F485144
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 900 | 301 | 900 | 165 |
Family's Representative Sequence
| Representative Sequence | 3300013307|Ga0157372_10933286|Ga0157372_109332861 |
| Length | 181 |
| Sequence | VKTELLPTPQERERKFMKMELIQPFINAADAVLSQGLQGTTKVGNLTMEEDAYRRKGVAGMIALTGDIEGRIILDLEPQTAVKVASHYAGTDLPESDELIKETIFELANQVVGNAVSALNDQGFHFRVHPPLLLTAQEGDKTSEDTEALMICFETSLGSVFMNVALRYNKKRMADHAAVGA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886012 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 | Metagenome | Rhizosphere |
| 2 | 3300000546 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled | Metagenome | Rhizosphere |
| 3 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 4 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 5 | 3300002155 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 | Metagenome | Rhizosphere |
| 6 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 7 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 8 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 9 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 12 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 13 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 16 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 18 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 19 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 20 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 22 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 23 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 24 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 32 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 35 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 40 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 45 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 46 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 47 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 48 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 49 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 50 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 52 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 53 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 54 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 55 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 57 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 58 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 62 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 64 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 65 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 66 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 68 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 69 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 70 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 71 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 72 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 73 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 74 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 75 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 76 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 77 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 78 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 79 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 80 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 81 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 82 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 84 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 85 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 86 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 87 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 88 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 90 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 91 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 92 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 116 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 120 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 121 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300019181 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZI3 metaT (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 123 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 124 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 125 | 3300022730 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU2 | Metagenome | Rhizosphere |
| 126 | 3300022732 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU1 | Metagenome | Rhizosphere |
| 127 | 3300022734 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU3 | Metagenome | Rhizosphere |
| 128 | 3300024225 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 | Metagenome | Rhizosphere |
| 129 | 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Metagenome | Rhizosphere |
| 130 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300028016 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 | Metagenome | Rhizosphere |
| 197 | 3300028017 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 | Metagenome | Rhizosphere |
| 198 | 3300028023 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 | Metagenome | Rhizosphere |
| 199 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 203 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 204 | 3300030760 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 205 | 3300030762 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 206 | 3300030836 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 207 | 3300030878 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 208 | 3300030879 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 209 | 3300031010 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 210 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 211 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 212 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 213 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 214 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 215 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 216 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 217 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 218 | 3300033545 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4 | Metagenome | Unclassified |
| 219 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 220 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 221 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 222 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 223 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 224 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 225 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 226 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 227 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 228 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 229 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 230 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 231 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 232 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 233 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 234 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 235 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 236 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 237 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 238 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 239 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 240 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 241 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 242 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 243 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 244 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 245 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 246 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 247 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 248 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 249 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 250 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 251 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 252 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 253 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 281 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 282 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 283 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 284 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 285 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 286 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 287 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 288 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 289 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 290 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 291 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 292 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 293 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 294 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 295 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 296 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 297 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 298 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.33 |
| Metatranscriptomes | 1.67 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 6.11 |
| Rhizosphere | 93.33 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.56 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | MBSR1b_contig_12373736 | 2162886012 | Unclassified | 1080 |
| 2 | LJNas_1000607 | 3300000546 | Bacteria | 6099 |
| 3 | JGI24743J22301_10000326 | 3300001991 | Bacteria | 5243 |
| 4 | JGI24749J21850_1013365 | 3300002076 | Bacteria | 1152 |
| 5 | JGI24033J26618_1034833 | 3300002155 | Bacteria | 687 |
| 6 | JGI24034J26672_10001510 | 3300002239 | Bacteria | 3094 |
| 7 | JGI24751J29686_10021546 | 3300002459 | Bacteria | 1336 |
| 8 | Ga0065715_10091638 | 3300005293 | Bacteria | 5634 |
| 9 | Ga0070658_10333721 | 3300005327 | Bacteria | 1296 |
| 10 | Ga0070658_10969985 | 3300005327 | Unclassified | 739 |
| 11 | Ga0070676_10010579 | 3300005328 | Bacteria | 5005 |
| 12 | Ga0070676_10073015 | 3300005328 | Unclassified | 2064 |
| 13 | Ga0070683_100008507 | 3300005329 | Bacteria | 8718 |
| 14 | Ga0070683_100029649 | 3300005329 | Bacteria | 4957 |
| 15 | Ga0070683_100505160 | 3300005329 | Unclassified | 1155 |
| 16 | Ga0070690_100026557 | 3300005330 | Bacteria | 3573 |
| 17 | Ga0070690_100454794 | 3300005330 | Unclassified | 950 |
| 18 | Ga0070670_100014317 | 3300005331 | Bacteria | 6805 |
| 19 | Ga0070670_100134527 | 3300005331 | Bacteria | 2136 |
| 20 | Ga0070677_10013347 | 3300005333 | Bacteria | 2872 |
| 21 | Ga0070677_10548777 | 3300005333 | Bacteria | 633 |
| 22 | Ga0068869_100014661 | 3300005334 | Bacteria | 5241 |
| 23 | Ga0070666_10028525 | 3300005335 | Bacteria | 3663 |
| 24 | Ga0070666_10175835 | 3300005335 | Unclassified | 1501 |
| 25 | Ga0070666_10206556 | 3300005335 | Unclassified | 1382 |
| 26 | Ga0070680_100256127 | 3300005336 | Unclassified | 1480 |
| 27 | Ga0070680_101260006 | 3300005336 | Bacteria | 640 |
| 28 | Ga0070680_101373755 | 3300005336 | Unclassified | 611 |
| 29 | Ga0070682_100021304 | 3300005337 | Bacteria | 3823 |
| 30 | Ga0070682_101578708 | 3300005337 | Unclassified | 566 |
| 31 | Ga0068868_100048560 | 3300005338 | Bacteria | 3329 |
| 32 | Ga0068868_100232874 | 3300005338 | Unclassified | 1546 |
| 33 | Ga0070660_100016361 | 3300005339 | Bacteria | 5382 |
| 34 | Ga0070660_100162634 | 3300005339 | Bacteria | 1799 |
| 35 | Ga0070689_100013364 | 3300005340 | Bacteria | 5938 |
| 36 | Ga0070691_10112169 | 3300005341 | Bacteria | 1365 |
| 37 | Ga0070687_100027361 | 3300005343 | Bacteria | 2754 |
| 38 | Ga0070661_100012448 | 3300005344 | Bacteria | 5950 |
| 39 | Ga0070661_100018311 | 3300005344 | Unclassified | 4978 |
| 40 | Ga0070661_100216493 | 3300005344 | Bacteria | 1468 |
| 41 | Ga0070668_100009738 | 3300005347 | Bacteria | 7125 |
| 42 | Ga0070668_100049564 | 3300005347 | Bacteria | 3231 |
| 43 | Ga0070669_100012969 | 3300005353 | Bacteria | 5920 |
| 44 | Ga0070669_100183475 | 3300005353 | Bacteria | 1638 |
| 45 | Ga0070675_100019172 | 3300005354 | Bacteria | 5449 |
| 46 | Ga0070671_100219132 | 3300005355 | Bacteria | 1614 |
| 47 | Ga0070674_100027611 | 3300005356 | Bacteria | 3720 |
| 48 | Ga0070674_101901762 | 3300005356 | Unclassified | 541 |
| 49 | Ga0070673_100010535 | 3300005364 | Bacteria | 6261 |
| 50 | Ga0070688_100006794 | 3300005365 | Bacteria | 6136 |
| 51 | Ga0070688_100089223 | 3300005365 | Bacteria | 2012 |
| 52 | Ga0070659_100005924 | 3300005366 | Bacteria | 8812 |
| 53 | Ga0070659_100134094 | 3300005366 | Unclassified | 2013 |
| 54 | Ga0070667_100018445 | 3300005367 | Bacteria | 5786 |
| 55 | Ga0070667_100205060 | 3300005367 | Bacteria | 1750 |
| 56 | Ga0070709_10001876 | 3300005434 | Bacteria | 11392 |
| 57 | Ga0070709_10006738 | 3300005434 | Bacteria | 6271 |
| 58 | Ga0070709_10011458 | 3300005434 | Bacteria | 4942 |
| 59 | Ga0070709_10012421 | 3300005434 | Bacteria | 4768 |
| 60 | Ga0070709_10035701 | 3300005434 | Bacteria | 3023 |
| 61 | Ga0070709_10076982 | 3300005434 | Bacteria | 2168 |
| 62 | Ga0070709_10687645 | 3300005434 | Bacteria | 795 |
| 63 | Ga0070709_10876434 | 3300005434 | Unclassified | 709 |
| 64 | Ga0070714_100000172 | 3300005435 | Bacteria | 52540 |
| 65 | Ga0070714_100046805 | 3300005435 | Bacteria | 3671 |
| 66 | Ga0070714_100084131 | 3300005435 | Bacteria | 2775 |
| 67 | Ga0070714_100310781 | 3300005435 | Bacteria | 1471 |
| 68 | Ga0070714_100371348 | 3300005435 | Bacteria | 1347 |
| 69 | Ga0070714_100688409 | 3300005435 | Unclassified | 986 |
| 70 | Ga0070714_100726817 | 3300005435 | Unclassified | 959 |
| 71 | Ga0070713_100000342 | 3300005436 | Bacteria | 30393 |
| 72 | Ga0070713_100000449 | 3300005436 | Bacteria | 26293 |
| 73 | Ga0070713_100000510 | 3300005436 | Bacteria | 24756 |
| 74 | Ga0070713_100013833 | 3300005436 | Bacteria | 5972 |
| 75 | Ga0070713_100045317 | 3300005436 | Bacteria | 3603 |
| 76 | Ga0070713_100065002 | 3300005436 | Bacteria | 3063 |
| 77 | Ga0070713_100101831 | 3300005436 | Unclassified | 2489 |
| 78 | Ga0070713_100144760 | 3300005436 | Bacteria | 2108 |
| 79 | Ga0070713_100198026 | 3300005436 | Bacteria | 1813 |
| 80 | Ga0070713_100230160 | 3300005436 | Bacteria | 1684 |
| 81 | Ga0070713_100413481 | 3300005436 | Bacteria | 1262 |
| 82 | Ga0070713_100444628 | 3300005436 | Bacteria | 1217 |
| 83 | Ga0070713_100446898 | 3300005436 | Unclassified | 1213 |
| 84 | Ga0070713_100530247 | 3300005436 | Bacteria | 1113 |
| 85 | Ga0070713_100567926 | 3300005436 | Bacteria | 1075 |
| 86 | Ga0070713_100875083 | 3300005436 | Bacteria | 863 |
| 87 | Ga0070710_10032513 | 3300005437 | Bacteria | 2827 |
| 88 | Ga0070710_10109687 | 3300005437 | Unclassified | 1656 |
| 89 | Ga0070710_10119208 | 3300005437 | Unclassified | 1595 |
| 90 | Ga0070710_10294543 | 3300005437 | Bacteria | 1057 |
| 91 | Ga0070710_10309313 | 3300005437 | Bacteria | 1034 |
| 92 | Ga0070710_10362018 | 3300005437 | Unclassified | 963 |
| 93 | Ga0070710_10394409 | 3300005437 | Unclassified | 926 |
| 94 | Ga0070710_10782788 | 3300005437 | Bacteria | 680 |
| 95 | Ga0070711_100000099 | 3300005439 | Bacteria | 45540 |
| 96 | Ga0070711_100002049 | 3300005439 | Bacteria | 11371 |
| 97 | Ga0070711_100017979 | 3300005439 | Bacteria | 4507 |
| 98 | Ga0070711_100046051 | 3300005439 | Bacteria | 2970 |
| 99 | Ga0070711_100072690 | 3300005439 | Unclassified | 2427 |
| 100 | Ga0070711_100099388 | 3300005439 | Bacteria | 2114 |
| 101 | Ga0070711_100140575 | 3300005439 | Bacteria | 1809 |
| 102 | Ga0070711_100610301 | 3300005439 | Bacteria | 911 |
| 103 | Ga0070711_100746168 | 3300005439 | Unclassified | 827 |
| 104 | Ga0070694_100271550 | 3300005444 | Bacteria | 1290 |
| 105 | Ga0070708_100000418 | 3300005445 | Bacteria | 31903 |
| 106 | Ga0070708_100001401 | 3300005445 | Bacteria | 18432 |
| 107 | Ga0070708_100002020 | 3300005445 | Bacteria | 15621 |
| 108 | Ga0070708_100016302 | 3300005445 | Bacteria | 6163 |
| 109 | Ga0070708_100044220 | 3300005445 | Bacteria | 3915 |
| 110 | Ga0070708_100044658 | 3300005445 | Bacteria | 3898 |
| 111 | Ga0070708_100095844 | 3300005445 | Bacteria | 2709 |
| 112 | Ga0070708_100163052 | 3300005445 | Bacteria | 2078 |
| 113 | Ga0070708_100164013 | 3300005445 | Bacteria | 2072 |
| 114 | Ga0070708_100625578 | 3300005445 | Bacteria | 1015 |
| 115 | Ga0070708_100962316 | 3300005445 | Unclassified | 801 |
| 116 | Ga0070663_100010754 | 3300005455 | Bacteria | 5714 |
| 117 | Ga0070663_100047085 | 3300005455 | Bacteria | 3054 |
| 118 | Ga0070678_100022210 | 3300005456 | Bacteria | 4199 |
| 119 | Ga0070678_100054141 | 3300005456 | Bacteria | 2921 |
| 120 | Ga0070662_100003783 | 3300005457 | Bacteria | 9469 |
| 121 | Ga0070662_100023119 | 3300005457 | Bacteria | 4266 |
| 122 | Ga0070662_100071465 | 3300005457 | Bacteria | 2559 |
| 123 | Ga0070681_10115544 | 3300005458 | Bacteria | 2621 |
| 124 | Ga0070681_10535497 | 3300005458 | Bacteria | 1085 |
| 125 | Ga0070681_10570204 | 3300005458 | Unclassified | 1046 |
| 126 | Ga0070681_10723022 | 3300005458 | Bacteria | 912 |
| 127 | Ga0068867_100011942 | 3300005459 | Bacteria | 6136 |
| 128 | Ga0068867_100065906 | 3300005459 | Bacteria | 2696 |
| 129 | Ga0070685_10005938 | 3300005466 | Bacteria | 6213 |
| 130 | Ga0070685_10146971 | 3300005466 | Bacteria | 1490 |
| 131 | Ga0070706_100000173 | 3300005467 | Bacteria | 81500 |
| 132 | Ga0070706_100001295 | 3300005467 | Bacteria | 26667 |
| 133 | Ga0070706_100013420 | 3300005467 | Bacteria | 7574 |
| 134 | Ga0070706_100018639 | 3300005467 | Bacteria | 6398 |
| 135 | Ga0070706_100060551 | 3300005467 | Unclassified | 3495 |
| 136 | Ga0070706_100511527 | 3300005467 | Bacteria | 1117 |
| 137 | Ga0070706_100538555 | 3300005467 | Bacteria | 1086 |
| 138 | Ga0070707_100000719 | 3300005468 | Bacteria | 33081 |
| 139 | Ga0070707_100002543 | 3300005468 | Bacteria | 17343 |
| 140 | Ga0070707_100012053 | 3300005468 | Bacteria | 8070 |
| 141 | Ga0070707_100057506 | 3300005468 | Bacteria | 3731 |
| 142 | Ga0070707_100057513 | 3300005468 | Bacteria | 3730 |
| 143 | Ga0070707_100297759 | 3300005468 | Bacteria | 1567 |
| 144 | Ga0070698_100000162 | 3300005471 | Bacteria | 61345 |
| 145 | Ga0070698_100007167 | 3300005471 | Bacteria | 12080 |
| 146 | Ga0070698_100128893 | 3300005471 | Bacteria | 2486 |
| 147 | Ga0070698_100136048 | 3300005471 | Bacteria | 2411 |
| 148 | Ga0070698_100166556 | 3300005471 | Bacteria | 2146 |
| 149 | Ga0070699_100001096 | 3300005518 | Bacteria | 25207 |
| 150 | Ga0070699_100002540 | 3300005518 | Bacteria | 16392 |
| 151 | Ga0070699_100004218 | 3300005518 | Bacteria | 12713 |
| 152 | Ga0070699_100012258 | 3300005518 | Bacteria | 7396 |
| 153 | Ga0070699_100048438 | 3300005518 | Unclassified | 3678 |
| 154 | Ga0070699_100096093 | 3300005518 | Unclassified | 2595 |
| 155 | Ga0070699_100158928 | 3300005518 | Unclassified | 2000 |
| 156 | Ga0070699_100592358 | 3300005518 | Unclassified | 1011 |
| 157 | Ga0070699_100625638 | 3300005518 | Bacteria | 982 |
| 158 | Ga0070699_100752106 | 3300005518 | Bacteria | 891 |
| 159 | Ga0070679_100256332 | 3300005530 | Bacteria | 1705 |
| 160 | Ga0070679_100322810 | 3300005530 | Bacteria | 1493 |
| 161 | Ga0070679_100978251 | 3300005530 | Unclassified | 790 |
| 162 | Ga0070684_100006304 | 3300005535 | Bacteria | 9166 |
| 163 | Ga0070684_100160446 | 3300005535 | Unclassified | 2040 |
| 164 | Ga0070684_100820120 | 3300005535 | Bacteria | 870 |
| 165 | Ga0070697_100000554 | 3300005536 | Bacteria | 28090 |
| 166 | Ga0070697_100000872 | 3300005536 | Bacteria | 22677 |
| 167 | Ga0070697_100001177 | 3300005536 | Bacteria | 19808 |
| 168 | Ga0070697_100001505 | 3300005536 | Bacteria | 17701 |
| 169 | Ga0070697_100002639 | 3300005536 | Bacteria | 13795 |
| 170 | Ga0070697_100024244 | 3300005536 | Bacteria | 4829 |
| 171 | Ga0070697_100174118 | 3300005536 | Unclassified | 1822 |
| 172 | Ga0070697_100212204 | 3300005536 | Bacteria | 1648 |
| 173 | Ga0068853_100016415 | 3300005539 | Bacteria | 6093 |
| 174 | Ga0068853_100035889 | 3300005539 | Bacteria | 4213 |
| 175 | Ga0068853_100035951 | 3300005539 | Bacteria | 4209 |
| 176 | Ga0070672_100019833 | 3300005543 | Bacteria | 4891 |
| 177 | Ga0070686_100030276 | 3300005544 | Bacteria | 3300 |
| 178 | Ga0070686_100062316 | 3300005544 | Bacteria | 2413 |
| 179 | Ga0070695_100161859 | 3300005545 | Bacteria | 1571 |
| 180 | Ga0070695_100572691 | 3300005545 | Unclassified | 883 |
| 181 | Ga0070696_100308363 | 3300005546 | Bacteria | 1214 |
| 182 | Ga0070693_100117514 | 3300005547 | Bacteria | 1645 |
| 183 | Ga0070693_100256189 | 3300005547 | Unclassified | 1162 |
| 184 | Ga0070665_100384352 | 3300005548 | Bacteria | 1411 |
| 185 | Ga0068855_100028151 | 3300005563 | Bacteria | 6721 |
| 186 | Ga0068855_100082032 | 3300005563 | Bacteria | 3737 |
| 187 | Ga0068855_100826772 | 3300005563 | Bacteria | 983 |
| 188 | Ga0068855_101094456 | 3300005563 | Unclassified | 833 |
| 189 | Ga0070664_100012980 | 3300005564 | Bacteria | 6778 |
| 190 | Ga0070664_100017362 | 3300005564 | Bacteria | 5909 |
| 191 | Ga0070664_100173686 | 3300005564 | Bacteria | 1912 |
| 192 | Ga0068857_100002662 | 3300005577 | Bacteria | 14661 |
| 193 | Ga0068857_100060124 | 3300005577 | Bacteria | 3376 |
| 194 | Ga0068854_100009708 | 3300005578 | Bacteria | 6219 |
| 195 | Ga0068854_100460332 | 3300005578 | Bacteria | 1064 |
| 196 | Ga0068856_100019084 | 3300005614 | Bacteria | 6654 |
| 197 | Ga0068856_100034355 | 3300005614 | Bacteria | 4966 |
| 198 | Ga0068856_100035602 | 3300005614 | Bacteria | 4879 |
| 199 | Ga0068856_100060078 | 3300005614 | Bacteria | 3756 |
| 200 | Ga0068856_100060970 | 3300005614 | Bacteria | 3726 |
| 201 | Ga0068856_100096241 | 3300005614 | Bacteria | 2949 |
| 202 | Ga0070702_100138308 | 3300005615 | Bacteria | 1548 |
| 203 | Ga0068852_100006784 | 3300005616 | Bacteria | 8307 |
| 204 | Ga0068852_100015554 | 3300005616 | Bacteria | 5907 |
| 205 | Ga0068852_100116529 | 3300005616 | Bacteria | 2438 |
| 206 | Ga0068859_100037215 | 3300005617 | Bacteria | 4884 |
| 207 | Ga0068864_100203828 | 3300005618 | Bacteria | 1818 |
| 208 | Ga0068864_100462302 | 3300005618 | Unclassified | 1215 |
| 209 | Ga0068864_100987147 | 3300005618 | Unclassified | 835 |
| 210 | Ga0068866_10001944 | 3300005718 | Bacteria | 8612 |
| 211 | Ga0068866_10326929 | 3300005718 | Bacteria | 966 |
| 212 | Ga0068861_100009145 | 3300005719 | Bacteria | 6834 |
| 213 | Ga0068851_10006235 | 3300005834 | Bacteria | 5441 |
| 214 | Ga0068851_10017023 | 3300005834 | Bacteria | 3486 |
| 215 | Ga0068851_10029284 | 3300005834 | Bacteria | 2726 |
| 216 | Ga0068870_10012560 | 3300005840 | Bacteria | 3961 |
| 217 | Ga0068863_100084025 | 3300005841 | Bacteria | 3017 |
| 218 | Ga0068863_100112243 | 3300005841 | Unclassified | 2596 |
| 219 | Ga0068863_100169230 | 3300005841 | Bacteria | 2095 |
| 220 | Ga0068863_100335151 | 3300005841 | Bacteria | 1471 |
| 221 | Ga0068858_100018536 | 3300005842 | Bacteria | 6516 |
| 222 | Ga0068858_100818521 | 3300005842 | Bacteria | 909 |
| 223 | Ga0068860_100033462 | 3300005843 | Bacteria | 4931 |
| 224 | Ga0068860_100286630 | 3300005843 | Bacteria | 1610 |
| 225 | Ga0068860_100462065 | 3300005843 | Bacteria | 1263 |
| 226 | Ga0068862_100024154 | 3300005844 | Bacteria | 5098 |
| 227 | Ga0068862_100125918 | 3300005844 | Bacteria | 2262 |
| 228 | Ga0070717_10000612 | 3300006028 | Bacteria | 22915 |
| 229 | Ga0070717_10000837 | 3300006028 | Bacteria | 20360 |
| 230 | Ga0070717_10001449 | 3300006028 | Bacteria | 16366 |
| 231 | Ga0070717_10005741 | 3300006028 | Bacteria | 9085 |
| 232 | Ga0070717_10024145 | 3300006028 | Bacteria | 4824 |
| 233 | Ga0070717_10045843 | 3300006028 | Bacteria | 3575 |
| 234 | Ga0070717_10137148 | 3300006028 | Bacteria | 2108 |
| 235 | Ga0070717_10146046 | 3300006028 | Bacteria | 2043 |
| 236 | Ga0070717_10147941 | 3300006028 | Bacteria | 2030 |
| 237 | Ga0070717_10224306 | 3300006028 | Bacteria | 1653 |
| 238 | Ga0070717_10252654 | 3300006028 | Bacteria | 1558 |
| 239 | Ga0070717_10496403 | 3300006028 | Unclassified | 1103 |
| 240 | Ga0070717_10743396 | 3300006028 | Bacteria | 892 |
| 241 | Ga0070717_10984018 | 3300006028 | Bacteria | 768 |
| 242 | Ga0070715_10090802 | 3300006163 | Bacteria | 1405 |
| 243 | Ga0070715_10095244 | 3300006163 | Unclassified | 1378 |
| 244 | Ga0070716_100000315 | 3300006173 | Bacteria | 19472 |
| 245 | Ga0070716_100002096 | 3300006173 | Bacteria | 9152 |
| 246 | Ga0070716_100014273 | 3300006173 | Bacteria | 4067 |
| 247 | Ga0070716_100037106 | 3300006173 | Bacteria | 2691 |
| 248 | Ga0070716_100042111 | 3300006173 | Bacteria | 2548 |
| 249 | Ga0070716_100092424 | 3300006173 | Bacteria | 1834 |
| 250 | Ga0070716_100097798 | 3300006173 | Bacteria | 1792 |
| 251 | Ga0070716_100120575 | 3300006173 | Bacteria | 1641 |
| 252 | Ga0070716_100191504 | 3300006173 | Bacteria | 1352 |
| 253 | Ga0070716_100281838 | 3300006173 | Unclassified | 1147 |
| 254 | Ga0070716_100339825 | 3300006173 | Bacteria | 1059 |
| 255 | Ga0070716_100449359 | 3300006173 | Unclassified | 939 |
| 256 | Ga0070716_100530529 | 3300006173 | Bacteria | 874 |
| 257 | Ga0070716_100880373 | 3300006173 | Bacteria | 699 |
| 258 | Ga0070712_100000546 | 3300006175 | Bacteria | 21742 |
| 259 | Ga0070712_100002960 | 3300006175 | Bacteria | 10514 |
| 260 | Ga0070712_100003075 | 3300006175 | Bacteria | 10319 |
| 261 | Ga0070712_100005278 | 3300006175 | Bacteria | 7994 |
| 262 | Ga0070712_100031299 | 3300006175 | Bacteria | 3583 |
| 263 | Ga0070712_100061623 | 3300006175 | Bacteria | 2651 |
| 264 | Ga0070712_100233313 | 3300006175 | Bacteria | 1462 |
| 265 | Ga0070712_100464965 | 3300006175 | Bacteria | 1055 |
| 266 | Ga0070712_100505911 | 3300006175 | Unclassified | 1013 |
| 267 | Ga0070712_100635624 | 3300006175 | Bacteria | 906 |
| 268 | Ga0070712_100709718 | 3300006175 | Unclassified | 858 |
| 269 | Ga0097621_100008160 | 3300006237 | Bacteria | 7529 |
| 270 | Ga0097621_100190616 | 3300006237 | Bacteria | 1775 |
| 271 | Ga0097621_100327422 | 3300006237 | Bacteria | 1358 |
| 272 | Ga0097621_100404318 | 3300006237 | Unclassified | 1223 |
| 273 | Ga0097621_100610893 | 3300006237 | Unclassified | 997 |
| 274 | Ga0068871_100007947 | 3300006358 | Bacteria | 7605 |
| 275 | Ga0068871_100040074 | 3300006358 | Bacteria | 3751 |
| 276 | Ga0068871_100188544 | 3300006358 | Bacteria | 1775 |
| 277 | Ga0068871_100256279 | 3300006358 | Bacteria | 1525 |
| 278 | Ga0068871_100488464 | 3300006358 | Bacteria | 1108 |
| 279 | Ga0075433_10001164 | 3300006852 | Bacteria | 19108 |
| 280 | Ga0075433_10001954 | 3300006852 | Bacteria | 15504 |
| 281 | Ga0075433_10572342 | 3300006852 | Unclassified | 992 |
| 282 | Ga0075434_100000041 | 3300006871 | Bacteria | 59536 |
| 283 | Ga0075434_100002766 | 3300006871 | Bacteria | 15521 |
| 284 | Ga0075434_100008051 | 3300006871 | Bacteria | 9775 |
| 285 | Ga0068865_100032569 | 3300006881 | Bacteria | 3483 |
| 286 | Ga0068865_100296483 | 3300006881 | Bacteria | 1292 |
| 287 | Ga0075436_100000526 | 3300006914 | Bacteria | 24961 |
| 288 | Ga0075436_100006992 | 3300006914 | Bacteria | 7726 |
| 289 | Ga0075436_100016670 | 3300006914 | Bacteria | 5029 |
| 290 | Ga0075436_100070745 | 3300006914 | Unclassified | 2412 |
| 291 | Ga0075436_100277786 | 3300006914 | Bacteria | 1197 |
| 292 | Ga0075436_100734257 | 3300006914 | Bacteria | 733 |
| 293 | Ga0097620_100037214 | 3300006931 | Bacteria | 4884 |
| 294 | Ga0075435_100000105 | 3300007076 | Bacteria | 45736 |
| 295 | Ga0075435_100023020 | 3300007076 | Bacteria | 4811 |
| 296 | Ga0075435_100037240 | 3300007076 | Bacteria | 3872 |
| 297 | Ga0075435_100347524 | 3300007076 | Bacteria | 1271 |
| 298 | Ga0075435_100552641 | 3300007076 | Unclassified | 997 |
| 299 | Ga0099794_10008610 | 3300007265 | Bacteria | 4247 |
| 300 | Ga0099794_10111802 | 3300007265 | Bacteria | 1369 |
| 301 | Ga0099794_10168120 | 3300007265 | Unclassified | 1117 |
| 302 | Ga0099794_10236851 | 3300007265 | Unclassified | 940 |
| 303 | Ga0099795_10036881 | 3300007788 | Bacteria | 1718 |
| 304 | Ga0099795_10101684 | 3300007788 | Bacteria | 1128 |
| 305 | Ga0105240_10074313 | 3300009093 | Bacteria | 4196 |
| 306 | Ga0105240_10181112 | 3300009093 | Bacteria | 2486 |
| 307 | Ga0105240_10256517 | 3300009093 | Bacteria | 2019 |
| 308 | Ga0105240_10263184 | 3300009093 | Unclassified | 1989 |
| 309 | Ga0105240_10593662 | 3300009093 | Bacteria | 1220 |
| 310 | Ga0105240_11617565 | 3300009093 | Unclassified | 677 |
| 311 | Ga0105240_12166851 | 3300009093 | Unclassified | 577 |
| 312 | Ga0105245_10030920 | 3300009098 | Bacteria | 4736 |
| 313 | Ga0105245_10140939 | 3300009098 | Bacteria | 2271 |
| 314 | Ga0105245_10165140 | 3300009098 | Bacteria | 2104 |
| 315 | Ga0105245_11021681 | 3300009098 | Unclassified | 872 |
| 316 | Ga0105247_10006289 | 3300009101 | Bacteria | 7361 |
| 317 | Ga0105247_10026851 | 3300009101 | Bacteria | 3480 |
| 318 | Ga0105247_11103034 | 3300009101 | Unclassified | 626 |
| 319 | Ga0114129_11407360 | 3300009147 | Bacteria | 860 |
| 320 | Ga0105243_10058571 | 3300009148 | Bacteria | 3070 |
| 321 | Ga0105243_11199285 | 3300009148 | Bacteria | 772 |
| 322 | Ga0105241_10000916 | 3300009174 | Bacteria | 22311 |
| 323 | Ga0105241_10013091 | 3300009174 | Bacteria | 6084 |
| 324 | Ga0105241_10241944 | 3300009174 | Bacteria | 1526 |
| 325 | Ga0105241_10328554 | 3300009174 | Bacteria | 1321 |
| 326 | Ga0105241_10736991 | 3300009174 | Bacteria | 902 |
| 327 | Ga0105241_10748814 | 3300009174 | Unclassified | 896 |
| 328 | Ga0105241_11130602 | 3300009174 | Unclassified | 739 |
| 329 | Ga0105242_10068669 | 3300009176 | Bacteria | 2933 |
| 330 | Ga0105248_10010789 | 3300009177 | Bacteria | 10087 |
| 331 | Ga0105248_10070138 | 3300009177 | Bacteria | 3936 |
| 332 | Ga0105248_10610461 | 3300009177 | Bacteria | 1231 |
| 333 | Ga0105248_11216137 | 3300009177 | Bacteria | 852 |
| 334 | Ga0105237_10062864 | 3300009545 | Bacteria | 3711 |
| 335 | Ga0105237_10617226 | 3300009545 | Bacteria | 1091 |
| 336 | Ga0105237_10785869 | 3300009545 | Bacteria | 959 |
| 337 | Ga0105237_11087867 | 3300009545 | Bacteria | 806 |
| 338 | Ga0105237_11755320 | 3300009545 | Unclassified | 628 |
| 339 | Ga0105238_10030598 | 3300009551 | Bacteria | 5481 |
| 340 | Ga0105238_10091469 | 3300009551 | Bacteria | 3030 |
| 341 | Ga0105238_10278522 | 3300009551 | Bacteria | 1653 |
| 342 | Ga0105249_10011376 | 3300009553 | Bacteria | 7814 |
| 343 | Ga0105249_10033432 | 3300009553 | Bacteria | 4655 |
| 344 | Ga0105249_10118256 | 3300009553 | Bacteria | 2515 |
| 345 | Ga0105249_11371650 | 3300009553 | Unclassified | 779 |
| 346 | Ga0105239_10117684 | 3300010375 | Bacteria | 2949 |
| 347 | Ga0105239_10460080 | 3300010375 | Bacteria | 1444 |
| 348 | Ga0105239_10691320 | 3300010375 | Unclassified | 1166 |
| 349 | Ga0105239_10768567 | 3300010375 | Bacteria | 1103 |
| 350 | Ga0105239_12520334 | 3300010375 | Unclassified | 599 |
| 351 | Ga0105246_10009260 | 3300011119 | Bacteria | 6066 |
| 352 | Ga0105246_11729674 | 3300011119 | Unclassified | 595 |
| 353 | Ga0157373_10000288 | 3300013100 | Bacteria | 40421 |
| 354 | Ga0157373_10004158 | 3300013100 | Bacteria | 10914 |
| 355 | Ga0157373_10112556 | 3300013100 | Bacteria | 1913 |
| 356 | Ga0157373_10207528 | 3300013100 | Bacteria | 1381 |
| 357 | Ga0157371_10031378 | 3300013102 | Bacteria | 3828 |
| 358 | Ga0157371_10271571 | 3300013102 | Unclassified | 1224 |
| 359 | Ga0157370_10045720 | 3300013104 | Bacteria | 4199 |
| 360 | Ga0157370_10085697 | 3300013104 | Unclassified | 2960 |
| 361 | Ga0157370_10677144 | 3300013104 | Bacteria | 942 |
| 362 | Ga0157369_10008623 | 3300013105 | Bacteria | 11692 |
| 363 | Ga0157369_10032939 | 3300013105 | Bacteria | 5695 |
| 364 | Ga0157369_10048103 | 3300013105 | Bacteria | 4629 |
| 365 | Ga0157369_10102365 | 3300013105 | Bacteria | 3052 |
| 366 | Ga0157369_10119587 | 3300013105 | Bacteria | 2795 |
| 367 | Ga0157374_10014241 | 3300013296 | Bacteria | 6954 |
| 368 | Ga0157374_10049285 | 3300013296 | Bacteria | 3912 |
| 369 | Ga0157374_10053326 | 3300013296 | Bacteria | 3770 |
| 370 | Ga0157374_10186316 | 3300013296 | Bacteria | 2029 |
| 371 | Ga0157374_10224493 | 3300013296 | Bacteria | 1844 |
| 372 | Ga0157374_10288743 | 3300013296 | Bacteria | 1620 |
| 373 | Ga0157374_11001050 | 3300013296 | Bacteria | 855 |
| 374 | Ga0157378_10010049 | 3300013297 | Bacteria | 8247 |
| 375 | Ga0157378_10103061 | 3300013297 | Bacteria | 2607 |
| 376 | Ga0157378_10310375 | 3300013297 | Bacteria | 1529 |
| 377 | Ga0163162_10029047 | 3300013306 | Bacteria | 5472 |
| 378 | Ga0163162_10294833 | 3300013306 | Bacteria | 1753 |
| 379 | Ga0163162_11370766 | 3300013306 | Bacteria | 804 |
| 380 | Ga0157372_10015183 | 3300013307 | Bacteria | 8245 |
| 381 | Ga0157372_10015214 | 3300013307 | Bacteria | 8240 |
| 382 | Ga0157372_10072578 | 3300013307 | Bacteria | 3879 |
| 383 | Ga0157372_10076790 | 3300013307 | Bacteria | 3772 |
| 384 | Ga0157372_10242027 | 3300013307 | Bacteria | 2093 |
| 385 | Ga0157372_10428455 | 3300013307 | Bacteria | 1542 |
| 386 | Ga0157372_10933286 | 3300013307 | Bacteria | 1006 |
| 387 | Ga0157372_11143669 | 3300013307 | Unclassified | 900 |
| 388 | Ga0157375_10027190 | 3300013308 | Bacteria | 5344 |
| 389 | Ga0163163_10007476 | 3300014325 | Bacteria | 9642 |
| 390 | Ga0163163_10011914 | 3300014325 | Bacteria | 7911 |
| 391 | Ga0163163_10020058 | 3300014325 | Bacteria | 6291 |
| 392 | Ga0163163_10022148 | 3300014325 | Bacteria | 6011 |
| 393 | Ga0182008_10019449 | 3300014497 | Bacteria | 3504 |
| 394 | Ga0182008_10107349 | 3300014497 | Bacteria | 1382 |
| 395 | Ga0157377_10001020 | 3300014745 | Bacteria | 11815 |
| 396 | Ga0157379_10007715 | 3300014968 | Bacteria | 9316 |
| 397 | Ga0157379_10014150 | 3300014968 | Bacteria | 6996 |
| 398 | Ga0157379_10653514 | 3300014968 | Unclassified | 984 |
| 399 | Ga0157379_10692323 | 3300014968 | Unclassified | 956 |
| 400 | Ga0157376_10009736 | 3300014969 | Bacteria | 6997 |
| 401 | Ga0157376_10017009 | 3300014969 | Bacteria | 5536 |
| 402 | Ga0157376_10035919 | 3300014969 | Bacteria | 4011 |
| 403 | Ga0157376_10397162 | 3300014969 | Bacteria | 1332 |
| 404 | Ga0157376_11458188 | 3300014969 | Bacteria | 717 |
| 405 | Ga0182007_10005070 | 3300015262 | Bacteria | 5851 |
| 406 | Ga0182007_10103770 | 3300015262 | Bacteria | 943 |
| 407 | Ga0182005_1009626 | 3300015265 | Bacteria | 2805 |
| 408 | Ga0163161_10019548 | 3300017792 | Bacteria | 4753 |
| 409 | Ga0184594_100472 | 3300019181 | Bacteria | 1155 |
| 410 | Ga0213873_10136317 | 3300021358 | Unclassified | 730 |
| 411 | Ga0213874_10090537 | 3300021377 | Unclassified | 1004 |
| 412 | Ga0224570_100064 | 3300022730 | Bacteria | 5809 |
| 413 | Ga0224569_100403 | 3300022732 | Bacteria | 3665 |
| 414 | Ga0224571_102100 | 3300022734 | Bacteria | 1262 |
| 415 | Ga0224572_1005998 | 3300024225 | Bacteria | 2186 |
| 416 | Ga0224572_1018321 | 3300024225 | Unclassified | 1345 |
| 417 | Ga0228598_1000222 | 3300024227 | Bacteria | 10731 |
| 418 | Ga0228598_1000502 | 3300024227 | Bacteria | 8089 |
| 419 | Ga0228598_1000816 | 3300024227 | Bacteria | 6714 |
| 420 | Ga0228598_1027302 | 3300024227 | Unclassified | 1122 |
| 421 | Ga0228598_1041734 | 3300024227 | Unclassified | 906 |
| 422 | Ga0207697_10007772 | 3300025315 | Bacteria | 4750 |
| 423 | Ga0207656_10037664 | 3300025321 | Bacteria | 2036 |
| 424 | Ga0207656_10211485 | 3300025321 | Bacteria | 940 |
| 425 | Ga0207682_10029528 | 3300025893 | Bacteria | 2192 |
| 426 | Ga0207682_10416653 | 3300025893 | Bacteria | 635 |
| 427 | Ga0207692_10006597 | 3300025898 | Bacteria | 4715 |
| 428 | Ga0207692_10068299 | 3300025898 | Bacteria | 1863 |
| 429 | Ga0207692_10089120 | 3300025898 | Unclassified | 1669 |
| 430 | Ga0207692_10325901 | 3300025898 | Bacteria | 941 |
| 431 | Ga0207692_10391074 | 3300025898 | Bacteria | 865 |
| 432 | Ga0207642_10104851 | 3300025899 | Unclassified | 1427 |
| 433 | Ga0207642_10386144 | 3300025899 | Bacteria | 834 |
| 434 | Ga0207710_10348901 | 3300025900 | Unclassified | 754 |
| 435 | Ga0207688_10145853 | 3300025901 | Bacteria | 1395 |
| 436 | Ga0207680_10015571 | 3300025903 | Bacteria | 3971 |
| 437 | Ga0207680_10663459 | 3300025903 | Bacteria | 747 |
| 438 | Ga0207647_10003441 | 3300025904 | Bacteria | 11878 |
| 439 | Ga0207647_10085312 | 3300025904 | Bacteria | 1889 |
| 440 | Ga0207685_10040513 | 3300025905 | Bacteria | 1736 |
| 441 | Ga0207699_10001324 | 3300025906 | Bacteria | 11774 |
| 442 | Ga0207699_10015400 | 3300025906 | Bacteria | 3970 |
| 443 | Ga0207699_10020214 | 3300025906 | Bacteria | 3563 |
| 444 | Ga0207699_10058713 | 3300025906 | Bacteria | 2302 |
| 445 | Ga0207699_10060749 | 3300025906 | Bacteria | 2271 |
| 446 | Ga0207699_10061138 | 3300025906 | Bacteria | 2265 |
| 447 | Ga0207699_10094983 | 3300025906 | Unclassified | 1879 |
| 448 | Ga0207699_10264602 | 3300025906 | Bacteria | 1190 |
| 449 | Ga0207699_10362925 | 3300025906 | Bacteria | 1025 |
| 450 | Ga0207699_10446256 | 3300025906 | Bacteria | 927 |
| 451 | Ga0207699_10656955 | 3300025906 | Unclassified | 766 |
| 452 | Ga0207699_10767960 | 3300025906 | Bacteria | 708 |
| 453 | Ga0207645_10000181 | 3300025907 | Bacteria | 50200 |
| 454 | Ga0207645_10019336 | 3300025907 | Bacteria | 4466 |
| 455 | Ga0207643_10001458 | 3300025908 | Bacteria | 13565 |
| 456 | Ga0207643_10109875 | 3300025908 | Bacteria | 1624 |
| 457 | Ga0207705_10045425 | 3300025909 | Bacteria | 3157 |
| 458 | Ga0207684_10000217 | 3300025910 | Bacteria | 88691 |
| 459 | Ga0207684_10000267 | 3300025910 | Bacteria | 77172 |
| 460 | Ga0207684_10004181 | 3300025910 | Bacteria | 13709 |
| 461 | Ga0207684_10498628 | 3300025910 | Bacteria | 1044 |
| 462 | Ga0207684_10779951 | 3300025910 | Bacteria | 809 |
| 463 | Ga0207654_10006062 | 3300025911 | Bacteria | 6077 |
| 464 | Ga0207654_10055269 | 3300025911 | Bacteria | 2298 |
| 465 | Ga0207654_10058367 | 3300025911 | Bacteria | 2246 |
| 466 | Ga0207654_10092107 | 3300025911 | Bacteria | 1850 |
| 467 | Ga0207654_10166552 | 3300025911 | Bacteria | 1428 |
| 468 | Ga0207654_10246661 | 3300025911 | Bacteria | 1195 |
| 469 | Ga0207654_10548815 | 3300025911 | Bacteria | 821 |
| 470 | Ga0207707_10015984 | 3300025912 | Bacteria | 6545 |
| 471 | Ga0207707_10175218 | 3300025912 | Unclassified | 1873 |
| 472 | Ga0207707_10470183 | 3300025912 | Bacteria | 1075 |
| 473 | Ga0207707_10510704 | 3300025912 | Bacteria | 1024 |
| 474 | Ga0207695_10027763 | 3300025913 | Bacteria | 6297 |
| 475 | Ga0207695_10064718 | 3300025913 | Bacteria | 3763 |
| 476 | Ga0207695_10299030 | 3300025913 | Bacteria | 1501 |
| 477 | Ga0207695_10307560 | 3300025913 | Bacteria | 1475 |
| 478 | Ga0207695_10545532 | 3300025913 | Bacteria | 1041 |
| 479 | Ga0207695_10905542 | 3300025913 | Bacteria | 762 |
| 480 | Ga0207671_10122728 | 3300025914 | Bacteria | 1987 |
| 481 | Ga0207671_10125768 | 3300025914 | Unclassified | 1964 |
| 482 | Ga0207671_10537801 | 3300025914 | Bacteria | 931 |
| 483 | Ga0207693_10000089 | 3300025915 | Bacteria | 81143 |
| 484 | Ga0207693_10000106 | 3300025915 | Bacteria | 75776 |
| 485 | Ga0207693_10009582 | 3300025915 | Bacteria | 7887 |
| 486 | Ga0207693_10013836 | 3300025915 | Bacteria | 6498 |
| 487 | Ga0207693_10029134 | 3300025915 | Bacteria | 4363 |
| 488 | Ga0207693_10075950 | 3300025915 | Bacteria | 2631 |
| 489 | Ga0207693_10209793 | 3300025915 | Bacteria | 1531 |
| 490 | Ga0207693_10286481 | 3300025915 | Bacteria | 1291 |
| 491 | Ga0207693_10374723 | 3300025915 | Bacteria | 1113 |
| 492 | Ga0207693_10761346 | 3300025915 | Bacteria | 748 |
| 493 | Ga0207663_10002155 | 3300025916 | Bacteria | 9394 |
| 494 | Ga0207663_10059922 | 3300025916 | Bacteria | 2410 |
| 495 | Ga0207663_10079355 | 3300025916 | Bacteria | 2143 |
| 496 | Ga0207663_10085695 | 3300025916 | Bacteria | 2075 |
| 497 | Ga0207663_10124631 | 3300025916 | Bacteria | 1770 |
| 498 | Ga0207663_10160137 | 3300025916 | Bacteria | 1588 |
| 499 | Ga0207663_10320556 | 3300025916 | Bacteria | 1164 |
| 500 | Ga0207663_10788727 | 3300025916 | Unclassified | 756 |
| 501 | Ga0207660_10379430 | 3300025917 | Bacteria | 1136 |
| 502 | Ga0207660_10761743 | 3300025917 | Bacteria | 790 |
| 503 | Ga0207662_10026172 | 3300025918 | Bacteria | 3364 |
| 504 | Ga0207657_10000535 | 3300025919 | Bacteria | 40427 |
| 505 | Ga0207657_10001828 | 3300025919 | Bacteria | 22959 |
| 506 | Ga0207657_10010586 | 3300025919 | Bacteria | 9195 |
| 507 | Ga0207649_10000350 | 3300025920 | Bacteria | 34881 |
| 508 | Ga0207649_10020780 | 3300025920 | Unclassified | 3769 |
| 509 | Ga0207649_10114548 | 3300025920 | Bacteria | 1807 |
| 510 | Ga0207652_10144604 | 3300025921 | Bacteria | 2127 |
| 511 | Ga0207652_10471230 | 3300025921 | Unclassified | 1131 |
| 512 | Ga0207646_10000296 | 3300025922 | Bacteria | 67683 |
| 513 | Ga0207646_10001311 | 3300025922 | Bacteria | 30882 |
| 514 | Ga0207646_10095550 | 3300025922 | Bacteria | 2662 |
| 515 | Ga0207646_10132679 | 3300025922 | Bacteria | 2242 |
| 516 | Ga0207646_10209420 | 3300025922 | Bacteria | 1761 |
| 517 | Ga0207646_10272895 | 3300025922 | Bacteria | 1529 |
| 518 | Ga0207646_10300814 | 3300025922 | Bacteria | 1449 |
| 519 | Ga0207681_10079583 | 3300025923 | Bacteria | 2309 |
| 520 | Ga0207694_10144453 | 3300025924 | Bacteria | 1914 |
| 521 | Ga0207694_10182398 | 3300025924 | Unclassified | 1703 |
| 522 | Ga0207694_10502618 | 3300025924 | Unclassified | 1015 |
| 523 | Ga0207650_10000223 | 3300025925 | Bacteria | 64087 |
| 524 | Ga0207650_10140577 | 3300025925 | Bacteria | 1898 |
| 525 | Ga0207659_10007479 | 3300025926 | Bacteria | 6721 |
| 526 | Ga0207687_10018290 | 3300025927 | Bacteria | 4624 |
| 527 | Ga0207687_10077263 | 3300025927 | Bacteria | 2394 |
| 528 | Ga0207700_10000289 | 3300025928 | Bacteria | 29760 |
| 529 | Ga0207700_10000888 | 3300025928 | Bacteria | 17211 |
| 530 | Ga0207700_10025835 | 3300025928 | Bacteria | 4086 |
| 531 | Ga0207700_10030601 | 3300025928 | Bacteria | 3814 |
| 532 | Ga0207700_10077108 | 3300025928 | Bacteria | 2588 |
| 533 | Ga0207700_10153261 | 3300025928 | Bacteria | 1906 |
| 534 | Ga0207700_10161029 | 3300025928 | Unclassified | 1864 |
| 535 | Ga0207700_10255286 | 3300025928 | Unclassified | 1499 |
| 536 | Ga0207700_10263812 | 3300025928 | Bacteria | 1476 |
| 537 | Ga0207700_10301690 | 3300025928 | Bacteria | 1383 |
| 538 | Ga0207700_10517468 | 3300025928 | Bacteria | 1057 |
| 539 | Ga0207700_10618550 | 3300025928 | Bacteria | 964 |
| 540 | Ga0207700_10657352 | 3300025928 | Bacteria | 935 |
| 541 | Ga0207700_10737072 | 3300025928 | Unclassified | 880 |
| 542 | Ga0207700_10845813 | 3300025928 | Bacteria | 819 |
| 543 | Ga0207664_10000118 | 3300025929 | Bacteria | 69258 |
| 544 | Ga0207664_10022203 | 3300025929 | Bacteria | 4735 |
| 545 | Ga0207664_10141500 | 3300025929 | Unclassified | 2035 |
| 546 | Ga0207664_10191181 | 3300025929 | Bacteria | 1762 |
| 547 | Ga0207664_10234103 | 3300025929 | Bacteria | 1597 |
| 548 | Ga0207664_10320035 | 3300025929 | Bacteria | 1369 |
| 549 | Ga0207664_10332482 | 3300025929 | Unclassified | 1342 |
| 550 | Ga0207664_10550611 | 3300025929 | Unclassified | 1035 |
| 551 | Ga0207664_10650565 | 3300025929 | Bacteria | 947 |
| 552 | Ga0207644_10011249 | 3300025931 | Bacteria | 5915 |
| 553 | Ga0207644_10049864 | 3300025931 | Unclassified | 2999 |
| 554 | Ga0207690_10029853 | 3300025932 | Bacteria | 3471 |
| 555 | Ga0207690_10387278 | 3300025932 | Bacteria | 1112 |
| 556 | Ga0207706_10000670 | 3300025933 | Bacteria | 35982 |
| 557 | Ga0207706_10009803 | 3300025933 | Bacteria | 8789 |
| 558 | Ga0207706_10014729 | 3300025933 | Bacteria | 7082 |
| 559 | Ga0207709_10108511 | 3300025935 | Bacteria | 1851 |
| 560 | Ga0207709_10823662 | 3300025935 | Bacteria | 750 |
| 561 | Ga0207670_10015700 | 3300025936 | Bacteria | 4531 |
| 562 | Ga0207669_10863890 | 3300025937 | Unclassified | 754 |
| 563 | Ga0207704_10067564 | 3300025938 | Bacteria | 2249 |
| 564 | Ga0207704_10176675 | 3300025938 | Bacteria | 1538 |
| 565 | Ga0207665_10001480 | 3300025939 | Bacteria | 15799 |
| 566 | Ga0207665_10001526 | 3300025939 | Bacteria | 15570 |
| 567 | Ga0207665_10008599 | 3300025939 | Bacteria | 6720 |
| 568 | Ga0207665_10044443 | 3300025939 | Bacteria | 2973 |
| 569 | Ga0207665_10079547 | 3300025939 | Bacteria | 2253 |
| 570 | Ga0207665_10138043 | 3300025939 | Bacteria | 1736 |
| 571 | Ga0207665_10229042 | 3300025939 | Bacteria | 1365 |
| 572 | Ga0207665_10255058 | 3300025939 | Bacteria | 1297 |
| 573 | Ga0207665_10317031 | 3300025939 | Bacteria | 1169 |
| 574 | Ga0207665_10347153 | 3300025939 | Unclassified | 1120 |
| 575 | Ga0207665_10347731 | 3300025939 | Bacteria | 1119 |
| 576 | Ga0207665_10883279 | 3300025939 | Unclassified | 709 |
| 577 | Ga0207691_10000345 | 3300025940 | Bacteria | 46775 |
| 578 | Ga0207711_10029037 | 3300025941 | Bacteria | 4661 |
| 579 | Ga0207689_10000499 | 3300025942 | Bacteria | 37043 |
| 580 | Ga0207689_10076620 | 3300025942 | Bacteria | 2749 |
| 581 | Ga0207661_10059699 | 3300025944 | Bacteria | 3074 |
| 582 | Ga0207661_10125076 | 3300025944 | Unclassified | 2195 |
| 583 | Ga0207661_10357834 | 3300025944 | Bacteria | 1318 |
| 584 | Ga0207679_10000115 | 3300025945 | Bacteria | 64466 |
| 585 | Ga0207679_10192010 | 3300025945 | Bacteria | 1699 |
| 586 | Ga0207679_10250551 | 3300025945 | Bacteria | 1505 |
| 587 | Ga0207667_10040938 | 3300025949 | Bacteria | 4931 |
| 588 | Ga0207667_10246893 | 3300025949 | Unclassified | 1826 |
| 589 | Ga0207667_11555893 | 3300025949 | Viruses | 631 |
| 590 | Ga0207651_10003270 | 3300025960 | Bacteria | 7932 |
| 591 | Ga0207712_10030933 | 3300025961 | Bacteria | 3602 |
| 592 | Ga0207712_10141863 | 3300025961 | Bacteria | 1845 |
| 593 | Ga0207668_10029993 | 3300025972 | Bacteria | 3570 |
| 594 | Ga0207668_10780986 | 3300025972 | Unclassified | 844 |
| 595 | Ga0207640_10154868 | 3300025981 | Bacteria | 1688 |
| 596 | Ga0207640_10416205 | 3300025981 | Bacteria | 1099 |
| 597 | Ga0207640_10595314 | 3300025981 | Unclassified | 935 |
| 598 | Ga0207658_10018432 | 3300025986 | Bacteria | 4819 |
| 599 | Ga0207658_10385427 | 3300025986 | Bacteria | 1228 |
| 600 | Ga0207677_10016957 | 3300026023 | Bacteria | 4328 |
| 601 | Ga0207677_10033304 | 3300026023 | Bacteria | 3323 |
| 602 | Ga0207677_10368197 | 3300026023 | Bacteria | 1209 |
| 603 | Ga0207703_10020915 | 3300026035 | Bacteria | 5118 |
| 604 | Ga0207703_10221807 | 3300026035 | Bacteria | 1691 |
| 605 | Ga0207703_10261335 | 3300026035 | Bacteria | 1565 |
| 606 | Ga0207639_10028794 | 3300026041 | Bacteria | 4059 |
| 607 | Ga0207678_10000130 | 3300026067 | Bacteria | 63279 |
| 608 | Ga0207678_10001418 | 3300026067 | Bacteria | 21972 |
| 609 | Ga0207678_10105876 | 3300026067 | Unclassified | 2399 |
| 610 | Ga0207678_11605438 | 3300026067 | Unclassified | 573 |
| 611 | Ga0207708_10088371 | 3300026075 | Bacteria | 2387 |
| 612 | Ga0207702_10002571 | 3300026078 | Bacteria | 17059 |
| 613 | Ga0207702_10023735 | 3300026078 | Bacteria | 5088 |
| 614 | Ga0207702_10109070 | 3300026078 | Unclassified | 2457 |
| 615 | Ga0207702_10257982 | 3300026078 | Bacteria | 1640 |
| 616 | Ga0207702_10291844 | 3300026078 | Bacteria | 1545 |
| 617 | Ga0207702_10622993 | 3300026078 | Unclassified | 1060 |
| 618 | Ga0207702_10627342 | 3300026078 | Bacteria | 1056 |
| 619 | Ga0207641_10000287 | 3300026088 | Bacteria | 63251 |
| 620 | Ga0207641_10233097 | 3300026088 | Bacteria | 1712 |
| 621 | Ga0207641_10648956 | 3300026088 | Bacteria | 1036 |
| 622 | Ga0207641_10830731 | 3300026088 | Bacteria | 915 |
| 623 | Ga0207641_11057882 | 3300026088 | Unclassified | 809 |
| 624 | Ga0207648_10001253 | 3300026089 | Bacteria | 28381 |
| 625 | Ga0207648_10031139 | 3300026089 | Bacteria | 4717 |
| 626 | Ga0207676_10019296 | 3300026095 | Bacteria | 4971 |
| 627 | Ga0207676_10156803 | 3300026095 | Bacteria | 1968 |
| 628 | Ga0207676_10433215 | 3300026095 | Unclassified | 1236 |
| 629 | Ga0207674_10020692 | 3300026116 | Bacteria | 7100 |
| 630 | Ga0207674_10025502 | 3300026116 | Bacteria | 6304 |
| 631 | Ga0207674_10027829 | 3300026116 | Bacteria | 5973 |
| 632 | Ga0207675_100008545 | 3300026118 | Bacteria | 9630 |
| 633 | Ga0207675_100147149 | 3300026118 | Bacteria | 2240 |
| 634 | Ga0207683_10000217 | 3300026121 | Bacteria | 50192 |
| 635 | Ga0207683_10028620 | 3300026121 | Bacteria | 4820 |
| 636 | Ga0207698_10057434 | 3300026142 | Bacteria | 3011 |
| 637 | Ga0207698_10102194 | 3300026142 | Bacteria | 2379 |
| 638 | Ga0207698_10249849 | 3300026142 | Bacteria | 1622 |
| 639 | Ga0265354_1004182 | 3300028016 | Bacteria | 1536 |
| 640 | Ga0265356_1000336 | 3300028017 | Bacteria | 8653 |
| 641 | Ga0265356_1010488 | 3300028017 | Bacteria | 1032 |
| 642 | Ga0265357_1018582 | 3300028023 | Unclassified | 751 |
| 643 | Ga0268266_10008412 | 3300028379 | Bacteria | 9174 |
| 644 | Ga0268266_10575144 | 3300028379 | Bacteria | 1081 |
| 645 | Ga0268266_10937589 | 3300028379 | Bacteria | 837 |
| 646 | Ga0268266_11726430 | 3300028379 | Unclassified | 601 |
| 647 | Ga0268265_10044706 | 3300028380 | Bacteria | 3300 |
| 648 | Ga0268265_10048037 | 3300028380 | Bacteria | 3201 |
| 649 | Ga0268265_10450156 | 3300028380 | Bacteria | 1202 |
| 650 | Ga0268264_10025038 | 3300028381 | Bacteria | 4876 |
| 651 | Ga0268264_10029486 | 3300028381 | Bacteria | 4494 |
| 652 | Ga0268264_10077395 | 3300028381 | Bacteria | 2833 |
| 653 | Ga0268264_10814500 | 3300028381 | Bacteria | 933 |
| 654 | Ga0265336_10044137 | 3300028666 | Unclassified | 1357 |
| 655 | Ga0265338_10010626 | 3300028800 | Bacteria | 10759 |
| 656 | Ga0265338_10012546 | 3300028800 | Bacteria | 9652 |
| 657 | Ga0265338_10173197 | 3300028800 | Unclassified | 1652 |
| 658 | Ga0265762_1002825 | 3300030760 | Bacteria | 3108 |
| 659 | Ga0265762_1013435 | 3300030760 | Bacteria | 1474 |
| 660 | Ga0265762_1020484 | 3300030760 | Bacteria | 1216 |
| 661 | Ga0265775_103190 | 3300030762 | Bacteria | 879 |
| 662 | Ga0265767_101478 | 3300030836 | Bacteria | 1159 |
| 663 | Ga0265770_1003844 | 3300030878 | Bacteria | 2043 |
| 664 | Ga0265770_1015093 | 3300030878 | Bacteria | 1172 |
| 665 | Ga0265770_1085108 | 3300030878 | Bacteria | 623 |
| 666 | Ga0265765_1009051 | 3300030879 | Bacteria | 1091 |
| 667 | Ga0265771_1003369 | 3300031010 | Bacteria | 916 |
| 668 | Ga0265760_10000331 | 3300031090 | Bacteria | 13250 |
| 669 | Ga0265760_10001481 | 3300031090 | Bacteria | 6917 |
| 670 | Ga0265760_10081793 | 3300031090 | Unclassified | 1001 |
| 671 | Ga0265760_10092507 | 3300031090 | Bacteria | 948 |
| 672 | Ga0265325_10010836 | 3300031241 | Bacteria | 5257 |
| 673 | Ga0265325_10086051 | 3300031241 | Bacteria | 1556 |
| 674 | Ga0265340_10078248 | 3300031247 | Bacteria | 1560 |
| 675 | Ga0265340_10160945 | 3300031247 | Bacteria | 1020 |
| 676 | Ga0265339_10015242 | 3300031249 | Bacteria | 4613 |
| 677 | Ga0265339_10068251 | 3300031249 | Bacteria | 1900 |
| 678 | Ga0265339_10161471 | 3300031249 | Bacteria | 1127 |
| 679 | Ga0265316_10019190 | 3300031344 | Bacteria | 5855 |
| 680 | Ga0265316_10568181 | 3300031344 | Unclassified | 806 |
| 681 | Ga0265314_10114275 | 3300031711 | Unclassified | 1710 |
| 682 | Ga0265342_10160925 | 3300031712 | Bacteria | 1241 |
| 683 | Ga0307416_100551502 | 3300032002 | Bacteria | 1226 |
| 684 | Ga0316214_1007710 | 3300033545 | Bacteria | 1441 |
| 685 | Ga0373930_0127190 | 3300034816 | Unclassified | 625 |
| 686 | Ga0373958_0017263 | 3300034819 | Bacteria | 1295 |
| 687 | Ga0373938_0015032 | 3300034957 | Bacteria | 1494 |
| 688 | Ga0373926_0028857 | 3300035083 | Bacteria | 1949 |
| 689 | Ga0373926_0042062 | 3300035083 | Bacteria | 1634 |
| 690 | Ga0373926_0145879 | 3300035083 | Bacteria | 900 |
| 691 | Ga0373934_0039992 | 3300035086 | Unclassified | 1849 |
| 692 | Ga0373944_0047625 | 3300035089 | Bacteria | 1343 |
| 693 | Ga0373944_0200346 | 3300035089 | Bacteria | 723 |
| 694 | Ga0373944_0245320 | 3300035089 | Bacteria | 660 |
| 695 | Ga0373923_0018059 | 3300035111 | Bacteria | 2708 |
| 696 | Ga0373932_0170061 | 3300035112 | Unclassified | 759 |
| 697 | Ga0373932_0212282 | 3300035112 | Bacteria | 692 |
| 698 | Ga0373936_0000966 | 3300035113 | Bacteria | 10244 |
| 699 | Ga0373936_0006441 | 3300035113 | Bacteria | 4428 |
| 700 | Ga0373953_0010005 | 3300035117 | Bacteria | 3287 |
| 701 | Ga0373954_0078263 | 3300035118 | Bacteria | 1577 |
| 702 | Ga0373956_0008841 | 3300035119 | Bacteria | 4080 |
| 703 | Ga0373956_0138998 | 3300035119 | Bacteria | 1140 |
| 704 | Ga0373957_0017150 | 3300035120 | Bacteria | 2517 |
| 705 | Ga0373957_0027426 | 3300035120 | Unclassified | 2069 |
| 706 | Ga0373957_0132135 | 3300035120 | Unclassified | 1017 |
| 707 | Ga0373960_0075450 | 3300035121 | Bacteria | 1051 |
| 708 | Ga0373943_0000054 | 3300035170 | Bacteria | 38966 |
| 709 | Ga0373943_0083341 | 3300035170 | Unclassified | 1643 |
| 710 | Ga0373946_0010120 | 3300035171 | Bacteria | 3487 |
| 711 | Ga0373955_0028331 | 3300035172 | Bacteria | 2902 |
| 712 | Ga0373955_0066887 | 3300035172 | Bacteria | 1999 |
| 713 | Ga0373955_0093625 | 3300035172 | Bacteria | 1716 |
| 714 | Ga0373955_0182572 | 3300035172 | Bacteria | 1245 |
| 715 | Ga0373924_0016533 | 3300035410 | Bacteria | 2816 |
| 716 | Ga0373924_0023333 | 3300035410 | Bacteria | 2426 |
| 717 | Ga0373931_0658721 | 3300035691 | Unclassified | 688 |
| 718 | Ga0373935_0004095 | 3300035692 | Bacteria | 8527 |
| 719 | Ga0373935_0022633 | 3300035692 | Bacteria | 3856 |
| 720 | Ga0373935_0031111 | 3300035692 | Bacteria | 3310 |
| 721 | Ga0373935_0116917 | 3300035692 | Bacteria | 1777 |
| 722 | Ga0373935_0151497 | 3300035692 | Bacteria | 1574 |
| 723 | Ga0373927_0082280 | 3300035695 | Bacteria | 2087 |
| 724 | Ga0373927_0136218 | 3300035695 | Bacteria | 1605 |
| 725 | Ga0373927_0273549 | 3300035695 | Bacteria | 1111 |
| 726 | Ga0373927_0275384 | 3300035695 | Bacteria | 1107 |
| 727 | Ga0373927_0293803 | 3300035695 | Unclassified | 1069 |
| 728 | Ga0373927_0463003 | 3300035695 | Unclassified | 838 |
| 729 | Ga0373927_0569314 | 3300035695 | Unclassified | 749 |
| 730 | Ga0373927_0908407 | 3300035695 | Unclassified | 581 |
| 731 | Ga0373933_0014246 | 3300035724 | Bacteria | 4418 |
| 732 | Ga0373933_0045238 | 3300035724 | Bacteria | 2610 |
| 733 | Ga0373933_0100682 | 3300035724 | Bacteria | 1793 |
| 734 | Ga0373933_0253078 | 3300035724 | Bacteria | 1134 |
| 735 | Ga0373933_0309111 | 3300035724 | Unclassified | 1024 |
| 736 | Ga0373933_0576410 | 3300035724 | Unclassified | 739 |
| 737 | Ga0373933_0828794 | 3300035724 | Unclassified | 609 |
| 738 | Ga0373947_0000496 | 3300035725 | Bacteria | 22749 |
| 739 | Ga0373947_0014673 | 3300035725 | Unclassified | 4494 |
| 740 | Ga0373947_0156647 | 3300035725 | Bacteria | 1470 |
| 741 | Ga0373937_0041215 | 3300036401 | Unclassified | 4212 |
| 742 | Ga0373937_0058242 | 3300036401 | Bacteria | 3549 |
| 743 | Ga0373937_0218937 | 3300036401 | Bacteria | 1792 |
| 744 | Ga0373937_0356387 | 3300036401 | Bacteria | 1386 |
| 745 | Ga0373937_0401786 | 3300036401 | Unclassified | 1300 |
| 746 | Ga0373937_0516119 | 3300036401 | Bacteria | 1135 |
| 747 | Ga0373937_0623515 | 3300036401 | Bacteria | 1023 |
| 748 | Ga0373937_0793375 | 3300036401 | Bacteria | 895 |
| 749 | Ga0373925_0003546 | 3300037068 | Bacteria | 12039 |
| 750 | Ga0373925_0018652 | 3300037068 | Bacteria | 5043 |
| 751 | Ga0373925_0141462 | 3300037068 | Bacteria | 1883 |
| 752 | Ga0373925_0234518 | 3300037068 | Bacteria | 1468 |
| 753 | Ga0373925_0239178 | 3300037068 | Unclassified | 1454 |
| 754 | Ga0373925_0542925 | 3300037068 | Bacteria | 956 |
| 755 | Ga0373925_0733739 | 3300037068 | Bacteria | 814 |
| 756 | Ga0395900_0930063 | 3300037418 | Bacteria | 792 |
| 757 | Ga0395905_0745593 | 3300037471 | Bacteria | 882 |
| 758 | Ga0436363_0310747 | 3300039450 | Unclassified | 811 |
| 759 | Ga0436363_0859048 | 3300039450 | Bacteria | 5706 |
| 760 | Ga0436363_1703454 | 3300039450 | Bacteria | 661 |
| 761 | Ga0436362_0242382 | 3300039453 | Bacteria | 2184 |
| 762 | Ga0466963_0510293 | 3300044694 | Bacteria | 849 |
| 763 | Ga0466964_0091790 | 3300044706 | Unclassified | 1323 |
| 764 | Ga0466964_0369952 | 3300044706 | Unclassified | 741 |
| 765 | Ga0466968_0362720 | 3300044735 | Unclassified | 705 |
| 766 | Ga0451576_0109127 | 3300045051 | Bacteria | 2880 |
| 767 | Ga0451576_2472999 | 3300045051 | Unclassified | 531 |
| 768 | Ga0466967_0075951 | 3300045976 | Bacteria | 3021 |
| 769 | Ga0466967_0274981 | 3300045976 | Unclassified | 1615 |
| 770 | Ga0495592_0651313 | 3300046454 | Unclassified | 638 |
| 771 | Ga0495603_0089785 | 3300046455 | Unclassified | 1798 |
| 772 | Ga0495629_0104434 | 3300046459 | Bacteria | 1976 |
| 773 | Ga0495629_0247385 | 3300046459 | Bacteria | 1227 |
| 774 | Ga0495651_0136996 | 3300046462 | Bacteria | 1780 |
| 775 | Ga0495580_0000031 | 3300046472 | Bacteria | 76248 |
| 776 | Ga0495580_0004216 | 3300046472 | Bacteria | 12090 |
| 777 | Ga0495580_0009626 | 3300046472 | Bacteria | 7588 |
| 778 | Ga0495580_0018579 | 3300046472 | Bacteria | 5174 |
| 779 | Ga0495580_0019658 | 3300046472 | Bacteria | 5015 |
| 780 | Ga0495580_0028922 | 3300046472 | Bacteria | 4026 |
| 781 | Ga0495580_0171239 | 3300046472 | Bacteria | 1501 |
| 782 | Ga0495580_0177389 | 3300046472 | Bacteria | 1472 |
| 783 | Ga0495580_0239685 | 3300046472 | Bacteria | 1244 |
| 784 | Ga0495580_0600474 | 3300046472 | Unclassified | 727 |
| 785 | Ga0495582_0015585 | 3300046473 | Bacteria | 4173 |
| 786 | Ga0495584_0018151 | 3300046491 | Bacteria | 3577 |
| 787 | Ga0495594_0030407 | 3300046499 | Bacteria | 2922 |
| 788 | Ga0495628_0476723 | 3300046516 | Bacteria | 903 |
| 789 | Ga0495630_0050881 | 3300046517 | Bacteria | 3100 |
| 790 | Ga0495630_0230553 | 3300046517 | Unclassified | 1415 |
| 791 | Ga0495630_0427477 | 3300046517 | Bacteria | 1015 |
| 792 | Ga0495630_0658930 | 3300046517 | Bacteria | 801 |
| 793 | Ga0495665_0025377 | 3300046531 | Bacteria | 3183 |
| 794 | Ga0495665_0192774 | 3300046531 | Bacteria | 1057 |
| 795 | Ga0495640_0240644 | 3300046533 | Bacteria | 1136 |
| 796 | Ga0495587_0604013 | 3300046536 | Unclassified | 604 |
| 797 | Ga0495645_0147033 | 3300046543 | Unclassified | 1641 |
| 798 | Ga0495645_0402031 | 3300046543 | Bacteria | 873 |
| 799 | Ga0495634_0388071 | 3300046642 | Unclassified | 831 |
| 800 | Ga0495635_0614387 | 3300046663 | Bacteria | 709 |
| 801 | Ga0495588_0052053 | 3300046674 | Bacteria | 2110 |
| 802 | Ga0495657_0204630 | 3300046675 | Bacteria | 1202 |
| 803 | Ga0495657_0654267 | 3300046675 | Unclassified | 606 |
| 804 | Ga0495623_0053862 | 3300046679 | Bacteria | 2540 |
| 805 | Ga0495647_0028580 | 3300046681 | Bacteria | 2057 |
| 806 | Ga0495669_0041066 | 3300046684 | Bacteria | 2053 |
| 807 | Ga0495669_0274918 | 3300046684 | Bacteria | 810 |
| 808 | Ga0495613_0122679 | 3300046689 | Bacteria | 1865 |
| 809 | Ga0495624_0086185 | 3300046690 | Bacteria | 1940 |
| 810 | Ga0495624_0580882 | 3300046690 | Unclassified | 668 |
| 811 | Ga0495600_0180149 | 3300046809 | Bacteria | 1362 |
| 812 | Ga0495600_0227709 | 3300046809 | Bacteria | 1191 |
| 813 | Ga0495674_0080360 | 3300047319 | Bacteria | 2798 |
| 814 | Ga0495674_0085250 | 3300047319 | Bacteria | 2706 |
| 815 | Ga0495593_0221085 | 3300047673 | Bacteria | 950 |
| 816 | Ga0495593_0289991 | 3300047673 | Bacteria | 818 |
| 817 | Ga0495602_0042006 | 3300048088 | Unclassified | 4169 |
| 818 | Ga0495602_0126933 | 3300048088 | Bacteria | 2042 |
| 819 | Ga0495602_0194576 | 3300048088 | Bacteria | 1552 |
| 820 | Ga0495602_0308844 | 3300048088 | Bacteria | 1155 |
| 821 | Ga0495602_0938898 | 3300048088 | Unclassified | 574 |
| 822 | Ga0496100_0009722 | 3300048903 | Bacteria | 5413 |
| 823 | Ga0496100_0668647 | 3300048903 | Bacteria | 809 |
| 824 | Ga0496100_0947093 | 3300048903 | Unclassified | 677 |
| 825 | Ga0496101_0019851 | 3300048904 | Bacteria | 4595 |
| 826 | Ga0496101_0029423 | 3300048904 | Bacteria | 3842 |
| 827 | Ga0496101_0178095 | 3300048904 | Bacteria | 1636 |
| 828 | Ga0496101_0210240 | 3300048904 | Bacteria | 1507 |
| 829 | Ga0496102_0001424 | 3300048905 | Bacteria | 21214 |
| 830 | Ga0496102_0032128 | 3300048905 | Unclassified | 4715 |
| 831 | Ga0496102_0092665 | 3300048905 | Bacteria | 2798 |
| 832 | Ga0496102_0116975 | 3300048905 | Bacteria | 2488 |
| 833 | Ga0496102_0153647 | 3300048905 | Unclassified | 2163 |
| 834 | Ga0496102_0322922 | 3300048905 | Bacteria | 1454 |
| 835 | Ga0496102_0586833 | 3300048905 | Bacteria | 1037 |
| 836 | Ga0496102_0852891 | 3300048905 | Bacteria | 833 |
| 837 | Ga0496102_1197648 | 3300048905 | Unclassified | 679 |
| 838 | Ga0496103_0004119 | 3300048906 | Bacteria | 8825 |
| 839 | Ga0496103_0022334 | 3300048906 | Unclassified | 3810 |
| 840 | Ga0496103_0137789 | 3300048906 | Bacteria | 1560 |
| 841 | Ga0496103_0160422 | 3300048906 | Bacteria | 1442 |
| 842 | Ga0496104_0157280 | 3300048907 | Bacteria | 2181 |
| 843 | Ga0496104_0172435 | 3300048907 | Unclassified | 2074 |
| 844 | Ga0496104_0220356 | 3300048907 | Bacteria | 1809 |
| 845 | Ga0496104_0315597 | 3300048907 | Bacteria | 1476 |
| 846 | Ga0496106_0056741 | 3300048909 | Bacteria | 2961 |
| 847 | Ga0496106_0068846 | 3300048909 | Bacteria | 2700 |
| 848 | Ga0496106_0083711 | 3300048909 | Bacteria | 2453 |
| 849 | Ga0496106_0181273 | 3300048909 | Bacteria | 1672 |
| 850 | Ga0496107_0052688 | 3300048910 | Bacteria | 2935 |
| 851 | Ga0496107_0069126 | 3300048910 | Bacteria | 2563 |
| 852 | Ga0496108_0020285 | 3300048911 | Bacteria | 5462 |
| 853 | Ga0496108_0043628 | 3300048911 | Bacteria | 3745 |
| 854 | Ga0496109_0000117 | 3300048912 | Bacteria | 82245 |
| 855 | Ga0496109_0054749 | 3300048912 | Bacteria | 3639 |
| 856 | Ga0496109_0106106 | 3300048912 | Bacteria | 2609 |
| 857 | Ga0496109_0446946 | 3300048912 | Bacteria | 1221 |
| 858 | Ga0496110_0004256 | 3300048913 | Bacteria | 11075 |
| 859 | Ga0496110_0012731 | 3300048913 | Bacteria | 6925 |
| 860 | Ga0496110_0115435 | 3300048913 | Bacteria | 2417 |
| 861 | Ga0496111_0009763 | 3300048914 | Bacteria | 6415 |
| 862 | Ga0496111_0076767 | 3300048914 | Bacteria | 2435 |
| 863 | Ga0496112_0000283 | 3300048915 | Bacteria | 32864 |
| 864 | Ga0496112_0069112 | 3300048915 | Bacteria | 3489 |
| 865 | Ga0496112_0081816 | 3300048915 | Bacteria | 3194 |
| 866 | Ga0496112_0114302 | 3300048915 | Bacteria | 2670 |
| 867 | Ga0496112_0249986 | 3300048915 | Bacteria | 1724 |
| 868 | Ga0496112_0341521 | 3300048915 | Unclassified | 1440 |
| 869 | Ga0496112_0610245 | 3300048915 | Unclassified | 1022 |
| 870 | Ga0496112_0756931 | 3300048915 | Unclassified | 897 |
| 871 | Ga0496112_1386136 | 3300048915 | Bacteria | 618 |
| 872 | Ga0496113_0002193 | 3300048916 | Bacteria | 11259 |
| 873 | Ga0496113_0024930 | 3300048916 | Unclassified | 4258 |
| 874 | Ga0496115_0003148 | 3300048918 | Bacteria | 11863 |
| 875 | Ga0496115_0009800 | 3300048918 | Bacteria | 7134 |
| 876 | Ga0496115_0191279 | 3300048918 | Bacteria | 1691 |
| 877 | nmdc:mga0n895_10187_c1 | 3300050512 | Bacteria | 8280 |
| 878 | nmdc:mga0n895_15801_c1 | 3300050512 | Bacteria | 6902 |
| 879 | nmdc:mga0n895_47_c1 | 3300050512 | Bacteria | 73703 |
| 880 | nmdc:mga0n895_539906_c1 | 3300050512 | Bacteria | 1172 |
| 881 | nmdc:mga0rr50_317270_c1 | 3300050513 | Bacteria | 1306 |
| 882 | nmdc:mga0rr50_421_c1 | 3300050513 | Bacteria | 22898 |
| 883 | nmdc:mga0rr50_71996_c1 | 3300050513 | Bacteria | 2639 |
| 884 | nmdc:mga0rr50_7786_c1 | 3300050513 | Bacteria | 6639 |
| 885 | nmdc:mga0rr50_839055_c1 | 3300050513 | Unclassified | 784 |
| 886 | nmdc:mga08x19_1461_c1 | 3300050514 | Bacteria | 14622 |
| 887 | nmdc:mga08x19_184697_c1 | 3300050514 | Bacteria | 1425 |
| 888 | nmdc:mga08x19_298231_c1 | 3300050514 | Bacteria | 1119 |
| 889 | nmdc:mga08x19_601136_c1 | 3300050514 | Bacteria | 779 |
| 890 | nmdc:mga08x19_751368_c1 | 3300050514 | Bacteria | 692 |
| 891 | nmdc:mga08x19_8169_c1 | 3300050514 | Bacteria | 6219 |
| 892 | nmdc:mga0a205_223264_c1 | 3300050515 | Unclassified | 1769 |
| 893 | nmdc:mga0a205_378_c1 | 3300050515 | Bacteria | 33792 |
| 894 | Ga0495601_0778046 | 3300053077 | Unclassified | 608 |
| 895 | Ga0495612_0349153 | 3300053078 | Unclassified | 668 |
| 896 | Ga0495612_0438881 | 3300053078 | Unclassified | 596 |
| 897 | Ga0495595_0053173 | 3300053084 | Bacteria | 1881 |
| 898 | Ga0495619_0075971 | 3300053085 | Bacteria | 2255 |
| 899 | Ga0495619_0197349 | 3300053085 | Bacteria | 1393 |
| 900 | Ga0495619_0739838 | 3300053085 | Unclassified | 667 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300048905 | Ga0496102_0852891 | Ga0496102_0852891_24_419 | 131 |
| 2 | 3300048912 | Ga0496109_0446946 | Ga0496109_0446946_74_469 | 131 |
| 3 | 3300030760 | Ga0265762_1013435 | Ga0265762_10134351 | 145 |
| 4 | 3300005437 | Ga0070710_10032513 | Ga0070710_100325133 | 146 |
| 5 | 3300025898 | Ga0207692_10068299 | Ga0207692_100682992 | 146 |
| 6 | 3300025906 | Ga0207699_10264602 | Ga0207699_102646022 | 146 |
| 7 | 3300031247 | Ga0265340_10160945 | Ga0265340_101609452 | 146 |
| 8 | 3300031249 | Ga0265339_10068251 | Ga0265339_100682512 | 146 |
| 9 | 3300031711 | Ga0265314_10114275 | Ga0265314_101142752 | 146 |
| 10 | 3300053085 | Ga0495619_0739838 | Ga0495619_0739838_93_560 | 155 |
| 11 | 3300007265 | Ga0099794_10008610 | Ga0099794_100086104 | 158 |
| 12 | 3300050513 | nmdc:mga0rr50_317270_c1 | nmdc:mga0rr50_317270_c1_654_1130 | 158 |
| 13 | 3300050514 | nmdc:mga08x19_8169_c1 | nmdc:mga08x19_8169_c1_836_1312 | 158 |
| 14 | 3300046663 | Ga0495635_0614387 | Ga0495635_0614387_115_597 | 159 |
| 15 | 3300005336 | Ga0070680_101260006 | Ga0070680_1012600061 | 160 |
| 16 | 3300005434 | Ga0070709_10011458 | Ga0070709_100114585 | 160 |
| 17 | 3300005435 | Ga0070714_100046805 | Ga0070714_1000468054 | 160 |
| 18 | 3300005436 | Ga0070713_100567926 | Ga0070713_1005679261 | 160 |
| 19 | 3300005437 | Ga0070710_10362018 | Ga0070710_103620182 | 160 |
| 20 | 3300005439 | Ga0070711_100017979 | Ga0070711_1000179791 | 160 |
| 21 | 3300005458 | Ga0070681_10723022 | Ga0070681_107230221 | 160 |
| 22 | 3300005518 | Ga0070699_100096093 | Ga0070699_1000960933 | 160 |
| 23 | 3300005518 | Ga0070699_100158928 | Ga0070699_1001589282 | 160 |
| 24 | 3300005530 | Ga0070679_100322810 | Ga0070679_1003228102 | 160 |
| 25 | 3300006028 | Ga0070717_10146046 | Ga0070717_101460461 | 160 |
| 26 | 3300006173 | Ga0070716_100530529 | Ga0070716_1005305292 | 160 |
| 27 | 3300006175 | Ga0070712_100635624 | Ga0070712_1006356241 | 160 |
| 28 | 3300006914 | Ga0075436_100000526 | Ga0075436_1000005269 | 160 |
| 29 | 3300006914 | Ga0075436_100016670 | Ga0075436_1000166704 | 160 |
| 30 | 3300006914 | Ga0075436_100070745 | Ga0075436_1000707453 | 160 |
| 31 | 3300007076 | Ga0075435_100347524 | Ga0075435_1003475242 | 160 |
| 32 | 3300009093 | Ga0105240_10263184 | Ga0105240_102631841 | 160 |
| 33 | 3300025906 | Ga0207699_10020214 | Ga0207699_100202144 | 160 |
| 34 | 3300025912 | Ga0207707_10470183 | Ga0207707_104701832 | 160 |
| 35 | 3300025913 | Ga0207695_10905542 | Ga0207695_109055422 | 160 |
| 36 | 3300025915 | Ga0207693_10761346 | Ga0207693_107613461 | 160 |
| 37 | 3300025916 | Ga0207663_10085695 | Ga0207663_100856953 | 160 |
| 38 | 3300025917 | Ga0207660_10761743 | Ga0207660_107617431 | 160 |
| 39 | 3300025929 | Ga0207664_10022203 | Ga0207664_100222031 | 160 |
| 40 | 3300044706 | Ga0466964_0091790 | Ga0466964_0091790_599_1081 | 160 |
| 41 | 3300045976 | Ga0466967_0274981 | Ga0466967_0274981_847_1329 | 160 |
| 42 | 3300048905 | Ga0496102_0322922 | Ga0496102_0322922_870_1352 | 160 |
| 43 | 3300050514 | nmdc:mga08x19_184697_c1 | nmdc:mga08x19_184697_c1_484_966 | 160 |
| 44 | 3300050514 | nmdc:mga08x19_298231_c1 | nmdc:mga08x19_298231_c1_594_1076 | 160 |
| 45 | 3300005434 | Ga0070709_10076982 | Ga0070709_100769822 | 161 |
| 46 | 3300005435 | Ga0070714_100688409 | Ga0070714_1006884092 | 161 |
| 47 | 3300005436 | Ga0070713_100446898 | Ga0070713_1004468981 | 161 |
| 48 | 3300005437 | Ga0070710_10109687 | Ga0070710_101096872 | 161 |
| 49 | 3300005439 | Ga0070711_100140575 | Ga0070711_1001405752 | 161 |
| 50 | 3300005518 | Ga0070699_100625638 | Ga0070699_1006256381 | 161 |
| 51 | 3300006028 | Ga0070717_10224306 | Ga0070717_102243063 | 161 |
| 52 | 3300006175 | Ga0070712_100709718 | Ga0070712_1007097182 | 161 |
| 53 | 3300006358 | Ga0068871_100040074 | Ga0068871_1000400742 | 161 |
| 54 | 3300025916 | Ga0207663_10124631 | Ga0207663_101246312 | 161 |
| 55 | 3300025929 | Ga0207664_10550611 | Ga0207664_105506111 | 161 |
| 56 | 3300026078 | Ga0207702_10622993 | Ga0207702_106229932 | 161 |
| 57 | 3300032002 | Ga0307416_100551502 | Ga0307416_1005515022 | 161 |
| 58 | 3300035113 | Ga0373936_0006441 | Ga0373936_0006441_2059_2544 | 161 |
| 59 | 3300035695 | Ga0373927_0136218 | Ga0373927_0136218_128_613 | 161 |
| 60 | 3300035725 | Ga0373947_0156647 | Ga0373947_0156647_894_1379 | 161 |
| 61 | 3300037068 | Ga0373925_0234518 | Ga0373925_0234518_348_833 | 161 |
| 62 | 3300044694 | Ga0466963_0510293 | Ga0466963_0510293_75_560 | 161 |
| 63 | 3300046472 | Ga0495580_0600474 | Ga0495580_0600474_138_623 | 161 |
| 64 | 3300048907 | Ga0496104_0172435 | Ga0496104_0172435_148_633 | 161 |
| 65 | 3300048915 | Ga0496112_0341521 | Ga0496112_0341521_845_1330 | 161 |
| 66 | 3300005434 | Ga0070709_10876434 | Ga0070709_108764341 | 162 |
| 67 | 3300005435 | Ga0070714_100084131 | Ga0070714_1000841312 | 162 |
| 68 | 3300005436 | Ga0070713_100230160 | Ga0070713_1002301602 | 162 |
| 69 | 3300005437 | Ga0070710_10782788 | Ga0070710_107827882 | 162 |
| 70 | 3300006028 | Ga0070717_10000612 | Ga0070717_100006122 | 162 |
| 71 | 3300006028 | Ga0070717_10252654 | Ga0070717_102526543 | 162 |
| 72 | 3300006028 | Ga0070717_10743396 | Ga0070717_107433962 | 162 |
| 73 | 3300009093 | Ga0105240_10256517 | Ga0105240_102565173 | 162 |
| 74 | 3300009093 | Ga0105240_10593662 | Ga0105240_105936623 | 162 |
| 75 | 3300009545 | Ga0105237_11087867 | Ga0105237_110878671 | 162 |
| 76 | 3300013104 | Ga0157370_10677144 | Ga0157370_106771442 | 162 |
| 77 | 3300013105 | Ga0157369_10119587 | Ga0157369_101195873 | 162 |
| 78 | 3300013307 | Ga0157372_10015214 | Ga0157372_100152142 | 162 |
| 79 | 3300013307 | Ga0157372_10242027 | Ga0157372_102420272 | 162 |
| 80 | 3300013307 | Ga0157372_10428455 | Ga0157372_104284552 | 162 |
| 81 | 3300015262 | Ga0182007_10103770 | Ga0182007_101037702 | 162 |
| 82 | 3300025898 | Ga0207692_10391074 | Ga0207692_103910742 | 162 |
| 83 | 3300025906 | Ga0207699_10656955 | Ga0207699_106569552 | 162 |
| 84 | 3300025913 | Ga0207695_10027763 | Ga0207695_100277635 | 162 |
| 85 | 3300025913 | Ga0207695_10064718 | Ga0207695_100647184 | 162 |
| 86 | 3300025914 | Ga0207671_10537801 | Ga0207671_105378012 | 162 |
| 87 | 3300025928 | Ga0207700_10030601 | Ga0207700_100306014 | 162 |
| 88 | 3300025929 | Ga0207664_10191181 | Ga0207664_101911813 | 162 |
| 89 | 3300025929 | Ga0207664_10650565 | Ga0207664_106505652 | 162 |
| 90 | 3300025949 | Ga0207667_11555893 | Ga0207667_115558932 | 162 |
| 91 | 3300026088 | Ga0207641_10233097 | Ga0207641_102330972 | 162 |
| 92 | 3300035119 | Ga0373956_0138998 | Ga0373956_0138998_177_665 | 162 |
| 93 | 3300035120 | Ga0373957_0132135 | Ga0373957_0132135_158_646 | 162 |
| 94 | 3300035692 | Ga0373935_0022633 | Ga0373935_0022633_2285_2773 | 162 |
| 95 | 3300035724 | Ga0373933_0309111 | Ga0373933_0309111_156_644 | 162 |
| 96 | 3300037418 | Ga0395900_0930063 | Ga0395900_0930063_222_710 | 162 |
| 97 | 3300046684 | Ga0495669_0041066 | Ga0495669_0041066_1072_1560 | 162 |
| 98 | 3300048088 | Ga0495602_0938898 | Ga0495602_0938898_33_521 | 162 |
| 99 | 3300048915 | Ga0496112_0081816 | Ga0496112_0081816_887_1375 | 162 |
| 100 | 3300005435 | Ga0070714_100726817 | Ga0070714_1007268172 | 163 |
| 101 | 3300005614 | Ga0068856_100060970 | Ga0068856_1000609702 | 163 |
| 102 | 3300006173 | Ga0070716_100120575 | Ga0070716_1001205752 | 163 |
| 103 | 3300006175 | Ga0070712_100505911 | Ga0070712_1005059112 | 163 |
| 104 | 3300006237 | Ga0097621_100327422 | Ga0097621_1003274221 | 163 |
| 105 | 3300007265 | Ga0099794_10236851 | Ga0099794_102368512 | 163 |
| 106 | 3300009093 | Ga0105240_10181112 | Ga0105240_101811123 | 163 |
| 107 | 3300009174 | Ga0105241_10000916 | Ga0105241_100009163 | 163 |
| 108 | 3300013100 | Ga0157373_10000288 | Ga0157373_1000028832 | 163 |
| 109 | 3300013104 | Ga0157370_10045720 | Ga0157370_100457203 | 163 |
| 110 | 3300013105 | Ga0157369_10008623 | Ga0157369_100086232 | 163 |
| 111 | 3300013296 | Ga0157374_10186316 | Ga0157374_101863162 | 163 |
| 112 | 3300013307 | Ga0157372_10015183 | Ga0157372_100151832 | 163 |
| 113 | 3300025911 | Ga0207654_10006062 | Ga0207654_100060623 | 163 |
| 114 | 3300025913 | Ga0207695_10307560 | Ga0207695_103075601 | 163 |
| 115 | 3300025945 | Ga0207679_10192010 | Ga0207679_101920101 | 163 |
| 116 | 3300025981 | Ga0207640_10154868 | Ga0207640_101548681 | 163 |
| 117 | 3300026078 | Ga0207702_10002571 | Ga0207702_1000257113 | 163 |
| 118 | 3300035121 | Ga0373960_0075450 | Ga0373960_0075450_160_651 | 163 |
| 119 | 3300035695 | Ga0373927_0908407 | Ga0373927_0908407_26_517 | 163 |
| 120 | 3300037068 | Ga0373925_0733739 | Ga0373925_0733739_46_537 | 163 |
| 121 | 3300044735 | Ga0466968_0362720 | Ga0466968_0362720_79_570 | 163 |
| 122 | 3300048915 | Ga0496112_0069112 | Ga0496112_0069112_2053_2544 | 163 |
| 123 | 3300005434 | Ga0070709_10687645 | Ga0070709_106876451 | 164 |
| 124 | 3300005436 | Ga0070713_100413481 | Ga0070713_1004134813 | 164 |
| 125 | 3300005436 | Ga0070713_100444628 | Ga0070713_1004446281 | 164 |
| 126 | 3300005439 | Ga0070711_100099388 | Ga0070711_1000993882 | 164 |
| 127 | 3300005445 | Ga0070708_100095844 | Ga0070708_1000958444 | 164 |
| 128 | 3300005518 | Ga0070699_100752106 | Ga0070699_1007521061 | 164 |
| 129 | 3300005536 | Ga0070697_100024244 | Ga0070697_1000242443 | 164 |
| 130 | 3300006175 | Ga0070712_100061623 | Ga0070712_1000616232 | 164 |
| 131 | 3300009093 | Ga0105240_11617565 | Ga0105240_116175651 | 164 |
| 132 | 3300009147 | Ga0114129_11407360 | Ga0114129_114073602 | 164 |
| 133 | 3300009177 | Ga0105248_10010789 | Ga0105248_100107892 | 164 |
| 134 | 3300009545 | Ga0105237_10062864 | Ga0105237_100628642 | 164 |
| 135 | 3300009553 | Ga0105249_11371650 | Ga0105249_113716501 | 164 |
| 136 | 3300013104 | Ga0157370_10085697 | Ga0157370_100856973 | 164 |
| 137 | 3300013105 | Ga0157369_10102365 | Ga0157369_101023653 | 164 |
| 138 | 3300013296 | Ga0157374_10014241 | Ga0157374_100142417 | 164 |
| 139 | 3300013307 | Ga0157372_11143669 | Ga0157372_111436691 | 164 |
| 140 | 3300014497 | Ga0182008_10019449 | Ga0182008_100194492 | 164 |
| 141 | 3300021377 | Ga0213874_10090537 | Ga0213874_100905372 | 164 |
| 142 | 3300025906 | Ga0207699_10446256 | Ga0207699_104462561 | 164 |
| 143 | 3300025915 | Ga0207693_10075950 | Ga0207693_100759504 | 164 |
| 144 | 3300025916 | Ga0207663_10079355 | Ga0207663_100793552 | 164 |
| 145 | 3300025922 | Ga0207646_10272895 | Ga0207646_102728953 | 164 |
| 146 | 3300025928 | Ga0207700_10153261 | Ga0207700_101532612 | 164 |
| 147 | 3300025928 | Ga0207700_10618550 | Ga0207700_106185502 | 164 |
| 148 | 3300035120 | Ga0373957_0027426 | Ga0373957_0027426_1263_1757 | 164 |
| 149 | 3300035172 | Ga0373955_0093625 | Ga0373955_0093625_793_1287 | 164 |
| 150 | 3300035695 | Ga0373927_0293803 | Ga0373927_0293803_238_732 | 164 |
| 151 | 3300035724 | Ga0373933_0045238 | Ga0373933_0045238_2101_2595 | 164 |
| 152 | 3300036401 | Ga0373937_0041215 | Ga0373937_0041215_59_553 | 164 |
| 153 | 3300036401 | Ga0373937_0356387 | Ga0373937_0356387_771_1265 | 164 |
| 154 | 3300037068 | Ga0373925_0003546 | Ga0373925_0003546_3846_4340 | 164 |
| 155 | 3300039450 | Ga0436363_0859048 | Ga0436363_0859048_4353_4847 | 164 |
| 156 | 3300046462 | Ga0495651_0136996 | Ga0495651_0136996_555_1049 | 164 |
| 157 | 3300046536 | Ga0495587_0604013 | Ga0495587_0604013_85_579 | 164 |
| 158 | 3300046543 | Ga0495645_0402031 | Ga0495645_0402031_117_611 | 164 |
| 159 | 3300048088 | Ga0495602_0042006 | Ga0495602_0042006_2440_2934 | 164 |
| 160 | 3300050512 | nmdc:mga0n895_47_c1 | nmdc:mga0n895_47_c1_64330_64824 | 164 |
| 161 | 3300050513 | nmdc:mga0rr50_421_c1 | nmdc:mga0rr50_421_c1_1858_2352 | 164 |
| 162 | 3300050514 | nmdc:mga08x19_1461_c1 | nmdc:mga08x19_1461_c1_1355_1849 | 164 |
| 163 | 3300050515 | nmdc:mga0a205_378_c1 | nmdc:mga0a205_378_c1_19055_19549 | 164 |
| 164 | 3300053077 | Ga0495601_0778046 | Ga0495601_0778046_40_534 | 164 |
| 165 | 3300053078 | Ga0495612_0349153 | Ga0495612_0349153_22_516 | 164 |
| 166 | 3300000546 | LJNas_1000607 | LJNas_10006075 | 165 |
| 167 | 3300005434 | Ga0070709_10001876 | Ga0070709_100018762 | 165 |
| 168 | 3300005434 | Ga0070709_10006738 | Ga0070709_100067382 | 165 |
| 169 | 3300005435 | Ga0070714_100000172 | Ga0070714_10000017211 | 165 |
| 170 | 3300005435 | Ga0070714_100310781 | Ga0070714_1003107812 | 165 |
| 171 | 3300005435 | Ga0070714_100371348 | Ga0070714_1003713481 | 165 |
| 172 | 3300005436 | Ga0070713_100000342 | Ga0070713_10000034213 | 165 |
| 173 | 3300005436 | Ga0070713_100000449 | Ga0070713_1000004497 | 165 |
| 174 | 3300005436 | Ga0070713_100000510 | Ga0070713_1000005101 | 165 |
| 175 | 3300005436 | Ga0070713_100013833 | Ga0070713_1000138335 | 165 |
| 176 | 3300005436 | Ga0070713_100045317 | Ga0070713_1000453172 | 165 |
| 177 | 3300005436 | Ga0070713_100101831 | Ga0070713_1001018313 | 165 |
| 178 | 3300005436 | Ga0070713_100144760 | Ga0070713_1001447602 | 165 |
| 179 | 3300005436 | Ga0070713_100198026 | Ga0070713_1001980263 | 165 |
| 180 | 3300005436 | Ga0070713_100530247 | Ga0070713_1005302472 | 165 |
| 181 | 3300005437 | Ga0070710_10119208 | Ga0070710_101192082 | 165 |
| 182 | 3300005437 | Ga0070710_10309313 | Ga0070710_103093132 | 165 |
| 183 | 3300005437 | Ga0070710_10394409 | Ga0070710_103944092 | 165 |
| 184 | 3300005439 | Ga0070711_100000099 | Ga0070711_10000009940 | 165 |
| 185 | 3300005439 | Ga0070711_100072690 | Ga0070711_1000726902 | 165 |
| 186 | 3300005439 | Ga0070711_100610301 | Ga0070711_1006103012 | 165 |
| 187 | 3300005439 | Ga0070711_100746168 | Ga0070711_1007461681 | 165 |
| 188 | 3300005445 | Ga0070708_100001401 | Ga0070708_10000140114 | 165 |
| 189 | 3300005445 | Ga0070708_100002020 | Ga0070708_10000202012 | 165 |
| 190 | 3300005445 | Ga0070708_100044658 | Ga0070708_1000446583 | 165 |
| 191 | 3300005445 | Ga0070708_100163052 | Ga0070708_1001630523 | 165 |
| 192 | 3300005445 | Ga0070708_100164013 | Ga0070708_1001640132 | 165 |
| 193 | 3300005445 | Ga0070708_100962316 | Ga0070708_1009623162 | 165 |
| 194 | 3300005458 | Ga0070681_10570204 | Ga0070681_105702041 | 165 |
| 195 | 3300005467 | Ga0070706_100013420 | Ga0070706_1000134207 | 165 |
| 196 | 3300005467 | Ga0070706_100060551 | Ga0070706_1000605511 | 165 |
| 197 | 3300005467 | Ga0070706_100511527 | Ga0070706_1005115272 | 165 |
| 198 | 3300005467 | Ga0070706_100538555 | Ga0070706_1005385552 | 165 |
| 199 | 3300005468 | Ga0070707_100002543 | Ga0070707_10000254315 | 165 |
| 200 | 3300005468 | Ga0070707_100057506 | Ga0070707_1000575062 | 165 |
| 201 | 3300005468 | Ga0070707_100297759 | Ga0070707_1002977592 | 165 |
| 202 | 3300005471 | Ga0070698_100007167 | Ga0070698_1000071679 | 165 |
| 203 | 3300005471 | Ga0070698_100128893 | Ga0070698_1001288931 | 165 |
| 204 | 3300005471 | Ga0070698_100136048 | Ga0070698_1001360482 | 165 |
| 205 | 3300005518 | Ga0070699_100001096 | Ga0070699_1000010967 | 165 |
| 206 | 3300005518 | Ga0070699_100048438 | Ga0070699_1000484383 | 165 |
| 207 | 3300005535 | Ga0070684_100820120 | Ga0070684_1008201202 | 165 |
| 208 | 3300005536 | Ga0070697_100002639 | Ga0070697_1000026397 | 165 |
| 209 | 3300005536 | Ga0070697_100212204 | Ga0070697_1002122042 | 165 |
| 210 | 3300005563 | Ga0068855_100826772 | Ga0068855_1008267721 | 165 |
| 211 | 3300005614 | Ga0068856_100019084 | Ga0068856_1000190845 | 165 |
| 212 | 3300006028 | Ga0070717_10000837 | Ga0070717_100008377 | 165 |
| 213 | 3300006028 | Ga0070717_10001449 | Ga0070717_100014499 | 165 |
| 214 | 3300006028 | Ga0070717_10005741 | Ga0070717_100057416 | 165 |
| 215 | 3300006028 | Ga0070717_10024145 | Ga0070717_100241455 | 165 |
| 216 | 3300006028 | Ga0070717_10045843 | Ga0070717_100458433 | 165 |
| 217 | 3300006028 | Ga0070717_10137148 | Ga0070717_101371482 | 165 |
| 218 | 3300006028 | Ga0070717_10147941 | Ga0070717_101479413 | 165 |
| 219 | 3300006028 | Ga0070717_10496403 | Ga0070717_104964032 | 165 |
| 220 | 3300006163 | Ga0070715_10095244 | Ga0070715_100952444 | 165 |
| 221 | 3300006173 | Ga0070716_100002096 | Ga0070716_1000020964 | 165 |
| 222 | 3300006173 | Ga0070716_100037106 | Ga0070716_1000371063 | 165 |
| 223 | 3300006173 | Ga0070716_100042111 | Ga0070716_1000421114 | 165 |
| 224 | 3300006173 | Ga0070716_100097798 | Ga0070716_1000977982 | 165 |
| 225 | 3300006173 | Ga0070716_100191504 | Ga0070716_1001915041 | 165 |
| 226 | 3300006173 | Ga0070716_100449359 | Ga0070716_1004493592 | 165 |
| 227 | 3300006173 | Ga0070716_100880373 | Ga0070716_1008803731 | 165 |
| 228 | 3300006175 | Ga0070712_100000546 | Ga0070712_10000054615 | 165 |
| 229 | 3300006175 | Ga0070712_100003075 | Ga0070712_1000030756 | 165 |
| 230 | 3300006175 | Ga0070712_100005278 | Ga0070712_1000052781 | 165 |
| 231 | 3300006175 | Ga0070712_100233313 | Ga0070712_1002333132 | 165 |
| 232 | 3300006175 | Ga0070712_100464965 | Ga0070712_1004649652 | 165 |
| 233 | 3300006871 | Ga0075434_100002766 | Ga0075434_10000276612 | 165 |
| 234 | 3300006914 | Ga0075436_100277786 | Ga0075436_1002777861 | 165 |
| 235 | 3300006914 | Ga0075436_100734257 | Ga0075436_1007342571 | 165 |
| 236 | 3300007076 | Ga0075435_100037240 | Ga0075435_1000372404 | 165 |
| 237 | 3300007265 | Ga0099794_10111802 | Ga0099794_101118023 | 165 |
| 238 | 3300007788 | Ga0099795_10036881 | Ga0099795_100368812 | 165 |
| 239 | 3300007788 | Ga0099795_10101684 | Ga0099795_101016842 | 165 |
| 240 | 3300009174 | Ga0105241_10328554 | Ga0105241_103285542 | 165 |
| 241 | 3300009545 | Ga0105237_11755320 | Ga0105237_117553202 | 165 |
| 242 | 3300010375 | Ga0105239_12520334 | Ga0105239_125203341 | 165 |
| 243 | 3300011119 | Ga0105246_11729674 | Ga0105246_117296741 | 165 |
| 244 | 3300013100 | Ga0157373_10207528 | Ga0157373_102075282 | 165 |
| 245 | 3300013307 | Ga0157372_10076790 | Ga0157372_100767903 | 165 |
| 246 | 3300013307 | Ga0157372_10933286 | Ga0157372_109332861 | 165 |
| 247 | 3300014969 | Ga0157376_10397162 | Ga0157376_103971621 | 165 |
| 248 | 3300019181 | Ga0184594_100472 | Ga0184594_1004722 | 165 |
| 249 | 3300021358 | Ga0213873_10136317 | Ga0213873_101363171 | 165 |
| 250 | 3300022730 | Ga0224570_100064 | Ga0224570_1000643 | 165 |
| 251 | 3300022732 | Ga0224569_100403 | Ga0224569_1004032 | 165 |
| 252 | 3300022734 | Ga0224571_102100 | Ga0224571_1021003 | 165 |
| 253 | 3300024225 | Ga0224572_1005998 | Ga0224572_10059982 | 165 |
| 254 | 3300024225 | Ga0224572_1018321 | Ga0224572_10183211 | 165 |
| 255 | 3300024227 | Ga0228598_1000222 | Ga0228598_10002228 | 165 |
| 256 | 3300024227 | Ga0228598_1000816 | Ga0228598_10008165 | 165 |
| 257 | 3300024227 | Ga0228598_1027302 | Ga0228598_10273021 | 165 |
| 258 | 3300025898 | Ga0207692_10006597 | Ga0207692_100065974 | 165 |
| 259 | 3300025898 | Ga0207692_10089120 | Ga0207692_100891202 | 165 |
| 260 | 3300025898 | Ga0207692_10325901 | Ga0207692_103259012 | 165 |
| 261 | 3300025906 | Ga0207699_10001324 | Ga0207699_100013249 | 165 |
| 262 | 3300025906 | Ga0207699_10058713 | Ga0207699_100587131 | 165 |
| 263 | 3300025906 | Ga0207699_10061138 | Ga0207699_100611381 | 165 |
| 264 | 3300025906 | Ga0207699_10767960 | Ga0207699_107679601 | 165 |
| 265 | 3300025910 | Ga0207684_10000217 | Ga0207684_1000021767 | 165 |
| 266 | 3300025910 | Ga0207684_10498628 | Ga0207684_104986282 | 165 |
| 267 | 3300025910 | Ga0207684_10779951 | Ga0207684_107799512 | 165 |
| 268 | 3300025911 | Ga0207654_10246661 | Ga0207654_102466611 | 165 |
| 269 | 3300025912 | Ga0207707_10510704 | Ga0207707_105107041 | 165 |
| 270 | 3300025913 | Ga0207695_10545532 | Ga0207695_105455321 | 165 |
| 271 | 3300025915 | Ga0207693_10000089 | Ga0207693_1000008957 | 165 |
| 272 | 3300025915 | Ga0207693_10000106 | Ga0207693_1000010616 | 165 |
| 273 | 3300025915 | Ga0207693_10009582 | Ga0207693_100095821 | 165 |
| 274 | 3300025915 | Ga0207693_10209793 | Ga0207693_102097931 | 165 |
| 275 | 3300025915 | Ga0207693_10286481 | Ga0207693_102864812 | 165 |
| 276 | 3300025915 | Ga0207693_10374723 | Ga0207693_103747232 | 165 |
| 277 | 3300025916 | Ga0207663_10320556 | Ga0207663_103205562 | 165 |
| 278 | 3300025916 | Ga0207663_10788727 | Ga0207663_107887272 | 165 |
| 279 | 3300025921 | Ga0207652_10144604 | Ga0207652_101446041 | 165 |
| 280 | 3300025922 | Ga0207646_10001311 | Ga0207646_1000131130 | 165 |
| 281 | 3300025922 | Ga0207646_10209420 | Ga0207646_102094201 | 165 |
| 282 | 3300025922 | Ga0207646_10300814 | Ga0207646_103008141 | 165 |
| 283 | 3300025924 | Ga0207694_10182398 | Ga0207694_101823982 | 165 |
| 284 | 3300025928 | Ga0207700_10000289 | Ga0207700_1000028915 | 165 |
| 285 | 3300025928 | Ga0207700_10000888 | Ga0207700_100008884 | 165 |
| 286 | 3300025928 | Ga0207700_10025835 | Ga0207700_100258354 | 165 |
| 287 | 3300025928 | Ga0207700_10077108 | Ga0207700_100771082 | 165 |
| 288 | 3300025928 | Ga0207700_10161029 | Ga0207700_101610293 | 165 |
| 289 | 3300025928 | Ga0207700_10255286 | Ga0207700_102552862 | 165 |
| 290 | 3300025928 | Ga0207700_10263812 | Ga0207700_102638123 | 165 |
| 291 | 3300025928 | Ga0207700_10657352 | Ga0207700_106573521 | 165 |
| 292 | 3300025929 | Ga0207664_10000118 | Ga0207664_1000011848 | 165 |
| 293 | 3300025929 | Ga0207664_10141500 | Ga0207664_101415003 | 165 |
| 294 | 3300025929 | Ga0207664_10234103 | Ga0207664_102341032 | 165 |
| 295 | 3300025929 | Ga0207664_10320035 | Ga0207664_103200352 | 165 |
| 296 | 3300025929 | Ga0207664_10332482 | Ga0207664_103324822 | 165 |
| 297 | 3300025939 | Ga0207665_10001480 | Ga0207665_100014804 | 165 |
| 298 | 3300025939 | Ga0207665_10001526 | Ga0207665_100015263 | 165 |
| 299 | 3300025939 | Ga0207665_10044443 | Ga0207665_100444434 | 165 |
| 300 | 3300025939 | Ga0207665_10079547 | Ga0207665_100795473 | 165 |
| 301 | 3300025939 | Ga0207665_10138043 | Ga0207665_101380431 | 165 |
| 302 | 3300025939 | Ga0207665_10255058 | Ga0207665_102550582 | 165 |
| 303 | 3300026078 | Ga0207702_10023735 | Ga0207702_100237353 | 165 |
| 304 | 3300026078 | Ga0207702_10627342 | Ga0207702_106273422 | 165 |
| 305 | 3300028017 | Ga0265356_1000336 | Ga0265356_10003367 | 165 |
| 306 | 3300028017 | Ga0265356_1010488 | Ga0265356_10104882 | 165 |
| 307 | 3300028023 | Ga0265357_1018582 | Ga0265357_10185822 | 165 |
| 308 | 3300028666 | Ga0265336_10044137 | Ga0265336_100441373 | 165 |
| 309 | 3300028800 | Ga0265338_10010626 | Ga0265338_100106268 | 165 |
| 310 | 3300028800 | Ga0265338_10012546 | Ga0265338_100125463 | 165 |
| 311 | 3300028800 | Ga0265338_10173197 | Ga0265338_101731971 | 165 |
| 312 | 3300030760 | Ga0265762_1002825 | Ga0265762_10028252 | 165 |
| 313 | 3300030760 | Ga0265762_1020484 | Ga0265762_10204842 | 165 |
| 314 | 3300030762 | Ga0265775_103190 | Ga0265775_1031901 | 165 |
| 315 | 3300030836 | Ga0265767_101478 | Ga0265767_1014782 | 165 |
| 316 | 3300030878 | Ga0265770_1085108 | Ga0265770_10851081 | 165 |
| 317 | 3300031010 | Ga0265771_1003369 | Ga0265771_10033691 | 165 |
| 318 | 3300031090 | Ga0265760_10001481 | Ga0265760_100014817 | 165 |
| 319 | 3300031090 | Ga0265760_10081793 | Ga0265760_100817932 | 165 |
| 320 | 3300031241 | Ga0265325_10010836 | Ga0265325_100108362 | 165 |
| 321 | 3300031241 | Ga0265325_10086051 | Ga0265325_100860511 | 165 |
| 322 | 3300031247 | Ga0265340_10078248 | Ga0265340_100782483 | 165 |
| 323 | 3300031249 | Ga0265339_10015242 | Ga0265339_100152423 | 165 |
| 324 | 3300031249 | Ga0265339_10161471 | Ga0265339_101614711 | 165 |
| 325 | 3300031344 | Ga0265316_10019190 | Ga0265316_100191905 | 165 |
| 326 | 3300031344 | Ga0265316_10568181 | Ga0265316_105681811 | 165 |
| 327 | 3300031712 | Ga0265342_10160925 | Ga0265342_101609253 | 165 |
| 328 | 3300033545 | Ga0316214_1007710 | Ga0316214_10077103 | 165 |
| 329 | 3300035083 | Ga0373926_0028857 | Ga0373926_0028857_326_823 | 165 |
| 330 | 3300035083 | Ga0373926_0042062 | Ga0373926_0042062_97_621 | 165 |
| 331 | 3300035083 | Ga0373926_0145879 | Ga0373926_0145879_279_776 | 165 |
| 332 | 3300035086 | Ga0373934_0039992 | Ga0373934_0039992_85_582 | 165 |
| 333 | 3300035089 | Ga0373944_0047625 | Ga0373944_0047625_154_651 | 165 |
| 334 | 3300035089 | Ga0373944_0200346 | Ga0373944_0200346_189_713 | 165 |
| 335 | 3300035111 | Ga0373923_0018059 | Ga0373923_0018059_1971_2468 | 165 |
| 336 | 3300035113 | Ga0373936_0000966 | Ga0373936_0000966_2417_2914 | 165 |
| 337 | 3300035117 | Ga0373953_0010005 | Ga0373953_0010005_2387_2884 | 165 |
| 338 | 3300035118 | Ga0373954_0078263 | Ga0373954_0078263_1004_1501 | 165 |
| 339 | 3300035119 | Ga0373956_0008841 | Ga0373956_0008841_1068_1565 | 165 |
| 340 | 3300035120 | Ga0373957_0017150 | Ga0373957_0017150_1847_2344 | 165 |
| 341 | 3300035170 | Ga0373943_0000054 | Ga0373943_0000054_11070_11567 | 165 |
| 342 | 3300035170 | Ga0373943_0083341 | Ga0373943_0083341_363_860 | 165 |
| 343 | 3300035171 | Ga0373946_0010120 | Ga0373946_0010120_759_1256 | 165 |
| 344 | 3300035172 | Ga0373955_0028331 | Ga0373955_0028331_1580_2077 | 165 |
| 345 | 3300035172 | Ga0373955_0066887 | Ga0373955_0066887_871_1368 | 165 |
| 346 | 3300035172 | Ga0373955_0182572 | Ga0373955_0182572_569_1066 | 165 |
| 347 | 3300035410 | Ga0373924_0016533 | Ga0373924_0016533_2032_2529 | 165 |
| 348 | 3300035410 | Ga0373924_0023333 | Ga0373924_0023333_1059_1556 | 165 |
| 349 | 3300035692 | Ga0373935_0004095 | Ga0373935_0004095_729_1226 | 165 |
| 350 | 3300035692 | Ga0373935_0031111 | Ga0373935_0031111_101_598 | 165 |
| 351 | 3300035692 | Ga0373935_0116917 | Ga0373935_0116917_418_915 | 165 |
| 352 | 3300035695 | Ga0373927_0082280 | Ga0373927_0082280_368_865 | 165 |
| 353 | 3300035695 | Ga0373927_0273549 | Ga0373927_0273549_511_1008 | 165 |
| 354 | 3300035695 | Ga0373927_0463003 | Ga0373927_0463003_68_565 | 165 |
| 355 | 3300035695 | Ga0373927_0569314 | Ga0373927_0569314_159_656 | 165 |
| 356 | 3300035724 | Ga0373933_0014246 | Ga0373933_0014246_700_1197 | 165 |
| 357 | 3300035724 | Ga0373933_0100682 | Ga0373933_0100682_1141_1638 | 165 |
| 358 | 3300035724 | Ga0373933_0253078 | Ga0373933_0253078_279_776 | 165 |
| 359 | 3300035724 | Ga0373933_0576410 | Ga0373933_0576410_137_634 | 165 |
| 360 | 3300035724 | Ga0373933_0828794 | Ga0373933_0828794_71_568 | 165 |
| 361 | 3300035725 | Ga0373947_0000496 | Ga0373947_0000496_2294_2791 | 165 |
| 362 | 3300035725 | Ga0373947_0014673 | Ga0373947_0014673_2196_2693 | 165 |
| 363 | 3300036401 | Ga0373937_0058242 | Ga0373937_0058242_1531_2028 | 165 |
| 364 | 3300036401 | Ga0373937_0401786 | Ga0373937_0401786_734_1273 | 165 |
| 365 | 3300036401 | Ga0373937_0516119 | Ga0373937_0516119_479_1018 | 165 |
| 366 | 3300036401 | Ga0373937_0623515 | Ga0373937_0623515_29_526 | 165 |
| 367 | 3300036401 | Ga0373937_0793375 | Ga0373937_0793375_228_725 | 165 |
| 368 | 3300037068 | Ga0373925_0018652 | Ga0373925_0018652_1159_1656 | 165 |
| 369 | 3300037068 | Ga0373925_0141462 | Ga0373925_0141462_51_548 | 165 |
| 370 | 3300037068 | Ga0373925_0239178 | Ga0373925_0239178_204_728 | 165 |
| 371 | 3300037068 | Ga0373925_0542925 | Ga0373925_0542925_70_567 | 165 |
| 372 | 3300037471 | Ga0395905_0745593 | Ga0395905_0745593_314_811 | 165 |
| 373 | 3300039450 | Ga0436363_0310747 | Ga0436363_0310747_40_537 | 165 |
| 374 | 3300039450 | Ga0436363_1703454 | Ga0436363_1703454_54_551 | 165 |
| 375 | 3300039453 | Ga0436362_0242382 | Ga0436362_0242382_1651_2148 | 165 |
| 376 | 3300044706 | Ga0466964_0369952 | Ga0466964_0369952_171_668 | 165 |
| 377 | 3300045051 | Ga0451576_2472999 | Ga0451576_2472999_10_507 | 165 |
| 378 | 3300046454 | Ga0495592_0651313 | Ga0495592_0651313_101_598 | 165 |
| 379 | 3300046459 | Ga0495629_0104434 | Ga0495629_0104434_36_533 | 165 |
| 380 | 3300046459 | Ga0495629_0247385 | Ga0495629_0247385_171_668 | 165 |
| 381 | 3300046472 | Ga0495580_0000031 | Ga0495580_0000031_63065_63562 | 165 |
| 382 | 3300046472 | Ga0495580_0018579 | Ga0495580_0018579_4009_4533 | 165 |
| 383 | 3300046472 | Ga0495580_0019658 | Ga0495580_0019658_3172_3669 | 165 |
| 384 | 3300046472 | Ga0495580_0171239 | Ga0495580_0171239_70_567 | 165 |
| 385 | 3300046472 | Ga0495580_0177389 | Ga0495580_0177389_615_1112 | 165 |
| 386 | 3300046473 | Ga0495582_0015585 | Ga0495582_0015585_741_1238 | 165 |
| 387 | 3300046491 | Ga0495584_0018151 | Ga0495584_0018151_1804_2301 | 165 |
| 388 | 3300046516 | Ga0495628_0476723 | Ga0495628_0476723_284_781 | 165 |
| 389 | 3300046517 | Ga0495630_0050881 | Ga0495630_0050881_1051_1548 | 165 |
| 390 | 3300046517 | Ga0495630_0230553 | Ga0495630_0230553_216_713 | 165 |
| 391 | 3300046517 | Ga0495630_0427477 | Ga0495630_0427477_143_640 | 165 |
| 392 | 3300046517 | Ga0495630_0658930 | Ga0495630_0658930_42_539 | 165 |
| 393 | 3300046531 | Ga0495665_0025377 | Ga0495665_0025377_1884_2381 | 165 |
| 394 | 3300046531 | Ga0495665_0192774 | Ga0495665_0192774_145_642 | 165 |
| 395 | 3300046533 | Ga0495640_0240644 | Ga0495640_0240644_89_586 | 165 |
| 396 | 3300046543 | Ga0495645_0147033 | Ga0495645_0147033_793_1290 | 165 |
| 397 | 3300046642 | Ga0495634_0388071 | Ga0495634_0388071_320_817 | 165 |
| 398 | 3300046675 | Ga0495657_0204630 | Ga0495657_0204630_324_821 | 165 |
| 399 | 3300046675 | Ga0495657_0654267 | Ga0495657_0654267_82_579 | 165 |
| 400 | 3300046679 | Ga0495623_0053862 | Ga0495623_0053862_699_1196 | 165 |
| 401 | 3300046681 | Ga0495647_0028580 | Ga0495647_0028580_994_1491 | 165 |
| 402 | 3300046684 | Ga0495669_0274918 | Ga0495669_0274918_35_532 | 165 |
| 403 | 3300046689 | Ga0495613_0122679 | Ga0495613_0122679_186_683 | 165 |
| 404 | 3300046690 | Ga0495624_0086185 | Ga0495624_0086185_324_821 | 165 |
| 405 | 3300046690 | Ga0495624_0580882 | Ga0495624_0580882_64_561 | 165 |
| 406 | 3300046809 | Ga0495600_0227709 | Ga0495600_0227709_635_1132 | 165 |
| 407 | 3300047319 | Ga0495674_0080360 | Ga0495674_0080360_826_1323 | 165 |
| 408 | 3300047319 | Ga0495674_0085250 | Ga0495674_0085250_89_586 | 165 |
| 409 | 3300047673 | Ga0495593_0221085 | Ga0495593_0221085_220_717 | 165 |
| 410 | 3300047673 | Ga0495593_0289991 | Ga0495593_0289991_14_511 | 165 |
| 411 | 3300048088 | Ga0495602_0126933 | Ga0495602_0126933_826_1323 | 165 |
| 412 | 3300048088 | Ga0495602_0308844 | Ga0495602_0308844_445_942 | 165 |
| 413 | 3300048915 | Ga0496112_1386136 | Ga0496112_1386136_42_587 | 165 |
| 414 | 3300048918 | Ga0496115_0009800 | Ga0496115_0009800_2157_2654 | 165 |
| 415 | 3300050512 | nmdc:mga0n895_15801_c1 | nmdc:mga0n895_15801_c1_5784_6281 | 165 |
| 416 | 3300050513 | nmdc:mga0rr50_7786_c1 | nmdc:mga0rr50_7786_c1_234_731 | 165 |
| 417 | 3300050514 | nmdc:mga08x19_601136_c1 | nmdc:mga08x19_601136_c1_162_659 | 165 |
| 418 | 3300050514 | nmdc:mga08x19_751368_c1 | nmdc:mga08x19_751368_c1_10_507 | 165 |
| 419 | 3300053078 | Ga0495612_0438881 | Ga0495612_0438881_68_568 | 165 |
| 420 | 3300053085 | Ga0495619_0075971 | Ga0495619_0075971_769_1266 | 165 |
| 421 | 2162886012 | MBSR1b_contig_12373736 | MBSR1b_0699.00003150 | 166 |
| 422 | 3300001991 | JGI24743J22301_10000326 | JGI24743J22301_100003262 | 166 |
| 423 | 3300002076 | JGI24749J21850_1013365 | JGI24749J21850_10133651 | 166 |
| 424 | 3300002155 | JGI24033J26618_1034833 | JGI24033J26618_10348331 | 166 |
| 425 | 3300002239 | JGI24034J26672_10001510 | JGI24034J26672_100015104 | 166 |
| 426 | 3300002459 | JGI24751J29686_10021546 | JGI24751J29686_100215461 | 166 |
| 427 | 3300005293 | Ga0065715_10091638 | Ga0065715_100916384 | 166 |
| 428 | 3300005327 | Ga0070658_10333721 | Ga0070658_103337211 | 166 |
| 429 | 3300005327 | Ga0070658_10969985 | Ga0070658_109699851 | 166 |
| 430 | 3300005328 | Ga0070676_10010579 | Ga0070676_100105794 | 166 |
| 431 | 3300005328 | Ga0070676_10073015 | Ga0070676_100730152 | 166 |
| 432 | 3300005329 | Ga0070683_100008507 | Ga0070683_1000085072 | 166 |
| 433 | 3300005329 | Ga0070683_100029649 | Ga0070683_1000296492 | 166 |
| 434 | 3300005329 | Ga0070683_100505160 | Ga0070683_1005051601 | 166 |
| 435 | 3300005330 | Ga0070690_100026557 | Ga0070690_1000265574 | 166 |
| 436 | 3300005330 | Ga0070690_100454794 | Ga0070690_1004547941 | 166 |
| 437 | 3300005331 | Ga0070670_100014317 | Ga0070670_1000143172 | 166 |
| 438 | 3300005331 | Ga0070670_100134527 | Ga0070670_1001345272 | 166 |
| 439 | 3300005333 | Ga0070677_10013347 | Ga0070677_100133473 | 166 |
| 440 | 3300005333 | Ga0070677_10548777 | Ga0070677_105487771 | 166 |
| 441 | 3300005334 | Ga0068869_100014661 | Ga0068869_1000146612 | 166 |
| 442 | 3300005335 | Ga0070666_10028525 | Ga0070666_100285254 | 166 |
| 443 | 3300005335 | Ga0070666_10175835 | Ga0070666_101758353 | 166 |
| 444 | 3300005335 | Ga0070666_10206556 | Ga0070666_102065562 | 166 |
| 445 | 3300005336 | Ga0070680_100256127 | Ga0070680_1002561272 | 166 |
| 446 | 3300005336 | Ga0070680_101373755 | Ga0070680_1013737551 | 166 |
| 447 | 3300005337 | Ga0070682_100021304 | Ga0070682_1000213043 | 166 |
| 448 | 3300005337 | Ga0070682_101578708 | Ga0070682_1015787081 | 166 |
| 449 | 3300005338 | Ga0068868_100048560 | Ga0068868_1000485603 | 166 |
| 450 | 3300005338 | Ga0068868_100232874 | Ga0068868_1002328742 | 166 |
| 451 | 3300005339 | Ga0070660_100016361 | Ga0070660_1000163614 | 166 |
| 452 | 3300005339 | Ga0070660_100162634 | Ga0070660_1001626341 | 166 |
| 453 | 3300005340 | Ga0070689_100013364 | Ga0070689_1000133644 | 166 |
| 454 | 3300005341 | Ga0070691_10112169 | Ga0070691_101121692 | 166 |
| 455 | 3300005343 | Ga0070687_100027361 | Ga0070687_1000273612 | 166 |
| 456 | 3300005344 | Ga0070661_100012448 | Ga0070661_1000124484 | 166 |
| 457 | 3300005344 | Ga0070661_100018311 | Ga0070661_1000183115 | 166 |
| 458 | 3300005344 | Ga0070661_100216493 | Ga0070661_1002164933 | 166 |
| 459 | 3300005347 | Ga0070668_100009738 | Ga0070668_1000097387 | 166 |
| 460 | 3300005347 | Ga0070668_100049564 | Ga0070668_1000495643 | 166 |
| 461 | 3300005353 | Ga0070669_100012969 | Ga0070669_1000129694 | 166 |
| 462 | 3300005353 | Ga0070669_100183475 | Ga0070669_1001834752 | 166 |
| 463 | 3300005354 | Ga0070675_100019172 | Ga0070675_1000191723 | 166 |
| 464 | 3300005355 | Ga0070671_100219132 | Ga0070671_1002191323 | 166 |
| 465 | 3300005356 | Ga0070674_100027611 | Ga0070674_1000276111 | 166 |
| 466 | 3300005356 | Ga0070674_101901762 | Ga0070674_1019017621 | 166 |
| 467 | 3300005364 | Ga0070673_100010535 | Ga0070673_1000105352 | 166 |
| 468 | 3300005365 | Ga0070688_100006794 | Ga0070688_1000067943 | 166 |
| 469 | 3300005365 | Ga0070688_100089223 | Ga0070688_1000892232 | 166 |
| 470 | 3300005366 | Ga0070659_100005924 | Ga0070659_1000059242 | 166 |
| 471 | 3300005366 | Ga0070659_100134094 | Ga0070659_1001340943 | 166 |
| 472 | 3300005367 | Ga0070667_100018445 | Ga0070667_1000184455 | 166 |
| 473 | 3300005367 | Ga0070667_100205060 | Ga0070667_1002050603 | 166 |
| 474 | 3300005434 | Ga0070709_10012421 | Ga0070709_100124211 | 166 |
| 475 | 3300005434 | Ga0070709_10035701 | Ga0070709_100357014 | 166 |
| 476 | 3300005436 | Ga0070713_100065002 | Ga0070713_1000650022 | 166 |
| 477 | 3300005436 | Ga0070713_100875083 | Ga0070713_1008750832 | 166 |
| 478 | 3300005437 | Ga0070710_10294543 | Ga0070710_102945432 | 166 |
| 479 | 3300005439 | Ga0070711_100002049 | Ga0070711_1000020493 | 166 |
| 480 | 3300005439 | Ga0070711_100046051 | Ga0070711_1000460513 | 166 |
| 481 | 3300005444 | Ga0070694_100271550 | Ga0070694_1002715501 | 166 |
| 482 | 3300005445 | Ga0070708_100000418 | Ga0070708_10000041824 | 166 |
| 483 | 3300005445 | Ga0070708_100016302 | Ga0070708_1000163025 | 166 |
| 484 | 3300005445 | Ga0070708_100044220 | Ga0070708_1000442204 | 166 |
| 485 | 3300005445 | Ga0070708_100625578 | Ga0070708_1006255782 | 166 |
| 486 | 3300005455 | Ga0070663_100010754 | Ga0070663_1000107544 | 166 |
| 487 | 3300005455 | Ga0070663_100047085 | Ga0070663_1000470852 | 166 |
| 488 | 3300005456 | Ga0070678_100022210 | Ga0070678_1000222104 | 166 |
| 489 | 3300005456 | Ga0070678_100054141 | Ga0070678_1000541411 | 166 |
| 490 | 3300005457 | Ga0070662_100003783 | Ga0070662_1000037832 | 166 |
| 491 | 3300005457 | Ga0070662_100023119 | Ga0070662_1000231192 | 166 |
| 492 | 3300005457 | Ga0070662_100071465 | Ga0070662_1000714652 | 166 |
| 493 | 3300005458 | Ga0070681_10115544 | Ga0070681_101155441 | 166 |
| 494 | 3300005458 | Ga0070681_10535497 | Ga0070681_105354971 | 166 |
| 495 | 3300005459 | Ga0068867_100011942 | Ga0068867_1000119426 | 166 |
| 496 | 3300005459 | Ga0068867_100065906 | Ga0068867_1000659061 | 166 |
| 497 | 3300005466 | Ga0070685_10005938 | Ga0070685_100059387 | 166 |
| 498 | 3300005466 | Ga0070685_10146971 | Ga0070685_101469712 | 166 |
| 499 | 3300005467 | Ga0070706_100000173 | Ga0070706_10000017318 | 166 |
| 500 | 3300005467 | Ga0070706_100001295 | Ga0070706_10000129511 | 166 |
| 501 | 3300005467 | Ga0070706_100018639 | Ga0070706_1000186396 | 166 |
| 502 | 3300005468 | Ga0070707_100000719 | Ga0070707_10000071911 | 166 |
| 503 | 3300005468 | Ga0070707_100012053 | Ga0070707_1000120535 | 166 |
| 504 | 3300005468 | Ga0070707_100057513 | Ga0070707_1000575134 | 166 |
| 505 | 3300005471 | Ga0070698_100000162 | Ga0070698_10000016231 | 166 |
| 506 | 3300005471 | Ga0070698_100166556 | Ga0070698_1001665563 | 166 |
| 507 | 3300005518 | Ga0070699_100002540 | Ga0070699_1000025407 | 166 |
| 508 | 3300005518 | Ga0070699_100004218 | Ga0070699_1000042187 | 166 |
| 509 | 3300005518 | Ga0070699_100012258 | Ga0070699_1000122584 | 166 |
| 510 | 3300005518 | Ga0070699_100592358 | Ga0070699_1005923582 | 166 |
| 511 | 3300005530 | Ga0070679_100256332 | Ga0070679_1002563322 | 166 |
| 512 | 3300005530 | Ga0070679_100978251 | Ga0070679_1009782511 | 166 |
| 513 | 3300005535 | Ga0070684_100006304 | Ga0070684_1000063047 | 166 |
| 514 | 3300005535 | Ga0070684_100160446 | Ga0070684_1001604462 | 166 |
| 515 | 3300005536 | Ga0070697_100000554 | Ga0070697_10000055423 | 166 |
| 516 | 3300005536 | Ga0070697_100000872 | Ga0070697_1000008728 | 166 |
| 517 | 3300005536 | Ga0070697_100001177 | Ga0070697_1000011772 | 166 |
| 518 | 3300005536 | Ga0070697_100001505 | Ga0070697_1000015055 | 166 |
| 519 | 3300005536 | Ga0070697_100174118 | Ga0070697_1001741182 | 166 |
| 520 | 3300005539 | Ga0068853_100016415 | Ga0068853_1000164154 | 166 |
| 521 | 3300005539 | Ga0068853_100035889 | Ga0068853_1000358892 | 166 |
| 522 | 3300005539 | Ga0068853_100035951 | Ga0068853_1000359512 | 166 |
| 523 | 3300005543 | Ga0070672_100019833 | Ga0070672_1000198334 | 166 |
| 524 | 3300005544 | Ga0070686_100030276 | Ga0070686_1000302764 | 166 |
| 525 | 3300005544 | Ga0070686_100062316 | Ga0070686_1000623163 | 166 |
| 526 | 3300005545 | Ga0070695_100161859 | Ga0070695_1001618593 | 166 |
| 527 | 3300005545 | Ga0070695_100572691 | Ga0070695_1005726911 | 166 |
| 528 | 3300005546 | Ga0070696_100308363 | Ga0070696_1003083632 | 166 |
| 529 | 3300005547 | Ga0070693_100117514 | Ga0070693_1001175142 | 166 |
| 530 | 3300005547 | Ga0070693_100256189 | Ga0070693_1002561892 | 166 |
| 531 | 3300005548 | Ga0070665_100384352 | Ga0070665_1003843521 | 166 |
| 532 | 3300005563 | Ga0068855_100028151 | Ga0068855_1000281514 | 166 |
| 533 | 3300005563 | Ga0068855_100082032 | Ga0068855_1000820321 | 166 |
| 534 | 3300005563 | Ga0068855_101094456 | Ga0068855_1010944562 | 166 |
| 535 | 3300005564 | Ga0070664_100012980 | Ga0070664_1000129807 | 166 |
| 536 | 3300005564 | Ga0070664_100017362 | Ga0070664_1000173622 | 166 |
| 537 | 3300005564 | Ga0070664_100173686 | Ga0070664_1001736863 | 166 |
| 538 | 3300005577 | Ga0068857_100002662 | Ga0068857_10000266211 | 166 |
| 539 | 3300005577 | Ga0068857_100060124 | Ga0068857_1000601242 | 166 |
| 540 | 3300005578 | Ga0068854_100009708 | Ga0068854_1000097087 | 166 |
| 541 | 3300005578 | Ga0068854_100460332 | Ga0068854_1004603321 | 166 |
| 542 | 3300005614 | Ga0068856_100034355 | Ga0068856_1000343553 | 166 |
| 543 | 3300005614 | Ga0068856_100035602 | Ga0068856_1000356024 | 166 |
| 544 | 3300005614 | Ga0068856_100060078 | Ga0068856_1000600782 | 166 |
| 545 | 3300005614 | Ga0068856_100096241 | Ga0068856_1000962412 | 166 |
| 546 | 3300005615 | Ga0070702_100138308 | Ga0070702_1001383082 | 166 |
| 547 | 3300005616 | Ga0068852_100006784 | Ga0068852_1000067846 | 166 |
| 548 | 3300005616 | Ga0068852_100015554 | Ga0068852_1000155544 | 166 |
| 549 | 3300005616 | Ga0068852_100116529 | Ga0068852_1001165291 | 166 |
| 550 | 3300005617 | Ga0068859_100037215 | Ga0068859_1000372153 | 166 |
| 551 | 3300005618 | Ga0068864_100203828 | Ga0068864_1002038283 | 166 |
| 552 | 3300005618 | Ga0068864_100462302 | Ga0068864_1004623022 | 166 |
| 553 | 3300005618 | Ga0068864_100987147 | Ga0068864_1009871471 | 166 |
| 554 | 3300005718 | Ga0068866_10001944 | Ga0068866_100019448 | 166 |
| 555 | 3300005718 | Ga0068866_10326929 | Ga0068866_103269292 | 166 |
| 556 | 3300005719 | Ga0068861_100009145 | Ga0068861_1000091455 | 166 |
| 557 | 3300005834 | Ga0068851_10006235 | Ga0068851_100062351 | 166 |
| 558 | 3300005834 | Ga0068851_10017023 | Ga0068851_100170233 | 166 |
| 559 | 3300005834 | Ga0068851_10029284 | Ga0068851_100292842 | 166 |
| 560 | 3300005840 | Ga0068870_10012560 | Ga0068870_100125602 | 166 |
| 561 | 3300005841 | Ga0068863_100084025 | Ga0068863_1000840253 | 166 |
| 562 | 3300005841 | Ga0068863_100112243 | Ga0068863_1001122432 | 166 |
| 563 | 3300005841 | Ga0068863_100169230 | Ga0068863_1001692302 | 166 |
| 564 | 3300005841 | Ga0068863_100335151 | Ga0068863_1003351513 | 166 |
| 565 | 3300005842 | Ga0068858_100018536 | Ga0068858_1000185361 | 166 |
| 566 | 3300005842 | Ga0068858_100818521 | Ga0068858_1008185212 | 166 |
| 567 | 3300005843 | Ga0068860_100033462 | Ga0068860_1000334623 | 166 |
| 568 | 3300005843 | Ga0068860_100286630 | Ga0068860_1002866302 | 166 |
| 569 | 3300005843 | Ga0068860_100462065 | Ga0068860_1004620652 | 166 |
| 570 | 3300005844 | Ga0068862_100024154 | Ga0068862_1000241542 | 166 |
| 571 | 3300005844 | Ga0068862_100125918 | Ga0068862_1001259182 | 166 |
| 572 | 3300006028 | Ga0070717_10984018 | Ga0070717_109840181 | 166 |
| 573 | 3300006163 | Ga0070715_10090802 | Ga0070715_100908021 | 166 |
| 574 | 3300006173 | Ga0070716_100000315 | Ga0070716_10000031511 | 166 |
| 575 | 3300006173 | Ga0070716_100014273 | Ga0070716_1000142734 | 166 |
| 576 | 3300006173 | Ga0070716_100092424 | Ga0070716_1000924241 | 166 |
| 577 | 3300006173 | Ga0070716_100281838 | Ga0070716_1002818381 | 166 |
| 578 | 3300006173 | Ga0070716_100339825 | Ga0070716_1003398251 | 166 |
| 579 | 3300006175 | Ga0070712_100002960 | Ga0070712_1000029606 | 166 |
| 580 | 3300006175 | Ga0070712_100031299 | Ga0070712_1000312992 | 166 |
| 581 | 3300006237 | Ga0097621_100008160 | Ga0097621_1000081607 | 166 |
| 582 | 3300006237 | Ga0097621_100190616 | Ga0097621_1001906163 | 166 |
| 583 | 3300006237 | Ga0097621_100404318 | Ga0097621_1004043181 | 166 |
| 584 | 3300006237 | Ga0097621_100610893 | Ga0097621_1006108932 | 166 |
| 585 | 3300006358 | Ga0068871_100007947 | Ga0068871_1000079476 | 166 |
| 586 | 3300006358 | Ga0068871_100188544 | Ga0068871_1001885443 | 166 |
| 587 | 3300006358 | Ga0068871_100256279 | Ga0068871_1002562793 | 166 |
| 588 | 3300006358 | Ga0068871_100488464 | Ga0068871_1004884643 | 166 |
| 589 | 3300006852 | Ga0075433_10001164 | Ga0075433_100011649 | 166 |
| 590 | 3300006852 | Ga0075433_10001954 | Ga0075433_1000195414 | 166 |
| 591 | 3300006852 | Ga0075433_10572342 | Ga0075433_105723422 | 166 |
| 592 | 3300006871 | Ga0075434_100000041 | Ga0075434_10000004114 | 166 |
| 593 | 3300006871 | Ga0075434_100008051 | Ga0075434_1000080514 | 166 |
| 594 | 3300006881 | Ga0068865_100032569 | Ga0068865_1000325693 | 166 |
| 595 | 3300006881 | Ga0068865_100296483 | Ga0068865_1002964833 | 166 |
| 596 | 3300006914 | Ga0075436_100006992 | Ga0075436_1000069924 | 166 |
| 597 | 3300006931 | Ga0097620_100037214 | Ga0097620_1000372143 | 166 |
| 598 | 3300007076 | Ga0075435_100000105 | Ga0075435_10000010520 | 166 |
| 599 | 3300007076 | Ga0075435_100023020 | Ga0075435_1000230205 | 166 |
| 600 | 3300007076 | Ga0075435_100552641 | Ga0075435_1005526412 | 166 |
| 601 | 3300007265 | Ga0099794_10168120 | Ga0099794_101681201 | 166 |
| 602 | 3300009093 | Ga0105240_10074313 | Ga0105240_100743132 | 166 |
| 603 | 3300009093 | Ga0105240_12166851 | Ga0105240_121668511 | 166 |
| 604 | 3300009098 | Ga0105245_10030920 | Ga0105245_100309202 | 166 |
| 605 | 3300009098 | Ga0105245_10140939 | Ga0105245_101409393 | 166 |
| 606 | 3300009098 | Ga0105245_10165140 | Ga0105245_101651403 | 166 |
| 607 | 3300009098 | Ga0105245_11021681 | Ga0105245_110216812 | 166 |
| 608 | 3300009101 | Ga0105247_10006289 | Ga0105247_100062892 | 166 |
| 609 | 3300009101 | Ga0105247_10026851 | Ga0105247_100268512 | 166 |
| 610 | 3300009101 | Ga0105247_11103034 | Ga0105247_111030341 | 166 |
| 611 | 3300009148 | Ga0105243_10058571 | Ga0105243_100585713 | 166 |
| 612 | 3300009148 | Ga0105243_11199285 | Ga0105243_111992852 | 166 |
| 613 | 3300009174 | Ga0105241_10013091 | Ga0105241_100130915 | 166 |
| 614 | 3300009174 | Ga0105241_10241944 | Ga0105241_102419442 | 166 |
| 615 | 3300009174 | Ga0105241_10736991 | Ga0105241_107369911 | 166 |
| 616 | 3300009174 | Ga0105241_10748814 | Ga0105241_107488141 | 166 |
| 617 | 3300009174 | Ga0105241_11130602 | Ga0105241_111306021 | 166 |
| 618 | 3300009176 | Ga0105242_10068669 | Ga0105242_100686692 | 166 |
| 619 | 3300009177 | Ga0105248_10070138 | Ga0105248_100701382 | 166 |
| 620 | 3300009177 | Ga0105248_10610461 | Ga0105248_106104612 | 166 |
| 621 | 3300009177 | Ga0105248_11216137 | Ga0105248_112161371 | 166 |
| 622 | 3300009545 | Ga0105237_10617226 | Ga0105237_106172261 | 166 |
| 623 | 3300009545 | Ga0105237_10785869 | Ga0105237_107858691 | 166 |
| 624 | 3300009551 | Ga0105238_10030598 | Ga0105238_100305984 | 166 |
| 625 | 3300009551 | Ga0105238_10091469 | Ga0105238_100914692 | 166 |
| 626 | 3300009551 | Ga0105238_10278522 | Ga0105238_102785222 | 166 |
| 627 | 3300009553 | Ga0105249_10011376 | Ga0105249_100113767 | 166 |
| 628 | 3300009553 | Ga0105249_10033432 | Ga0105249_100334324 | 166 |
| 629 | 3300009553 | Ga0105249_10118256 | Ga0105249_101182561 | 166 |
| 630 | 3300010375 | Ga0105239_10117684 | Ga0105239_101176842 | 166 |
| 631 | 3300010375 | Ga0105239_10460080 | Ga0105239_104600802 | 166 |
| 632 | 3300010375 | Ga0105239_10691320 | Ga0105239_106913202 | 166 |
| 633 | 3300010375 | Ga0105239_10768567 | Ga0105239_107685672 | 166 |
| 634 | 3300011119 | Ga0105246_10009260 | Ga0105246_100092604 | 166 |
| 635 | 3300013100 | Ga0157373_10004158 | Ga0157373_100041583 | 166 |
| 636 | 3300013100 | Ga0157373_10112556 | Ga0157373_101125563 | 166 |
| 637 | 3300013102 | Ga0157371_10031378 | Ga0157371_100313782 | 166 |
| 638 | 3300013102 | Ga0157371_10271571 | Ga0157371_102715712 | 166 |
| 639 | 3300013105 | Ga0157369_10032939 | Ga0157369_100329396 | 166 |
| 640 | 3300013105 | Ga0157369_10048103 | Ga0157369_100481031 | 166 |
| 641 | 3300013296 | Ga0157374_10049285 | Ga0157374_100492852 | 166 |
| 642 | 3300013296 | Ga0157374_10053326 | Ga0157374_100533262 | 166 |
| 643 | 3300013296 | Ga0157374_10224493 | Ga0157374_102244933 | 166 |
| 644 | 3300013296 | Ga0157374_10288743 | Ga0157374_102887433 | 166 |
| 645 | 3300013296 | Ga0157374_11001050 | Ga0157374_110010502 | 166 |
| 646 | 3300013297 | Ga0157378_10010049 | Ga0157378_100100492 | 166 |
| 647 | 3300013297 | Ga0157378_10103061 | Ga0157378_101030614 | 166 |
| 648 | 3300013297 | Ga0157378_10310375 | Ga0157378_103103753 | 166 |
| 649 | 3300013306 | Ga0163162_10029047 | Ga0163162_100290472 | 166 |
| 650 | 3300013306 | Ga0163162_10294833 | Ga0163162_102948333 | 166 |
| 651 | 3300013306 | Ga0163162_11370766 | Ga0163162_113707662 | 166 |
| 652 | 3300013307 | Ga0157372_10072578 | Ga0157372_100725782 | 166 |
| 653 | 3300013308 | Ga0157375_10027190 | Ga0157375_100271902 | 166 |
| 654 | 3300014325 | Ga0163163_10007476 | Ga0163163_100074767 | 166 |
| 655 | 3300014325 | Ga0163163_10011914 | Ga0163163_100119143 | 166 |
| 656 | 3300014325 | Ga0163163_10020058 | Ga0163163_100200583 | 166 |
| 657 | 3300014325 | Ga0163163_10022148 | Ga0163163_100221485 | 166 |
| 658 | 3300014497 | Ga0182008_10107349 | Ga0182008_101073491 | 166 |
| 659 | 3300014745 | Ga0157377_10001020 | Ga0157377_100010209 | 166 |
| 660 | 3300014968 | Ga0157379_10007715 | Ga0157379_1000771510 | 166 |
| 661 | 3300014968 | Ga0157379_10014150 | Ga0157379_100141507 | 166 |
| 662 | 3300014968 | Ga0157379_10653514 | Ga0157379_106535141 | 166 |
| 663 | 3300014968 | Ga0157379_10692323 | Ga0157379_106923232 | 166 |
| 664 | 3300014969 | Ga0157376_10009736 | Ga0157376_100097366 | 166 |
| 665 | 3300014969 | Ga0157376_10017009 | Ga0157376_100170095 | 166 |
| 666 | 3300014969 | Ga0157376_10035919 | Ga0157376_100359192 | 166 |
| 667 | 3300014969 | Ga0157376_11458188 | Ga0157376_114581882 | 166 |
| 668 | 3300015262 | Ga0182007_10005070 | Ga0182007_100050705 | 166 |
| 669 | 3300015265 | Ga0182005_1009626 | Ga0182005_10096264 | 166 |
| 670 | 3300017792 | Ga0163161_10019548 | Ga0163161_100195484 | 166 |
| 671 | 3300024227 | Ga0228598_1000502 | Ga0228598_10005028 | 166 |
| 672 | 3300024227 | Ga0228598_1041734 | Ga0228598_10417342 | 166 |
| 673 | 3300025315 | Ga0207697_10007772 | Ga0207697_100077722 | 166 |
| 674 | 3300025321 | Ga0207656_10037664 | Ga0207656_100376642 | 166 |
| 675 | 3300025321 | Ga0207656_10211485 | Ga0207656_102114852 | 166 |
| 676 | 3300025893 | Ga0207682_10029528 | Ga0207682_100295283 | 166 |
| 677 | 3300025893 | Ga0207682_10416653 | Ga0207682_104166531 | 166 |
| 678 | 3300025899 | Ga0207642_10104851 | Ga0207642_101048512 | 166 |
| 679 | 3300025899 | Ga0207642_10386144 | Ga0207642_103861442 | 166 |
| 680 | 3300025900 | Ga0207710_10348901 | Ga0207710_103489011 | 166 |
| 681 | 3300025901 | Ga0207688_10145853 | Ga0207688_101458532 | 166 |
| 682 | 3300025903 | Ga0207680_10015571 | Ga0207680_100155712 | 166 |
| 683 | 3300025903 | Ga0207680_10663459 | Ga0207680_106634591 | 166 |
| 684 | 3300025904 | Ga0207647_10003441 | Ga0207647_100034419 | 166 |
| 685 | 3300025904 | Ga0207647_10085312 | Ga0207647_100853123 | 166 |
| 686 | 3300025905 | Ga0207685_10040513 | Ga0207685_100405132 | 166 |
| 687 | 3300025906 | Ga0207699_10015400 | Ga0207699_100154004 | 166 |
| 688 | 3300025906 | Ga0207699_10060749 | Ga0207699_100607493 | 166 |
| 689 | 3300025906 | Ga0207699_10094983 | Ga0207699_100949832 | 166 |
| 690 | 3300025906 | Ga0207699_10362925 | Ga0207699_103629252 | 166 |
| 691 | 3300025907 | Ga0207645_10000181 | Ga0207645_100001813 | 166 |
| 692 | 3300025907 | Ga0207645_10019336 | Ga0207645_100193363 | 166 |
| 693 | 3300025908 | Ga0207643_10001458 | Ga0207643_100014589 | 166 |
| 694 | 3300025908 | Ga0207643_10109875 | Ga0207643_101098752 | 166 |
| 695 | 3300025909 | Ga0207705_10045425 | Ga0207705_100454252 | 166 |
| 696 | 3300025910 | Ga0207684_10000267 | Ga0207684_1000026714 | 166 |
| 697 | 3300025910 | Ga0207684_10004181 | Ga0207684_1000418112 | 166 |
| 698 | 3300025911 | Ga0207654_10055269 | Ga0207654_100552691 | 166 |
| 699 | 3300025911 | Ga0207654_10058367 | Ga0207654_100583672 | 166 |
| 700 | 3300025911 | Ga0207654_10092107 | Ga0207654_100921073 | 166 |
| 701 | 3300025911 | Ga0207654_10166552 | Ga0207654_101665521 | 166 |
| 702 | 3300025911 | Ga0207654_10548815 | Ga0207654_105488151 | 166 |
| 703 | 3300025912 | Ga0207707_10015984 | Ga0207707_100159843 | 166 |
| 704 | 3300025912 | Ga0207707_10175218 | Ga0207707_101752182 | 166 |
| 705 | 3300025913 | Ga0207695_10299030 | Ga0207695_102990303 | 166 |
| 706 | 3300025914 | Ga0207671_10122728 | Ga0207671_101227283 | 166 |
| 707 | 3300025914 | Ga0207671_10125768 | Ga0207671_101257683 | 166 |
| 708 | 3300025915 | Ga0207693_10013836 | Ga0207693_100138362 | 166 |
| 709 | 3300025915 | Ga0207693_10029134 | Ga0207693_100291344 | 166 |
| 710 | 3300025916 | Ga0207663_10002155 | Ga0207663_100021552 | 166 |
| 711 | 3300025916 | Ga0207663_10059922 | Ga0207663_100599221 | 166 |
| 712 | 3300025916 | Ga0207663_10160137 | Ga0207663_101601373 | 166 |
| 713 | 3300025917 | Ga0207660_10379430 | Ga0207660_103794302 | 166 |
| 714 | 3300025918 | Ga0207662_10026172 | Ga0207662_100261723 | 166 |
| 715 | 3300025919 | Ga0207657_10000535 | Ga0207657_1000053518 | 166 |
| 716 | 3300025919 | Ga0207657_10001828 | Ga0207657_100018286 | 166 |
| 717 | 3300025919 | Ga0207657_10010586 | Ga0207657_100105869 | 166 |
| 718 | 3300025920 | Ga0207649_10000350 | Ga0207649_1000035025 | 166 |
| 719 | 3300025920 | Ga0207649_10020780 | Ga0207649_100207801 | 166 |
| 720 | 3300025920 | Ga0207649_10114548 | Ga0207649_101145482 | 166 |
| 721 | 3300025921 | Ga0207652_10471230 | Ga0207652_104712302 | 166 |
| 722 | 3300025922 | Ga0207646_10000296 | Ga0207646_1000029637 | 166 |
| 723 | 3300025922 | Ga0207646_10095550 | Ga0207646_100955504 | 166 |
| 724 | 3300025922 | Ga0207646_10132679 | Ga0207646_101326793 | 166 |
| 725 | 3300025923 | Ga0207681_10079583 | Ga0207681_100795832 | 166 |
| 726 | 3300025924 | Ga0207694_10144453 | Ga0207694_101444532 | 166 |
| 727 | 3300025924 | Ga0207694_10502618 | Ga0207694_105026182 | 166 |
| 728 | 3300025925 | Ga0207650_10000223 | Ga0207650_100002233 | 166 |
| 729 | 3300025925 | Ga0207650_10140577 | Ga0207650_101405772 | 166 |
| 730 | 3300025926 | Ga0207659_10007479 | Ga0207659_100074792 | 166 |
| 731 | 3300025927 | Ga0207687_10018290 | Ga0207687_100182902 | 166 |
| 732 | 3300025927 | Ga0207687_10077263 | Ga0207687_100772631 | 166 |
| 733 | 3300025928 | Ga0207700_10301690 | Ga0207700_103016902 | 166 |
| 734 | 3300025928 | Ga0207700_10517468 | Ga0207700_105174681 | 166 |
| 735 | 3300025928 | Ga0207700_10737072 | Ga0207700_107370721 | 166 |
| 736 | 3300025928 | Ga0207700_10845813 | Ga0207700_108458132 | 166 |
| 737 | 3300025931 | Ga0207644_10011249 | Ga0207644_100112494 | 166 |
| 738 | 3300025931 | Ga0207644_10049864 | Ga0207644_100498643 | 166 |
| 739 | 3300025932 | Ga0207690_10029853 | Ga0207690_100298531 | 166 |
| 740 | 3300025932 | Ga0207690_10387278 | Ga0207690_103872782 | 166 |
| 741 | 3300025933 | Ga0207706_10000670 | Ga0207706_1000067027 | 166 |
| 742 | 3300025933 | Ga0207706_10009803 | Ga0207706_100098037 | 166 |
| 743 | 3300025933 | Ga0207706_10014729 | Ga0207706_100147294 | 166 |
| 744 | 3300025935 | Ga0207709_10108511 | Ga0207709_101085111 | 166 |
| 745 | 3300025935 | Ga0207709_10823662 | Ga0207709_108236622 | 166 |
| 746 | 3300025936 | Ga0207670_10015700 | Ga0207670_100157004 | 166 |
| 747 | 3300025937 | Ga0207669_10863890 | Ga0207669_108638901 | 166 |
| 748 | 3300025938 | Ga0207704_10067564 | Ga0207704_100675643 | 166 |
| 749 | 3300025938 | Ga0207704_10176675 | Ga0207704_101766752 | 166 |
| 750 | 3300025939 | Ga0207665_10008599 | Ga0207665_100085992 | 166 |
| 751 | 3300025939 | Ga0207665_10229042 | Ga0207665_102290421 | 166 |
| 752 | 3300025939 | Ga0207665_10317031 | Ga0207665_103170312 | 166 |
| 753 | 3300025939 | Ga0207665_10347153 | Ga0207665_103471531 | 166 |
| 754 | 3300025939 | Ga0207665_10347731 | Ga0207665_103477312 | 166 |
| 755 | 3300025939 | Ga0207665_10883279 | Ga0207665_108832791 | 166 |
| 756 | 3300025940 | Ga0207691_10000345 | Ga0207691_100003453 | 166 |
| 757 | 3300025941 | Ga0207711_10029037 | Ga0207711_100290373 | 166 |
| 758 | 3300025942 | Ga0207689_10000499 | Ga0207689_1000049930 | 166 |
| 759 | 3300025942 | Ga0207689_10076620 | Ga0207689_100766203 | 166 |
| 760 | 3300025944 | Ga0207661_10059699 | Ga0207661_100596992 | 166 |
| 761 | 3300025944 | Ga0207661_10125076 | Ga0207661_101250763 | 166 |
| 762 | 3300025944 | Ga0207661_10357834 | Ga0207661_103578341 | 166 |
| 763 | 3300025945 | Ga0207679_10000115 | Ga0207679_1000011559 | 166 |
| 764 | 3300025945 | Ga0207679_10250551 | Ga0207679_102505513 | 166 |
| 765 | 3300025949 | Ga0207667_10040938 | Ga0207667_100409384 | 166 |
| 766 | 3300025949 | Ga0207667_10246893 | Ga0207667_102468931 | 166 |
| 767 | 3300025960 | Ga0207651_10003270 | Ga0207651_100032707 | 166 |
| 768 | 3300025961 | Ga0207712_10030933 | Ga0207712_100309333 | 166 |
| 769 | 3300025961 | Ga0207712_10141863 | Ga0207712_101418632 | 166 |
| 770 | 3300025972 | Ga0207668_10029993 | Ga0207668_100299933 | 166 |
| 771 | 3300025972 | Ga0207668_10780986 | Ga0207668_107809862 | 166 |
| 772 | 3300025981 | Ga0207640_10416205 | Ga0207640_104162052 | 166 |
| 773 | 3300025981 | Ga0207640_10595314 | Ga0207640_105953142 | 166 |
| 774 | 3300025986 | Ga0207658_10018432 | Ga0207658_100184324 | 166 |
| 775 | 3300025986 | Ga0207658_10385427 | Ga0207658_103854273 | 166 |
| 776 | 3300026023 | Ga0207677_10016957 | Ga0207677_100169573 | 166 |
| 777 | 3300026023 | Ga0207677_10033304 | Ga0207677_100333041 | 166 |
| 778 | 3300026023 | Ga0207677_10368197 | Ga0207677_103681971 | 166 |
| 779 | 3300026035 | Ga0207703_10020915 | Ga0207703_100209154 | 166 |
| 780 | 3300026035 | Ga0207703_10221807 | Ga0207703_102218071 | 166 |
| 781 | 3300026035 | Ga0207703_10261335 | Ga0207703_102613352 | 166 |
| 782 | 3300026041 | Ga0207639_10028794 | Ga0207639_100287944 | 166 |
| 783 | 3300026067 | Ga0207678_10000130 | Ga0207678_100001303 | 166 |
| 784 | 3300026067 | Ga0207678_10001418 | Ga0207678_1000141816 | 166 |
| 785 | 3300026067 | Ga0207678_10105876 | Ga0207678_101058764 | 166 |
| 786 | 3300026067 | Ga0207678_11605438 | Ga0207678_116054381 | 166 |
| 787 | 3300026075 | Ga0207708_10088371 | Ga0207708_100883713 | 166 |
| 788 | 3300026078 | Ga0207702_10109070 | Ga0207702_101090704 | 166 |
| 789 | 3300026078 | Ga0207702_10257982 | Ga0207702_102579822 | 166 |
| 790 | 3300026078 | Ga0207702_10291844 | Ga0207702_102918441 | 166 |
| 791 | 3300026088 | Ga0207641_10000287 | Ga0207641_100002873 | 166 |
| 792 | 3300026088 | Ga0207641_10648956 | Ga0207641_106489561 | 166 |
| 793 | 3300026088 | Ga0207641_10830731 | Ga0207641_108307311 | 166 |
| 794 | 3300026088 | Ga0207641_11057882 | Ga0207641_110578822 | 166 |
| 795 | 3300026089 | Ga0207648_10001253 | Ga0207648_100012532 | 166 |
| 796 | 3300026089 | Ga0207648_10031139 | Ga0207648_100311393 | 166 |
| 797 | 3300026095 | Ga0207676_10019296 | Ga0207676_100192963 | 166 |
| 798 | 3300026095 | Ga0207676_10156803 | Ga0207676_101568032 | 166 |
| 799 | 3300026095 | Ga0207676_10433215 | Ga0207676_104332152 | 166 |
| 800 | 3300026116 | Ga0207674_10020692 | Ga0207674_100206923 | 166 |
| 801 | 3300026116 | Ga0207674_10025502 | Ga0207674_100255024 | 166 |
| 802 | 3300026116 | Ga0207674_10027829 | Ga0207674_100278293 | 166 |
| 803 | 3300026118 | Ga0207675_100008545 | Ga0207675_1000085456 | 166 |
| 804 | 3300026118 | Ga0207675_100147149 | Ga0207675_1001471493 | 166 |
| 805 | 3300026121 | Ga0207683_10000217 | Ga0207683_1000021746 | 166 |
| 806 | 3300026121 | Ga0207683_10028620 | Ga0207683_100286203 | 166 |
| 807 | 3300026142 | Ga0207698_10057434 | Ga0207698_100574342 | 166 |
| 808 | 3300026142 | Ga0207698_10102194 | Ga0207698_101021942 | 166 |
| 809 | 3300026142 | Ga0207698_10249849 | Ga0207698_102498492 | 166 |
| 810 | 3300028016 | Ga0265354_1004182 | Ga0265354_10041821 | 166 |
| 811 | 3300028379 | Ga0268266_10008412 | Ga0268266_100084123 | 166 |
| 812 | 3300028379 | Ga0268266_10575144 | Ga0268266_105751442 | 166 |
| 813 | 3300028379 | Ga0268266_10937589 | Ga0268266_109375891 | 166 |
| 814 | 3300028379 | Ga0268266_11726430 | Ga0268266_117264301 | 166 |
| 815 | 3300028380 | Ga0268265_10044706 | Ga0268265_100447063 | 166 |
| 816 | 3300028380 | Ga0268265_10048037 | Ga0268265_100480374 | 166 |
| 817 | 3300028380 | Ga0268265_10450156 | Ga0268265_104501562 | 166 |
| 818 | 3300028381 | Ga0268264_10025038 | Ga0268264_100250382 | 166 |
| 819 | 3300028381 | Ga0268264_10029486 | Ga0268264_100294861 | 166 |
| 820 | 3300028381 | Ga0268264_10077395 | Ga0268264_100773951 | 166 |
| 821 | 3300028381 | Ga0268264_10814500 | Ga0268264_108145002 | 166 |
| 822 | 3300030878 | Ga0265770_1003844 | Ga0265770_10038442 | 166 |
| 823 | 3300030878 | Ga0265770_1015093 | Ga0265770_10150932 | 166 |
| 824 | 3300030879 | Ga0265765_1009051 | Ga0265765_10090512 | 166 |
| 825 | 3300031090 | Ga0265760_10000331 | Ga0265760_100003319 | 166 |
| 826 | 3300031090 | Ga0265760_10092507 | Ga0265760_100925072 | 166 |
| 827 | 3300034816 | Ga0373930_0127190 | Ga0373930_0127190_39_539 | 166 |
| 828 | 3300034819 | Ga0373958_0017263 | Ga0373958_0017263_132_632 | 166 |
| 829 | 3300034957 | Ga0373938_0015032 | Ga0373938_0015032_896_1396 | 166 |
| 830 | 3300035089 | Ga0373944_0245320 | Ga0373944_0245320_86_589 | 166 |
| 831 | 3300035112 | Ga0373932_0170061 | Ga0373932_0170061_44_544 | 166 |
| 832 | 3300035112 | Ga0373932_0212282 | Ga0373932_0212282_84_584 | 166 |
| 833 | 3300035691 | Ga0373931_0658721 | Ga0373931_0658721_61_561 | 166 |
| 834 | 3300035692 | Ga0373935_0151497 | Ga0373935_0151497_967_1467 | 166 |
| 835 | 3300035695 | Ga0373927_0275384 | Ga0373927_0275384_496_999 | 166 |
| 836 | 3300036401 | Ga0373937_0218937 | Ga0373937_0218937_712_1215 | 166 |
| 837 | 3300045051 | Ga0451576_0109127 | Ga0451576_0109127_953_1453 | 166 |
| 838 | 3300045976 | Ga0466967_0075951 | Ga0466967_0075951_1655_2155 | 166 |
| 839 | 3300046455 | Ga0495603_0089785 | Ga0495603_0089785_406_906 | 166 |
| 840 | 3300046472 | Ga0495580_0004216 | Ga0495580_0004216_4814_5314 | 166 |
| 841 | 3300046472 | Ga0495580_0009626 | Ga0495580_0009626_5164_5664 | 166 |
| 842 | 3300046472 | Ga0495580_0028922 | Ga0495580_0028922_3282_3782 | 166 |
| 843 | 3300046472 | Ga0495580_0239685 | Ga0495580_0239685_268_768 | 166 |
| 844 | 3300046499 | Ga0495594_0030407 | Ga0495594_0030407_711_1211 | 166 |
| 845 | 3300046674 | Ga0495588_0052053 | Ga0495588_0052053_11_511 | 166 |
| 846 | 3300046809 | Ga0495600_0180149 | Ga0495600_0180149_30_533 | 166 |
| 847 | 3300048088 | Ga0495602_0194576 | Ga0495602_0194576_330_830 | 166 |
| 848 | 3300048903 | Ga0496100_0009722 | Ga0496100_0009722_3681_4184 | 166 |
| 849 | 3300048903 | Ga0496100_0668647 | Ga0496100_0668647_202_702 | 166 |
| 850 | 3300048903 | Ga0496100_0947093 | Ga0496100_0947093_92_592 | 166 |
| 851 | 3300048904 | Ga0496101_0019851 | Ga0496101_0019851_544_1047 | 166 |
| 852 | 3300048904 | Ga0496101_0029423 | Ga0496101_0029423_1710_2210 | 166 |
| 853 | 3300048904 | Ga0496101_0178095 | Ga0496101_0178095_766_1266 | 166 |
| 854 | 3300048904 | Ga0496101_0210240 | Ga0496101_0210240_869_1369 | 166 |
| 855 | 3300048905 | Ga0496102_0001424 | Ga0496102_0001424_3190_3690 | 166 |
| 856 | 3300048905 | Ga0496102_0032128 | Ga0496102_0032128_415_915 | 166 |
| 857 | 3300048905 | Ga0496102_0092665 | Ga0496102_0092665_1548_2048 | 166 |
| 858 | 3300048905 | Ga0496102_0116975 | Ga0496102_0116975_1632_2132 | 166 |
| 859 | 3300048905 | Ga0496102_0153647 | Ga0496102_0153647_446_946 | 166 |
| 860 | 3300048905 | Ga0496102_0586833 | Ga0496102_0586833_479_982 | 166 |
| 861 | 3300048905 | Ga0496102_1197648 | Ga0496102_1197648_92_592 | 166 |
| 862 | 3300048906 | Ga0496103_0004119 | Ga0496103_0004119_94_594 | 166 |
| 863 | 3300048906 | Ga0496103_0022334 | Ga0496103_0022334_281_781 | 166 |
| 864 | 3300048906 | Ga0496103_0137789 | Ga0496103_0137789_457_957 | 166 |
| 865 | 3300048906 | Ga0496103_0160422 | Ga0496103_0160422_130_630 | 166 |
| 866 | 3300048907 | Ga0496104_0157280 | Ga0496104_0157280_647_1150 | 166 |
| 867 | 3300048907 | Ga0496104_0220356 | Ga0496104_0220356_492_992 | 166 |
| 868 | 3300048907 | Ga0496104_0315597 | Ga0496104_0315597_527_1027 | 166 |
| 869 | 3300048909 | Ga0496106_0056741 | Ga0496106_0056741_261_764 | 166 |
| 870 | 3300048909 | Ga0496106_0068846 | Ga0496106_0068846_275_775 | 166 |
| 871 | 3300048909 | Ga0496106_0083711 | Ga0496106_0083711_878_1378 | 166 |
| 872 | 3300048909 | Ga0496106_0181273 | Ga0496106_0181273_318_818 | 166 |
| 873 | 3300048910 | Ga0496107_0052688 | Ga0496107_0052688_2348_2848 | 166 |
| 874 | 3300048910 | Ga0496107_0069126 | Ga0496107_0069126_1581_2081 | 166 |
| 875 | 3300048911 | Ga0496108_0020285 | Ga0496108_0020285_986_1486 | 166 |
| 876 | 3300048911 | Ga0496108_0043628 | Ga0496108_0043628_740_1240 | 166 |
| 877 | 3300048912 | Ga0496109_0000117 | Ga0496109_0000117_20926_21426 | 166 |
| 878 | 3300048912 | Ga0496109_0054749 | Ga0496109_0054749_3063_3563 | 166 |
| 879 | 3300048912 | Ga0496109_0106106 | Ga0496109_0106106_41_541 | 166 |
| 880 | 3300048913 | Ga0496110_0004256 | Ga0496110_0004256_2099_2599 | 166 |
| 881 | 3300048913 | Ga0496110_0012731 | Ga0496110_0012731_3241_3741 | 166 |
| 882 | 3300048913 | Ga0496110_0115435 | Ga0496110_0115435_1747_2247 | 166 |
| 883 | 3300048914 | Ga0496111_0009763 | Ga0496111_0009763_2621_3121 | 166 |
| 884 | 3300048914 | Ga0496111_0076767 | Ga0496111_0076767_1678_2178 | 166 |
| 885 | 3300048915 | Ga0496112_0000283 | Ga0496112_0000283_2164_2664 | 166 |
| 886 | 3300048915 | Ga0496112_0114302 | Ga0496112_0114302_137_640 | 166 |
| 887 | 3300048915 | Ga0496112_0249986 | Ga0496112_0249986_1074_1574 | 166 |
| 888 | 3300048915 | Ga0496112_0610245 | Ga0496112_0610245_146_646 | 166 |
| 889 | 3300048915 | Ga0496112_0756931 | Ga0496112_0756931_311_811 | 166 |
| 890 | 3300048916 | Ga0496113_0002193 | Ga0496113_0002193_8714_9214 | 166 |
| 891 | 3300048916 | Ga0496113_0024930 | Ga0496113_0024930_1322_1822 | 166 |
| 892 | 3300048918 | Ga0496115_0003148 | Ga0496115_0003148_3898_4401 | 166 |
| 893 | 3300048918 | Ga0496115_0191279 | Ga0496115_0191279_305_805 | 166 |
| 894 | 3300050512 | nmdc:mga0n895_10187_c1 | nmdc:mga0n895_10187_c1_5936_6436 | 166 |
| 895 | 3300050512 | nmdc:mga0n895_539906_c1 | nmdc:mga0n895_539906_c1_218_718 | 166 |
| 896 | 3300050513 | nmdc:mga0rr50_71996_c1 | nmdc:mga0rr50_71996_c1_1255_1755 | 166 |
| 897 | 3300050513 | nmdc:mga0rr50_839055_c1 | nmdc:mga0rr50_839055_c1_177_677 | 166 |
| 898 | 3300050515 | nmdc:mga0a205_223264_c1 | nmdc:mga0a205_223264_c1_346_846 | 166 |
| 899 | 3300053084 | Ga0495595_0053173 | Ga0495595_0053173_1271_1774 | 166 |
| 900 | 3300053085 | Ga0495619_0197349 | Ga0495619_0197349_747_1250 | 166 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3iic-assembly1.cif.gz_B | crystal structure of chec-like superfamily protein (yp_001095400.1) from shewanella sp. pv-4 at 2.13 a resolution | 0.8766 | 1 | 150 |
| 1squ-assembly1.cif.gz_A | structural genomics, crystal structure of the chex protein from thermotoga maritima | 0.8579 | 1 | 151 |
| 3iic-assembly1.cif.gz_B | crystal structure of chec-like superfamily protein (yp_001095400.1) from shewanella sp. pv-4 at 2.13 a resolution | 0.8504 | 1 | 150 |
| 1squ-assembly1.cif.gz_A | structural genomics, crystal structure of the chex protein from thermotoga maritima | 0.8474 | 1 | 151 |
| 3hzh-assembly1.cif.gz_B | crystal structure of the chex-chey-bef3-mg+2 complex from borrelia burgdorferi | 0.8464 | 6 | 151 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3hm4A00 | Alpha Beta;3-Layer(aba) Sandwich;Chemotaxis protein chec;CheC-like | 0.8353 | 3 | 150 | 3.40.1550.10 |
| 1xkoA00 | Alpha Beta;3-Layer(aba) Sandwich;Chemotaxis protein chec;CheC-like | 0.8294 | 1 | 151 | 3.40.1550.10 |
| 1xkoA00 | Alpha Beta;3-Layer(aba) Sandwich;Chemotaxis protein chec;CheC-like | 0.8196 | 1 | 151 | 3.40.1550.10 |
| 3hm4A00 | Alpha Beta;3-Layer(aba) Sandwich;Chemotaxis protein chec;CheC-like | 0.8093 | 3 | 150 | 3.40.1550.10 |
| 3hzhB00 | Alpha Beta;3-Layer(aba) Sandwich;Chemotaxis protein chec;CheC-like | 0.7988 | 6 | 151 | 3.40.1550.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2V9MT73-F1-model_v4 | Chemotaxis protein CheX | 0.9818 | 1 | 149 |
GO:0006935
|
| AF-A0A2V9MT73-F1-model_v4 | Chemotaxis protein CheX | 0.969 | 1 | 149 |
GO:0006935
|
| AF-A0A1Y2T7J3-F1-model_v4 | Chemotaxis protein | 0.941 | 1 | 119 |
GO:0006935
|
| AF-A0A1Y2T7J3-F1-model_v4 | Chemotaxis protein | 0.9335 | 1 | 119 |
GO:0006935
|
| AF-A0A353BHD7-F1-model_v4 | Chemotaxis protein CheX | 0.9279 | 1 | 154 |
GO:0006935
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar