 1494
688 Ga0373926_0028857 3300035083 Bacteria 1949
689 Ga0373926_0042062 3300035083 Bacteria 1634
690 Ga0373926_0145879 3300035083 Bacteria 900
691 Ga0373934_0039992 3300035086 Unclassified 1849
692 Ga0373944_0047625 3300035089 Bacteria 1343
693 Ga0373944_0200346 3300035089 Bacteria 723
694 Ga0373944_0245320 3300035089 Bacteria 660
695 Ga0373923_0018059 3300035111 Bacteria 2708
696 Ga0373932_0170061 3300035112 Unclassified 759
697 Ga0373932_0212282 3300035112 Bacteria 692
698 Ga0373936_0000966 3300035113 Bacteria 10244
699 Ga0373936_0006441 3300035113 Bacteria 4428
700 Ga0373953_0010005 3300035117 Bacteria 3287
701 Ga0373954_0078263 3300035118 Bacteria 1577
702 Ga0373956_0008841 3300035119 Bacteria 4080
703 Ga0373956_0138998 3300035119 Bacteria 1140
704 Ga0373957_0017150 3300035120 Bacteria 2517
705 Ga0373957_0027426 3300035120 Unclassified 2069
706 Ga0373957_0132135 3300035120 Unclassified 1017
707 Ga0373960_0075450 3300035121 Bacteria 1051
708 Ga0373943_0000054 3300035170 Bacteria 38966
709 Ga0373943_0083341 3300035170 Unclassified 1643
710 Ga0373946_0010120 3300035171 Bacteria 3487
711 Ga0373955_0028331 3300035172 Bacteria 2902
712 Ga0373955_0066887 3300035172 Bacteria 1999
713 Ga0373955_0093625 3300035172 Bacteria 1716
714 Ga0373955_0182572 3300035172 Bacteria 1245
715 Ga0373924_0016533 3300035410 Bacteria 2816
716 Ga0373924_0023333 3300035410 Bacteria 2426
717 Ga0373931_0658721 3300035691 Unclassified 688
718 Ga0373935_0004095 3300035692 Bacteria 8527
719 Ga0373935_0022633 3300035692 Bacteria 3856
720 Ga0373935_0031111 3300035692 Bacteria 3310
721 Ga0373935_0116917 3300035692 Bacteria 1777
722 Ga0373935_0151497 3300035692 Bacteria 1574
723 Ga0373927_0082280 3300035695 Bacteria 2087
724 Ga0373927_0136218 3300035695 Bacteria 1605
725 Ga0373927_0273549 3300035695 Bacteria 1111
726 Ga0373927_0275384 3300035695 Bacteria 1107
727 Ga0373927_0293803 3300035695 Unclassified 1069
728 Ga0373927_0463003 3300035695 Unclassified 838
729 Ga0373927_0569314 3300035695 Unclassified 749
730 Ga0373927_0908407 3300035695 Unclassified 581
731 Ga0373933_0014246 3300035724 Bacteria 4418
732 Ga0373933_0045238 3300035724 Bacteria 2610
733 Ga0373933_0100682 3300035724 Bacteria 1793
734 Ga0373933_0253078 3300035724 Bacteria 1134
735 Ga0373933_0309111 3300035724 Unclassified 1024
736 Ga0373933_0576410 3300035724 Unclassified 739
737 Ga0373933_0828794 3300035724 Unclassified 609
738 Ga0373947_0000496 3300035725 Bacteria 22749
739 Ga0373947_0014673 3300035725 Unclassified 4494
740 Ga0373947_0156647 3300035725 Bacteria 1470
741 Ga0373937_0041215 3300036401 Unclassified 4212
742 Ga0373937_0058242 3300036401 Bacteria 3549
743 Ga0373937_0218937 3300036401 Bacteria 1792
744 Ga0373937_0356387 3300036401 Bacteria 1386
745 Ga0373937_0401786 3300036401 Unclassified 1300
746 Ga0373937_0516119 3300036401 Bacteria 1135
747 Ga0373937_0623515 3300036401 Bacteria 1023
748 Ga0373937_0793375 3300036401 Bacteria 895
749 Ga0373925_0003546 3300037068 Bacteria 12039
750 Ga0373925_0018652 3300037068 Bacteria 5043
751 Ga0373925_0141462 3300037068 Bacteria 1883
752 Ga0373925_0234518 3300037068 Bacteria 1468
753 Ga0373925_0239178 3300037068 Unclassified 1454
754 Ga0373925_0542925 3300037068 Bacteria 956
755 Ga0373925_0733739 3300037068 Bacteria 814
756 Ga0395900_0930063 3300037418 Bacteria 792
757 Ga0395905_0745593 3300037471 Bacteria 882
758 Ga0436363_0310747 3300039450 Unclassified 811
759 Ga0436363_0859048 3300039450 Bacteria 5706
760 Ga0436363_1703454 3300039450 Bacteria 661
761 Ga0436362_0242382 3300039453 Bacteria 2184
762 Ga0466963_0510293 3300044694 Bacteria 849
763 Ga0466964_0091790 3300044706 Unclassified 1323
764 Ga0466964_0369952 3300044706 Unclassified 741
765 Ga0466968_0362720 3300044735 Unclassified 705
766 Ga0451576_0109127 3300045051 Bacteria 2880
767 Ga0451576_2472999 3300045051 Unclassified 531
768 Ga0466967_0075951 3300045976 Bacteria 3021
769 Ga0466967_0274981 3300045976 Unclassified 1615
770 Ga0495592_0651313 3300046454 Unclassified 638
771 Ga0495603_0089785 3300046455 Unclassified 1798
772 Ga0495629_0104434 3300046459 Bacteria 1976
773 Ga0495629_0247385 3300046459 Bacteria 1227
774 Ga0495651_0136996 3300046462 Bacteria 1780
775 Ga0495580_0000031 3300046472 Bacteria 76248
776 Ga0495580_0004216 3300046472 Bacteria 12090
777 Ga0495580_0009626 3300046472 Bacteria 7588
778 Ga0495580_0018579 3300046472 Bacteria 5174
779 Ga0495580_0019658 3300046472 Bacteria 5015
780 Ga0495580_0028922 3300046472 Bacteria 4026
781 Ga0495580_0171239 3300046472 Bacteria 1501
782 Ga0495580_0177389 3300046472 Bacteria 1472
783 Ga0495580_0239685 3300046472 Bacteria 1244
784 Ga0495580_0600474 3300046472 Unclassified 727
785 Ga0495582_0015585 3300046473 Bacteria 4173
786 Ga0495584_0018151 3300046491 Bacteria 3577
787 Ga0495594_0030407 3300046499 Bacteria 2922
788 Ga0495628_0476723 3300046516 Bacteria 903
789 Ga0495630_0050881 3300046517 Bacteria 3100
790 Ga0495630_0230553 3300046517 Unclassified 1415
791 Ga0495630_0427477 3300046517 Bacteria 1015
792 Ga0495630_0658930 3300046517 Bacteria 801
793 Ga0495665_0025377 3300046531 Bacteria 3183
794 Ga0495665_0192774 3300046531 Bacteria 1057
795 Ga0495640_0240644 3300046533 Bacteria 1136
796 Ga0495587_0604013 3300046536 Unclassified 604
797 Ga0495645_0147033 3300046543 Unclassified 1641
798 Ga0495645_0402031 3300046543 Bacteria 873
799 Ga0495634_0388071 3300046642 Unclassified 831
800 Ga0495635_0614387 3300046663 Bacteria 709
801 Ga0495588_0052053 3300046674 Bacteria 2110
802 Ga0495657_0204630 3300046675 Bacteria 1202
803 Ga0495657_0654267 3300046675 Unclassified 606
804 Ga0495623_0053862 3300046679 Bacteria 2540
805 Ga0495647_0028580 3300046681 Bacteria 2057
806 Ga0495669_0041066 3300046684 Bacteria 2053
807 Ga0495669_0274918 3300046684 Bacteria 810
808 Ga0495613_0122679 3300046689 Bacteria 1865
809 Ga0495624_0086185 3300046690 Bacteria 1940
810 Ga0495624_0580882 3300046690 Unclassified 668
811 Ga0495600_0180149 3300046809 Bacteria 1362
812 Ga0495600_0227709 3300046809 Bacteria 1191
813 Ga0495674_0080360 3300047319 Bacteria 2798
814 Ga0495674_0085250 3300047319 Bacteria 2706
815 Ga0495593_0221085 3300047673 Bacteria 950
816 Ga0495593_0289991 3300047673 Bacteria 818
817 Ga0495602_0042006 3300048088 Unclassified 4169
818 Ga0495602_0126933 3300048088 Bacteria 2042
819 Ga0495602_0194576 3300048088 Bacteria 1552
820 Ga0495602_0308844 3300048088 Bacteria 1155
821 Ga0495602_0938898 3300048088 Unclassified 574
822 Ga0496100_0009722 3300048903 Bacteria 5413
823 Ga0496100_0668647 3300048903 Bacteria 809
824 Ga0496100_0947093 3300048903 Unclassified 677
825 Ga0496101_0019851 3300048904 Bacteria 4595
826 Ga0496101_0029423 3300048904 Bacteria 3842
827 Ga0496101_0178095 3300048904 Bacteria 1636
828 Ga0496101_0210240 3300048904 Bacteria 1507
829 Ga0496102_0001424 3300048905 Bacteria 21214
830 Ga0496102_0032128 3300048905 Unclassified 4715
831 Ga0496102_0092665 3300048905 Bacteria 2798
832 Ga0496102_0116975 3300048905 Bacteria 2488
833 Ga0496102_0153647 3300048905 Unclassified 2163
834 Ga0496102_0322922 3300048905 Bacteria 1454
835 Ga0496102_0586833 3300048905 Bacteria 1037
836 Ga0496102_0852891 3300048905 Bacteria 833
837 Ga0496102_1197648 3300048905 Unclassified 679
838 Ga0496103_0004119 3300048906 Bacteria 8825
839 Ga0496103_0022334 3300048906 Unclassified 3810
840 Ga0496103_0137789 3300048906 Bacteria 1560
841 Ga0496103_0160422 3300048906 Bacteria 1442
842 Ga0496104_0157280 3300048907 Bacteria 2181
843 Ga0496104_0172435 3300048907 Unclassified 2074
844 Ga0496104_0220356 3300048907 Bacteria 1809
845 Ga0496104_0315597 3300048907 Bacteria 1476
846 Ga0496106_0056741 3300048909 Bacteria 2961
847 Ga0496106_0068846 3300048909 Bacteria 2700
848 Ga0496106_0083711 3300048909 Bacteria 2453
849 Ga0496106_0181273 3300048909 Bacteria 1672
850 Ga0496107_0052688 3300048910 Bacteria 2935
851 Ga0496107_0069126 3300048910 Bacteria 2563
852 Ga0496108_0020285 3300048911 Bacteria 5462
853 Ga0496108_0043628 3300048911 Bacteria 3745
854 Ga0496109_0000117 3300048912 Bacteria 82245
855 Ga0496109_0054749 3300048912 Bacteria 3639
856 Ga0496109_0106106 3300048912 Bacteria 2609
857 Ga0496109_0446946 3300048912 Bacteria 1221
858 Ga0496110_0004256 3300048913 Bacteria 11075
859 Ga0496110_0012731 3300048913 Bacteria 6925
860 Ga0496110_0115435 3300048913 Bacteria 2417
861 Ga0496111_0009763 3300048914 Bacteria 6415
862 Ga0496111_0076767 3300048914 Bacteria 2435
863 Ga0496112_0000283 3300048915 Bacteria 32864
864 Ga0496112_0069112 3300048915 Bacteria 3489
865 Ga0496112_0081816 3300048915 Bacteria 3194
866 Ga0496112_0114302 3300048915 Bacteria 2670
867 Ga0496112_0249986 3300048915 Bacteria 1724
868 Ga0496112_0341521 3300048915 Unclassified 1440
869 Ga0496112_0610245 3300048915 Unclassified 1022
870 Ga0496112_0756931 3300048915 Unclassified 897
871 Ga0496112_1386136 3300048915 Bacteria 618
872 Ga0496113_0002193 3300048916 Bacteria 11259
873 Ga0496113_0024930 3300048916 Unclassified 4258
874 Ga0496115_0003148 3300048918 Bacteria 11863
875 Ga0496115_0009800 3300048918 Bacteria 7134
876 Ga0496115_0191279 3300048918 Bacteria 1691
877 nmdc:mga0n895_10187_c1 3300050512 Bacteria 8280
878 nmdc:mga0n895_15801_c1 3300050512 Bacteria 6902
879 nmdc:mga0n895_47_c1 3300050512 Bacteria 73703
880 nmdc:mga0n895_539906_c1 3300050512 Bacteria 1172
881 nmdc:mga0rr50_317270_c1 3300050513 Bacteria 1306
882 nmdc:mga0rr50_421_c1 3300050513 Bacteria 22898
883 nmdc:mga0rr50_71996_c1 3300050513 Bacteria 2639
884 nmdc:mga0rr50_7786_c1 3300050513 Bacteria 6639
885 nmdc:mga0rr50_839055_c1 3300050513 Unclassified 784
886 nmdc:mga08x19_1461_c1 3300050514 Bacteria 14622
887 nmdc:mga08x19_184697_c1 3300050514 Bacteria 1425
888 nmdc:mga08x19_298231_c1 3300050514 Bacteria 1119
889 nmdc:mga08x19_601136_c1 3300050514 Bacteria 779
890 nmdc:mga08x19_751368_c1 3300050514 Bacteria 692
891 nmdc:mga08x19_8169_c1 3300050514 Bacteria 6219
892 nmdc:mga0a205_223264_c1 3300050515 Unclassified 1769
893 nmdc:mga0a205_378_c1 3300050515 Bacteria 33792
894 Ga0495601_0778046 3300053077 Unclassified 608
895 Ga0495612_0349153 3300053078 Unclassified 668
896 Ga0495612_0438881 3300053078 Unclassified 596
897 Ga0495595_0053173 3300053084 Bacteria 1881
898 Ga0495619_0075971 3300053085 Bacteria 2255
899 Ga0495619_0197349 3300053085 Bacteria 1393
900 Ga0495619_0739838 3300053085 Unclassified 667

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048905 Ga0496102_0852891 Ga0496102_0852891_24_419 131
2 3300048912 Ga0496109_0446946 Ga0496109_0446946_74_469 131
3 3300030760 Ga0265762_1013435 Ga0265762_10134351 145
4 3300005437 Ga0070710_10032513 Ga0070710_100325133 146
5 3300025898 Ga0207692_10068299 Ga0207692_100682992 146
6 3300025906 Ga0207699_10264602 Ga0207699_102646022 146
7 3300031247 Ga0265340_10160945 Ga0265340_101609452 146
8 3300031249 Ga0265339_10068251 Ga0265339_100682512 146
9 3300031711 Ga0265314_10114275 Ga0265314_101142752 146
10 3300053085 Ga0495619_0739838 Ga0495619_0739838_93_560 155
11 3300007265 Ga0099794_10008610 Ga0099794_100086104 158
12 3300050513 nmdc:mga0rr50_317270_c1 nmdc:mga0rr50_317270_c1_654_1130 158
13 3300050514 nmdc:mga08x19_8169_c1 nmdc:mga08x19_8169_c1_836_1312 158
14 3300046663 Ga0495635_0614387 Ga0495635_0614387_115_597 159
15 3300005336 Ga0070680_101260006 Ga0070680_1012600061 160
16 3300005434 Ga0070709_10011458 Ga0070709_100114585 160
17 3300005435 Ga0070714_100046805 Ga0070714_1000468054 160
18 3300005436 Ga0070713_100567926 Ga0070713_1005679261 160
19 3300005437 Ga0070710_10362018 Ga0070710_103620182 160
20 3300005439 Ga0070711_100017979 Ga0070711_1000179791 160
21 3300005458 Ga0070681_10723022 Ga0070681_107230221 160
22 3300005518 Ga0070699_100096093 Ga0070699_1000960933 160
23 3300005518 Ga0070699_100158928 Ga0070699_1001589282 160
24 3300005530 Ga0070679_100322810 Ga0070679_1003228102 160
25 3300006028 Ga0070717_10146046 Ga0070717_101460461 160
26 3300006173 Ga0070716_100530529 Ga0070716_1005305292 160
27 3300006175 Ga0070712_100635624 Ga0070712_1006356241 160
28 3300006914 Ga0075436_100000526 Ga0075436_1000005269 160
29 3300006914 Ga0075436_100016670 Ga0075436_1000166704 160
30 3300006914 Ga0075436_100070745 Ga0075436_1000707453 160
31 3300007076 Ga0075435_100347524 Ga0075435_1003475242 160
32 3300009093 Ga0105240_10263184 Ga0105240_102631841 160
33 3300025906 Ga0207699_10020214 Ga0207699_100202144 160
34 3300025912 Ga0207707_10470183 Ga0207707_104701832 160
35 3300025913 Ga0207695_10905542 Ga0207695_109055422 160
36 3300025915 Ga0207693_10761346 Ga0207693_107613461 160
37 3300025916 Ga0207663_10085695 Ga0207663_100856953 160
38 3300025917 Ga0207660_10761743 Ga0207660_107617431 160
39 3300025929 Ga0207664_10022203 Ga0207664_100222031 160
40 3300044706 Ga0466964_0091790 Ga0466964_0091790_599_1081 160
41 3300045976 Ga0466967_0274981 Ga0466967_0274981_847_1329 160
42 3300048905 Ga0496102_0322922 Ga0496102_0322922_870_1352 160
43 3300050514 nmdc:mga08x19_184697_c1 nmdc:mga08x19_184697_c1_484_966 160
44 3300050514 nmdc:mga08x19_298231_c1 nmdc:mga08x19_298231_c1_594_1076 160
45 3300005434 Ga0070709_10076982 Ga0070709_100769822 161
46 3300005435 Ga0070714_100688409 Ga0070714_1006884092 161
47 3300005436 Ga0070713_100446898 Ga0070713_1004468981 161
48 3300005437 Ga0070710_10109687 Ga0070710_101096872 161
49 3300005439 Ga0070711_100140575 Ga0070711_1001405752 161
50 3300005518 Ga0070699_100625638 Ga0070699_1006256381 161
51 3300006028 Ga0070717_10224306 Ga0070717_102243063 161
52 3300006175 Ga0070712_100709718 Ga0070712_1007097182 161
53 3300006358 Ga0068871_100040074 Ga0068871_1000400742 161
54 3300025916 Ga0207663_10124631 Ga0207663_101246312 161
55 3300025929 Ga0207664_10550611 Ga0207664_105506111 161
56 3300026078 Ga0207702_10622993 Ga0207702_106229932 161
57 3300032002 Ga0307416_100551502 Ga0307416_1005515022 161
58 3300035113 Ga0373936_0006441 Ga0373936_0006441_2059_2544 161
59 3300035695 Ga0373927_0136218 Ga0373927_0136218_128_613 161
60 3300035725 Ga0373947_0156647 Ga0373947_0156647_894_1379 161
61 3300037068 Ga0373925_0234518 Ga0373925_0234518_348_833 161
62 3300044694 Ga0466963_0510293 Ga0466963_0510293_75_560 161
63 3300046472 Ga0495580_0600474 Ga0495580_0600474_138_623 161
64 3300048907 Ga0496104_0172435 Ga0496104_0172435_148_633 161
65 3300048915 Ga0496112_0341521 Ga0496112_0341521_845_1330 161
66 3300005434 Ga0070709_10876434 Ga0070709_108764341 162
67 3300005435 Ga0070714_100084131 Ga0070714_1000841312 162
68 3300005436 Ga0070713_100230160 Ga0070713_1002301602 162
69 3300005437 Ga0070710_10782788 Ga0070710_107827882 162
70 3300006028 Ga0070717_10000612 Ga0070717_100006122 162
71 3300006028 Ga0070717_10252654 Ga0070717_102526543 162
72 3300006028 Ga0070717_10743396 Ga0070717_107433962 162
73 3300009093 Ga0105240_10256517 Ga0105240_102565173 162
74 3300009093 Ga0105240_10593662 Ga0105240_105936623 162
75 3300009545 Ga0105237_11087867 Ga0105237_110878671 162
76 3300013104 Ga0157370_10677144 Ga0157370_106771442 162
77 3300013105 Ga0157369_10119587 Ga0157369_101195873 162
78 3300013307 Ga0157372_10015214 Ga0157372_100152142 162
79 3300013307 Ga0157372_10242027 Ga0157372_102420272 162
80 3300013307 Ga0157372_10428455 Ga0157372_104284552 162
81 3300015262 Ga0182007_10103770 Ga0182007_101037702 162
82 3300025898 Ga0207692_10391074 Ga0207692_103910742 162
83 3300025906 Ga0207699_10656955 Ga0207699_106569552 162
84 3300025913 Ga0207695_10027763 Ga0207695_100277635 162
85 3300025913 Ga0207695_10064718 Ga0207695_100647184 162
86 3300025914 Ga0207671_10537801 Ga0207671_105378012 162
87 3300025928 Ga0207700_10030601 Ga0207700_100306014 162
88 3300025929 Ga0207664_10191181 Ga0207664_101911813 162
89 3300025929 Ga0207664_10650565 Ga0207664_106505652 162
90 3300025949 Ga0207667_11555893 Ga0207667_115558932 162
91 3300026088 Ga0207641_10233097 Ga0207641_102330972 162
92 3300035119 Ga0373956_0138998 Ga0373956_0138998_177_665 162
93 3300035120 Ga0373957_0132135 Ga0373957_0132135_158_646 162
94 3300035692 Ga0373935_0022633 Ga0373935_0022633_2285_2773 162
95 3300035724 Ga0373933_0309111 Ga0373933_0309111_156_644 162
96 3300037418 Ga0395900_0930063 Ga0395900_0930063_222_710 162
97 3300046684 Ga0495669_0041066 Ga0495669_0041066_1072_1560 162
98 3300048088 Ga0495602_0938898 Ga0495602_0938898_33_521 162
99 3300048915 Ga0496112_0081816 Ga0496112_0081816_887_1375 162
100 3300005435 Ga0070714_100726817 Ga0070714_1007268172 163
101 3300005614 Ga0068856_100060970 Ga0068856_1000609702 163
102 3300006173 Ga0070716_100120575 Ga0070716_1001205752 163
103 3300006175 Ga0070712_100505911 Ga0070712_1005059112 163
104 3300006237 Ga0097621_100327422 Ga0097621_1003274221 163
105 3300007265 Ga0099794_10236851 Ga0099794_102368512 163
106 3300009093 Ga0105240_10181112 Ga0105240_101811123 163
107 3300009174 Ga0105241_10000916 Ga0105241_100009163 163
108 3300013100 Ga0157373_10000288 Ga0157373_1000028832 163
109 3300013104 Ga0157370_10045720 Ga0157370_100457203 163
110 3300013105 Ga0157369_10008623 Ga0157369_100086232 163
111 3300013296 Ga0157374_10186316 Ga0157374_101863162 163
112 3300013307 Ga0157372_10015183 Ga0157372_100151832 163
113 3300025911 Ga0207654_10006062 Ga0207654_100060623 163
114 3300025913 Ga0207695_10307560 Ga0207695_103075601 163
115 3300025945 Ga0207679_10192010 Ga0207679_101920101 163
116 3300025981 Ga0207640_10154868 Ga0207640_101548681 163
117 3300026078 Ga0207702_10002571 Ga0207702_1000257113 163
118 3300035121 Ga0373960_0075450 Ga0373960_0075450_160_651 163
119 3300035695 Ga0373927_0908407 Ga0373927_0908407_26_517 163
120 3300037068 Ga0373925_0733739 Ga0373925_0733739_46_537 163
121 3300044735 Ga0466968_0362720 Ga0466968_0362720_79_570 163
122 3300048915 Ga0496112_0069112 Ga0496112_0069112_2053_2544 163
123 3300005434 Ga0070709_10687645 Ga0070709_106876451 164
124 3300005436 Ga0070713_100413481 Ga0070713_1004134813 164
125 3300005436 Ga0070713_100444628 Ga0070713_1004446281 164
126 3300005439 Ga0070711_100099388 Ga0070711_1000993882 164
127 3300005445 Ga0070708_100095844 Ga0070708_1000958444 164
128 3300005518 Ga0070699_100752106 Ga0070699_1007521061 164
129 3300005536 Ga0070697_100024244 Ga0070697_1000242443 164
130 3300006175 Ga0070712_100061623 Ga0070712_1000616232 164
131 3300009093 Ga0105240_11617565 Ga0105240_116175651 164
132 3300009147 Ga0114129_11407360 Ga0114129_114073602 164
133 3300009177 Ga0105248_10010789 Ga0105248_100107892 164
134 3300009545 Ga0105237_10062864 Ga0105237_100628642 164
135 3300009553 Ga0105249_11371650 Ga0105249_113716501 164
136 3300013104 Ga0157370_10085697 Ga0157370_100856973 164
137 3300013105 Ga0157369_10102365 Ga0157369_101023653 164
138 3300013296 Ga0157374_10014241 Ga0157374_100142417 164
139 3300013307 Ga0157372_11143669 Ga0157372_111436691 164
140 3300014497 Ga0182008_10019449 Ga0182008_100194492 164
141 3300021377 Ga0213874_10090537 Ga0213874_100905372 164
142 3300025906 Ga0207699_10446256 Ga0207699_104462561 164
143 3300025915 Ga0207693_10075950 Ga0207693_100759504 164
144 3300025916 Ga0207663_10079355 Ga0207663_100793552 164
145 3300025922 Ga0207646_10272895 Ga0207646_102728953 164
146 3300025928 Ga0207700_10153261 Ga0207700_101532612 164
147 3300025928 Ga0207700_10618550 Ga0207700_106185502 164
148 3300035120 Ga0373957_0027426 Ga0373957_0027426_1263_1757 164
149 3300035172 Ga0373955_0093625 Ga0373955_0093625_793_1287 164
150 3300035695 Ga0373927_0293803 Ga0373927_0293803_238_732 164
151 3300035724 Ga0373933_0045238 Ga0373933_0045238_2101_2595 164
152 3300036401 Ga0373937_0041215 Ga0373937_0041215_59_553 164
153 3300036401 Ga0373937_0356387 Ga0373937_0356387_771_1265 164
154 3300037068 Ga0373925_0003546 Ga0373925_0003546_3846_4340 164
155 3300039450 Ga0436363_0859048 Ga0436363_0859048_4353_4847 164
156 3300046462 Ga0495651_0136996 Ga0495651_0136996_555_1049 164
157 3300046536 Ga0495587_0604013 Ga0495587_0604013_85_579 164
158 3300046543 Ga0495645_0402031 Ga0495645_0402031_117_611 164
159 3300048088 Ga0495602_0042006 Ga0495602_0042006_2440_2934 164
160 3300050512 nmdc:mga0n895_47_c1 nmdc:mga0n895_47_c1_64330_64824 164
161 3300050513 nmdc:mga0rr50_421_c1 nmdc:mga0rr50_421_c1_1858_2352 164
162 3300050514 nmdc:mga08x19_1461_c1 nmdc:mga08x19_1461_c1_1355_1849 164
163 3300050515 nmdc:mga0a205_378_c1 nmdc:mga0a205_378_c1_19055_19549 164
164 3300053077 Ga0495601_0778046 Ga0495601_0778046_40_534 164
165 3300053078 Ga0495612_0349153 Ga0495612_0349153_22_516 164
166 3300000546 LJNas_1000607 LJNas_10006075 165
167 3300005434 Ga0070709_10001876 Ga0070709_100018762 165
168 3300005434 Ga0070709_10006738 Ga0070709_100067382 165
169 3300005435 Ga0070714_100000172 Ga0070714_10000017211 165
170 3300005435 Ga0070714_100310781 Ga0070714_1003107812 165
171 3300005435 Ga0070714_100371348 Ga0070714_1003713481 165
172 3300005436 Ga0070713_100000342 Ga0070713_10000034213 165
173 3300005436 Ga0070713_100000449 Ga0070713_1000004497 165
174 3300005436 Ga0070713_100000510 Ga0070713_1000005101 165
175 3300005436 Ga0070713_100013833 Ga0070713_1000138335 165
176 3300005436 Ga0070713_100045317 Ga0070713_1000453172 165
177 3300005436 Ga0070713_100101831 Ga0070713_1001018313 165
178 3300005436 Ga0070713_100144760 Ga0070713_1001447602 165
179 3300005436 Ga0070713_100198026 Ga0070713_1001980263 165
180 3300005436 Ga0070713_100530247 Ga0070713_1005302472 165
181 3300005437 Ga0070710_10119208 Ga0070710_101192082 165
182 3300005437 Ga0070710_10309313 Ga0070710_103093132 165
183 3300005437 Ga0070710_10394409 Ga0070710_103944092 165
184 3300005439 Ga0070711_100000099 Ga0070711_10000009940 165
185 3300005439 Ga0070711_100072690 Ga0070711_1000726902 165
186 3300005439 Ga0070711_100610301 Ga0070711_1006103012 165
187 3300005439 Ga0070711_100746168 Ga0070711_1007461681 165
188 3300005445 Ga0070708_100001401 Ga0070708_10000140114 165
189 3300005445 Ga0070708_100002020 Ga0070708_10000202012 165
190 3300005445 Ga0070708_100044658 Ga0070708_1000446583 165
191 3300005445 Ga0070708_100163052 Ga0070708_1001630523 165
192 3300005445 Ga0070708_100164013 Ga0070708_1001640132 165
193 3300005445 Ga0070708_100962316 Ga0070708_1009623162 165
194 3300005458 Ga0070681_10570204 Ga0070681_105702041 165
195 3300005467 Ga0070706_100013420 Ga0070706_1000134207 165
196 3300005467 Ga0070706_100060551 Ga0070706_1000605511 165
197 3300005467 Ga0070706_100511527 Ga0070706_1005115272 165
198 3300005467 Ga0070706_100538555 Ga0070706_1005385552 165
199 3300005468 Ga0070707_100002543 Ga0070707_10000254315 165
200 3300005468 Ga0070707_100057506 Ga0070707_1000575062 165
201 3300005468 Ga0070707_100297759 Ga0070707_1002977592 165
202 3300005471 Ga0070698_100007167 Ga0070698_1000071679 165
203 3300005471 Ga0070698_100128893 Ga0070698_1001288931 165
204 3300005471 Ga0070698_100136048 Ga0070698_1001360482 165
205 3300005518 Ga0070699_100001096 Ga0070699_1000010967 165
206 3300005518 Ga0070699_100048438 Ga0070699_1000484383 165
207 3300005535 Ga0070684_100820120 Ga0070684_1008201202 165
208 3300005536 Ga0070697_100002639 Ga0070697_1000026397 165
209 3300005536 Ga0070697_100212204 Ga0070697_1002122042 165
210 3300005563 Ga0068855_100826772 Ga0068855_1008267721 165
211 3300005614 Ga0068856_100019084 Ga0068856_1000190845 165
212 3300006028 Ga0070717_10000837 Ga0070717_100008377 165
213 3300006028 Ga0070717_10001449 Ga0070717_100014499 165
214 3300006028 Ga0070717_10005741 Ga0070717_100057416 165
215 3300006028 Ga0070717_10024145 Ga0070717_100241455 165
216 3300006028 Ga0070717_10045843 Ga0070717_100458433 165
217 3300006028 Ga0070717_10137148 Ga0070717_101371482 165
218 3300006028 Ga0070717_10147941 Ga0070717_101479413 165
219 3300006028 Ga0070717_10496403 Ga0070717_104964032 165
220 3300006163 Ga0070715_10095244 Ga0070715_100952444 165
221 3300006173 Ga0070716_100002096 Ga0070716_1000020964 165
222 3300006173 Ga0070716_100037106 Ga0070716_1000371063 165
223 3300006173 Ga0070716_100042111 Ga0070716_1000421114 165
224 3300006173 Ga0070716_100097798 Ga0070716_1000977982 165
225 3300006173 Ga0070716_100191504 Ga0070716_1001915041 165
226 3300006173 Ga0070716_100449359 Ga0070716_1004493592 165
227 3300006173 Ga0070716_100880373 Ga0070716_1008803731 165
228 3300006175 Ga0070712_100000546 Ga0070712_10000054615 165
229 3300006175 Ga0070712_100003075 Ga0070712_1000030756 165
230 3300006175 Ga0070712_100005278 Ga0070712_1000052781 165
231 3300006175 Ga0070712_100233313 Ga0070712_1002333132 165
232 3300006175 Ga0070712_100464965 Ga0070712_1004649652 165
233 3300006871 Ga0075434_100002766 Ga0075434_10000276612 165
234 3300006914 Ga0075436_100277786 Ga0075436_1002777861 165
235 3300006914 Ga0075436_100734257 Ga0075436_1007342571 165
236 3300007076 Ga0075435_100037240 Ga0075435_1000372404 165
237 3300007265 Ga0099794_10111802 Ga0099794_101118023 165
238 3300007788 Ga0099795_10036881 Ga0099795_100368812 165
239 3300007788 Ga0099795_10101684 Ga0099795_101016842 165
240 3300009174 Ga0105241_10328554 Ga0105241_103285542 165
241 3300009545 Ga0105237_11755320 Ga0105237_117553202 165
242 3300010375 Ga0105239_12520334 Ga0105239_125203341 165
243 3300011119 Ga0105246_11729674 Ga0105246_117296741 165
244 3300013100 Ga0157373_10207528 Ga0157373_102075282 165
245 3300013307 Ga0157372_10076790 Ga0157372_100767903 165
246 3300013307 Ga0157372_10933286 Ga0157372_109332861 165
247 3300014969 Ga0157376_10397162 Ga0157376_103971621 165
248 3300019181 Ga0184594_100472 Ga0184594_1004722 165
249 3300021358 Ga0213873_10136317 Ga0213873_101363171 165
250 3300022730 Ga0224570_100064 Ga0224570_1000643 165
251 3300022732 Ga0224569_100403 Ga0224569_1004032 165
252 3300022734 Ga0224571_102100 Ga0224571_1021003 165
253 3300024225 Ga0224572_1005998 Ga0224572_10059982 165
254 3300024225 Ga0224572_1018321 Ga0224572_10183211 165
255 3300024227 Ga0228598_1000222 Ga0228598_10002228 165
256 3300024227 Ga0228598_1000816 Ga0228598_10008165 165
257 3300024227 Ga0228598_1027302 Ga0228598_10273021 165
258 3300025898 Ga0207692_10006597 Ga0207692_100065974 165
259 3300025898 Ga0207692_10089120 Ga0207692_100891202 165
260 3300025898 Ga0207692_10325901 Ga0207692_103259012 165
261 3300025906 Ga0207699_10001324 Ga0207699_100013249 165
262 3300025906 Ga0207699_10058713 Ga0207699_100587131 165
263 3300025906 Ga0207699_10061138 Ga0207699_100611381 165
264 3300025906 Ga0207699_10767960 Ga0207699_107679601 165
265 3300025910 Ga0207684_10000217 Ga0207684_1000021767 165
266 3300025910 Ga0207684_10498628 Ga0207684_104986282 165
267 3300025910 Ga0207684_10779951 Ga0207684_107799512 165
268 3300025911 Ga0207654_10246661 Ga0207654_102466611 165
269 3300025912 Ga0207707_10510704 Ga0207707_105107041 165
270 3300025913 Ga0207695_10545532 Ga0207695_105455321 165
271 3300025915 Ga0207693_10000089 Ga0207693_1000008957 165
272 3300025915 Ga0207693_10000106 Ga0207693_1000010616 165
273 3300025915 Ga0207693_10009582 Ga0207693_100095821 165
274 3300025915 Ga0207693_10209793 Ga0207693_102097931 165
275 3300025915 Ga0207693_10286481 Ga0207693_102864812 165
276 3300025915 Ga0207693_10374723 Ga0207693_103747232 165
277 3300025916 Ga0207663_10320556 Ga0207663_103205562 165
278 3300025916 Ga0207663_10788727 Ga0207663_107887272 165
279 3300025921 Ga0207652_10144604 Ga0207652_101446041 165
280 3300025922 Ga0207646_10001311 Ga0207646_1000131130 165
281 3300025922 Ga0207646_10209420 Ga0207646_102094201 165
282 3300025922 Ga0207646_10300814 Ga0207646_103008141 165
283 3300025924 Ga0207694_10182398 Ga0207694_101823982 165
284 3300025928 Ga0207700_10000289 Ga0207700_1000028915 165
285 3300025928 Ga0207700_10000888 Ga0207700_100008884 165
286 3300025928 Ga0207700_10025835 Ga0207700_100258354 165
287 3300025928 Ga0207700_10077108 Ga0207700_100771082 165
288 3300025928 Ga0207700_10161029 Ga0207700_101610293 165
289 3300025928 Ga0207700_10255286 Ga0207700_102552862 165
290 3300025928 Ga0207700_10263812 Ga0207700_102638123 165
291 3300025928 Ga0207700_10657352 Ga0207700_106573521 165
292 3300025929 Ga0207664_10000118 Ga0207664_1000011848 165
293 3300025929 Ga0207664_10141500 Ga0207664_101415003 165
294 3300025929 Ga0207664_10234103 Ga0207664_102341032 165
295 3300025929 Ga0207664_10320035 Ga0207664_103200352 165
296 3300025929 Ga0207664_10332482 Ga0207664_103324822 165
297 3300025939 Ga0207665_10001480 Ga0207665_100014804 165
298 3300025939 Ga0207665_10001526 Ga0207665_100015263 165
299 3300025939 Ga0207665_10044443 Ga0207665_100444434 165
300 3300025939 Ga0207665_10079547 Ga0207665_100795473 165
301 3300025939 Ga0207665_10138043 Ga0207665_101380431 165
302 3300025939 Ga0207665_10255058 Ga0207665_102550582 165
303 3300026078 Ga0207702_10023735 Ga0207702_100237353 165
304 3300026078 Ga0207702_10627342 Ga0207702_106273422 165
305 3300028017 Ga0265356_1000336 Ga0265356_10003367 165
306 3300028017 Ga0265356_1010488 Ga0265356_10104882 165
307 3300028023 Ga0265357_1018582 Ga0265357_10185822 165
308 3300028666 Ga0265336_10044137 Ga0265336_100441373 165
309 3300028800 Ga0265338_10010626 Ga0265338_100106268 165
310 3300028800 Ga0265338_10012546 Ga0265338_100125463 165
311 3300028800 Ga0265338_10173197 Ga0265338_101731971 165
312 3300030760 Ga0265762_1002825 Ga0265762_10028252 165
313 3300030760 Ga0265762_1020484 Ga0265762_10204842 165
314 3300030762 Ga0265775_103190 Ga0265775_1031901 165
315 3300030836 Ga0265767_101478 Ga0265767_1014782 165
316 3300030878 Ga0265770_1085108 Ga0265770_10851081 165
317 3300031010 Ga0265771_1003369 Ga0265771_10033691 165
318 3300031090 Ga0265760_10001481 Ga0265760_100014817 165
319 3300031090 Ga0265760_10081793 Ga0265760_100817932 165
320 3300031241 Ga0265325_10010836 Ga0265325_100108362 165
321 3300031241 Ga0265325_10086051 Ga0265325_100860511 165
322 3300031247 Ga0265340_10078248 Ga0265340_100782483 165
323 3300031249 Ga0265339_10015242 Ga0265339_100152423 165
324 3300031249 Ga0265339_10161471 Ga0265339_101614711 165
325 3300031344 Ga0265316_10019190 Ga0265316_100191905 165
326 3300031344 Ga0265316_10568181 Ga0265316_105681811 165
327 3300031712 Ga0265342_10160925 Ga0265342_101609253 165
328 3300033545 Ga0316214_1007710 Ga0316214_10077103 165
329 3300035083 Ga0373926_0028857 Ga0373926_0028857_326_823 165
330 3300035083 Ga0373926_0042062 Ga0373926_0042062_97_621 165
331 3300035083 Ga0373926_0145879 Ga0373926_0145879_279_776 165
332 3300035086 Ga0373934_0039992 Ga0373934_0039992_85_582 165
333 3300035089 Ga0373944_0047625 Ga0373944_0047625_154_651 165
334 3300035089 Ga0373944_0200346 Ga0373944_0200346_189_713 165
335 3300035111 Ga0373923_0018059 Ga0373923_0018059_1971_2468 165
336 3300035113 Ga0373936_0000966 Ga0373936_0000966_2417_2914 165
337 3300035117 Ga0373953_0010005 Ga0373953_0010005_2387_2884 165
338 3300035118 Ga0373954_0078263 Ga0373954_0078263_1004_1501 165
339 3300035119 Ga0373956_0008841 Ga0373956_0008841_1068_1565 165
340 3300035120 Ga0373957_0017150 Ga0373957_0017150_1847_2344 165
341 3300035170 Ga0373943_0000054 Ga0373943_0000054_11070_11567 165
342 3300035170 Ga0373943_0083341 Ga0373943_0083341_363_860 165
343 3300035171 Ga0373946_0010120 Ga0373946_0010120_759_1256 165
344 3300035172 Ga0373955_0028331 Ga0373955_0028331_1580_2077 165
345 3300035172 Ga0373955_0066887 Ga0373955_0066887_871_1368 165
346 3300035172 Ga0373955_0182572 Ga0373955_0182572_569_1066 165
347 3300035410 Ga0373924_0016533 Ga0373924_0016533_2032_2529 165
348 3300035410 Ga0373924_0023333 Ga0373924_0023333_1059_1556 165
349 3300035692 Ga0373935_0004095 Ga0373935_0004095_729_1226 165
350 3300035692 Ga0373935_0031111 Ga0373935_0031111_101_598 165
351 3300035692 Ga0373935_0116917 Ga0373935_0116917_418_915 165
352 3300035695 Ga0373927_0082280 Ga0373927_0082280_368_865 165
353 3300035695 Ga0373927_0273549 Ga0373927_0273549_511_1008 165
354 3300035695 Ga0373927_0463003 Ga0373927_0463003_68_565 165
355 3300035695 Ga0373927_0569314 Ga0373927_0569314_159_656 165
356 3300035724 Ga0373933_0014246 Ga0373933_0014246_700_1197 165
357 3300035724 Ga0373933_0100682 Ga0373933_0100682_1141_1638 165
358 3300035724 Ga0373933_0253078 Ga0373933_0253078_279_776 165
359 3300035724 Ga0373933_0576410 Ga0373933_0576410_137_634 165
360 3300035724 Ga0373933_0828794 Ga0373933_0828794_71_568 165
361 3300035725 Ga0373947_0000496 Ga0373947_0000496_2294_2791 165
362 3300035725 Ga0373947_0014673 Ga0373947_0014673_2196_2693 165
363 3300036401 Ga0373937_0058242 Ga0373937_0058242_1531_2028 165
364 3300036401 Ga0373937_0401786 Ga0373937_0401786_734_1273 165
365 3300036401 Ga0373937_0516119 Ga0373937_0516119_479_1018 165
366 3300036401 Ga0373937_0623515 Ga0373937_0623515_29_526 165
367 3300036401 Ga0373937_0793375 Ga0373937_0793375_228_725 165
368 3300037068 Ga0373925_0018652 Ga0373925_0018652_1159_1656 165
369 3300037068 Ga0373925_0141462 Ga0373925_0141462_51_548 165
370 3300037068 Ga0373925_0239178 Ga0373925_0239178_204_728 165
371 3300037068 Ga0373925_0542925 Ga0373925_0542925_70_567 165
372 3300037471 Ga0395905_0745593 Ga0395905_0745593_314_811 165
373 3300039450 Ga0436363_0310747 Ga0436363_0310747_40_537 165
374 3300039450 Ga0436363_1703454 Ga0436363_1703454_54_551 165
375 3300039453 Ga0436362_0242382 Ga0436362_0242382_1651_2148 165
376 3300044706 Ga0466964_0369952 Ga0466964_0369952_171_668 165
377 3300045051 Ga0451576_2472999 Ga0451576_2472999_10_507 165
378 3300046454 Ga0495592_0651313 Ga0495592_0651313_101_598 165
379 3300046459 Ga0495629_0104434 Ga0495629_0104434_36_533 165
380 3300046459 Ga0495629_0247385 Ga0495629_0247385_171_668 165
381 3300046472 Ga0495580_0000031 Ga0495580_0000031_63065_63562 165
382 3300046472 Ga0495580_0018579 Ga0495580_0018579_4009_4533 165
383 3300046472 Ga0495580_0019658 Ga0495580_0019658_3172_3669 165
384 3300046472 Ga0495580_0171239 Ga0495580_0171239_70_567 165
385 3300046472 Ga0495580_0177389 Ga0495580_0177389_615_1112 165
386 3300046473 Ga0495582_0015585 Ga0495582_0015585_741_1238 165
387 3300046491 Ga0495584_0018151 Ga0495584_0018151_1804_2301 165
388 3300046516 Ga0495628_0476723 Ga0495628_0476723_284_781 165
389 3300046517 Ga0495630_0050881 Ga0495630_0050881_1051_1548 165
390 3300046517 Ga0495630_0230553 Ga0495630_0230553_216_713 165
391 3300046517 Ga0495630_0427477 Ga0495630_0427477_143_640 165
392 3300046517 Ga0495630_0658930 Ga0495630_0658930_42_539 165
393 3300046531 Ga0495665_0025377 Ga0495665_0025377_1884_2381 165
394 3300046531 Ga0495665_0192774 Ga0495665_0192774_145_642 165
395 3300046533 Ga0495640_0240644 Ga0495640_0240644_89_586 165
396 3300046543 Ga0495645_0147033 Ga0495645_0147033_793_1290 165
397 3300046642 Ga0495634_0388071 Ga0495634_0388071_320_817 165
398 3300046675 Ga0495657_0204630 Ga0495657_0204630_324_821 165
399 3300046675 Ga0495657_0654267 Ga0495657_0654267_82_579 165
400 3300046679 Ga0495623_0053862 Ga0495623_0053862_699_1196 165
401 3300046681 Ga0495647_0028580 Ga0495647_0028580_994_1491 165
402 3300046684 Ga0495669_0274918 Ga0495669_0274918_35_532 165
403 3300046689 Ga0495613_0122679 Ga0495613_0122679_186_683 165
404 3300046690 Ga0495624_0086185 Ga0495624_0086185_324_821 165
405 3300046690 Ga0495624_0580882 Ga0495624_0580882_64_561 165
406 3300046809 Ga0495600_0227709 Ga0495600_0227709_635_1132 165
407 3300047319 Ga0495674_0080360 Ga0495674_0080360_826_1323 165
408 3300047319 Ga0495674_0085250 Ga0495674_0085250_89_586 165
409 3300047673 Ga0495593_0221085 Ga0495593_0221085_220_717 165
410 3300047673 Ga0495593_0289991 Ga0495593_0289991_14_511 165
411 3300048088 Ga0495602_0126933 Ga0495602_0126933_826_1323 165
412 3300048088 Ga0495602_0308844 Ga0495602_0308844_445_942 165
413 3300048915 Ga0496112_1386136 Ga0496112_1386136_42_587 165
414 3300048918 Ga0496115_0009800 Ga0496115_0009800_2157_2654 165
415 3300050512 nmdc:mga0n895_15801_c1 nmdc:mga0n895_15801_c1_5784_6281 165
416 3300050513 nmdc:mga0rr50_7786_c1 nmdc:mga0rr50_7786_c1_234_731 165
417 3300050514 nmdc:mga08x19_601136_c1 nmdc:mga08x19_601136_c1_162_659 165
418 3300050514 nmdc:mga08x19_751368_c1 nmdc:mga08x19_751368_c1_10_507 165
419 3300053078 Ga0495612_0438881 Ga0495612_0438881_68_568 165
420 3300053085 Ga0495619_0075971 Ga0495619_0075971_769_1266 165
421 2162886012 MBSR1b_contig_12373736 MBSR1b_0699.00003150 166
422 3300001991 JGI24743J22301_10000326 JGI24743J22301_100003262 166
423 3300002076 JGI24749J21850_1013365 JGI24749J21850_10133651 166
424 3300002155 JGI24033J26618_1034833 JGI24033J26618_10348331 166
425 3300002239 JGI24034J26672_10001510 JGI24034J26672_100015104 166
426 3300002459 JGI24751J29686_10021546 JGI24751J29686_100215461 166
427 3300005293 Ga0065715_10091638 Ga0065715_100916384 166
428 3300005327 Ga0070658_10333721 Ga0070658_103337211 166
429 3300005327 Ga0070658_10969985 Ga0070658_109699851 166
430 3300005328 Ga0070676_10010579 Ga0070676_100105794 166
431 3300005328 Ga0070676_10073015 Ga0070676_100730152 166
432 3300005329 Ga0070683_100008507 Ga0070683_1000085072 166
433 3300005329 Ga0070683_100029649 Ga0070683_1000296492 166
434 3300005329 Ga0070683_100505160 Ga0070683_1005051601 166
435 3300005330 Ga0070690_100026557 Ga0070690_1000265574 166
436 3300005330 Ga0070690_100454794 Ga0070690_1004547941 166
437 3300005331 Ga0070670_100014317 Ga0070670_1000143172 166
438 3300005331 Ga0070670_100134527 Ga0070670_1001345272 166
439 3300005333 Ga0070677_10013347 Ga0070677_100133473 166
440 3300005333 Ga0070677_10548777 Ga0070677_105487771 166
441 3300005334 Ga0068869_100014661 Ga0068869_1000146612 166
442 3300005335 Ga0070666_10028525 Ga0070666_100285254 166
443 3300005335 Ga0070666_10175835 Ga0070666_101758353 166
444 3300005335 Ga0070666_10206556 Ga0070666_102065562 166
445 3300005336 Ga0070680_100256127 Ga0070680_1002561272 166
446 3300005336 Ga0070680_101373755 Ga0070680_1013737551 166
447 3300005337 Ga0070682_100021304 Ga0070682_1000213043 166
448 3300005337 Ga0070682_101578708 Ga0070682_1015787081 166
449 3300005338 Ga0068868_100048560 Ga0068868_1000485603 166
450 3300005338 Ga0068868_100232874 Ga0068868_1002328742 166
451 3300005339 Ga0070660_100016361 Ga0070660_1000163614 166
452 3300005339 Ga0070660_100162634 Ga0070660_1001626341 166
453 3300005340 Ga0070689_100013364 Ga0070689_1000133644 166
454 3300005341 Ga0070691_10112169 Ga0070691_101121692 166
455 3300005343 Ga0070687_100027361 Ga0070687_1000273612 166
456 3300005344 Ga0070661_100012448 Ga0070661_1000124484 166
457 3300005344 Ga0070661_100018311 Ga0070661_1000183115 166
458 3300005344 Ga0070661_100216493 Ga0070661_1002164933 166
459 3300005347 Ga0070668_100009738 Ga0070668_1000097387 166
460 3300005347 Ga0070668_100049564 Ga0070668_1000495643 166
461 3300005353 Ga0070669_100012969 Ga0070669_1000129694 166
462 3300005353 Ga0070669_100183475 Ga0070669_1001834752 166
463 3300005354 Ga0070675_100019172 Ga0070675_1000191723 166
464 3300005355 Ga0070671_100219132 Ga0070671_1002191323 166
465 3300005356 Ga0070674_100027611 Ga0070674_1000276111 166
466 3300005356 Ga0070674_101901762 Ga0070674_1019017621 166
467 3300005364 Ga0070673_100010535 Ga0070673_1000105352 166
468 3300005365 Ga0070688_100006794 Ga0070688_1000067943 166
469 3300005365 Ga0070688_100089223 Ga0070688_1000892232 166
470 3300005366 Ga0070659_100005924 Ga0070659_1000059242 166
471 3300005366 Ga0070659_100134094 Ga0070659_1001340943 166
472 3300005367 Ga0070667_100018445 Ga0070667_1000184455 166
473 3300005367 Ga0070667_100205060 Ga0070667_1002050603 166
474 3300005434 Ga0070709_10012421 Ga0070709_100124211 166
475 3300005434 Ga0070709_10035701 Ga0070709_100357014 166
476 3300005436 Ga0070713_100065002 Ga0070713_1000650022 166
477 3300005436 Ga0070713_100875083 Ga0070713_1008750832 166
478 3300005437 Ga0070710_10294543 Ga0070710_102945432 166
479 3300005439 Ga0070711_100002049 Ga0070711_1000020493 166
480 3300005439 Ga0070711_100046051 Ga0070711_1000460513 166
481 3300005444 Ga0070694_100271550 Ga0070694_1002715501 166
482 3300005445 Ga0070708_100000418 Ga0070708_10000041824 166
483 3300005445 Ga0070708_100016302 Ga0070708_1000163025 166
484 3300005445 Ga0070708_100044220 Ga0070708_1000442204 166
485 3300005445 Ga0070708_100625578 Ga0070708_1006255782 166
486 3300005455 Ga0070663_100010754 Ga0070663_1000107544 166
487 3300005455 Ga0070663_100047085 Ga0070663_1000470852 166
488 3300005456 Ga0070678_100022210 Ga0070678_1000222104 166
489 3300005456 Ga0070678_100054141 Ga0070678_1000541411 166
490 3300005457 Ga0070662_100003783 Ga0070662_1000037832 166
491 3300005457 Ga0070662_100023119 Ga0070662_1000231192 166
492 3300005457 Ga0070662_100071465 Ga0070662_1000714652 166
493 3300005458 Ga0070681_10115544 Ga0070681_101155441 166
494 3300005458 Ga0070681_10535497 Ga0070681_105354971 166
495 3300005459 Ga0068867_100011942 Ga0068867_1000119426 166
496 3300005459 Ga0068867_100065906 Ga0068867_1000659061 166
497 3300005466 Ga0070685_10005938 Ga0070685_100059387 166
498 3300005466 Ga0070685_10146971 Ga0070685_101469712 166
499 3300005467 Ga0070706_100000173 Ga0070706_10000017318 166
500 3300005467 Ga0070706_100001295 Ga0070706_10000129511 166
501 3300005467 Ga0070706_100018639 Ga0070706_1000186396 166
502 3300005468 Ga0070707_100000719 Ga0070707_10000071911 166
503 3300005468 Ga0070707_100012053 Ga0070707_1000120535 166
504 3300005468 Ga0070707_100057513 Ga0070707_1000575134 166
505 3300005471 Ga0070698_100000162 Ga0070698_10000016231 166
506 3300005471 Ga0070698_100166556 Ga0070698_1001665563 166
507 3300005518 Ga0070699_100002540 Ga0070699_1000025407 166
508 3300005518 Ga0070699_100004218 Ga0070699_1000042187 166
509 3300005518 Ga0070699_100012258 Ga0070699_1000122584 166
510 3300005518 Ga0070699_100592358 Ga0070699_1005923582 166
511 3300005530 Ga0070679_100256332 Ga0070679_1002563322 166
512 3300005530 Ga0070679_100978251 Ga0070679_1009782511 166
513 3300005535 Ga0070684_100006304 Ga0070684_1000063047 166
514 3300005535 Ga0070684_100160446 Ga0070684_1001604462 166
515 3300005536 Ga0070697_100000554 Ga0070697_10000055423 166
516 3300005536 Ga0070697_100000872 Ga0070697_1000008728 166
517 3300005536 Ga0070697_100001177 Ga0070697_1000011772 166
518 3300005536 Ga0070697_100001505 Ga0070697_1000015055 166
519 3300005536 Ga0070697_100174118 Ga0070697_1001741182 166
520 3300005539 Ga0068853_100016415 Ga0068853_1000164154 166
521 3300005539 Ga0068853_100035889 Ga0068853_1000358892 166
522 3300005539 Ga0068853_100035951 Ga0068853_1000359512 166
523 3300005543 Ga0070672_100019833 Ga0070672_1000198334 166
524 3300005544 Ga0070686_100030276 Ga0070686_1000302764 166
525 3300005544 Ga0070686_100062316 Ga0070686_1000623163 166
526 3300005545 Ga0070695_100161859 Ga0070695_1001618593 166
527 3300005545 Ga0070695_100572691 Ga0070695_1005726911 166
528 3300005546 Ga0070696_100308363 Ga0070696_1003083632 166
529 3300005547 Ga0070693_100117514 Ga0070693_1001175142 166
530 3300005547 Ga0070693_100256189 Ga0070693_1002561892 166
531 3300005548 Ga0070665_100384352 Ga0070665_1003843521 166
532 3300005563 Ga0068855_100028151 Ga0068855_1000281514 166
533 3300005563 Ga0068855_100082032 Ga0068855_1000820321 166
534 3300005563 Ga0068855_101094456 Ga0068855_1010944562 166
535 3300005564 Ga0070664_100012980 Ga0070664_1000129807 166
536 3300005564 Ga0070664_100017362 Ga0070664_1000173622 166
537 3300005564 Ga0070664_100173686 Ga0070664_1001736863 166
538 3300005577 Ga0068857_100002662 Ga0068857_10000266211 166
539 3300005577 Ga0068857_100060124 Ga0068857_1000601242 166
540 3300005578 Ga0068854_100009708 Ga0068854_1000097087 166
541 3300005578 Ga0068854_100460332 Ga0068854_1004603321 166
542 3300005614 Ga0068856_100034355 Ga0068856_1000343553 166
543 3300005614 Ga0068856_100035602 Ga0068856_1000356024 166
544 3300005614 Ga0068856_100060078 Ga0068856_1000600782 166
545 3300005614 Ga0068856_100096241 Ga0068856_1000962412 166
546 3300005615 Ga0070702_100138308 Ga0070702_1001383082 166
547 3300005616 Ga0068852_100006784 Ga0068852_1000067846 166
548 3300005616 Ga0068852_100015554 Ga0068852_1000155544 166
549 3300005616 Ga0068852_100116529 Ga0068852_1001165291 166
550 3300005617 Ga0068859_100037215 Ga0068859_1000372153 166
551 3300005618 Ga0068864_100203828 Ga0068864_1002038283 166
552 3300005618 Ga0068864_100462302 Ga0068864_1004623022 166
553 3300005618 Ga0068864_100987147 Ga0068864_1009871471 166
554 3300005718 Ga0068866_10001944 Ga0068866_100019448 166
555 3300005718 Ga0068866_10326929 Ga0068866_103269292 166
556 3300005719 Ga0068861_100009145 Ga0068861_1000091455 166
557 3300005834 Ga0068851_10006235 Ga0068851_100062351 166
558 3300005834 Ga0068851_10017023 Ga0068851_100170233 166
559 3300005834 Ga0068851_10029284 Ga0068851_100292842 166
560 3300005840 Ga0068870_10012560 Ga0068870_100125602 166
561 3300005841 Ga0068863_100084025 Ga0068863_1000840253 166
562 3300005841 Ga0068863_100112243 Ga0068863_1001122432 166
563 3300005841 Ga0068863_100169230 Ga0068863_1001692302 166
564 3300005841 Ga0068863_100335151 Ga0068863_1003351513 166
565 3300005842 Ga0068858_100018536 Ga0068858_1000185361 166
566 3300005842 Ga0068858_100818521 Ga0068858_1008185212 166
567 3300005843 Ga0068860_100033462 Ga0068860_1000334623 166
568 3300005843 Ga0068860_100286630 Ga0068860_1002866302 166
569 3300005843 Ga0068860_100462065 Ga0068860_1004620652 166
570 3300005844 Ga0068862_100024154 Ga0068862_1000241542 166
571 3300005844 Ga0068862_100125918 Ga0068862_1001259182 166
572 3300006028 Ga0070717_10984018 Ga0070717_109840181 166
573 3300006163 Ga0070715_10090802 Ga0070715_100908021 166
574 3300006173 Ga0070716_100000315 Ga0070716_10000031511 166
575 3300006173 Ga0070716_100014273 Ga0070716_1000142734 166
576 3300006173 Ga0070716_100092424 Ga0070716_1000924241 166
577 3300006173 Ga0070716_100281838 Ga0070716_1002818381 166
578 3300006173 Ga0070716_100339825 Ga0070716_1003398251 166
579 3300006175 Ga0070712_100002960 Ga0070712_1000029606 166
580 3300006175 Ga0070712_100031299 Ga0070712_1000312992 166
581 3300006237 Ga0097621_100008160 Ga0097621_1000081607 166
582 3300006237 Ga0097621_100190616 Ga0097621_1001906163 166
583 3300006237 Ga0097621_100404318 Ga0097621_1004043181 166
584 3300006237 Ga0097621_100610893 Ga0097621_1006108932 166
585 3300006358 Ga0068871_100007947 Ga0068871_1000079476 166
586 3300006358 Ga0068871_100188544 Ga0068871_1001885443 166
587 3300006358 Ga0068871_100256279 Ga0068871_1002562793 166
588 3300006358 Ga0068871_100488464 Ga0068871_1004884643 166
589 3300006852 Ga0075433_10001164 Ga0075433_100011649 166
590 3300006852 Ga0075433_10001954 Ga0075433_1000195414 166
591 3300006852 Ga0075433_10572342 Ga0075433_105723422 166
592 3300006871 Ga0075434_100000041 Ga0075434_10000004114 166
593 3300006871 Ga0075434_100008051 Ga0075434_1000080514 166
594 3300006881 Ga0068865_100032569 Ga0068865_1000325693 166
595 3300006881 Ga0068865_100296483 Ga0068865_1002964833 166
596 3300006914 Ga0075436_100006992 Ga0075436_1000069924 166
597 3300006931 Ga0097620_100037214 Ga0097620_1000372143 166
598 3300007076 Ga0075435_100000105 Ga0075435_10000010520 166
599 3300007076 Ga0075435_100023020 Ga0075435_1000230205 166
600 3300007076 Ga0075435_100552641 Ga0075435_1005526412 166
601 3300007265 Ga0099794_10168120 Ga0099794_101681201 166
602 3300009093 Ga0105240_10074313 Ga0105240_100743132 166
603 3300009093 Ga0105240_12166851 Ga0105240_121668511 166
604 3300009098 Ga0105245_10030920 Ga0105245_100309202 166
605 3300009098 Ga0105245_10140939 Ga0105245_101409393 166
606 3300009098 Ga0105245_10165140 Ga0105245_101651403 166
607 3300009098 Ga0105245_11021681 Ga0105245_110216812 166
608 3300009101 Ga0105247_10006289 Ga0105247_100062892 166
609 3300009101 Ga0105247_10026851 Ga0105247_100268512 166
610 3300009101 Ga0105247_11103034 Ga0105247_111030341 166
611 3300009148 Ga0105243_10058571 Ga0105243_100585713 166
612 3300009148 Ga0105243_11199285 Ga0105243_111992852 166
613 3300009174 Ga0105241_10013091 Ga0105241_100130915 166
614 3300009174 Ga0105241_10241944 Ga0105241_102419442 166
615 3300009174 Ga0105241_10736991 Ga0105241_107369911 166
616 3300009174 Ga0105241_10748814 Ga0105241_107488141 166
617 3300009174 Ga0105241_11130602 Ga0105241_111306021 166
618 3300009176 Ga0105242_10068669 Ga0105242_100686692 166
619 3300009177 Ga0105248_10070138 Ga0105248_100701382 166
620 3300009177 Ga0105248_10610461 Ga0105248_106104612 166
621 3300009177 Ga0105248_11216137 Ga0105248_112161371 166
622 3300009545 Ga0105237_10617226 Ga0105237_106172261 166
623 3300009545 Ga0105237_10785869 Ga0105237_107858691 166
624 3300009551 Ga0105238_10030598 Ga0105238_100305984 166
625 3300009551 Ga0105238_10091469 Ga0105238_100914692 166
626 3300009551 Ga0105238_10278522 Ga0105238_102785222 166
627 3300009553 Ga0105249_10011376 Ga0105249_100113767 166
628 3300009553 Ga0105249_10033432 Ga0105249_100334324 166
629 3300009553 Ga0105249_10118256 Ga0105249_101182561 166
630 3300010375 Ga0105239_10117684 Ga0105239_101176842 166
631 3300010375 Ga0105239_10460080 Ga0105239_104600802 166
632 3300010375 Ga0105239_10691320 Ga0105239_106913202 166
633 3300010375 Ga0105239_10768567 Ga0105239_107685672 166
634 3300011119 Ga0105246_10009260 Ga0105246_100092604 166
635 3300013100 Ga0157373_10004158 Ga0157373_100041583 166
636 3300013100 Ga0157373_10112556 Ga0157373_101125563 166
637 3300013102 Ga0157371_10031378 Ga0157371_100313782 166
638 3300013102 Ga0157371_10271571 Ga0157371_102715712 166
639 3300013105 Ga0157369_10032939 Ga0157369_100329396 166
640 3300013105 Ga0157369_10048103 Ga0157369_100481031 166
641 3300013296 Ga0157374_10049285 Ga0157374_100492852 166
642 3300013296 Ga0157374_10053326 Ga0157374_100533262 166
643 3300013296 Ga0157374_10224493 Ga0157374_102244933 166
644 3300013296 Ga0157374_10288743 Ga0157374_102887433 166
645 3300013296 Ga0157374_11001050 Ga0157374_110010502 166
646 3300013297 Ga0157378_10010049 Ga0157378_100100492 166
647 3300013297 Ga0157378_10103061 Ga0157378_101030614 166
648 3300013297 Ga0157378_10310375 Ga0157378_103103753 166
649 3300013306 Ga0163162_10029047 Ga0163162_100290472 166
650 3300013306 Ga0163162_10294833 Ga0163162_102948333 166
651 3300013306 Ga0163162_11370766 Ga0163162_113707662 166
652 3300013307 Ga0157372_10072578 Ga0157372_100725782 166
653 3300013308 Ga0157375_10027190 Ga0157375_100271902 166
654 3300014325 Ga0163163_10007476 Ga0163163_100074767 166
655 3300014325 Ga0163163_10011914 Ga0163163_100119143 166
656 3300014325 Ga0163163_10020058 Ga0163163_100200583 166
657 3300014325 Ga0163163_10022148 Ga0163163_100221485 166
658 3300014497 Ga0182008_10107349 Ga0182008_101073491 166
659 3300014745 Ga0157377_10001020 Ga0157377_100010209 166
660 3300014968 Ga0157379_10007715 Ga0157379_1000771510 166
661 3300014968 Ga0157379_10014150 Ga0157379_100141507 166
662 3300014968 Ga0157379_10653514 Ga0157379_106535141 166
663 3300014968 Ga0157379_10692323 Ga0157379_106923232 166
664 3300014969 Ga0157376_10009736 Ga0157376_100097366 166
665 3300014969 Ga0157376_10017009 Ga0157376_100170095 166
666 3300014969 Ga0157376_10035919 Ga0157376_100359192 166
667 3300014969 Ga0157376_11458188 Ga0157376_114581882 166
668 3300015262 Ga0182007_10005070 Ga0182007_100050705 166
669 3300015265 Ga0182005_1009626 Ga0182005_10096264 166
670 3300017792 Ga0163161_10019548 Ga0163161_100195484 166
671 3300024227 Ga0228598_1000502 Ga0228598_10005028 166
672 3300024227 Ga0228598_1041734 Ga0228598_10417342 166
673 3300025315 Ga0207697_10007772 Ga0207697_100077722 166
674 3300025321 Ga0207656_10037664 Ga0207656_100376642 166
675 3300025321 Ga0207656_10211485 Ga0207656_102114852 166
676 3300025893 Ga0207682_10029528 Ga0207682_100295283 166
677 3300025893 Ga0207682_10416653 Ga0207682_104166531 166
678 3300025899 Ga0207642_10104851 Ga0207642_101048512 166
679 3300025899 Ga0207642_10386144 Ga0207642_103861442 166
680 3300025900 Ga0207710_10348901 Ga0207710_103489011 166
681 3300025901 Ga0207688_10145853 Ga0207688_101458532 166
682 3300025903 Ga0207680_10015571 Ga0207680_100155712 166
683 3300025903 Ga0207680_10663459 Ga0207680_106634591 166
684 3300025904 Ga0207647_10003441 Ga0207647_100034419 166
685 3300025904 Ga0207647_10085312 Ga0207647_100853123 166
686 3300025905 Ga0207685_10040513 Ga0207685_100405132 166
687 3300025906 Ga0207699_10015400 Ga0207699_100154004 166
688 3300025906 Ga0207699_10060749 Ga0207699_100607493 166
689 3300025906 Ga0207699_10094983 Ga0207699_100949832 166
690 3300025906 Ga0207699_10362925 Ga0207699_103629252 166
691 3300025907 Ga0207645_10000181 Ga0207645_100001813 166
692 3300025907 Ga0207645_10019336 Ga0207645_100193363 166
693 3300025908 Ga0207643_10001458 Ga0207643_100014589 166
694 3300025908 Ga0207643_10109875 Ga0207643_101098752 166
695 3300025909 Ga0207705_10045425 Ga0207705_100454252 166
696 3300025910 Ga0207684_10000267 Ga0207684_1000026714 166
697 3300025910 Ga0207684_10004181 Ga0207684_1000418112 166
698 3300025911 Ga0207654_10055269 Ga0207654_100552691 166
699 3300025911 Ga0207654_10058367 Ga0207654_100583672 166
700 3300025911 Ga0207654_10092107 Ga0207654_100921073 166
701 3300025911 Ga0207654_10166552 Ga0207654_101665521 166
702 3300025911 Ga0207654_10548815 Ga0207654_105488151 166
703 3300025912 Ga0207707_10015984 Ga0207707_100159843 166
704 3300025912 Ga0207707_10175218 Ga0207707_101752182 166
705 3300025913 Ga0207695_10299030 Ga0207695_102990303 166
706 3300025914 Ga0207671_10122728 Ga0207671_101227283 166
707 3300025914 Ga0207671_10125768 Ga0207671_101257683 166
708 3300025915 Ga0207693_10013836 Ga0207693_100138362 166
709 3300025915 Ga0207693_10029134 Ga0207693_100291344 166
710 3300025916 Ga0207663_10002155 Ga0207663_100021552 166
711 3300025916 Ga0207663_10059922 Ga0207663_100599221 166
712 3300025916 Ga0207663_10160137 Ga0207663_101601373 166
713 3300025917 Ga0207660_10379430 Ga0207660_103794302 166
714 3300025918 Ga0207662_10026172 Ga0207662_100261723 166
715 3300025919 Ga0207657_10000535 Ga0207657_1000053518 166
716 3300025919 Ga0207657_10001828 Ga0207657_100018286 166
717 3300025919 Ga0207657_10010586 Ga0207657_100105869 166
718 3300025920 Ga0207649_10000350 Ga0207649_1000035025 166
719 3300025920 Ga0207649_10020780 Ga0207649_100207801 166
720 3300025920 Ga0207649_10114548 Ga0207649_101145482 166
721 3300025921 Ga0207652_10471230 Ga0207652_104712302 166
722 3300025922 Ga0207646_10000296 Ga0207646_1000029637 166
723 3300025922 Ga0207646_10095550 Ga0207646_100955504 166
724 3300025922 Ga0207646_10132679 Ga0207646_101326793 166
725 3300025923 Ga0207681_10079583 Ga0207681_100795832 166
726 3300025924 Ga0207694_10144453 Ga0207694_101444532 166
727 3300025924 Ga0207694_10502618 Ga0207694_105026182 166
728 3300025925 Ga0207650_10000223 Ga0207650_100002233 166
729 3300025925 Ga0207650_10140577 Ga0207650_101405772 166
730 3300025926 Ga0207659_10007479 Ga0207659_100074792 166
731 3300025927 Ga0207687_10018290 Ga0207687_100182902 166
732 3300025927 Ga0207687_10077263 Ga0207687_100772631 166
733 3300025928 Ga0207700_10301690 Ga0207700_103016902 166
734 3300025928 Ga0207700_10517468 Ga0207700_105174681 166
735 3300025928 Ga0207700_10737072 Ga0207700_107370721 166
736 3300025928 Ga0207700_10845813 Ga0207700_108458132 166
737 3300025931 Ga0207644_10011249 Ga0207644_100112494 166
738 3300025931 Ga0207644_10049864 Ga0207644_100498643 166
739 3300025932 Ga0207690_10029853 Ga0207690_100298531 166
740 3300025932 Ga0207690_10387278 Ga0207690_103872782 166
741 3300025933 Ga0207706_10000670 Ga0207706_1000067027 166
742 3300025933 Ga0207706_10009803 Ga0207706_100098037 166
743 3300025933 Ga0207706_10014729 Ga0207706_100147294 166
744 3300025935 Ga0207709_10108511 Ga0207709_101085111 166
745 3300025935 Ga0207709_10823662 Ga0207709_108236622 166
746 3300025936 Ga0207670_10015700 Ga0207670_100157004 166
747 3300025937 Ga0207669_10863890 Ga0207669_108638901 166
748 3300025938 Ga0207704_10067564 Ga0207704_100675643 166
749 3300025938 Ga0207704_10176675 Ga0207704_101766752 166
750 3300025939 Ga0207665_10008599 Ga0207665_100085992 166
751 3300025939 Ga0207665_10229042 Ga0207665_102290421 166
752 3300025939 Ga0207665_10317031 Ga0207665_103170312 166
753 3300025939 Ga0207665_10347153 Ga0207665_103471531 166
754 3300025939 Ga0207665_10347731 Ga0207665_103477312 166
755 3300025939 Ga0207665_10883279 Ga0207665_108832791 166
756 3300025940 Ga0207691_10000345 Ga0207691_100003453 166
757 3300025941 Ga0207711_10029037 Ga0207711_100290373 166
758 3300025942 Ga0207689_10000499 Ga0207689_1000049930 166
759 3300025942 Ga0207689_10076620 Ga0207689_100766203 166
760 3300025944 Ga0207661_10059699 Ga0207661_100596992 166
761 3300025944 Ga0207661_10125076 Ga0207661_101250763 166
762 3300025944 Ga0207661_10357834 Ga0207661_103578341 166
763 3300025945 Ga0207679_10000115 Ga0207679_1000011559 166
764 3300025945 Ga0207679_10250551 Ga0207679_102505513 166
765 3300025949 Ga0207667_10040938 Ga0207667_100409384 166
766 3300025949 Ga0207667_10246893 Ga0207667_102468931 166
767 3300025960 Ga0207651_10003270 Ga0207651_100032707 166
768 3300025961 Ga0207712_10030933 Ga0207712_100309333 166
769 3300025961 Ga0207712_10141863 Ga0207712_101418632 166
770 3300025972 Ga0207668_10029993 Ga0207668_100299933 166
771 3300025972 Ga0207668_10780986 Ga0207668_107809862 166
772 3300025981 Ga0207640_10416205 Ga0207640_104162052 166
773 3300025981 Ga0207640_10595314 Ga0207640_105953142 166
774 3300025986 Ga0207658_10018432 Ga0207658_100184324 166
775 3300025986 Ga0207658_10385427 Ga0207658_103854273 166
776 3300026023 Ga0207677_10016957 Ga0207677_100169573 166
777 3300026023 Ga0207677_10033304 Ga0207677_100333041 166
778 3300026023 Ga0207677_10368197 Ga0207677_103681971 166
779 3300026035 Ga0207703_10020915 Ga0207703_100209154 166
780 3300026035 Ga0207703_10221807 Ga0207703_102218071 166
781 3300026035 Ga0207703_10261335 Ga0207703_102613352 166
782 3300026041 Ga0207639_10028794 Ga0207639_100287944 166
783 3300026067 Ga0207678_10000130 Ga0207678_100001303 166
784 3300026067 Ga0207678_10001418 Ga0207678_1000141816 166
785 3300026067 Ga0207678_10105876 Ga0207678_101058764 166
786 3300026067 Ga0207678_11605438 Ga0207678_116054381 166
787 3300026075 Ga0207708_10088371 Ga0207708_100883713 166
788 3300026078 Ga0207702_10109070 Ga0207702_101090704 166
789 3300026078 Ga0207702_10257982 Ga0207702_102579822 166
790 3300026078 Ga0207702_10291844 Ga0207702_102918441 166
791 3300026088 Ga0207641_10000287 Ga0207641_100002873 166
792 3300026088 Ga0207641_10648956 Ga0207641_106489561 166
793 3300026088 Ga0207641_10830731 Ga0207641_108307311 166
794 3300026088 Ga0207641_11057882 Ga0207641_110578822 166
795 3300026089 Ga0207648_10001253 Ga0207648_100012532 166
796 3300026089 Ga0207648_10031139 Ga0207648_100311393 166
797 3300026095 Ga0207676_10019296 Ga0207676_100192963 166
798 3300026095 Ga0207676_10156803 Ga0207676_101568032 166
799 3300026095 Ga0207676_10433215 Ga0207676_104332152 166
800 3300026116 Ga0207674_10020692 Ga0207674_100206923 166
801 3300026116 Ga0207674_10025502 Ga0207674_100255024 166
802 3300026116 Ga0207674_10027829 Ga0207674_100278293 166
803 3300026118 Ga0207675_100008545 Ga0207675_1000085456 166
804 3300026118 Ga0207675_100147149 Ga0207675_1001471493 166
805 3300026121 Ga0207683_10000217 Ga0207683_1000021746 166
806 3300026121 Ga0207683_10028620 Ga0207683_100286203 166
807 3300026142 Ga0207698_10057434 Ga0207698_100574342 166
808 3300026142 Ga0207698_10102194 Ga0207698_101021942 166
809 3300026142 Ga0207698_10249849 Ga0207698_102498492 166
810 3300028016 Ga0265354_1004182 Ga0265354_10041821 166
811 3300028379 Ga0268266_10008412 Ga0268266_100084123 166
812 3300028379 Ga0268266_10575144 Ga0268266_105751442 166
813 3300028379 Ga0268266_10937589 Ga0268266_109375891 166
814 3300028379 Ga0268266_11726430 Ga0268266_117264301 166
815 3300028380 Ga0268265_10044706 Ga0268265_100447063 166
816 3300028380 Ga0268265_10048037 Ga0268265_100480374 166
817 3300028380 Ga0268265_10450156 Ga0268265_104501562 166
818 3300028381 Ga0268264_10025038 Ga0268264_100250382 166
819 3300028381 Ga0268264_10029486 Ga0268264_100294861 166
820 3300028381 Ga0268264_10077395 Ga0268264_100773951 166
821 3300028381 Ga0268264_10814500 Ga0268264_108145002 166
822 3300030878 Ga0265770_1003844 Ga0265770_10038442 166
823 3300030878 Ga0265770_1015093 Ga0265770_10150932 166
824 3300030879 Ga0265765_1009051 Ga0265765_10090512 166
825 3300031090 Ga0265760_10000331 Ga0265760_100003319 166
826 3300031090 Ga0265760_10092507 Ga0265760_100925072 166
827 3300034816 Ga0373930_0127190 Ga0373930_0127190_39_539 166
828 3300034819 Ga0373958_0017263 Ga0373958_0017263_132_632 166
829 3300034957 Ga0373938_0015032 Ga0373938_0015032_896_1396 166
830 3300035089 Ga0373944_0245320 Ga0373944_0245320_86_589 166
831 3300035112 Ga0373932_0170061 Ga0373932_0170061_44_544 166
832 3300035112 Ga0373932_0212282 Ga0373932_0212282_84_584 166
833 3300035691 Ga0373931_0658721 Ga0373931_0658721_61_561 166
834 3300035692 Ga0373935_0151497 Ga0373935_0151497_967_1467 166
835 3300035695 Ga0373927_0275384 Ga0373927_0275384_496_999 166
836 3300036401 Ga0373937_0218937 Ga0373937_0218937_712_1215 166
837 3300045051 Ga0451576_0109127 Ga0451576_0109127_953_1453 166
838 3300045976 Ga0466967_0075951 Ga0466967_0075951_1655_2155 166
839 3300046455 Ga0495603_0089785 Ga0495603_0089785_406_906 166
840 3300046472 Ga0495580_0004216 Ga0495580_0004216_4814_5314 166
841 3300046472 Ga0495580_0009626 Ga0495580_0009626_5164_5664 166
842 3300046472 Ga0495580_0028922 Ga0495580_0028922_3282_3782 166
843 3300046472 Ga0495580_0239685 Ga0495580_0239685_268_768 166
844 3300046499 Ga0495594_0030407 Ga0495594_0030407_711_1211 166
845 3300046674 Ga0495588_0052053 Ga0495588_0052053_11_511 166
846 3300046809 Ga0495600_0180149 Ga0495600_0180149_30_533 166
847 3300048088 Ga0495602_0194576 Ga0495602_0194576_330_830 166
848 3300048903 Ga0496100_0009722 Ga0496100_0009722_3681_4184 166
849 3300048903 Ga0496100_0668647 Ga0496100_0668647_202_702 166
850 3300048903 Ga0496100_0947093 Ga0496100_0947093_92_592 166
851 3300048904 Ga0496101_0019851 Ga0496101_0019851_544_1047 166
852 3300048904 Ga0496101_0029423 Ga0496101_0029423_1710_2210 166
853 3300048904 Ga0496101_0178095 Ga0496101_0178095_766_1266 166
854 3300048904 Ga0496101_0210240 Ga0496101_0210240_869_1369 166
855 3300048905 Ga0496102_0001424 Ga0496102_0001424_3190_3690 166
856 3300048905 Ga0496102_0032128 Ga0496102_0032128_415_915 166
857 3300048905 Ga0496102_0092665 Ga0496102_0092665_1548_2048 166
858 3300048905 Ga0496102_0116975 Ga0496102_0116975_1632_2132 166
859 3300048905 Ga0496102_0153647 Ga0496102_0153647_446_946 166
860 3300048905 Ga0496102_0586833 Ga0496102_0586833_479_982 166
861 3300048905 Ga0496102_1197648 Ga0496102_1197648_92_592 166
862 3300048906 Ga0496103_0004119 Ga0496103_0004119_94_594 166
863 3300048906 Ga0496103_0022334 Ga0496103_0022334_281_781 166
864 3300048906 Ga0496103_0137789 Ga0496103_0137789_457_957 166
865 3300048906 Ga0496103_0160422 Ga0496103_0160422_130_630 166
866 3300048907 Ga0496104_0157280 Ga0496104_0157280_647_1150 166
867 3300048907 Ga0496104_0220356 Ga0496104_0220356_492_992 166
868 3300048907 Ga0496104_0315597 Ga0496104_0315597_527_1027 166
869 3300048909 Ga0496106_0056741 Ga0496106_0056741_261_764 166
870 3300048909 Ga0496106_0068846 Ga0496106_0068846_275_775 166
871 3300048909 Ga0496106_0083711 Ga0496106_0083711_878_1378 166
872 3300048909 Ga0496106_0181273 Ga0496106_0181273_318_818 166
873 3300048910 Ga0496107_0052688 Ga0496107_0052688_2348_2848 166
874 3300048910 Ga0496107_0069126 Ga0496107_0069126_1581_2081 166
875 3300048911 Ga0496108_0020285 Ga0496108_0020285_986_1486 166
876 3300048911 Ga0496108_0043628 Ga0496108_0043628_740_1240 166
877 3300048912 Ga0496109_0000117 Ga0496109_0000117_20926_21426 166
878 3300048912 Ga0496109_0054749 Ga0496109_0054749_3063_3563 166
879 3300048912 Ga0496109_0106106 Ga0496109_0106106_41_541 166
880 3300048913 Ga0496110_0004256 Ga0496110_0004256_2099_2599 166
881 3300048913 Ga0496110_0012731 Ga0496110_0012731_3241_3741 166
882 3300048913 Ga0496110_0115435 Ga0496110_0115435_1747_2247 166
883 3300048914 Ga0496111_0009763 Ga0496111_0009763_2621_3121 166
884 3300048914 Ga0496111_0076767 Ga0496111_0076767_1678_2178 166
885 3300048915 Ga0496112_0000283 Ga0496112_0000283_2164_2664 166
886 3300048915 Ga0496112_0114302 Ga0496112_0114302_137_640 166
887 3300048915 Ga0496112_0249986 Ga0496112_0249986_1074_1574 166
888 3300048915 Ga0496112_0610245 Ga0496112_0610245_146_646 166
889 3300048915 Ga0496112_0756931 Ga0496112_0756931_311_811 166
890 3300048916 Ga0496113_0002193 Ga0496113_0002193_8714_9214 166
891 3300048916 Ga0496113_0024930 Ga0496113_0024930_1322_1822 166
892 3300048918 Ga0496115_0003148 Ga0496115_0003148_3898_4401 166
893 3300048918 Ga0496115_0191279 Ga0496115_0191279_305_805 166
894 3300050512 nmdc:mga0n895_10187_c1 nmdc:mga0n895_10187_c1_5936_6436 166
895 3300050512 nmdc:mga0n895_539906_c1 nmdc:mga0n895_539906_c1_218_718 166
896 3300050513 nmdc:mga0rr50_71996_c1 nmdc:mga0rr50_71996_c1_1255_1755 166
897 3300050513 nmdc:mga0rr50_839055_c1 nmdc:mga0rr50_839055_c1_177_677 166
898 3300050515 nmdc:mga0a205_223264_c1 nmdc:mga0a205_223264_c1_346_846 166
899 3300053084 Ga0495595_0053173 Ga0495595_0053173_1271_1774 166
900 3300053085 Ga0495619_0197349 Ga0495619_0197349_747_1250 166

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04509

CheC

CheC-like family

100

134

0.93

PF13690

CheX

Chemotaxis phosphatase CheX

58

154

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
3iic-assembly1.cif.gz_B crystal structure of chec-like superfamily protein (yp_001095400.1) from shewanella sp. pv-4 at 2.13 a resolution 0.8766 1 150
1squ-assembly1.cif.gz_A structural genomics, crystal structure of the chex protein from thermotoga maritima 0.8579 1 151
3iic-assembly1.cif.gz_B crystal structure of chec-like superfamily protein (yp_001095400.1) from shewanella sp. pv-4 at 2.13 a resolution 0.8504 1 150
1squ-assembly1.cif.gz_A structural genomics, crystal structure of the chex protein from thermotoga maritima 0.8474 1 151
3hzh-assembly1.cif.gz_B crystal structure of the chex-chey-bef3-mg+2 complex from borrelia burgdorferi 0.8464 6 151
ID Description Score Start End Superfamily
3hm4A00 Alpha Beta;3-Layer(aba) Sandwich;Chemotaxis protein chec;CheC-like 0.8353 3 150 3.40.1550.10
1xkoA00 Alpha Beta;3-Layer(aba) Sandwich;Chemotaxis protein chec;CheC-like 0.8294 1 151 3.40.1550.10
1xkoA00 Alpha Beta;3-Layer(aba) Sandwich;Chemotaxis protein chec;CheC-like 0.8196 1 151 3.40.1550.10
3hm4A00 Alpha Beta;3-Layer(aba) Sandwich;Chemotaxis protein chec;CheC-like 0.8093 3 150 3.40.1550.10
3hzhB00 Alpha Beta;3-Layer(aba) Sandwich;Chemotaxis protein chec;CheC-like 0.7988 6 151 3.40.1550.10
ID Description Score Start End GO Terms
AF-A0A2V9MT73-F1-model_v4 Chemotaxis protein CheX 0.9818 1 149 GO:0006935
AF-A0A2V9MT73-F1-model_v4 Chemotaxis protein CheX 0.969 1 149 GO:0006935
AF-A0A1Y2T7J3-F1-model_v4 Chemotaxis protein 0.941 1 119 GO:0006935
AF-A0A1Y2T7J3-F1-model_v4 Chemotaxis protein 0.9335 1 119 GO:0006935
AF-A0A353BHD7-F1-model_v4 Chemotaxis protein CheX 0.9279 1 154 GO:0006935

Feature Viewer

pLDDT pTM Quality
85.78 0.83 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map