F485154
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 900 | 372 | 859 | 381 |
Family's Representative Sequence
| Representative Sequence | 3300049589|Ga0501073_0006743|Ga0501073_0006743_2687_3814 |
| Length | 375 |
| Sequence | MQIETKLPKVGTTIFTVMSQLAQEHKAVNLGQGFPDFDGPQALRDALTAAMNAGRNQYAPMTGLPALREQIAKKTEALYGRKVNPDTDITVTSGATEALFAAIAAIVRPGDEVIVLDPCYDSYEPAIELNGGRAVHVPLDPRDFSPDWKRVRAAITPKTRMILVNTPHNPCGAVFTADDLDDRDIVVLSDEVYEHIVFDGKPHQGVLRHAELADRSFVVSSFGKTYHCTGWKVGYCVAPRSLSAEFRKVHQYLTFCTFTPAQVAFAEILEKDPQHYLDLPAFYQQKRDRFRDLLSGSKFRPLPVGGAYFQVVDYSALDGRDDLAFCEWLVKEGGVAAIPISAFYESPPPDQRLIRFCFAKSDATLEEAAKRLRAL |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2576861471 | Stenotrophomonas rhizophila DSM 14405 | Isolate | Rhizosphere |
| 2 | 2593339238 | Luteibacter sp. UNCMF366Tsu5.1 | Isolate | Unclassified |
| 3 | 2593339239 | Luteibacter sp. UNCMF331Sha3.1 | Isolate | Unclassified |
| 4 | 2643221577 | Rhodanobacter sp. Root627 | Isolate | Unclassified |
| 5 | 2643221685 | Rhodanobacter sp. Root480 | Isolate | Unclassified |
| 6 | 2718218334 | Luteibacter rhizovicinus LJ96 | Isolate | Rhizosphere |
| 7 | 2734482264 | Dyella sp. AD052 | Isolate | Unclassified |
| 8 | 2738543009 | Luteibacter sp. OK325 | Isolate | Unclassified |
| 9 | 2739367700 | Dyella sp. YR388 | Isolate | Unclassified |
| 10 | 2747842428 | Stenotrophomonas sp. WCS2014-113 | Isolate | Unclassified |
| 11 | 2765235840 | Stenotrophomonas maltophilia AA1 | Isolate | Unclassified |
| 12 | 2818991440 | Luteibacter yeojuensis 583 | Isolate | Unclassified |
| 13 | 2818991457 | Xanthomonas translucens 569 | Isolate | Unclassified |
| 14 | 2842757796 | Stenotrophomonas sp. R-72406 | Isolate | Unclassified |
| 15 | 2842914999 | Luteibacter sp. R-72151 | Isolate | Unclassified |
| 16 | 2842918807 | Luteibacter sp. R-73110 | Isolate | Unclassified |
| 17 | 2852684882 | Xanthomonas sp. JAI131 | Isolate | Rhizosphere |
| 18 | 2857442823 | Stenotrophomonas sp. R-74235 | Isolate | Unclassified |
| 19 | 2874220319 | Stenotrophomonas maltophilia PS5 | Isolate | Unclassified |
| 20 | 2884338543 | Luteibacter pinisoli MAH-14 | Isolate | Rhizosphere |
| 21 | 2884411467 | Dyella sp. AD56 | Isolate | Rhizosphere |
| 22 | 2904463128 | Luteibacter yeojuensis 3191 | Isolate | Unclassified |
| 23 | 2919085039 | Luteibacter sp. 1214 | Isolate | Unclassified |
| 24 | 2919089067 | Stenotrophomonas sp. 1337 | Isolate | Rhizosphere |
| 25 | 2919130084 | Xanthomonas sp. 1678 | Isolate | Rhizosphere |
| 26 | 2919404418 | Luteibacter sp. 3190 | Isolate | Unclassified |
| 27 | 2928496128 | Stenotrophomonas indicatrix 1163 | Isolate | Unclassified |
| 28 | 2928963466 | Dyella japonica 1073 | Isolate | Unclassified |
| 29 | 2929195423 | Xanthomonas sp. R-73098 Hybrid assembly | Isolate | Unclassified |
| 30 | 2931380184 | Stenotrophomonas sp. DR822 | Isolate | Rhizosphere |
| 31 | 2937610967 | Stenotrophomonas maltophilia EP20 | Isolate | Unclassified |
| 32 | 2939589442 | Stenotrophomonas rhizophila 716 | Isolate | Rhizosphere |
| 33 | 2939611941 | Rhodanobacter soli 1757 | Isolate | Rhizosphere |
| 34 | 2939622612 | Stenotrophomonas sp. 2619 | Isolate | Rhizosphere |
| 35 | 2939626828 | Stenotrophomonas sp. 2694 | Isolate | Rhizosphere |
| 36 | 2941471342 | Luteibacter sp. 621 | Isolate | Unclassified |
| 37 | 2953994433 | Luteibacter sp. W1I16 | Isolate | Rhizosphere |
| 38 | 2961047084 | Stenotrophomonas maltophilia EP5 | Isolate | Unclassified |
| 39 | 2974307012 | Stenotrophomonas sp. SORGH_AS_0282 | Isolate | Unclassified |
| 40 | 2977247770 | Stenotrophomonas rhizophila SORGH_AS 457 | Isolate | Unclassified |
| 41 | 2984514374 | Stenotrophomonas sp. SORGH_AS282 | Isolate | Aerial Root |
| 42 | 3300001904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 | Metagenome | Rhizosphere |
| 43 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 44 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 45 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 46 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 47 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 48 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 49 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 50 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 51 | 3300002771 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB | Metagenome | Endosphere |
| 52 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 53 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 54 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 55 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 56 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 57 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 58 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 59 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 60 | 3300003760 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 | Metagenome | Endosphere |
| 61 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 62 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 63 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 64 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 65 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 66 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 67 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 68 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 69 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 70 | 3300003856 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz | Metagenome | Rhizosphere |
| 71 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 72 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 74 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 76 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 78 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 79 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 80 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 81 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 82 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 83 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 84 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 85 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 86 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 87 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 88 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 89 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 90 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 91 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 92 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 93 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 94 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 95 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 96 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 97 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 98 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 99 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 100 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 101 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 102 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 103 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 104 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 105 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 106 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 107 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 108 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 109 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 110 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 111 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 112 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 113 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 114 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 115 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 116 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 117 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 118 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 119 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 120 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 122 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 123 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 125 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 126 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 127 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 128 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 129 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 130 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 131 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 132 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 133 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 134 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 135 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 136 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 137 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 138 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 139 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 140 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 141 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 142 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 143 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 144 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 145 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 146 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 147 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 148 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 149 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 150 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 151 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 152 | 3300015687 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 | Metagenome | Rhizosphere |
| 153 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 154 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 155 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 156 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 157 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 158 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 159 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 160 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 161 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 162 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 163 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 164 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 165 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 166 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 167 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 168 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 169 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 170 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 171 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 172 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 173 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 174 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 175 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 176 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 177 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 178 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 179 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 180 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 181 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 182 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 183 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 234 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 235 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 236 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 237 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 238 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 239 | 3300030742 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 | Metagenome | Rhizosphere |
| 240 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 241 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 242 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 243 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 244 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 245 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 246 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 247 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 248 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 249 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 250 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 251 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 252 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 253 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 254 | 3300038705 | Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 | Metagenome | Unclassified |
| 255 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 256 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 257 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 258 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 259 | 3300041462 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG | Metagenome | Rhizoplane |
| 260 | 3300041463 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG | Metagenome | Rhizoplane |
| 261 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 262 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 263 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 264 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 265 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 266 | 3300042132 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_070716_133 | Metagenome | Rhizosphere |
| 267 | 3300042133 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 | Metagenome | Rhizosphere |
| 268 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 269 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 270 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 271 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 272 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 273 | 3300044672 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E | Metagenome | Unclassified |
| 274 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 275 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 276 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 277 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 278 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 279 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 280 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 281 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 282 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 283 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 284 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 285 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 314 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 315 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 316 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 317 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 318 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 319 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 320 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 321 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 322 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 323 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 324 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 325 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 326 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 329 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 330 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 331 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 332 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 333 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 334 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 335 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 336 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 337 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 338 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 339 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 340 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 341 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 342 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 343 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 344 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 345 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 346 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 347 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 348 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 349 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 350 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 351 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 352 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 353 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 354 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 355 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 356 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 357 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 358 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 359 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 360 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 361 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 362 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 363 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 364 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 365 | 3300053120 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere | Metagenome | Endosphere |
| 366 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 367 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 368 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 369 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 370 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 371 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 372 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 94.67 |
| Metatranscriptomes | 0.78 |
| Isolates | 4.56 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.11 |
| Bulb | 0 |
| Endosphere | 13.11 |
| Nodule | 0 |
| Rhizoplane | 1.11 |
| Rhizosphere | 73.78 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 11.89 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24736J21556_1004702 | 3300001904 | Bacteria | 2320 |
| 2 | JGI24741J21665_1000222 | 3300001915 | Bacteria | 17088 |
| 3 | JGI24741J21665_1004101 | 3300001915 | Bacteria | 3304 |
| 4 | JGI24741J21665_1005082 | 3300001915 | Bacteria | 2811 |
| 5 | JGI24740J21852_10001834 | 3300001979 | Bacteria | 9726 |
| 6 | JGI24740J21852_10002844 | 3300001979 | Bacteria | 7737 |
| 7 | JGI24740J21852_10005375 | 3300001979 | Bacteria | 5425 |
| 8 | JGI24739J22299_10000752 | 3300001989 | Bacteria | 11806 |
| 9 | JGI24737J22298_10000922 | 3300001990 | Bacteria | 10448 |
| 10 | JGI24735J21928_10003438 | 3300002067 | Bacteria | 5393 |
| 11 | JGI24735J21928_10007930 | 3300002067 | Bacteria | 3449 |
| 12 | JGI25156J39149_1005799 | 3300002705 | Bacteria | 3493 |
| 13 | JGI25162J39368_1000048 | 3300002737 | Bacteria | 159652 |
| 14 | JGI25162J39368_1000665 | 3300002737 | Bacteria | 24271 |
| 15 | JGI25162J39368_1000810 | 3300002737 | Bacteria | 20701 |
| 16 | JGI25162J39368_1001000 | 3300002737 | Bacteria | 17747 |
| 17 | JGI25162J39368_1003917 | 3300002737 | Bacteria | 3838 |
| 18 | JGI25157J39369_1000269 | 3300002741 | Bacteria | 37975 |
| 19 | JGI25157J39369_1000582 | 3300002741 | Bacteria | 21574 |
| 20 | JGI25157J39369_1001539 | 3300002741 | Bacteria | 8345 |
| 21 | JGI25157J39369_1002682 | 3300002741 | Bacteria | 4147 |
| 22 | JGI25163J39215_1000651 | 3300002771 | Bacteria | 9382 |
| 23 | JGI25164J39214_1000085 | 3300002772 | Bacteria | 92776 |
| 24 | JGI25164J39214_1000284 | 3300002772 | Bacteria | 35665 |
| 25 | JGI25165J46597_1000009 | 3300003214 | Bacteria | 467965 |
| 26 | JGI25165J46597_1000090 | 3300003214 | Bacteria | 168833 |
| 27 | JGI25153J46596_10017182 | 3300003215 | Bacteria | 2861 |
| 28 | Ga0006562J51391_1191774 | 3300003578 | Bacteria | 6298 |
| 29 | Ga0006562J51391_1191776 | 3300003578 | Bacteria | 2480 |
| 30 | Ga0055538_1002276 | 3300003751 | Bacteria | 2925 |
| 31 | Ga0055539_1000667 | 3300003752 | Bacteria | 9030 |
| 32 | Ga0055533_1000487 | 3300003756 | Bacteria | 14705 |
| 33 | Ga0055533_1001318 | 3300003756 | Bacteria | 6736 |
| 34 | Ga0055525_1000097 | 3300003759 | Bacteria | 137371 |
| 35 | Ga0055527_1000677 | 3300003760 | Bacteria | 10204 |
| 36 | Ga0055527_1000689 | 3300003760 | Bacteria | 9874 |
| 37 | Ga0055527_1001726 | 3300003760 | Bacteria | 4232 |
| 38 | Ga0055535_1000016 | 3300003761 | Bacteria | 252398 |
| 39 | Ga0055535_1001167 | 3300003761 | Bacteria | 15414 |
| 40 | Ga0055535_1001556 | 3300003761 | Bacteria | 11182 |
| 41 | Ga0055535_1001670 | 3300003761 | Bacteria | 10202 |
| 42 | Ga0055535_1001681 | 3300003761 | Bacteria | 10147 |
| 43 | Ga0055535_1001685 | 3300003761 | Bacteria | 10119 |
| 44 | Ga0055542_1000045 | 3300003762 | Bacteria | 203558 |
| 45 | Ga0055542_1000098 | 3300003762 | Bacteria | 117711 |
| 46 | Ga0055542_1001145 | 3300003762 | Bacteria | 15627 |
| 47 | Ga0055542_1001620 | 3300003762 | Bacteria | 10202 |
| 48 | Ga0055542_1001628 | 3300003762 | Bacteria | 10147 |
| 49 | Ga0055542_1001632 | 3300003762 | Bacteria | 10112 |
| 50 | Ga0055529_1000020 | 3300003763 | Bacteria | 324857 |
| 51 | Ga0055529_1001211 | 3300003763 | Bacteria | 10147 |
| 52 | Ga0055529_1001215 | 3300003763 | Bacteria | 10116 |
| 53 | Ga0055529_1001245 | 3300003763 | Bacteria | 9468 |
| 54 | Ga0055526_1000263 | 3300003771 | Bacteria | 44141 |
| 55 | Ga0055526_1002377 | 3300003771 | Bacteria | 12752 |
| 56 | Ga0055537_1000164 | 3300003773 | Bacteria | 49285 |
| 57 | Ga0055524_1016320 | 3300003775 | Bacteria | 2669 |
| 58 | Ga0055536_1001874 | 3300003781 | Bacteria | 12248 |
| 59 | Ga0055534_1000026 | 3300003784 | Bacteria | 130908 |
| 60 | Ga0055530_10000772 | 3300003791 | Bacteria | 26697 |
| 61 | Ga0058692_1000006 | 3300003856 | Bacteria | 398109 |
| 62 | Ga0058692_1000012 | 3300003856 | Bacteria | 318930 |
| 63 | Ga0065165_1000001 | 3300005262 | Bacteria | 494087 |
| 64 | Ga0065165_1000940 | 3300005262 | Bacteria | 37166 |
| 65 | Ga0070658_10002041 | 3300005327 | Bacteria | 16931 |
| 66 | Ga0070658_10068626 | 3300005327 | Bacteria | 2899 |
| 67 | Ga0070658_10133566 | 3300005327 | Bacteria | 2069 |
| 68 | Ga0070690_100110876 | 3300005330 | Bacteria | 1831 |
| 69 | Ga0070670_100000002 | 3300005331 | Bacteria | 568775 |
| 70 | Ga0070670_100145951 | 3300005331 | Bacteria | 2047 |
| 71 | Ga0068869_100037648 | 3300005334 | Bacteria | 3441 |
| 72 | Ga0070666_10000034 | 3300005335 | Bacteria | 121537 |
| 73 | Ga0070666_10000349 | 3300005335 | Bacteria | 28972 |
| 74 | Ga0070666_10004505 | 3300005335 | Bacteria | 8489 |
| 75 | Ga0070666_10006812 | 3300005335 | Bacteria | 7040 |
| 76 | Ga0070666_10026150 | 3300005335 | Bacteria | 3810 |
| 77 | Ga0070680_100000209 | 3300005336 | Bacteria | 38470 |
| 78 | Ga0070680_100001172 | 3300005336 | Bacteria | 18843 |
| 79 | Ga0070680_100095324 | 3300005336 | Bacteria | 2467 |
| 80 | Ga0070682_100016224 | 3300005337 | Bacteria | 4328 |
| 81 | Ga0070682_100023562 | 3300005337 | Bacteria | 3655 |
| 82 | Ga0070660_100071018 | 3300005339 | Bacteria | 2718 |
| 83 | Ga0070660_100076743 | 3300005339 | Bacteria | 2617 |
| 84 | Ga0070691_10009542 | 3300005341 | Bacteria | 4431 |
| 85 | Ga0070661_100001611 | 3300005344 | Bacteria | 15612 |
| 86 | Ga0070661_100006432 | 3300005344 | Bacteria | 8102 |
| 87 | Ga0070661_100008490 | 3300005344 | Bacteria | 7105 |
| 88 | Ga0070661_100043425 | 3300005344 | Bacteria | 3283 |
| 89 | Ga0070692_10001030 | 3300005345 | Bacteria | 9605 |
| 90 | Ga0070668_100020437 | 3300005347 | Bacteria | 4997 |
| 91 | Ga0070668_100096721 | 3300005347 | Bacteria | 2334 |
| 92 | Ga0070668_100201816 | 3300005347 | Bacteria | 1632 |
| 93 | Ga0070669_100008381 | 3300005353 | Bacteria | 7375 |
| 94 | Ga0070669_100210889 | 3300005353 | Bacteria | 1532 |
| 95 | Ga0070675_100198263 | 3300005354 | Bacteria | 1742 |
| 96 | Ga0070671_100000071 | 3300005355 | Bacteria | 65048 |
| 97 | Ga0070674_100194024 | 3300005356 | Bacteria | 1564 |
| 98 | Ga0070659_100020340 | 3300005366 | Bacteria | 5040 |
| 99 | Ga0070659_100079503 | 3300005366 | Bacteria | 2617 |
| 100 | Ga0070667_100000005 | 3300005367 | Bacteria | 347268 |
| 101 | Ga0070667_100000007 | 3300005367 | Bacteria | 292130 |
| 102 | Ga0070667_100076048 | 3300005367 | Bacteria | 2866 |
| 103 | Ga0070667_100120315 | 3300005367 | Bacteria | 2283 |
| 104 | Ga0070714_100001173 | 3300005435 | Bacteria | 18879 |
| 105 | Ga0070713_100000486 | 3300005436 | Bacteria | 25305 |
| 106 | Ga0070663_100009827 | 3300005455 | Bacteria | 5943 |
| 107 | Ga0070663_100019628 | 3300005455 | Bacteria | 4461 |
| 108 | Ga0070663_100021767 | 3300005455 | Bacteria | 4271 |
| 109 | Ga0070663_100058261 | 3300005455 | Bacteria | 2773 |
| 110 | Ga0070663_100080133 | 3300005455 | Bacteria | 2397 |
| 111 | Ga0070678_100012770 | 3300005456 | Bacteria | 5237 |
| 112 | Ga0070678_100033970 | 3300005456 | Bacteria | 3547 |
| 113 | Ga0070678_100086612 | 3300005456 | Bacteria | 2390 |
| 114 | Ga0070662_100023627 | 3300005457 | Bacteria | 4225 |
| 115 | Ga0070662_100087991 | 3300005457 | Bacteria | 2327 |
| 116 | Ga0070681_10000007 | 3300005458 | Bacteria | 159821 |
| 117 | Ga0070681_10000397 | 3300005458 | Bacteria | 35263 |
| 118 | Ga0070681_10000998 | 3300005458 | Bacteria | 23956 |
| 119 | Ga0070681_10017959 | 3300005458 | Bacteria | 7070 |
| 120 | Ga0068867_100005929 | 3300005459 | Bacteria | 8667 |
| 121 | Ga0070685_10000275 | 3300005466 | Bacteria | 33104 |
| 122 | Ga0070679_100000412 | 3300005530 | Bacteria | 36448 |
| 123 | Ga0070679_100004197 | 3300005530 | Bacteria | 13289 |
| 124 | Ga0070679_100014507 | 3300005530 | Bacteria | 7569 |
| 125 | Ga0070679_100084989 | 3300005530 | Bacteria | 3151 |
| 126 | Ga0070679_100109154 | 3300005530 | Bacteria | 2753 |
| 127 | Ga0070679_100231057 | 3300005530 | Bacteria | 1809 |
| 128 | Ga0068853_100000206 | 3300005539 | Bacteria | 41721 |
| 129 | Ga0068853_100003817 | 3300005539 | Bacteria | 11543 |
| 130 | Ga0068853_100010874 | 3300005539 | Bacteria | 7374 |
| 131 | Ga0068853_100013551 | 3300005539 | Bacteria | 6663 |
| 132 | Ga0068853_100013620 | 3300005539 | Bacteria | 6646 |
| 133 | Ga0068853_100014698 | 3300005539 | Bacteria | 6421 |
| 134 | Ga0068853_100071311 | 3300005539 | Bacteria | 3025 |
| 135 | Ga0070696_100041500 | 3300005546 | Bacteria | 3179 |
| 136 | Ga0070696_100090932 | 3300005546 | Bacteria | 2172 |
| 137 | Ga0070696_100217777 | 3300005546 | Bacteria | 1431 |
| 138 | Ga0070693_100011214 | 3300005547 | Bacteria | 4510 |
| 139 | Ga0070665_100000057 | 3300005548 | Bacteria | 237271 |
| 140 | Ga0070665_100000227 | 3300005548 | Bacteria | 93439 |
| 141 | Ga0070665_100034667 | 3300005548 | Bacteria | 5076 |
| 142 | Ga0070665_100049290 | 3300005548 | Bacteria | 4226 |
| 143 | Ga0070665_100083170 | 3300005548 | Bacteria | 3206 |
| 144 | Ga0070665_100098700 | 3300005548 | Bacteria | 2925 |
| 145 | Ga0070665_100102185 | 3300005548 | Bacteria | 2870 |
| 146 | Ga0070665_100113007 | 3300005548 | Bacteria | 2719 |
| 147 | Ga0070665_100122132 | 3300005548 | Bacteria | 2606 |
| 148 | Ga0068855_100003573 | 3300005563 | Bacteria | 19011 |
| 149 | Ga0068855_100004858 | 3300005563 | Bacteria | 16409 |
| 150 | Ga0068855_100012573 | 3300005563 | Bacteria | 10217 |
| 151 | Ga0068855_100014971 | 3300005563 | Bacteria | 9342 |
| 152 | Ga0068855_100120621 | 3300005563 | Bacteria | 3001 |
| 153 | Ga0070664_100092394 | 3300005564 | Bacteria | 2620 |
| 154 | Ga0068857_100001801 | 3300005577 | Bacteria | 17237 |
| 155 | Ga0068857_100039809 | 3300005577 | Bacteria | 4165 |
| 156 | Ga0068857_100057497 | 3300005577 | Bacteria | 3452 |
| 157 | Ga0068854_100000774 | 3300005578 | Bacteria | 18996 |
| 158 | Ga0068854_100005461 | 3300005578 | Bacteria | 8028 |
| 159 | Ga0068854_100009017 | 3300005578 | Bacteria | 6428 |
| 160 | Ga0068854_100197937 | 3300005578 | Bacteria | 1578 |
| 161 | Ga0068856_100000310 | 3300005614 | Bacteria | 53426 |
| 162 | Ga0068856_100001563 | 3300005614 | Bacteria | 23973 |
| 163 | Ga0068856_100128167 | 3300005614 | Bacteria | 2541 |
| 164 | Ga0068856_100147658 | 3300005614 | Bacteria | 2359 |
| 165 | Ga0068856_100174181 | 3300005614 | Bacteria | 2164 |
| 166 | Ga0068852_100006743 | 3300005616 | Bacteria | 8330 |
| 167 | Ga0068852_100010358 | 3300005616 | Bacteria | 6964 |
| 168 | Ga0068852_100015345 | 3300005616 | Bacteria | 5936 |
| 169 | Ga0068852_100016190 | 3300005616 | Bacteria | 5806 |
| 170 | Ga0068852_100100870 | 3300005616 | Bacteria | 2605 |
| 171 | Ga0068859_100001188 | 3300005617 | Bacteria | 26597 |
| 172 | Ga0068859_100087241 | 3300005617 | Bacteria | 3168 |
| 173 | Ga0068859_100089097 | 3300005617 | Bacteria | 3135 |
| 174 | Ga0068859_100134405 | 3300005617 | Bacteria | 2545 |
| 175 | Ga0068864_100000003 | 3300005618 | Bacteria | 568775 |
| 176 | Ga0068861_100079415 | 3300005719 | Bacteria | 2565 |
| 177 | Ga0068851_10001367 | 3300005834 | Bacteria | 10634 |
| 178 | Ga0068851_10004040 | 3300005834 | Bacteria | 6586 |
| 179 | Ga0068851_10004918 | 3300005834 | Bacteria | 6058 |
| 180 | Ga0068863_100000773 | 3300005841 | Bacteria | 32109 |
| 181 | Ga0068863_100286884 | 3300005841 | Bacteria | 1595 |
| 182 | Ga0068858_100042553 | 3300005842 | Bacteria | 4211 |
| 183 | Ga0068858_100187011 | 3300005842 | Bacteria | 1956 |
| 184 | Ga0068860_100004261 | 3300005843 | Bacteria | 14649 |
| 185 | Ga0068862_100000548 | 3300005844 | Bacteria | 39395 |
| 186 | Ga0068862_100005287 | 3300005844 | Bacteria | 10818 |
| 187 | Ga0068862_100255905 | 3300005844 | Bacteria | 1597 |
| 188 | Ga0068862_100292956 | 3300005844 | Bacteria | 1495 |
| 189 | Ga0081540_1003991 | 3300005983 | Bacteria | 11440 |
| 190 | Ga0075364_10131251 | 3300006051 | Bacteria | 1681 |
| 191 | Ga0075369_10004497 | 3300006186 | Bacteria | 5156 |
| 192 | Ga0097621_100029605 | 3300006237 | Bacteria | 4326 |
| 193 | Ga0097621_100111918 | 3300006237 | Bacteria | 2307 |
| 194 | Ga0075431_100069913 | 3300006847 | Bacteria | 3622 |
| 195 | Ga0068865_100009828 | 3300006881 | Bacteria | 5940 |
| 196 | Ga0068865_100048270 | 3300006881 | Bacteria | 2929 |
| 197 | Ga0097620_100001188 | 3300006931 | Bacteria | 26597 |
| 198 | Ga0097620_100087241 | 3300006931 | Bacteria | 3168 |
| 199 | Ga0097620_100089103 | 3300006931 | Bacteria | 3135 |
| 200 | Ga0097620_100134403 | 3300006931 | Bacteria | 2545 |
| 201 | Ga0105251_10007635 | 3300009011 | Bacteria | 6622 |
| 202 | Ga0105240_10004166 | 3300009093 | Bacteria | 22164 |
| 203 | Ga0105240_10092908 | 3300009093 | Bacteria | 3683 |
| 204 | Ga0105240_10096470 | 3300009093 | Bacteria | 3603 |
| 205 | Ga0105240_10097179 | 3300009093 | Bacteria | 3589 |
| 206 | Ga0105240_10109408 | 3300009093 | Bacteria | 3346 |
| 207 | Ga0105240_10115149 | 3300009093 | Bacteria | 3246 |
| 208 | Ga0105240_10298749 | 3300009093 | Bacteria | 1843 |
| 209 | Ga0105245_10090266 | 3300009098 | Bacteria | 2818 |
| 210 | Ga0105247_10011228 | 3300009101 | Bacteria | 5403 |
| 211 | Ga0105243_10057514 | 3300009148 | Bacteria | 3097 |
| 212 | Ga0105241_10003106 | 3300009174 | Bacteria | 12356 |
| 213 | Ga0105241_10005656 | 3300009174 | Bacteria | 9223 |
| 214 | Ga0105241_10162852 | 3300009174 | Bacteria | 1835 |
| 215 | Ga0105242_10404173 | 3300009176 | Bacteria | 1275 |
| 216 | Ga0105248_10001462 | 3300009177 | Bacteria | 26311 |
| 217 | Ga0105248_10198295 | 3300009177 | Bacteria | 2262 |
| 218 | Ga0105237_10000250 | 3300009545 | Bacteria | 76317 |
| 219 | Ga0105237_10000701 | 3300009545 | Bacteria | 46447 |
| 220 | Ga0105237_10002972 | 3300009545 | Bacteria | 20494 |
| 221 | Ga0105238_10001647 | 3300009551 | Bacteria | 22393 |
| 222 | Ga0105238_10003680 | 3300009551 | Bacteria | 15278 |
| 223 | Ga0105238_10010010 | 3300009551 | Bacteria | 9512 |
| 224 | Ga0105238_10034239 | 3300009551 | Bacteria | 5169 |
| 225 | Ga0105238_10128450 | 3300009551 | Bacteria | 2513 |
| 226 | Ga0105238_10196202 | 3300009551 | Bacteria | 1995 |
| 227 | Ga0105238_10299083 | 3300009551 | Bacteria | 1593 |
| 228 | Ga0105249_10000763 | 3300009553 | Bacteria | 28922 |
| 229 | Ga0105249_10009268 | 3300009553 | Bacteria | 8608 |
| 230 | Ga0105249_10128256 | 3300009553 | Bacteria | 2418 |
| 231 | Ga0105239_10003089 | 3300010375 | Bacteria | 20669 |
| 232 | Ga0105239_10011101 | 3300010375 | Bacteria | 10053 |
| 233 | Ga0105239_10027103 | 3300010375 | Bacteria | 6308 |
| 234 | Ga0105239_10044717 | 3300010375 | Bacteria | 4853 |
| 235 | Ga0105239_10076582 | 3300010375 | Bacteria | 3679 |
| 236 | Ga0105239_10109250 | 3300010375 | Bacteria | 3065 |
| 237 | Ga0157373_10057570 | 3300013100 | Bacteria | 2757 |
| 238 | Ga0157373_10210362 | 3300013100 | Bacteria | 1371 |
| 239 | Ga0157373_10210593 | 3300013100 | Bacteria | 1371 |
| 240 | Ga0157371_10000400 | 3300013102 | Bacteria | 54327 |
| 241 | Ga0157371_10005810 | 3300013102 | Bacteria | 10324 |
| 242 | Ga0157371_10020709 | 3300013102 | Bacteria | 4837 |
| 243 | Ga0157371_10098820 | 3300013102 | Bacteria | 2070 |
| 244 | Ga0157370_10000204 | 3300013104 | Bacteria | 75030 |
| 245 | Ga0157370_10006775 | 3300013104 | Bacteria | 12568 |
| 246 | Ga0157370_10065744 | 3300013104 | Bacteria | 3430 |
| 247 | Ga0157370_10157804 | 3300013104 | Bacteria | 2111 |
| 248 | Ga0157369_10004267 | 3300013105 | Bacteria | 16901 |
| 249 | Ga0157369_10014816 | 3300013105 | Bacteria | 8798 |
| 250 | Ga0157369_10108550 | 3300013105 | Bacteria | 2952 |
| 251 | Ga0157369_10361418 | 3300013105 | Bacteria | 1507 |
| 252 | Ga0157374_10009835 | 3300013296 | Bacteria | 8207 |
| 253 | Ga0157378_10000742 | 3300013297 | Bacteria | 30520 |
| 254 | Ga0163162_10000106 | 3300013306 | Bacteria | 74934 |
| 255 | Ga0163162_10033814 | 3300013306 | Bacteria | 5082 |
| 256 | Ga0163162_10053513 | 3300013306 | Bacteria | 4057 |
| 257 | Ga0157372_10000445 | 3300013307 | Bacteria | 45478 |
| 258 | Ga0157372_10003420 | 3300013307 | Bacteria | 17127 |
| 259 | Ga0157372_10007949 | 3300013307 | Bacteria | 11273 |
| 260 | Ga0157372_10043583 | 3300013307 | Bacteria | 4968 |
| 261 | Ga0157372_10065011 | 3300013307 | Bacteria | 4094 |
| 262 | Ga0157372_10068579 | 3300013307 | Bacteria | 3987 |
| 263 | Ga0157375_10003145 | 3300013308 | Bacteria | 14336 |
| 264 | Ga0157375_10074274 | 3300013308 | Bacteria | 3421 |
| 265 | Ga0163163_10000031 | 3300014325 | Bacteria | 169040 |
| 266 | Ga0163163_10000863 | 3300014325 | Bacteria | 25845 |
| 267 | Ga0163163_10013489 | 3300014325 | Bacteria | 7486 |
| 268 | Ga0163163_10089563 | 3300014325 | Bacteria | 3089 |
| 269 | Ga0182008_10000123 | 3300014497 | Bacteria | 58726 |
| 270 | Ga0182008_10001033 | 3300014497 | Bacteria | 19349 |
| 271 | Ga0157379_10004344 | 3300014968 | Bacteria | 12122 |
| 272 | Ga0157379_10039177 | 3300014968 | Bacteria | 4228 |
| 273 | Ga0157376_10001616 | 3300014969 | Bacteria | 14902 |
| 274 | Ga0157376_10023869 | 3300014969 | Bacteria | 4795 |
| 275 | Ga0182006_1000005 | 3300015261 | Bacteria | 621201 |
| 276 | Ga0182006_1002024 | 3300015261 | Bacteria | 11384 |
| 277 | Ga0182007_10006316 | 3300015262 | Bacteria | 5097 |
| 278 | Ga0182005_1000004 | 3300015265 | Bacteria | 609645 |
| 279 | Ga0182005_1000611 | 3300015265 | Bacteria | 17260 |
| 280 | Ga0182005_1001305 | 3300015265 | Bacteria | 10217 |
| 281 | Ga0182005_1005449 | 3300015265 | Bacteria | 3975 |
| 282 | Ga0183368_1004 | 3300015687 | Bacteria | 1211761 |
| 283 | Ga0163161_10001879 | 3300017792 | Bacteria | 15327 |
| 284 | Ga0163161_10002326 | 3300017792 | Bacteria | 13623 |
| 285 | Ga0163161_10004817 | 3300017792 | Bacteria | 9403 |
| 286 | Ga0206350_11099119 | 3300020080 | Bacteria | 3094 |
| 287 | Ga0206353_11265797 | 3300020082 | Bacteria | 2224 |
| 288 | Ga0154015_1194426 | 3300020610 | Bacteria | 3262 |
| 289 | Ga0154015_1205975 | 3300020610 | Bacteria | 3374 |
| 290 | Ga0224712_10026609 | 3300022467 | Bacteria | 2047 |
| 291 | Ga0209784_100013 | 3300025224 | Bacteria | 518664 |
| 292 | Ga0209674_100062 | 3300025226 | Bacteria | 276316 |
| 293 | Ga0209674_100108 | 3300025226 | Bacteria | 150893 |
| 294 | Ga0209674_100193 | 3300025226 | Bacteria | 65447 |
| 295 | Ga0209674_100776 | 3300025226 | Bacteria | 10798 |
| 296 | Ga0209674_102155 | 3300025226 | Bacteria | 4431 |
| 297 | Ga0209672_100007 | 3300025228 | Bacteria | 959482 |
| 298 | Ga0209672_100078 | 3300025228 | Bacteria | 156926 |
| 299 | Ga0209672_100551 | 3300025228 | Bacteria | 20261 |
| 300 | Ga0209563_100079 | 3300025230 | Bacteria | 203017 |
| 301 | Ga0207427_100033 | 3300025231 | Bacteria | 338459 |
| 302 | Ga0207427_100073 | 3300025231 | Bacteria | 156503 |
| 303 | Ga0207427_100112 | 3300025231 | Bacteria | 109224 |
| 304 | Ga0207427_107381 | 3300025231 | Bacteria | 1295 |
| 305 | Ga0209437_100012 | 3300025233 | Bacteria | 792625 |
| 306 | Ga0209437_100020 | 3300025233 | Bacteria | 656374 |
| 307 | Ga0209437_100105 | 3300025233 | Bacteria | 220034 |
| 308 | Ga0209437_100151 | 3300025233 | Bacteria | 156418 |
| 309 | Ga0209437_101420 | 3300025233 | Bacteria | 5923 |
| 310 | Ga0209258_100012 | 3300025242 | Bacteria | 825544 |
| 311 | Ga0209258_100019 | 3300025242 | Bacteria | 566728 |
| 312 | Ga0209258_100046 | 3300025242 | Bacteria | 369794 |
| 313 | Ga0209258_100582 | 3300025242 | Bacteria | 30641 |
| 314 | Ga0209258_100600 | 3300025242 | Bacteria | 29489 |
| 315 | Ga0209258_101514 | 3300025242 | Bacteria | 7876 |
| 316 | Ga0209646_1000749 | 3300025246 | Bacteria | 11332 |
| 317 | Ga0209646_1001723 | 3300025246 | Bacteria | 5527 |
| 318 | Ga0209646_1003294 | 3300025246 | Bacteria | 3221 |
| 319 | Ga0209026_1000015 | 3300025250 | Bacteria | 395555 |
| 320 | Ga0209026_1000213 | 3300025250 | Bacteria | 80756 |
| 321 | Ga0209026_1000381 | 3300025250 | Bacteria | 40677 |
| 322 | Ga0209026_1001297 | 3300025250 | Bacteria | 11308 |
| 323 | Ga0209677_100725 | 3300025253 | Bacteria | 16786 |
| 324 | Ga0209148_1000001 | 3300025254 | Bacteria | 2545271 |
| 325 | Ga0209148_1000005 | 3300025254 | Bacteria | 1806504 |
| 326 | Ga0209148_1000013 | 3300025254 | Bacteria | 956684 |
| 327 | Ga0209148_1000039 | 3300025254 | Bacteria | 482479 |
| 328 | Ga0209148_1000084 | 3300025254 | Bacteria | 268147 |
| 329 | Ga0209148_1000296 | 3300025254 | Bacteria | 73505 |
| 330 | Ga0209759_1000462 | 3300025256 | Bacteria | 46113 |
| 331 | Ga0209759_1000719 | 3300025256 | Bacteria | 29163 |
| 332 | Ga0209759_1000802 | 3300025256 | Bacteria | 25445 |
| 333 | Ga0209759_1002655 | 3300025256 | Bacteria | 7675 |
| 334 | Ga0209759_1007906 | 3300025256 | Bacteria | 3366 |
| 335 | Ga0209129_1001478 | 3300025258 | Bacteria | 13064 |
| 336 | Ga0209129_1005121 | 3300025258 | Bacteria | 4795 |
| 337 | Ga0209233_1000002 | 3300025261 | Bacteria | 2501366 |
| 338 | Ga0209233_1000020 | 3300025261 | Bacteria | 798224 |
| 339 | Ga0209233_1000080 | 3300025261 | Bacteria | 338459 |
| 340 | Ga0209565_1000022 | 3300025263 | Bacteria | 390888 |
| 341 | Ga0209455_1000010 | 3300025272 | Bacteria | 959482 |
| 342 | Ga0209455_1000027 | 3300025272 | Bacteria | 566710 |
| 343 | Ga0209455_1000034 | 3300025272 | Bacteria | 483129 |
| 344 | Ga0209455_1000126 | 3300025272 | Bacteria | 165771 |
| 345 | Ga0209455_1000662 | 3300025272 | Bacteria | 20911 |
| 346 | Ga0209673_1000110 | 3300025273 | Bacteria | 181173 |
| 347 | Ga0209675_1000060 | 3300025291 | Bacteria | 184316 |
| 348 | Ga0209676_1000219 | 3300025292 | Bacteria | 125330 |
| 349 | Ga0209676_1000279 | 3300025292 | Bacteria | 106358 |
| 350 | Ga0209564_1000304 | 3300025295 | Bacteria | 97304 |
| 351 | Ga0209758_1002818 | 3300025297 | Bacteria | 16919 |
| 352 | Ga0209758_1005835 | 3300025297 | Bacteria | 9199 |
| 353 | Ga0209050_1000542 | 3300025298 | Bacteria | 62500 |
| 354 | Ga0209050_1000825 | 3300025298 | Bacteria | 43030 |
| 355 | Ga0209050_1022520 | 3300025298 | Bacteria | 2254 |
| 356 | Ga0209256_1007442 | 3300025299 | Bacteria | 5395 |
| 357 | Ga0209256_1008983 | 3300025299 | Bacteria | 4487 |
| 358 | Ga0209051_1012166 | 3300025303 | Bacteria | 4178 |
| 359 | Ga0209257_1000726 | 3300025304 | Bacteria | 50193 |
| 360 | Ga0207656_10010701 | 3300025321 | Bacteria | 3444 |
| 361 | Ga0207656_10017871 | 3300025321 | Bacteria | 2784 |
| 362 | Ga0207713_1034419 | 3300025735 | Bacteria | 2200 |
| 363 | Ga0207710_10079395 | 3300025900 | Bacteria | 1520 |
| 364 | Ga0207680_10000005 | 3300025903 | Bacteria | 660983 |
| 365 | Ga0207647_10000056 | 3300025904 | Bacteria | 86476 |
| 366 | Ga0207647_10000213 | 3300025904 | Bacteria | 47297 |
| 367 | Ga0207647_10000229 | 3300025904 | Bacteria | 46400 |
| 368 | Ga0207647_10004577 | 3300025904 | Bacteria | 10246 |
| 369 | Ga0207647_10005182 | 3300025904 | Bacteria | 9592 |
| 370 | Ga0207647_10007991 | 3300025904 | Bacteria | 7606 |
| 371 | Ga0207705_10000128 | 3300025909 | Bacteria | 83519 |
| 372 | Ga0207705_10002200 | 3300025909 | Bacteria | 15078 |
| 373 | Ga0207705_10003255 | 3300025909 | Bacteria | 12367 |
| 374 | Ga0207705_10016797 | 3300025909 | Bacteria | 5240 |
| 375 | Ga0207654_10000126 | 3300025911 | Bacteria | 49852 |
| 376 | Ga0207654_10012493 | 3300025911 | Bacteria | 4352 |
| 377 | Ga0207654_10146572 | 3300025911 | Bacteria | 1511 |
| 378 | Ga0207707_10000665 | 3300025912 | Bacteria | 34141 |
| 379 | Ga0207707_10000699 | 3300025912 | Bacteria | 33304 |
| 380 | Ga0207707_10001116 | 3300025912 | Bacteria | 25500 |
| 381 | Ga0207707_10001210 | 3300025912 | Bacteria | 24269 |
| 382 | Ga0207707_10003426 | 3300025912 | Bacteria | 14064 |
| 383 | Ga0207707_10005504 | 3300025912 | Bacteria | 11067 |
| 384 | Ga0207707_10007116 | 3300025912 | Bacteria | 9748 |
| 385 | Ga0207695_10000094 | 3300025913 | Bacteria | 265779 |
| 386 | Ga0207695_10000869 | 3300025913 | Bacteria | 55012 |
| 387 | Ga0207695_10001748 | 3300025913 | Bacteria | 34501 |
| 388 | Ga0207695_10003671 | 3300025913 | Bacteria | 21402 |
| 389 | Ga0207695_10004041 | 3300025913 | Bacteria | 20186 |
| 390 | Ga0207695_10052537 | 3300025913 | Bacteria | 4268 |
| 391 | Ga0207695_10101736 | 3300025913 | Bacteria | 2868 |
| 392 | Ga0207695_10147442 | 3300025913 | Bacteria | 2296 |
| 393 | Ga0207671_10000050 | 3300025914 | Bacteria | 190479 |
| 394 | Ga0207671_10000116 | 3300025914 | Bacteria | 122775 |
| 395 | Ga0207671_10003678 | 3300025914 | Bacteria | 15116 |
| 396 | Ga0207671_10007188 | 3300025914 | Bacteria | 9702 |
| 397 | Ga0207671_10007824 | 3300025914 | Bacteria | 9191 |
| 398 | Ga0207671_10113998 | 3300025914 | Bacteria | 2060 |
| 399 | Ga0207671_10147784 | 3300025914 | Bacteria | 1814 |
| 400 | Ga0207660_10001431 | 3300025917 | Bacteria | 16015 |
| 401 | Ga0207660_10001647 | 3300025917 | Bacteria | 14968 |
| 402 | Ga0207660_10003057 | 3300025917 | Bacteria | 10944 |
| 403 | Ga0207657_10004614 | 3300025919 | Bacteria | 14556 |
| 404 | Ga0207657_10004766 | 3300025919 | Bacteria | 14306 |
| 405 | Ga0207657_10005275 | 3300025919 | Bacteria | 13543 |
| 406 | Ga0207657_10015540 | 3300025919 | Bacteria | 7373 |
| 407 | Ga0207657_10097954 | 3300025919 | Bacteria | 2437 |
| 408 | Ga0207649_10000493 | 3300025920 | Bacteria | 28027 |
| 409 | Ga0207649_10001479 | 3300025920 | Bacteria | 13790 |
| 410 | Ga0207649_10010387 | 3300025920 | Bacteria | 5115 |
| 411 | Ga0207649_10093259 | 3300025920 | Bacteria | 1975 |
| 412 | Ga0207649_10193575 | 3300025920 | Bacteria | 1432 |
| 413 | Ga0207652_10000030 | 3300025921 | Bacteria | 144884 |
| 414 | Ga0207652_10000820 | 3300025921 | Bacteria | 29635 |
| 415 | Ga0207652_10000846 | 3300025921 | Bacteria | 29174 |
| 416 | Ga0207652_10001111 | 3300025921 | Bacteria | 24285 |
| 417 | Ga0207652_10078652 | 3300025921 | Bacteria | 2880 |
| 418 | Ga0207681_10016810 | 3300025923 | Bacteria | 4585 |
| 419 | Ga0207694_10002059 | 3300025924 | Bacteria | 16629 |
| 420 | Ga0207694_10005930 | 3300025924 | Bacteria | 9371 |
| 421 | Ga0207694_10008956 | 3300025924 | Bacteria | 7557 |
| 422 | Ga0207694_10010172 | 3300025924 | Bacteria | 7089 |
| 423 | Ga0207650_10000003 | 3300025925 | Bacteria | 1123235 |
| 424 | Ga0207650_10245264 | 3300025925 | Bacteria | 1449 |
| 425 | Ga0207687_10103069 | 3300025927 | Bacteria | 2103 |
| 426 | Ga0207700_10034657 | 3300025928 | Bacteria | 3626 |
| 427 | Ga0207664_10000126 | 3300025929 | Bacteria | 66358 |
| 428 | Ga0207664_10156749 | 3300025929 | Bacteria | 1939 |
| 429 | Ga0207644_10001445 | 3300025931 | Bacteria | 15314 |
| 430 | Ga0207690_10000266 | 3300025932 | Bacteria | 37573 |
| 431 | Ga0207690_10001014 | 3300025932 | Bacteria | 17947 |
| 432 | Ga0207690_10001119 | 3300025932 | Bacteria | 17096 |
| 433 | Ga0207690_10011293 | 3300025932 | Bacteria | 5336 |
| 434 | Ga0207706_10017013 | 3300025933 | Bacteria | 6559 |
| 435 | Ga0207706_10021569 | 3300025933 | Bacteria | 5783 |
| 436 | Ga0207706_10070314 | 3300025933 | Bacteria | 3079 |
| 437 | Ga0207709_10016265 | 3300025935 | Bacteria | 4133 |
| 438 | Ga0207669_10219859 | 3300025937 | Bacteria | 1393 |
| 439 | Ga0207704_10005509 | 3300025938 | Bacteria | 5836 |
| 440 | Ga0207704_10022683 | 3300025938 | Bacteria | 3369 |
| 441 | Ga0207691_10176412 | 3300025940 | Bacteria | 1869 |
| 442 | Ga0207711_10001229 | 3300025941 | Bacteria | 24284 |
| 443 | Ga0207711_10005099 | 3300025941 | Bacteria | 11129 |
| 444 | Ga0207689_10030973 | 3300025942 | Bacteria | 4457 |
| 445 | Ga0207661_10014451 | 3300025944 | Bacteria | 5787 |
| 446 | Ga0207661_10038955 | 3300025944 | Bacteria | 3728 |
| 447 | Ga0207679_10008076 | 3300025945 | Bacteria | 6694 |
| 448 | Ga0207679_10099435 | 3300025945 | Bacteria | 2271 |
| 449 | Ga0207667_10000031 | 3300025949 | Bacteria | 323587 |
| 450 | Ga0207667_10000125 | 3300025949 | Bacteria | 118155 |
| 451 | Ga0207667_10000634 | 3300025949 | Bacteria | 45497 |
| 452 | Ga0207667_10000818 | 3300025949 | Bacteria | 40208 |
| 453 | Ga0207667_10003528 | 3300025949 | Bacteria | 19334 |
| 454 | Ga0207667_10007474 | 3300025949 | Bacteria | 13129 |
| 455 | Ga0207667_10092266 | 3300025949 | Bacteria | 3128 |
| 456 | Ga0207667_10368415 | 3300025949 | Bacteria | 1464 |
| 457 | Ga0207712_10000169 | 3300025961 | Bacteria | 67461 |
| 458 | Ga0207712_10001183 | 3300025961 | Bacteria | 18055 |
| 459 | Ga0207668_10040485 | 3300025972 | Bacteria | 3144 |
| 460 | Ga0207640_10000082 | 3300025981 | Bacteria | 74895 |
| 461 | Ga0207640_10001407 | 3300025981 | Bacteria | 13002 |
| 462 | Ga0207640_10005086 | 3300025981 | Bacteria | 7152 |
| 463 | Ga0207640_10015481 | 3300025981 | Bacteria | 4416 |
| 464 | Ga0207640_10078855 | 3300025981 | Bacteria | 2243 |
| 465 | Ga0207658_10000004 | 3300025986 | Bacteria | 569357 |
| 466 | Ga0207658_10000006 | 3300025986 | Bacteria | 392309 |
| 467 | Ga0207658_10009512 | 3300025986 | Bacteria | 6598 |
| 468 | Ga0207658_10035251 | 3300025986 | Bacteria | 3583 |
| 469 | Ga0207658_10102787 | 3300025986 | Bacteria | 2242 |
| 470 | Ga0207677_10170281 | 3300026023 | Bacteria | 1702 |
| 471 | Ga0207677_10204134 | 3300026023 | Bacteria | 1573 |
| 472 | Ga0207703_10011575 | 3300026035 | Bacteria | 6859 |
| 473 | Ga0207703_10075899 | 3300026035 | Bacteria | 2787 |
| 474 | Ga0207639_10000230 | 3300026041 | Bacteria | 41807 |
| 475 | Ga0207639_10001497 | 3300026041 | Bacteria | 15730 |
| 476 | Ga0207639_10001503 | 3300026041 | Bacteria | 15684 |
| 477 | Ga0207639_10001512 | 3300026041 | Bacteria | 15628 |
| 478 | Ga0207639_10012848 | 3300026041 | Bacteria | 5842 |
| 479 | Ga0207639_10032218 | 3300026041 | Bacteria | 3857 |
| 480 | Ga0207639_10090133 | 3300026041 | Bacteria | 2452 |
| 481 | Ga0207678_10001435 | 3300026067 | Bacteria | 21864 |
| 482 | Ga0207678_10006920 | 3300026067 | Bacteria | 10062 |
| 483 | Ga0207678_10014775 | 3300026067 | Bacteria | 6870 |
| 484 | Ga0207678_10019278 | 3300026067 | Bacteria | 5991 |
| 485 | Ga0207678_10025756 | 3300026067 | Bacteria | 5133 |
| 486 | Ga0207678_10034586 | 3300026067 | Bacteria | 4401 |
| 487 | Ga0207678_10080917 | 3300026067 | Bacteria | 2780 |
| 488 | Ga0207708_10174009 | 3300026075 | Bacteria | 1706 |
| 489 | Ga0207702_10000265 | 3300026078 | Bacteria | 60212 |
| 490 | Ga0207702_10000384 | 3300026078 | Bacteria | 50456 |
| 491 | Ga0207702_10005204 | 3300026078 | Bacteria | 11423 |
| 492 | Ga0207702_10011335 | 3300026078 | Bacteria | 7432 |
| 493 | Ga0207702_10011594 | 3300026078 | Bacteria | 7345 |
| 494 | Ga0207702_10064781 | 3300026078 | Bacteria | 3128 |
| 495 | Ga0207702_10125723 | 3300026078 | Bacteria | 2302 |
| 496 | Ga0207702_10158328 | 3300026078 | Bacteria | 2066 |
| 497 | Ga0207641_10009701 | 3300026088 | Bacteria | 7932 |
| 498 | Ga0207641_10049188 | 3300026088 | Bacteria | 3561 |
| 499 | Ga0207641_10053431 | 3300026088 | Bacteria | 3424 |
| 500 | Ga0207641_10083288 | 3300026088 | Bacteria | 2781 |
| 501 | Ga0207648_10117566 | 3300026089 | Bacteria | 2336 |
| 502 | Ga0207676_10000003 | 3300026095 | Bacteria | 1123235 |
| 503 | Ga0207674_10002112 | 3300026116 | Bacteria | 25126 |
| 504 | Ga0207674_10004296 | 3300026116 | Bacteria | 17186 |
| 505 | Ga0207674_10006067 | 3300026116 | Bacteria | 14293 |
| 506 | Ga0207674_10015842 | 3300026116 | Bacteria | 8267 |
| 507 | Ga0207674_10042792 | 3300026116 | Bacteria | 4674 |
| 508 | Ga0207675_100131643 | 3300026118 | Bacteria | 2372 |
| 509 | Ga0207683_10038290 | 3300026121 | Bacteria | 4179 |
| 510 | Ga0207683_10039725 | 3300026121 | Bacteria | 4105 |
| 511 | Ga0207683_10045636 | 3300026121 | Bacteria | 3832 |
| 512 | Ga0207683_10144088 | 3300026121 | Bacteria | 2147 |
| 513 | Ga0207698_10001180 | 3300026142 | Bacteria | 15239 |
| 514 | Ga0207698_10001757 | 3300026142 | Bacteria | 12633 |
| 515 | Ga0207698_10006674 | 3300026142 | Bacteria | 7212 |
| 516 | Ga0207698_10026723 | 3300026142 | Bacteria | 4086 |
| 517 | Ga0207698_10031345 | 3300026142 | Bacteria | 3836 |
| 518 | Ga0207698_10079147 | 3300026142 | Bacteria | 2643 |
| 519 | Ga0207698_10081075 | 3300026142 | Bacteria | 2617 |
| 520 | Ga0207698_10211122 | 3300026142 | Bacteria | 1747 |
| 521 | Ga0209371_1000007 | 3300027312 | Bacteria | 1050654 |
| 522 | Ga0209371_1000016 | 3300027312 | Bacteria | 646301 |
| 523 | Ga0268266_10000001 | 3300028379 | Bacteria | 4040580 |
| 524 | Ga0268266_10000004 | 3300028379 | Bacteria | 1495817 |
| 525 | Ga0268266_10000006 | 3300028379 | Bacteria | 1410021 |
| 526 | Ga0268266_10004408 | 3300028379 | Bacteria | 13488 |
| 527 | Ga0268266_10102131 | 3300028379 | Bacteria | 2529 |
| 528 | Ga0268266_10111722 | 3300028379 | Bacteria | 2421 |
| 529 | Ga0268265_10001087 | 3300028380 | Bacteria | 24196 |
| 530 | Ga0268265_10003544 | 3300028380 | Bacteria | 11168 |
| 531 | Ga0268265_10233467 | 3300028380 | Bacteria | 1618 |
| 532 | Ga0268265_10278620 | 3300028380 | Bacteria | 1495 |
| 533 | Ga0268264_10000016 | 3300028381 | Bacteria | 502537 |
| 534 | Ga0268264_10305021 | 3300028381 | Bacteria | 1500 |
| 535 | Ga0307517_10153775 | 3300028786 | Bacteria | 1569 |
| 536 | Ga0307515_10164507 | 3300028794 | Bacteria | 2244 |
| 537 | Ga0268256_1000008 | 3300030500 | Bacteria | 1050654 |
| 538 | Ga0268256_1000015 | 3300030500 | Bacteria | 646300 |
| 539 | Ga0316183_1072209 | 3300030742 | Bacteria | 4712 |
| 540 | Ga0265332_10046656 | 3300031238 | Bacteria | 1866 |
| 541 | Ga0265331_10039292 | 3300031250 | Bacteria | 2308 |
| 542 | Ga0265327_10000044 | 3300031251 | Bacteria | 284808 |
| 543 | Ga0265316_10138153 | 3300031344 | Bacteria | 1832 |
| 544 | Ga0307408_100106805 | 3300031548 | Bacteria | 2143 |
| 545 | Ga0307516_10052700 | 3300031730 | Bacteria | 3981 |
| 546 | Ga0307412_10000684 | 3300031911 | Bacteria | 19615 |
| 547 | Ga0307412_10008621 | 3300031911 | Bacteria | 5829 |
| 548 | Ga0307412_10144655 | 3300031911 | Bacteria | 1746 |
| 549 | Ga0307507_10098766 | 3300033179 | Bacteria | 2456 |
| 550 | Ga0307510_10000049 | 3300033180 | Bacteria | 91546 |
| 551 | Ga0395899_0000133 | 3300037312 | Bacteria | 114879 |
| 552 | Ga0395899_0075905 | 3300037312 | Bacteria | 2454 |
| 553 | Ga0395899_0088684 | 3300037312 | Bacteria | 2243 |
| 554 | Ga0395900_0000033 | 3300037418 | Bacteria | 260271 |
| 555 | Ga0395900_0000061 | 3300037418 | Bacteria | 202483 |
| 556 | Ga0395900_0068601 | 3300037418 | Bacteria | 3644 |
| 557 | Ga0395900_0216503 | 3300037418 | Bacteria | 1932 |
| 558 | Ga0395898_0000034 | 3300037466 | Bacteria | 356745 |
| 559 | Ga0395898_0000197 | 3300037466 | Bacteria | 155187 |
| 560 | Ga0395898_0062735 | 3300037466 | Bacteria | 3608 |
| 561 | Ga0395898_0090322 | 3300037466 | Bacteria | 2947 |
| 562 | Ga0395898_0100362 | 3300037466 | Bacteria | 2779 |
| 563 | Ga0395898_0218030 | 3300037466 | Bacteria | 1820 |
| 564 | Ga0395898_0218850 | 3300037466 | Bacteria | 1816 |
| 565 | Ga0395905_0051773 | 3300037471 | Bacteria | 3846 |
| 566 | Ga0395901_0000772 | 3300038443 | Bacteria | 35860 |
| 567 | Ga0395901_0005878 | 3300038443 | Bacteria | 12416 |
| 568 | Ga0395901_0021408 | 3300038443 | Bacteria | 6624 |
| 569 | Ga0395901_0071975 | 3300038443 | Bacteria | 3603 |
| 570 | Ga0237819_05304 | 3300038705 | Bacteria | 2035 |
| 571 | Ga0439436_0000042 | 3300041404 | Bacteria | 39617 |
| 572 | Ga0439465_0002276 | 3300041413 | Bacteria | 6306 |
| 573 | Ga0451793_0280819 | 3300041452 | Bacteria | 1579 |
| 574 | Ga0451800_1047982 | 3300041459 | Bacteria | 1385 |
| 575 | Ga0451806_243917 | 3300041462 | Bacteria | 1497 |
| 576 | Ga0451804_0591474 | 3300041463 | Bacteria | 1403 |
| 577 | Ga0451807_0137290 | 3300041486 | Bacteria | 1652 |
| 578 | Ga0451837_0542554 | 3300041494 | Bacteria | 2057 |
| 579 | Ga0451839_0258198 | 3300041496 | Bacteria | 1455 |
| 580 | Ga0451843_0036637 | 3300041509 | Bacteria | 3045 |
| 581 | Ga0451853_0612520 | 3300041512 | Bacteria | 6430 |
| 582 | Ga0450895_000548 | 3300042132 | Bacteria | 2211 |
| 583 | Ga0450896_000078 | 3300042133 | Bacteria | 6552 |
| 584 | Ga0450907_003204 | 3300042146 | Bacteria | 2954 |
| 585 | Ga0450908_000392 | 3300042184 | Bacteria | 8425 |
| 586 | Ga0450918_004985 | 3300042531 | Bacteria | 2393 |
| 587 | Ga0466969_0001628 | 3300044656 | Bacteria | 12034 |
| 588 | Ga0466969_0005914 | 3300044656 | Bacteria | 6507 |
| 589 | Ga0466972_0001288 | 3300044658 | Bacteria | 12110 |
| 590 | Ga0466972_0103252 | 3300044658 | Bacteria | 1348 |
| 591 | Ga0466982_0000010 | 3300044672 | Bacteria | 188341 |
| 592 | Ga0466982_0000196 | 3300044672 | Bacteria | 15881 |
| 593 | Ga0466965_0022391 | 3300044683 | Bacteria | 3046 |
| 594 | Ga0466966_0003629 | 3300044684 | Bacteria | 10182 |
| 595 | Ga0466966_0017116 | 3300044684 | Bacteria | 4795 |
| 596 | Ga0466961_0003687 | 3300044693 | Bacteria | 9559 |
| 597 | Ga0466961_0004916 | 3300044693 | Bacteria | 8403 |
| 598 | Ga0466961_0011932 | 3300044693 | Bacteria | 5554 |
| 599 | Ga0466961_0043425 | 3300044693 | Bacteria | 2879 |
| 600 | Ga0466961_0088931 | 3300044693 | Bacteria | 1951 |
| 601 | Ga0466964_0011053 | 3300044706 | Bacteria | 3410 |
| 602 | Ga0453684_0002590 | 3300044712 | Bacteria | 43282 |
| 603 | Ga0466971_0009268 | 3300044719 | Bacteria | 4300 |
| 604 | Ga0466968_0001991 | 3300044735 | Bacteria | 7422 |
| 605 | Ga0466970_0000202 | 3300044765 | Bacteria | 28937 |
| 606 | Ga0466970_0062608 | 3300044765 | Bacteria | 1994 |
| 607 | Ga0466957_0003347 | 3300044842 | Bacteria | 8785 |
| 608 | Ga0466957_0022118 | 3300044842 | Bacteria | 3749 |
| 609 | Ga0466957_0041557 | 3300044842 | Bacteria | 2781 |
| 610 | Ga0466959_0000232 | 3300045049 | Bacteria | 35011 |
| 611 | Ga0466959_0000888 | 3300045049 | Bacteria | 17606 |
| 612 | Ga0466959_0024693 | 3300045049 | Bacteria | 4453 |
| 613 | Ga0466959_0087654 | 3300045049 | Bacteria | 2238 |
| 614 | Ga0451576_0000840 | 3300045051 | Bacteria | 59794 |
| 615 | Ga0495617_000016 | 3300046452 | Bacteria | 253600 |
| 616 | Ga0495617_002329 | 3300046452 | Bacteria | 7633 |
| 617 | Ga0495638_0000212 | 3300046460 | Bacteria | 81733 |
| 618 | Ga0495638_0000938 | 3300046460 | Bacteria | 29535 |
| 619 | Ga0495638_0001592 | 3300046460 | Bacteria | 20319 |
| 620 | Ga0495650_0000614 | 3300046471 | Bacteria | 48415 |
| 621 | Ga0495650_0001007 | 3300046471 | Bacteria | 31805 |
| 622 | Ga0495650_0001927 | 3300046471 | Bacteria | 18382 |
| 623 | Ga0495584_0000847 | 3300046491 | Bacteria | 19760 |
| 624 | Ga0495585_0000007 | 3300046492 | Bacteria | 288113 |
| 625 | Ga0495585_0002049 | 3300046492 | Bacteria | 14849 |
| 626 | Ga0495607_0000003 | 3300046501 | Bacteria | 366900 |
| 627 | Ga0495607_0000437 | 3300046501 | Bacteria | 42089 |
| 628 | Ga0495606_0000610 | 3300046507 | Bacteria | 56591 |
| 629 | Ga0495606_0001571 | 3300046507 | Bacteria | 29944 |
| 630 | Ga0495606_0001761 | 3300046507 | Bacteria | 27728 |
| 631 | Ga0495606_0012718 | 3300046507 | Bacteria | 6712 |
| 632 | Ga0495610_0008323 | 3300046512 | Bacteria | 6735 |
| 633 | Ga0495616_0000001 | 3300046513 | Bacteria | 780061 |
| 634 | Ga0495616_0016407 | 3300046513 | Bacteria | 4100 |
| 635 | Ga0495620_0001003 | 3300046515 | Bacteria | 17446 |
| 636 | Ga0495631_0000065 | 3300046518 | Bacteria | 65356 |
| 637 | Ga0495631_0000217 | 3300046518 | Bacteria | 39565 |
| 638 | Ga0495632_0000011 | 3300046519 | Bacteria | 266804 |
| 639 | Ga0495632_0000581 | 3300046519 | Bacteria | 33896 |
| 640 | Ga0495637_0006365 | 3300046520 | Bacteria | 5935 |
| 641 | Ga0495648_0002069 | 3300046524 | Bacteria | 18985 |
| 642 | Ga0495648_0017405 | 3300046524 | Bacteria | 5136 |
| 643 | Ga0495663_0016674 | 3300046525 | Bacteria | 2077 |
| 644 | Ga0495668_0064904 | 3300046616 | Bacteria | 2009 |
| 645 | Ga0495611_0000001 | 3300046648 | Bacteria | 2628469 |
| 646 | Ga0495611_0000068 | 3300046648 | Bacteria | 71983 |
| 647 | Ga0495625_0000001 | 3300046660 | Bacteria | 1641829 |
| 648 | Ga0495625_0010620 | 3300046660 | Bacteria | 7597 |
| 649 | Ga0495625_0018578 | 3300046660 | Bacteria | 5421 |
| 650 | Ga0495625_0058667 | 3300046660 | Bacteria | 2734 |
| 651 | Ga0495661_0001999 | 3300046665 | Bacteria | 16088 |
| 652 | Ga0495657_0151105 | 3300046675 | Bacteria | 1442 |
| 653 | Ga0495670_0011736 | 3300046691 | Bacteria | 4313 |
| 654 | Ga0495670_0019299 | 3300046691 | Bacteria | 3358 |
| 655 | Ga0495671_0004638 | 3300046692 | Bacteria | 8148 |
| 656 | Ga0495649_0006750 | 3300046694 | Bacteria | 7111 |
| 657 | Ga0495589_0000016 | 3300046794 | Bacteria | 209027 |
| 658 | Ga0495660_0000018 | 3300046810 | Bacteria | 317061 |
| 659 | Ga0495660_0000294 | 3300046810 | Bacteria | 45736 |
| 660 | Ga0495679_000001 | 3300047446 | Bacteria | 1607568 |
| 661 | Ga0495673_0000001 | 3300047469 | Bacteria | 1630730 |
| 662 | Ga0495673_0000018 | 3300047469 | Bacteria | 569190 |
| 663 | Ga0495673_0006286 | 3300047469 | Bacteria | 6998 |
| 664 | Ga0495686_0000026 | 3300047472 | Bacteria | 383637 |
| 665 | Ga0495686_0000037 | 3300047472 | Bacteria | 307937 |
| 666 | Ga0495686_0010946 | 3300047472 | Bacteria | 6422 |
| 667 | Ga0495686_0011052 | 3300047472 | Bacteria | 6385 |
| 668 | Ga0495686_0039726 | 3300047472 | Bacteria | 3003 |
| 669 | Ga0496101_0015402 | 3300048904 | Bacteria | 5152 |
| 670 | Ga0496113_0076306 | 3300048916 | Bacteria | 2560 |
| 671 | Ga0496113_0216433 | 3300048916 | Bacteria | 1526 |
| 672 | Ga0496115_0000140 | 3300048918 | Bacteria | 66883 |
| 673 | Ga0496115_0000160 | 3300048918 | Bacteria | 63326 |
| 674 | Ga0496116_0002429 | 3300048919 | Bacteria | 19630 |
| 675 | Ga0496117_0000779 | 3300048920 | Bacteria | 50165 |
| 676 | Ga0496117_0031479 | 3300048920 | Bacteria | 4048 |
| 677 | Ga0496117_0045558 | 3300048920 | Bacteria | 3166 |
| 678 | Ga0496117_0058938 | 3300048920 | Bacteria | 2656 |
| 679 | Ga0496118_0000497 | 3300048921 | Bacteria | 65119 |
| 680 | Ga0496118_0001337 | 3300048921 | Bacteria | 37414 |
| 681 | Ga0496118_0001789 | 3300048921 | Bacteria | 31029 |
| 682 | Ga0496118_0002288 | 3300048921 | Bacteria | 26119 |
| 683 | Ga0496118_0002346 | 3300048921 | Bacteria | 25662 |
| 684 | Ga0496118_0004535 | 3300048921 | Bacteria | 16392 |
| 685 | Ga0496118_0004950 | 3300048921 | Bacteria | 15436 |
| 686 | Ga0496118_0071155 | 3300048921 | Bacteria | 2505 |
| 687 | Ga0496119_0024864 | 3300048922 | Bacteria | 4199 |
| 688 | Ga0496121_0000044 | 3300048924 | Bacteria | 337672 |
| 689 | Ga0496121_0001002 | 3300048924 | Bacteria | 50506 |
| 690 | Ga0496121_0001590 | 3300048924 | Bacteria | 37776 |
| 691 | Ga0496121_0007287 | 3300048924 | Bacteria | 13384 |
| 692 | Ga0496121_0025118 | 3300048924 | Bacteria | 5669 |
| 693 | Ga0496121_0025582 | 3300048924 | Bacteria | 5594 |
| 694 | Ga0496121_0061625 | 3300048924 | Bacteria | 3077 |
| 695 | Ga0496122_0000463 | 3300048925 | Bacteria | 84540 |
| 696 | Ga0496122_0011204 | 3300048925 | Bacteria | 9121 |
| 697 | Ga0496122_0012727 | 3300048925 | Bacteria | 8328 |
| 698 | Ga0496122_0013601 | 3300048925 | Bacteria | 7947 |
| 699 | Ga0496122_0016711 | 3300048925 | Bacteria | 6916 |
| 700 | Ga0496123_0001598 | 3300048926 | Bacteria | 30746 |
| 701 | Ga0496123_0012693 | 3300048926 | Bacteria | 7151 |
| 702 | Ga0496123_0019840 | 3300048926 | Bacteria | 5278 |
| 703 | Ga0496123_0037450 | 3300048926 | Bacteria | 3424 |
| 704 | Ga0496123_0051705 | 3300048926 | Bacteria | 2734 |
| 705 | Ga0496123_0068423 | 3300048926 | Bacteria | 2236 |
| 706 | Ga0496124_0000840 | 3300048927 | Bacteria | 50101 |
| 707 | Ga0496124_0000893 | 3300048927 | Bacteria | 48172 |
| 708 | Ga0496124_0008226 | 3300048927 | Bacteria | 10940 |
| 709 | Ga0496124_0008239 | 3300048927 | Bacteria | 10930 |
| 710 | Ga0496124_0033579 | 3300048927 | Bacteria | 4512 |
| 711 | Ga0496124_0166034 | 3300048927 | Bacteria | 1715 |
| 712 | Ga0496124_0171850 | 3300048927 | Bacteria | 1677 |
| 713 | Ga0496125_0000795 | 3300048928 | Bacteria | 51440 |
| 714 | Ga0496125_0006055 | 3300048928 | Bacteria | 13220 |
| 715 | Ga0496125_0017297 | 3300048928 | Bacteria | 6883 |
| 716 | Ga0496125_0042716 | 3300048928 | Bacteria | 3857 |
| 717 | Ga0496125_0049534 | 3300048928 | Bacteria | 3490 |
| 718 | Ga0496125_0060411 | 3300048928 | Bacteria | 3046 |
| 719 | Ga0496125_0063681 | 3300048928 | Bacteria | 2938 |
| 720 | Ga0496126_0052243 | 3300048929 | Bacteria | 3715 |
| 721 | Ga0496126_0105529 | 3300048929 | Bacteria | 2460 |
| 722 | Ga0496126_0194845 | 3300048929 | Bacteria | 1714 |
| 723 | Ga0495678_001288 | 3300049459 | Bacteria | 20269 |
| 724 | Ga0495682_0000948 | 3300049460 | Bacteria | 17553 |
| 725 | Ga0495682_0006512 | 3300049460 | Bacteria | 4719 |
| 726 | Ga0495682_0012133 | 3300049460 | Bacteria | 3309 |
| 727 | Ga0501031_0025683 | 3300049568 | Bacteria | 3842 |
| 728 | Ga0501031_0026082 | 3300049568 | Bacteria | 3811 |
| 729 | Ga0501032_0003271 | 3300049569 | Bacteria | 12472 |
| 730 | Ga0501032_0044660 | 3300049569 | Bacteria | 2999 |
| 731 | Ga0501033_0000329 | 3300049570 | Bacteria | 45324 |
| 732 | Ga0501033_0005967 | 3300049570 | Bacteria | 9560 |
| 733 | Ga0501033_0007277 | 3300049570 | Bacteria | 8632 |
| 734 | Ga0501033_0020764 | 3300049570 | Bacteria | 4962 |
| 735 | Ga0501033_0046423 | 3300049570 | Bacteria | 3229 |
| 736 | Ga0501033_0141220 | 3300049570 | Bacteria | 1741 |
| 737 | Ga0501034_0001661 | 3300049571 | Bacteria | 28667 |
| 738 | Ga0501034_0002728 | 3300049571 | Bacteria | 20777 |
| 739 | Ga0501034_0006794 | 3300049571 | Bacteria | 12236 |
| 740 | Ga0501034_0007130 | 3300049571 | Bacteria | 11923 |
| 741 | Ga0501034_0019091 | 3300049571 | Bacteria | 7019 |
| 742 | Ga0501034_0045078 | 3300049571 | Bacteria | 4458 |
| 743 | Ga0501034_0055591 | 3300049571 | Bacteria | 3983 |
| 744 | Ga0501034_0165077 | 3300049571 | Bacteria | 2183 |
| 745 | Ga0501034_0217390 | 3300049571 | Bacteria | 1864 |
| 746 | Ga0501036_0005648 | 3300049572 | Bacteria | 10147 |
| 747 | Ga0501036_0034329 | 3300049572 | Bacteria | 4291 |
| 748 | Ga0501036_0040661 | 3300049572 | Bacteria | 3933 |
| 749 | Ga0501036_0056274 | 3300049572 | Bacteria | 3332 |
| 750 | Ga0501036_0190923 | 3300049572 | Bacteria | 1723 |
| 751 | Ga0501037_0007353 | 3300049573 | Bacteria | 8055 |
| 752 | Ga0501037_0103843 | 3300049573 | Bacteria | 2049 |
| 753 | Ga0501037_0156826 | 3300049573 | Bacteria | 1624 |
| 754 | Ga0501038_0002332 | 3300049574 | Bacteria | 17683 |
| 755 | Ga0501038_0018266 | 3300049574 | Bacteria | 6330 |
| 756 | Ga0501038_0038294 | 3300049574 | Bacteria | 4200 |
| 757 | Ga0501038_0060216 | 3300049574 | Bacteria | 3249 |
| 758 | Ga0501038_0109918 | 3300049574 | Bacteria | 2284 |
| 759 | Ga0501039_0003401 | 3300049575 | Bacteria | 11893 |
| 760 | Ga0501039_0004998 | 3300049575 | Bacteria | 10064 |
| 761 | Ga0501040_0099063 | 3300049576 | Bacteria | 2032 |
| 762 | Ga0501042_0046076 | 3300049578 | Bacteria | 3109 |
| 763 | Ga0501043_0046282 | 3300049579 | Bacteria | 3421 |
| 764 | Ga0501046_0016750 | 3300049580 | Bacteria | 6127 |
| 765 | Ga0501046_0021887 | 3300049580 | Bacteria | 5270 |
| 766 | Ga0501046_0030737 | 3300049580 | Bacteria | 4357 |
| 767 | Ga0501046_0043592 | 3300049580 | Bacteria | 3571 |
| 768 | Ga0501046_0098393 | 3300049580 | Bacteria | 2246 |
| 769 | Ga0501046_0109128 | 3300049580 | Bacteria | 2116 |
| 770 | Ga0501047_0000925 | 3300049581 | Bacteria | 30036 |
| 771 | Ga0501047_0005009 | 3300049581 | Bacteria | 12432 |
| 772 | Ga0501047_0009424 | 3300049581 | Bacteria | 9225 |
| 773 | Ga0501047_0016805 | 3300049581 | Bacteria | 6991 |
| 774 | Ga0501047_0028672 | 3300049581 | Bacteria | 5369 |
| 775 | Ga0501047_0041719 | 3300049581 | Bacteria | 4433 |
| 776 | Ga0501047_0128123 | 3300049581 | Bacteria | 2418 |
| 777 | Ga0501047_0217257 | 3300049581 | Bacteria | 1768 |
| 778 | Ga0501048_0011325 | 3300049582 | Bacteria | 6651 |
| 779 | Ga0501048_0084586 | 3300049582 | Bacteria | 2237 |
| 780 | Ga0501067_0000156 | 3300049583 | Bacteria | 37946 |
| 781 | Ga0501067_0015309 | 3300049583 | Bacteria | 4244 |
| 782 | Ga0501068_0001884 | 3300049584 | Bacteria | 11164 |
| 783 | Ga0501068_0012805 | 3300049584 | Bacteria | 4762 |
| 784 | Ga0501068_0103539 | 3300049584 | Bacteria | 1765 |
| 785 | Ga0501069_0000829 | 3300049585 | Bacteria | 14614 |
| 786 | Ga0501069_0005548 | 3300049585 | Bacteria | 6570 |
| 787 | Ga0501069_0024160 | 3300049585 | Bacteria | 3315 |
| 788 | Ga0501069_0147448 | 3300049585 | Bacteria | 1351 |
| 789 | Ga0501070_0000105 | 3300049586 | Bacteria | 73931 |
| 790 | Ga0501070_0005394 | 3300049586 | Bacteria | 10905 |
| 791 | Ga0501070_0011632 | 3300049586 | Bacteria | 7429 |
| 792 | Ga0501070_0015227 | 3300049586 | Bacteria | 6473 |
| 793 | Ga0501070_0025592 | 3300049586 | Bacteria | 4949 |
| 794 | Ga0501070_0037811 | 3300049586 | Bacteria | 4028 |
| 795 | Ga0501070_0232991 | 3300049586 | Bacteria | 1508 |
| 796 | Ga0501071_0080680 | 3300049587 | Bacteria | 2379 |
| 797 | Ga0501071_0088189 | 3300049587 | Bacteria | 2276 |
| 798 | Ga0501072_0000722 | 3300049588 | Bacteria | 24035 |
| 799 | Ga0501072_0048402 | 3300049588 | Bacteria | 3348 |
| 800 | Ga0501073_0000305 | 3300049589 | Bacteria | 32450 |
| 801 | Ga0501073_0002931 | 3300049589 | Bacteria | 12802 |
| 802 | Ga0501073_0006743 | 3300049589 | Bacteria | 8548 |
| 803 | Ga0501073_0089506 | 3300049589 | Bacteria | 2140 |
| 804 | Ga0501074_0006157 | 3300049590 | Bacteria | 8664 |
| 805 | Ga0501074_0008079 | 3300049590 | Bacteria | 7623 |
| 806 | Ga0501074_0011517 | 3300049590 | Bacteria | 6430 |
| 807 | Ga0501074_0031601 | 3300049590 | Bacteria | 3835 |
| 808 | Ga0501079_0065327 | 3300049741 | Bacteria | 2806 |
| 809 | Ga0501080_0000867 | 3300049742 | Bacteria | 24781 |
| 810 | Ga0501080_0002410 | 3300049742 | Bacteria | 16318 |
| 811 | Ga0501080_0004755 | 3300049742 | Bacteria | 12111 |
| 812 | Ga0501080_0015663 | 3300049742 | Bacteria | 6991 |
| 813 | Ga0501080_0027236 | 3300049742 | Bacteria | 5316 |
| 814 | Ga0501080_0037361 | 3300049742 | Bacteria | 4535 |
| 815 | Ga0501080_0365882 | 3300049742 | Bacteria | 1301 |
| 816 | Ga0501081_0045080 | 3300049743 | Bacteria | 3028 |
| 817 | Ga0501083_0001739 | 3300049744 | Bacteria | 14853 |
| 818 | Ga0501083_0093581 | 3300049744 | Bacteria | 1984 |
| 819 | Ga0501035_0009302 | 3300049822 | Bacteria | 9131 |
| 820 | Ga0501035_0025529 | 3300049822 | Bacteria | 5416 |
| 821 | Ga0501035_0032477 | 3300049822 | Bacteria | 4749 |
| 822 | Ga0501035_0032987 | 3300049822 | Bacteria | 4709 |
| 823 | Ga0501035_0051360 | 3300049822 | Bacteria | 3692 |
| 824 | Ga0501035_0060203 | 3300049822 | Bacteria | 3381 |
| 825 | Ga0501035_0142923 | 3300049822 | Bacteria | 2079 |
| 826 | Ga0501035_0224597 | 3300049822 | Bacteria | 1602 |
| 827 | Ga0501035_0228920 | 3300049822 | Bacteria | 1584 |
| 828 | Ga0501044_0006675 | 3300049823 | Bacteria | 12721 |
| 829 | Ga0501044_0028607 | 3300049823 | Bacteria | 5882 |
| 830 | Ga0501044_0042666 | 3300049823 | Bacteria | 4716 |
| 831 | Ga0501044_0062567 | 3300049823 | Bacteria | 3804 |
| 832 | Ga0501044_0072136 | 3300049823 | Bacteria | 3511 |
| 833 | Ga0501044_0109658 | 3300049823 | Bacteria | 2769 |
| 834 | Ga0501044_0141185 | 3300049823 | Bacteria | 2397 |
| 835 | Ga0501045_0150712 | 3300049824 | Bacteria | 1730 |
| 836 | nmdc:mga0sz30_74114_c1 | 3300050516 | Bacteria | 1468 |
| 837 | Ga0500610_0000085 | 3300053079 | Bacteria | 28416 |
| 838 | Ga0500635_0012551 | 3300053080 | Bacteria | 2437 |
| 839 | Ga0500643_000002 | 3300053087 | Bacteria | 1277657 |
| 840 | Ga0500646_0010649 | 3300053090 | Bacteria | 2360 |
| 841 | Ga0500651_0000179 | 3300053093 | Bacteria | 41058 |
| 842 | Ga0500651_0001442 | 3300053093 | Bacteria | 11965 |
| 843 | Ga0500651_0031023 | 3300053093 | Bacteria | 3365 |
| 844 | Ga0500650_0000027 | 3300053098 | Bacteria | 59407 |
| 845 | Ga0500555_001867 | 3300053103 | Bacteria | 6265 |
| 846 | Ga0500597_000841 | 3300053120 | Bacteria | 7048 |
| 847 | Ga0500568_0001481 | 3300053139 | Bacteria | 15052 |
| 848 | Ga0500633_0005906 | 3300053160 | Bacteria | 2956 |
| 849 | Ga0500645_003001 | 3300053730 | Bacteria | 7140 |
| 850 | Ga0501084_0288880 | 3300054114 | Bacteria | 1385 |
| 851 | Ga0500661_004432 | 3300055283 | Bacteria | 2625 |
| 852 | Ga0501082_0000082 | 3300060353 | Bacteria | 71065 |
| 853 | Ga0501082_0103899 | 3300060353 | Bacteria | 2458 |
| 854 | Ga0501082_0122996 | 3300060353 | Bacteria | 2250 |
| 855 | Ga0501082_0173941 | 3300060353 | Bacteria | 1872 |
| 856 | Ga0466962_0004187 | 3300061719 | Bacteria | 6910 |
| 857 | Ga0466962_0009563 | 3300061719 | Bacteria | 4649 |
| 858 | Ga0466962_0017220 | 3300061719 | Bacteria | 3481 |
| 859 | Ga0466962_0024084 | 3300061719 | Bacteria | 2925 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300044658 | Ga0466972_0103252 | Ga0466972_0103252_236_1330 | 364 |
| 2 | 3300048916 | Ga0496113_0216433 | Ga0496113_0216433_28_1122 | 364 |
| 3 | 3300025933 | Ga0207706_10021569 | Ga0207706_100215692 | 366 |
| 4 | 3300005367 | Ga0070667_100076048 | Ga0070667_1000760483 | 367 |
| 5 | 3300005539 | Ga0068853_100000206 | Ga0068853_10000020611 | 367 |
| 6 | 3300005539 | Ga0068853_100014698 | Ga0068853_1000146986 | 367 |
| 7 | 3300005563 | Ga0068855_100014971 | Ga0068855_1000149714 | 367 |
| 8 | 3300005577 | Ga0068857_100039809 | Ga0068857_1000398093 | 367 |
| 9 | 3300009553 | Ga0105249_10128256 | Ga0105249_101282562 | 367 |
| 10 | 3300010375 | Ga0105239_10003089 | Ga0105239_100030898 | 367 |
| 11 | 3300025986 | Ga0207658_10102787 | Ga0207658_101027872 | 367 |
| 12 | 3300026041 | Ga0207639_10000230 | Ga0207639_1000023016 | 367 |
| 13 | 3300026041 | Ga0207639_10012848 | Ga0207639_100128482 | 367 |
| 14 | 3300026088 | Ga0207641_10049188 | Ga0207641_100491884 | 367 |
| 15 | 3300026116 | Ga0207674_10015842 | Ga0207674_100158426 | 367 |
| 16 | 3300041494 | Ga0451837_0542554 | Ga0451837_0542554_562_1710 | 367 |
| 17 | 3300049568 | Ga0501031_0026082 | Ga0501031_0026082_962_2110 | 367 |
| 18 | 3300049569 | Ga0501032_0003271 | Ga0501032_0003271_3758_4906 | 367 |
| 19 | 3300049570 | Ga0501033_0005967 | Ga0501033_0005967_8109_9257 | 367 |
| 20 | 3300049571 | Ga0501034_0001661 | Ga0501034_0001661_8141_9289 | 367 |
| 21 | 3300049572 | Ga0501036_0056274 | Ga0501036_0056274_447_1595 | 367 |
| 22 | 3300049573 | Ga0501037_0103843 | Ga0501037_0103843_330_1478 | 367 |
| 23 | 3300049574 | Ga0501038_0018266 | Ga0501038_0018266_1808_2956 | 367 |
| 24 | 3300049575 | Ga0501039_0004998 | Ga0501039_0004998_6130_7278 | 367 |
| 25 | 3300049581 | Ga0501047_0009424 | Ga0501047_0009424_278_1426 | 367 |
| 26 | 3300049589 | Ga0501073_0002931 | Ga0501073_0002931_8289_9437 | 367 |
| 27 | 3300049822 | Ga0501035_0032987 | Ga0501035_0032987_3360_4508 | 367 |
| 28 | 3300049823 | Ga0501044_0042666 | Ga0501044_0042666_202_1350 | 367 |
| 29 | 3300053093 | Ga0500651_0001442 | Ga0500651_0001442_2290_3438 | 367 |
| 30 | 3300053079 | Ga0500610_0000085 | Ga0500610_0000085_266_1414 | 368 |
| 31 | 3300049584 | Ga0501068_0103539 | Ga0501068_0103539_449_1591 | 369 |
| 32 | 3300049587 | Ga0501071_0088189 | Ga0501071_0088189_425_1567 | 369 |
| 33 | 3300049824 | Ga0501045_0150712 | Ga0501045_0150712_104_1246 | 369 |
| 34 | 3300060353 | Ga0501082_0103899 | Ga0501082_0103899_964_2106 | 369 |
| 35 | 3300049580 | Ga0501046_0109128 | Ga0501046_0109128_944_2086 | 371 |
| 36 | 3300049743 | Ga0501081_0045080 | Ga0501081_0045080_536_1678 | 371 |
| 37 | 3300049589 | Ga0501073_0006743 | Ga0501073_0006743_2687_3814 | 374 |
| 38 | 3300049586 | Ga0501070_0232991 | Ga0501070_0232991_13_1140 | 375 |
| 39 | iso_pu_bacteria | 2643221577 | 2643894964 | 376 |
| 40 | iso_pu_bacteria | 2643221685 | 2644477122 | 376 |
| 41 | iso_pu_bacteria | 2576861471 | 2578457767 | 377 |
| 42 | iso_pu_bacteria | 2593339238 | 2595446321 | 377 |
| 43 | iso_pu_bacteria | 2593339239 | 2595452250 | 377 |
| 44 | iso_pu_bacteria | 2718218334 | 2721027243 | 377 |
| 45 | iso_pu_bacteria | 2734482264 | 2735837164 | 377 |
| 46 | iso_pu_bacteria | 2738543009 | 2739226622 | 377 |
| 47 | iso_pu_bacteria | 2739367700 | 2739731521 | 377 |
| 48 | iso_pu_bacteria | 2747842428 | 2747949148 | 377 |
| 49 | iso_pu_bacteria | 2765235840 | 2765579726 | 377 |
| 50 | iso_pu_bacteria | 2818991440 | 2819562905 | 377 |
| 51 | iso_pu_bacteria | 2818991457 | 2819659901 | 377 |
| 52 | iso_pu_bacteria | 2842757796 | 2842760070 | 377 |
| 53 | iso_pu_bacteria | 2842914999 | 2842916602 | 377 |
| 54 | iso_pu_bacteria | 2842918807 | 2842919054 | 377 |
| 55 | iso_pu_bacteria | 2852684882 | 2852685271 | 377 |
| 56 | iso_pu_bacteria | 2857442823 | 2857446126 | 377 |
| 57 | iso_pu_bacteria | 2874220319 | 2874222421 | 377 |
| 58 | iso_pu_bacteria | 2884338543 | 2884340669 | 377 |
| 59 | iso_pu_bacteria | 2884411467 | 2884414932 | 377 |
| 60 | iso_pu_bacteria | 2904463128 | 2904463517 | 377 |
| 61 | iso_pu_bacteria | 2919085039 | 2919085268 | 377 |
| 62 | iso_pu_bacteria | 2919089067 | 2919090359 | 377 |
| 63 | iso_pu_bacteria | 2919130084 | 2919131392 | 377 |
| 64 | iso_pu_bacteria | 2919404418 | 2919405599 | 377 |
| 65 | iso_pu_bacteria | 2928496128 | 2928497746 | 377 |
| 66 | iso_pu_bacteria | 2928963466 | 2928967608 | 377 |
| 67 | iso_pu_bacteria | 2929195423 | 2929198186 | 377 |
| 68 | iso_pu_bacteria | 2931380184 | 2931384123 | 377 |
| 69 | iso_pu_bacteria | 2937610967 | 2937614714 | 377 |
| 70 | iso_pu_bacteria | 2939589442 | 2939590948 | 377 |
| 71 | iso_pu_bacteria | 2939611941 | 2939612215 | 377 |
| 72 | iso_pu_bacteria | 2939622612 | 2939625549 | 377 |
| 73 | iso_pu_bacteria | 2939626828 | 2939630600 | 377 |
| 74 | iso_pu_bacteria | 2941471342 | 2941471380 | 377 |
| 75 | iso_pu_bacteria | 2953994433 | 2953994665 | 377 |
| 76 | iso_pu_bacteria | 2961047084 | 2961049186 | 377 |
| 77 | iso_pu_bacteria | 2974307012 | 2974308378 | 377 |
| 78 | iso_pu_bacteria | 2977247770 | 2977249135 | 377 |
| 79 | iso_pu_bacteria | 2984514374 | 2984516413 | 377 |
| 80 | 3300028794 | Ga0307515_10164507 | Ga0307515_101645072 | 378 |
| 81 | 3300042132 | Ga0450895_000548 | Ga0450895_000548_842_1999 | 379 |
| 82 | 3300042133 | Ga0450896_000078 | Ga0450896_000078_4928_6085 | 379 |
| 83 | 3300042146 | Ga0450907_003204 | Ga0450907_003204_1095_2252 | 379 |
| 84 | 3300042531 | Ga0450918_004985 | Ga0450918_004985_799_1956 | 379 |
| 85 | 3300005337 | Ga0070682_100016224 | Ga0070682_1000162242 | 380 |
| 86 | 3300005366 | Ga0070659_100020340 | Ga0070659_1000203402 | 380 |
| 87 | 3300005435 | Ga0070714_100001173 | Ga0070714_1000011737 | 380 |
| 88 | 3300005457 | Ga0070662_100087991 | Ga0070662_1000879911 | 380 |
| 89 | 3300005530 | Ga0070679_100231057 | Ga0070679_1002310571 | 380 |
| 90 | 3300005614 | Ga0068856_100174181 | Ga0068856_1001741812 | 380 |
| 91 | 3300010375 | Ga0105239_10027103 | Ga0105239_100271034 | 380 |
| 92 | 3300020082 | Ga0206353_11265797 | Ga0206353_112657972 | 380 |
| 93 | 3300025904 | Ga0207647_10007991 | Ga0207647_100079918 | 380 |
| 94 | 3300025912 | Ga0207707_10003426 | Ga0207707_100034264 | 380 |
| 95 | 3300025919 | Ga0207657_10015540 | Ga0207657_100155407 | 380 |
| 96 | 3300025929 | Ga0207664_10000126 | Ga0207664_1000012644 | 380 |
| 97 | 3300025932 | Ga0207690_10000266 | Ga0207690_1000026620 | 380 |
| 98 | 3300025932 | Ga0207690_10011293 | Ga0207690_100112932 | 380 |
| 99 | 3300025933 | Ga0207706_10017013 | Ga0207706_100170132 | 380 |
| 100 | 3300049571 | Ga0501034_0045078 | Ga0501034_0045078_168_1310 | 380 |
| 101 | 3300049580 | Ga0501046_0021887 | Ga0501046_0021887_933_2075 | 380 |
| 102 | 3300049581 | Ga0501047_0128123 | Ga0501047_0128123_436_1578 | 380 |
| 103 | 3300001904 | JGI24736J21556_1004702 | JGI24736J21556_10047022 | 381 |
| 104 | 3300001915 | JGI24741J21665_1000222 | JGI24741J21665_100022211 | 381 |
| 105 | 3300001915 | JGI24741J21665_1004101 | JGI24741J21665_10041011 | 381 |
| 106 | 3300001915 | JGI24741J21665_1005082 | JGI24741J21665_10050822 | 381 |
| 107 | 3300001979 | JGI24740J21852_10001834 | JGI24740J21852_100018344 | 381 |
| 108 | 3300001979 | JGI24740J21852_10002844 | JGI24740J21852_100028448 | 381 |
| 109 | 3300001979 | JGI24740J21852_10005375 | JGI24740J21852_100053755 | 381 |
| 110 | 3300001989 | JGI24739J22299_10000752 | JGI24739J22299_100007524 | 381 |
| 111 | 3300001990 | JGI24737J22298_10000922 | JGI24737J22298_100009223 | 381 |
| 112 | 3300002067 | JGI24735J21928_10003438 | JGI24735J21928_100034387 | 381 |
| 113 | 3300002067 | JGI24735J21928_10007930 | JGI24735J21928_100079304 | 381 |
| 114 | 3300002705 | JGI25156J39149_1005799 | JGI25156J39149_10057993 | 381 |
| 115 | 3300002737 | JGI25162J39368_1000048 | JGI25162J39368_1000048123 | 381 |
| 116 | 3300002737 | JGI25162J39368_1000665 | JGI25162J39368_10006655 | 381 |
| 117 | 3300002737 | JGI25162J39368_1000810 | JGI25162J39368_10008104 | 381 |
| 118 | 3300002737 | JGI25162J39368_1001000 | JGI25162J39368_10010001 | 381 |
| 119 | 3300002737 | JGI25162J39368_1003917 | JGI25162J39368_10039174 | 381 |
| 120 | 3300002741 | JGI25157J39369_1000269 | JGI25157J39369_100026914 | 381 |
| 121 | 3300002741 | JGI25157J39369_1000582 | JGI25157J39369_100058221 | 381 |
| 122 | 3300002741 | JGI25157J39369_1001539 | JGI25157J39369_10015392 | 381 |
| 123 | 3300002741 | JGI25157J39369_1002682 | JGI25157J39369_10026824 | 381 |
| 124 | 3300002771 | JGI25163J39215_1000651 | JGI25163J39215_10006515 | 381 |
| 125 | 3300002772 | JGI25164J39214_1000085 | JGI25164J39214_100008571 | 381 |
| 126 | 3300002772 | JGI25164J39214_1000284 | JGI25164J39214_100028432 | 381 |
| 127 | 3300003214 | JGI25165J46597_1000009 | JGI25165J46597_1000009320 | 381 |
| 128 | 3300003214 | JGI25165J46597_1000090 | JGI25165J46597_1000090148 | 381 |
| 129 | 3300003215 | JGI25153J46596_10017182 | JGI25153J46596_100171822 | 381 |
| 130 | 3300003578 | Ga0006562J51391_1191774 | Ga0006562J51391_11917746 | 381 |
| 131 | 3300003578 | Ga0006562J51391_1191776 | Ga0006562J51391_11917762 | 381 |
| 132 | 3300003751 | Ga0055538_1002276 | Ga0055538_10022762 | 381 |
| 133 | 3300003752 | Ga0055539_1000667 | Ga0055539_100066711 | 381 |
| 134 | 3300003756 | Ga0055533_1000487 | Ga0055533_100048715 | 381 |
| 135 | 3300003756 | Ga0055533_1001318 | Ga0055533_10013182 | 381 |
| 136 | 3300003759 | Ga0055525_1000097 | Ga0055525_1000097115 | 381 |
| 137 | 3300003760 | Ga0055527_1000677 | Ga0055527_10006774 | 381 |
| 138 | 3300003760 | Ga0055527_1000689 | Ga0055527_10006893 | 381 |
| 139 | 3300003760 | Ga0055527_1001726 | Ga0055527_10017264 | 381 |
| 140 | 3300003761 | Ga0055535_1000016 | Ga0055535_1000016173 | 381 |
| 141 | 3300003761 | Ga0055535_1001167 | Ga0055535_100116714 | 381 |
| 142 | 3300003761 | Ga0055535_1001556 | Ga0055535_10015566 | 381 |
| 143 | 3300003761 | Ga0055535_1001670 | Ga0055535_10016708 | 381 |
| 144 | 3300003761 | Ga0055535_1001681 | Ga0055535_10016814 | 381 |
| 145 | 3300003761 | Ga0055535_1001685 | Ga0055535_10016858 | 381 |
| 146 | 3300003762 | Ga0055542_1000045 | Ga0055542_1000045122 | 381 |
| 147 | 3300003762 | Ga0055542_1000098 | Ga0055542_100009876 | 381 |
| 148 | 3300003762 | Ga0055542_1001145 | Ga0055542_10011456 | 381 |
| 149 | 3300003762 | Ga0055542_1001620 | Ga0055542_10016204 | 381 |
| 150 | 3300003762 | Ga0055542_1001628 | Ga0055542_10016284 | 381 |
| 151 | 3300003762 | Ga0055542_1001632 | Ga0055542_10016328 | 381 |
| 152 | 3300003763 | Ga0055529_1000020 | Ga0055529_1000020136 | 381 |
| 153 | 3300003763 | Ga0055529_1001211 | Ga0055529_10012114 | 381 |
| 154 | 3300003763 | Ga0055529_1001215 | Ga0055529_10012154 | 381 |
| 155 | 3300003763 | Ga0055529_1001245 | Ga0055529_10012457 | 381 |
| 156 | 3300003771 | Ga0055526_1000263 | Ga0055526_10002634 | 381 |
| 157 | 3300003771 | Ga0055526_1002377 | Ga0055526_100237713 | 381 |
| 158 | 3300003773 | Ga0055537_1000164 | Ga0055537_100016423 | 381 |
| 159 | 3300003775 | Ga0055524_1016320 | Ga0055524_10163201 | 381 |
| 160 | 3300003781 | Ga0055536_1001874 | Ga0055536_100187410 | 381 |
| 161 | 3300003784 | Ga0055534_1000026 | Ga0055534_100002657 | 381 |
| 162 | 3300003791 | Ga0055530_10000772 | Ga0055530_100007725 | 381 |
| 163 | 3300003856 | Ga0058692_1000006 | Ga0058692_1000006210 | 381 |
| 164 | 3300003856 | Ga0058692_1000012 | Ga0058692_1000012121 | 381 |
| 165 | 3300005262 | Ga0065165_1000001 | Ga0065165_1000001183 | 381 |
| 166 | 3300005262 | Ga0065165_1000940 | Ga0065165_100094027 | 381 |
| 167 | 3300005327 | Ga0070658_10002041 | Ga0070658_100020418 | 381 |
| 168 | 3300005327 | Ga0070658_10068626 | Ga0070658_100686262 | 381 |
| 169 | 3300005327 | Ga0070658_10133566 | Ga0070658_101335661 | 381 |
| 170 | 3300005330 | Ga0070690_100110876 | Ga0070690_1001108762 | 381 |
| 171 | 3300005331 | Ga0070670_100000002 | Ga0070670_100000002317 | 381 |
| 172 | 3300005331 | Ga0070670_100145951 | Ga0070670_1001459512 | 381 |
| 173 | 3300005334 | Ga0068869_100037648 | Ga0068869_1000376481 | 381 |
| 174 | 3300005335 | Ga0070666_10000034 | Ga0070666_1000003491 | 381 |
| 175 | 3300005335 | Ga0070666_10000349 | Ga0070666_1000034933 | 381 |
| 176 | 3300005335 | Ga0070666_10004505 | Ga0070666_100045054 | 381 |
| 177 | 3300005335 | Ga0070666_10006812 | Ga0070666_100068122 | 381 |
| 178 | 3300005335 | Ga0070666_10026150 | Ga0070666_100261502 | 381 |
| 179 | 3300005336 | Ga0070680_100000209 | Ga0070680_10000020915 | 381 |
| 180 | 3300005336 | Ga0070680_100001172 | Ga0070680_1000011724 | 381 |
| 181 | 3300005336 | Ga0070680_100095324 | Ga0070680_1000953242 | 381 |
| 182 | 3300005337 | Ga0070682_100023562 | Ga0070682_1000235622 | 381 |
| 183 | 3300005339 | Ga0070660_100071018 | Ga0070660_1000710182 | 381 |
| 184 | 3300005339 | Ga0070660_100076743 | Ga0070660_1000767432 | 381 |
| 185 | 3300005341 | Ga0070691_10009542 | Ga0070691_100095424 | 381 |
| 186 | 3300005344 | Ga0070661_100001611 | Ga0070661_1000016113 | 381 |
| 187 | 3300005344 | Ga0070661_100006432 | Ga0070661_1000064322 | 381 |
| 188 | 3300005344 | Ga0070661_100008490 | Ga0070661_1000084908 | 381 |
| 189 | 3300005344 | Ga0070661_100043425 | Ga0070661_1000434252 | 381 |
| 190 | 3300005345 | Ga0070692_10001030 | Ga0070692_100010307 | 381 |
| 191 | 3300005347 | Ga0070668_100020437 | Ga0070668_1000204373 | 381 |
| 192 | 3300005347 | Ga0070668_100096721 | Ga0070668_1000967212 | 381 |
| 193 | 3300005347 | Ga0070668_100201816 | Ga0070668_1002018161 | 381 |
| 194 | 3300005353 | Ga0070669_100008381 | Ga0070669_1000083815 | 381 |
| 195 | 3300005353 | Ga0070669_100210889 | Ga0070669_1002108891 | 381 |
| 196 | 3300005354 | Ga0070675_100198263 | Ga0070675_1001982632 | 381 |
| 197 | 3300005355 | Ga0070671_100000071 | Ga0070671_10000007123 | 381 |
| 198 | 3300005356 | Ga0070674_100194024 | Ga0070674_1001940242 | 381 |
| 199 | 3300005366 | Ga0070659_100079503 | Ga0070659_1000795032 | 381 |
| 200 | 3300005367 | Ga0070667_100000005 | Ga0070667_10000000530 | 381 |
| 201 | 3300005367 | Ga0070667_100000007 | Ga0070667_100000007185 | 381 |
| 202 | 3300005367 | Ga0070667_100120315 | Ga0070667_1001203152 | 381 |
| 203 | 3300005436 | Ga0070713_100000486 | Ga0070713_10000048622 | 381 |
| 204 | 3300005455 | Ga0070663_100009827 | Ga0070663_1000098273 | 381 |
| 205 | 3300005455 | Ga0070663_100019628 | Ga0070663_1000196283 | 381 |
| 206 | 3300005455 | Ga0070663_100021767 | Ga0070663_1000217672 | 381 |
| 207 | 3300005455 | Ga0070663_100058261 | Ga0070663_1000582611 | 381 |
| 208 | 3300005455 | Ga0070663_100080133 | Ga0070663_1000801332 | 381 |
| 209 | 3300005456 | Ga0070678_100012770 | Ga0070678_1000127702 | 381 |
| 210 | 3300005456 | Ga0070678_100033970 | Ga0070678_1000339704 | 381 |
| 211 | 3300005456 | Ga0070678_100086612 | Ga0070678_1000866121 | 381 |
| 212 | 3300005457 | Ga0070662_100023627 | Ga0070662_1000236274 | 381 |
| 213 | 3300005458 | Ga0070681_10000007 | Ga0070681_1000000726 | 381 |
| 214 | 3300005458 | Ga0070681_10000397 | Ga0070681_1000039710 | 381 |
| 215 | 3300005458 | Ga0070681_10000998 | Ga0070681_1000099815 | 381 |
| 216 | 3300005458 | Ga0070681_10017959 | Ga0070681_100179593 | 381 |
| 217 | 3300005459 | Ga0068867_100005929 | Ga0068867_1000059292 | 381 |
| 218 | 3300005466 | Ga0070685_10000275 | Ga0070685_100002756 | 381 |
| 219 | 3300005530 | Ga0070679_100000412 | Ga0070679_10000041225 | 381 |
| 220 | 3300005530 | Ga0070679_100004197 | Ga0070679_10000419712 | 381 |
| 221 | 3300005530 | Ga0070679_100014507 | Ga0070679_1000145078 | 381 |
| 222 | 3300005530 | Ga0070679_100084989 | Ga0070679_1000849892 | 381 |
| 223 | 3300005530 | Ga0070679_100109154 | Ga0070679_1001091542 | 381 |
| 224 | 3300005539 | Ga0068853_100003817 | Ga0068853_1000038173 | 381 |
| 225 | 3300005539 | Ga0068853_100010874 | Ga0068853_1000108746 | 381 |
| 226 | 3300005539 | Ga0068853_100013551 | Ga0068853_1000135515 | 381 |
| 227 | 3300005539 | Ga0068853_100013620 | Ga0068853_1000136207 | 381 |
| 228 | 3300005539 | Ga0068853_100071311 | Ga0068853_1000713111 | 381 |
| 229 | 3300005546 | Ga0070696_100041500 | Ga0070696_1000415003 | 381 |
| 230 | 3300005546 | Ga0070696_100090932 | Ga0070696_1000909322 | 381 |
| 231 | 3300005546 | Ga0070696_100217777 | Ga0070696_1002177771 | 381 |
| 232 | 3300005547 | Ga0070693_100011214 | Ga0070693_1000112145 | 381 |
| 233 | 3300005548 | Ga0070665_100000057 | Ga0070665_100000057238 | 381 |
| 234 | 3300005548 | Ga0070665_100000227 | Ga0070665_10000022732 | 381 |
| 235 | 3300005548 | Ga0070665_100034667 | Ga0070665_1000346676 | 381 |
| 236 | 3300005548 | Ga0070665_100049290 | Ga0070665_1000492905 | 381 |
| 237 | 3300005548 | Ga0070665_100083170 | Ga0070665_1000831701 | 381 |
| 238 | 3300005548 | Ga0070665_100098700 | Ga0070665_1000987003 | 381 |
| 239 | 3300005548 | Ga0070665_100102185 | Ga0070665_1001021852 | 381 |
| 240 | 3300005548 | Ga0070665_100113007 | Ga0070665_1001130074 | 381 |
| 241 | 3300005548 | Ga0070665_100122132 | Ga0070665_1001221322 | 381 |
| 242 | 3300005563 | Ga0068855_100003573 | Ga0068855_1000035737 | 381 |
| 243 | 3300005563 | Ga0068855_100004858 | Ga0068855_1000048587 | 381 |
| 244 | 3300005563 | Ga0068855_100012573 | Ga0068855_1000125734 | 381 |
| 245 | 3300005563 | Ga0068855_100120621 | Ga0068855_1001206212 | 381 |
| 246 | 3300005564 | Ga0070664_100092394 | Ga0070664_1000923943 | 381 |
| 247 | 3300005577 | Ga0068857_100001801 | Ga0068857_10000180111 | 381 |
| 248 | 3300005577 | Ga0068857_100057497 | Ga0068857_1000574972 | 381 |
| 249 | 3300005578 | Ga0068854_100000774 | Ga0068854_10000077416 | 381 |
| 250 | 3300005578 | Ga0068854_100005461 | Ga0068854_1000054616 | 381 |
| 251 | 3300005578 | Ga0068854_100009017 | Ga0068854_1000090175 | 381 |
| 252 | 3300005578 | Ga0068854_100197937 | Ga0068854_1001979372 | 381 |
| 253 | 3300005614 | Ga0068856_100000310 | Ga0068856_10000031022 | 381 |
| 254 | 3300005614 | Ga0068856_100001563 | Ga0068856_10000156311 | 381 |
| 255 | 3300005614 | Ga0068856_100128167 | Ga0068856_1001281673 | 381 |
| 256 | 3300005614 | Ga0068856_100147658 | Ga0068856_1001476582 | 381 |
| 257 | 3300005616 | Ga0068852_100006743 | Ga0068852_1000067434 | 381 |
| 258 | 3300005616 | Ga0068852_100010358 | Ga0068852_1000103584 | 381 |
| 259 | 3300005616 | Ga0068852_100015345 | Ga0068852_1000153456 | 381 |
| 260 | 3300005616 | Ga0068852_100016190 | Ga0068852_1000161903 | 381 |
| 261 | 3300005616 | Ga0068852_100100870 | Ga0068852_1001008702 | 381 |
| 262 | 3300005617 | Ga0068859_100001188 | Ga0068859_1000011884 | 381 |
| 263 | 3300005617 | Ga0068859_100087241 | Ga0068859_1000872412 | 381 |
| 264 | 3300005617 | Ga0068859_100089097 | Ga0068859_1000890972 | 381 |
| 265 | 3300005617 | Ga0068859_100134405 | Ga0068859_1001344053 | 381 |
| 266 | 3300005618 | Ga0068864_100000003 | Ga0068864_100000003323 | 381 |
| 267 | 3300005719 | Ga0068861_100079415 | Ga0068861_1000794153 | 381 |
| 268 | 3300005834 | Ga0068851_10001367 | Ga0068851_100013672 | 381 |
| 269 | 3300005834 | Ga0068851_10004040 | Ga0068851_100040406 | 381 |
| 270 | 3300005834 | Ga0068851_10004918 | Ga0068851_100049186 | 381 |
| 271 | 3300005841 | Ga0068863_100000773 | Ga0068863_10000077316 | 381 |
| 272 | 3300005841 | Ga0068863_100286884 | Ga0068863_1002868841 | 381 |
| 273 | 3300005842 | Ga0068858_100042553 | Ga0068858_1000425531 | 381 |
| 274 | 3300005842 | Ga0068858_100187011 | Ga0068858_1001870112 | 381 |
| 275 | 3300005843 | Ga0068860_100004261 | Ga0068860_1000042616 | 381 |
| 276 | 3300005844 | Ga0068862_100000548 | Ga0068862_1000005483 | 381 |
| 277 | 3300005844 | Ga0068862_100005287 | Ga0068862_1000052873 | 381 |
| 278 | 3300005844 | Ga0068862_100255905 | Ga0068862_1002559052 | 381 |
| 279 | 3300005844 | Ga0068862_100292956 | Ga0068862_1002929562 | 381 |
| 280 | 3300005983 | Ga0081540_1003991 | Ga0081540_10039913 | 381 |
| 281 | 3300006051 | Ga0075364_10131251 | Ga0075364_101312512 | 381 |
| 282 | 3300006186 | Ga0075369_10004497 | Ga0075369_100044972 | 381 |
| 283 | 3300006237 | Ga0097621_100029605 | Ga0097621_1000296053 | 381 |
| 284 | 3300006237 | Ga0097621_100111918 | Ga0097621_1001119182 | 381 |
| 285 | 3300006847 | Ga0075431_100069913 | Ga0075431_1000699132 | 381 |
| 286 | 3300006881 | Ga0068865_100009828 | Ga0068865_1000098284 | 381 |
| 287 | 3300006881 | Ga0068865_100048270 | Ga0068865_1000482701 | 381 |
| 288 | 3300006931 | Ga0097620_100001188 | Ga0097620_1000011884 | 381 |
| 289 | 3300006931 | Ga0097620_100087241 | Ga0097620_1000872412 | 381 |
| 290 | 3300006931 | Ga0097620_100089103 | Ga0097620_1000891031 | 381 |
| 291 | 3300006931 | Ga0097620_100134403 | Ga0097620_1001344033 | 381 |
| 292 | 3300009011 | Ga0105251_10007635 | Ga0105251_100076352 | 381 |
| 293 | 3300009093 | Ga0105240_10004166 | Ga0105240_100041665 | 381 |
| 294 | 3300009093 | Ga0105240_10092908 | Ga0105240_100929082 | 381 |
| 295 | 3300009093 | Ga0105240_10096470 | Ga0105240_100964704 | 381 |
| 296 | 3300009093 | Ga0105240_10097179 | Ga0105240_100971792 | 381 |
| 297 | 3300009093 | Ga0105240_10109408 | Ga0105240_101094083 | 381 |
| 298 | 3300009093 | Ga0105240_10115149 | Ga0105240_101151492 | 381 |
| 299 | 3300009093 | Ga0105240_10298749 | Ga0105240_102987492 | 381 |
| 300 | 3300009098 | Ga0105245_10090266 | Ga0105245_100902662 | 381 |
| 301 | 3300009101 | Ga0105247_10011228 | Ga0105247_100112282 | 381 |
| 302 | 3300009148 | Ga0105243_10057514 | Ga0105243_100575142 | 381 |
| 303 | 3300009174 | Ga0105241_10003106 | Ga0105241_100031063 | 381 |
| 304 | 3300009174 | Ga0105241_10005656 | Ga0105241_100056568 | 381 |
| 305 | 3300009174 | Ga0105241_10162852 | Ga0105241_101628522 | 381 |
| 306 | 3300009176 | Ga0105242_10404173 | Ga0105242_104041732 | 381 |
| 307 | 3300009177 | Ga0105248_10001462 | Ga0105248_1000146228 | 381 |
| 308 | 3300009177 | Ga0105248_10198295 | Ga0105248_101982951 | 381 |
| 309 | 3300009545 | Ga0105237_10000250 | Ga0105237_1000025074 | 381 |
| 310 | 3300009545 | Ga0105237_10000701 | Ga0105237_1000070133 | 381 |
| 311 | 3300009545 | Ga0105237_10002972 | Ga0105237_100029727 | 381 |
| 312 | 3300009551 | Ga0105238_10001647 | Ga0105238_1000164712 | 381 |
| 313 | 3300009551 | Ga0105238_10003680 | Ga0105238_100036804 | 381 |
| 314 | 3300009551 | Ga0105238_10010010 | Ga0105238_100100105 | 381 |
| 315 | 3300009551 | Ga0105238_10034239 | Ga0105238_100342392 | 381 |
| 316 | 3300009551 | Ga0105238_10128450 | Ga0105238_101284502 | 381 |
| 317 | 3300009551 | Ga0105238_10196202 | Ga0105238_101962022 | 381 |
| 318 | 3300009551 | Ga0105238_10299083 | Ga0105238_102990832 | 381 |
| 319 | 3300009553 | Ga0105249_10000763 | Ga0105249_1000076312 | 381 |
| 320 | 3300009553 | Ga0105249_10009268 | Ga0105249_100092689 | 381 |
| 321 | 3300010375 | Ga0105239_10011101 | Ga0105239_100111016 | 381 |
| 322 | 3300010375 | Ga0105239_10044717 | Ga0105239_100447173 | 381 |
| 323 | 3300010375 | Ga0105239_10076582 | Ga0105239_100765824 | 381 |
| 324 | 3300010375 | Ga0105239_10109250 | Ga0105239_101092502 | 381 |
| 325 | 3300013100 | Ga0157373_10057570 | Ga0157373_100575702 | 381 |
| 326 | 3300013100 | Ga0157373_10210362 | Ga0157373_102103621 | 381 |
| 327 | 3300013100 | Ga0157373_10210593 | Ga0157373_102105931 | 381 |
| 328 | 3300013102 | Ga0157371_10000400 | Ga0157371_1000040038 | 381 |
| 329 | 3300013102 | Ga0157371_10005810 | Ga0157371_1000581010 | 381 |
| 330 | 3300013102 | Ga0157371_10020709 | Ga0157371_100207096 | 381 |
| 331 | 3300013102 | Ga0157371_10098820 | Ga0157371_100988202 | 381 |
| 332 | 3300013104 | Ga0157370_10000204 | Ga0157370_1000020421 | 381 |
| 333 | 3300013104 | Ga0157370_10006775 | Ga0157370_100067758 | 381 |
| 334 | 3300013104 | Ga0157370_10065744 | Ga0157370_100657442 | 381 |
| 335 | 3300013104 | Ga0157370_10157804 | Ga0157370_101578042 | 381 |
| 336 | 3300013105 | Ga0157369_10004267 | Ga0157369_1000426711 | 381 |
| 337 | 3300013105 | Ga0157369_10014816 | Ga0157369_100148165 | 381 |
| 338 | 3300013105 | Ga0157369_10108550 | Ga0157369_101085502 | 381 |
| 339 | 3300013105 | Ga0157369_10361418 | Ga0157369_103614182 | 381 |
| 340 | 3300013296 | Ga0157374_10009835 | Ga0157374_100098354 | 381 |
| 341 | 3300013297 | Ga0157378_10000742 | Ga0157378_1000074227 | 381 |
| 342 | 3300013306 | Ga0163162_10000106 | Ga0163162_1000010668 | 381 |
| 343 | 3300013306 | Ga0163162_10033814 | Ga0163162_100338142 | 381 |
| 344 | 3300013306 | Ga0163162_10053513 | Ga0163162_100535132 | 381 |
| 345 | 3300013307 | Ga0157372_10000445 | Ga0157372_1000044526 | 381 |
| 346 | 3300013307 | Ga0157372_10003420 | Ga0157372_100034205 | 381 |
| 347 | 3300013307 | Ga0157372_10007949 | Ga0157372_100079496 | 381 |
| 348 | 3300013307 | Ga0157372_10043583 | Ga0157372_100435833 | 381 |
| 349 | 3300013307 | Ga0157372_10065011 | Ga0157372_100650114 | 381 |
| 350 | 3300013307 | Ga0157372_10068579 | Ga0157372_100685792 | 381 |
| 351 | 3300013308 | Ga0157375_10003145 | Ga0157375_1000314513 | 381 |
| 352 | 3300013308 | Ga0157375_10074274 | Ga0157375_100742742 | 381 |
| 353 | 3300014325 | Ga0163163_10000031 | Ga0163163_1000003146 | 381 |
| 354 | 3300014325 | Ga0163163_10000863 | Ga0163163_100008635 | 381 |
| 355 | 3300014325 | Ga0163163_10013489 | Ga0163163_100134894 | 381 |
| 356 | 3300014325 | Ga0163163_10089563 | Ga0163163_100895632 | 381 |
| 357 | 3300014497 | Ga0182008_10000123 | Ga0182008_1000012337 | 381 |
| 358 | 3300014497 | Ga0182008_10001033 | Ga0182008_100010337 | 381 |
| 359 | 3300014968 | Ga0157379_10004344 | Ga0157379_100043444 | 381 |
| 360 | 3300014968 | Ga0157379_10039177 | Ga0157379_100391772 | 381 |
| 361 | 3300014969 | Ga0157376_10001616 | Ga0157376_1000161611 | 381 |
| 362 | 3300014969 | Ga0157376_10023869 | Ga0157376_100238693 | 381 |
| 363 | 3300015261 | Ga0182006_1000005 | Ga0182006_1000005261 | 381 |
| 364 | 3300015261 | Ga0182006_1002024 | Ga0182006_10020243 | 381 |
| 365 | 3300015262 | Ga0182007_10006316 | Ga0182007_100063163 | 381 |
| 366 | 3300015265 | Ga0182005_1000004 | Ga0182005_1000004340 | 381 |
| 367 | 3300015265 | Ga0182005_1000611 | Ga0182005_10006118 | 381 |
| 368 | 3300015265 | Ga0182005_1001305 | Ga0182005_10013058 | 381 |
| 369 | 3300015265 | Ga0182005_1005449 | Ga0182005_10054493 | 381 |
| 370 | 3300015687 | Ga0183368_1004 | Ga0183368_1004983 | 381 |
| 371 | 3300017792 | Ga0163161_10001879 | Ga0163161_1000187912 | 381 |
| 372 | 3300017792 | Ga0163161_10002326 | Ga0163161_100023268 | 381 |
| 373 | 3300017792 | Ga0163161_10004817 | Ga0163161_100048173 | 381 |
| 374 | 3300020080 | Ga0206350_11099119 | Ga0206350_110991191 | 381 |
| 375 | 3300020610 | Ga0154015_1194426 | Ga0154015_11944263 | 381 |
| 376 | 3300020610 | Ga0154015_1205975 | Ga0154015_12059753 | 381 |
| 377 | 3300022467 | Ga0224712_10026609 | Ga0224712_100266092 | 381 |
| 378 | 3300025224 | Ga0209784_100013 | Ga0209784_100013184 | 381 |
| 379 | 3300025226 | Ga0209674_100062 | Ga0209674_100062146 | 381 |
| 380 | 3300025226 | Ga0209674_100108 | Ga0209674_100108108 | 381 |
| 381 | 3300025226 | Ga0209674_100193 | Ga0209674_10019333 | 381 |
| 382 | 3300025226 | Ga0209674_100776 | Ga0209674_1007762 | 381 |
| 383 | 3300025226 | Ga0209674_102155 | Ga0209674_1021552 | 381 |
| 384 | 3300025228 | Ga0209672_100007 | Ga0209672_100007249 | 381 |
| 385 | 3300025228 | Ga0209672_100078 | Ga0209672_1000784 | 381 |
| 386 | 3300025228 | Ga0209672_100551 | Ga0209672_1005514 | 381 |
| 387 | 3300025230 | Ga0209563_100079 | Ga0209563_100079114 | 381 |
| 388 | 3300025231 | Ga0207427_100033 | Ga0207427_100033294 | 381 |
| 389 | 3300025231 | Ga0207427_100073 | Ga0207427_100073115 | 381 |
| 390 | 3300025231 | Ga0207427_100112 | Ga0207427_10011286 | 381 |
| 391 | 3300025231 | Ga0207427_107381 | Ga0207427_1073811 | 381 |
| 392 | 3300025233 | Ga0209437_100012 | Ga0209437_100012435 | 381 |
| 393 | 3300025233 | Ga0209437_100020 | Ga0209437_10002068 | 381 |
| 394 | 3300025233 | Ga0209437_100105 | Ga0209437_100105193 | 381 |
| 395 | 3300025233 | Ga0209437_100151 | Ga0209437_100151116 | 381 |
| 396 | 3300025233 | Ga0209437_101420 | Ga0209437_1014206 | 381 |
| 397 | 3300025242 | Ga0209258_100012 | Ga0209258_100012698 | 381 |
| 398 | 3300025242 | Ga0209258_100019 | Ga0209258_100019355 | 381 |
| 399 | 3300025242 | Ga0209258_100046 | Ga0209258_10004688 | 381 |
| 400 | 3300025242 | Ga0209258_100582 | Ga0209258_10058220 | 381 |
| 401 | 3300025242 | Ga0209258_100600 | Ga0209258_10060015 | 381 |
| 402 | 3300025242 | Ga0209258_101514 | Ga0209258_1015147 | 381 |
| 403 | 3300025246 | Ga0209646_1000749 | Ga0209646_10007497 | 381 |
| 404 | 3300025246 | Ga0209646_1001723 | Ga0209646_10017238 | 381 |
| 405 | 3300025246 | Ga0209646_1003294 | Ga0209646_10032942 | 381 |
| 406 | 3300025250 | Ga0209026_1000015 | Ga0209026_100001579 | 381 |
| 407 | 3300025250 | Ga0209026_1000213 | Ga0209026_100021345 | 381 |
| 408 | 3300025250 | Ga0209026_1000381 | Ga0209026_100038117 | 381 |
| 409 | 3300025250 | Ga0209026_1001297 | Ga0209026_10012976 | 381 |
| 410 | 3300025253 | Ga0209677_100725 | Ga0209677_10072511 | 381 |
| 411 | 3300025254 | Ga0209148_1000001 | Ga0209148_10000011946 | 381 |
| 412 | 3300025254 | Ga0209148_1000005 | Ga0209148_1000005457 | 381 |
| 413 | 3300025254 | Ga0209148_1000013 | Ga0209148_1000013673 | 381 |
| 414 | 3300025254 | Ga0209148_1000039 | Ga0209148_1000039453 | 381 |
| 415 | 3300025254 | Ga0209148_1000084 | Ga0209148_100008442 | 381 |
| 416 | 3300025254 | Ga0209148_1000296 | Ga0209148_100029663 | 381 |
| 417 | 3300025256 | Ga0209759_1000462 | Ga0209759_100046226 | 381 |
| 418 | 3300025256 | Ga0209759_1000719 | Ga0209759_100071928 | 381 |
| 419 | 3300025256 | Ga0209759_1000802 | Ga0209759_100080222 | 381 |
| 420 | 3300025256 | Ga0209759_1002655 | Ga0209759_10026554 | 381 |
| 421 | 3300025256 | Ga0209759_1007906 | Ga0209759_10079063 | 381 |
| 422 | 3300025258 | Ga0209129_1001478 | Ga0209129_100147811 | 381 |
| 423 | 3300025258 | Ga0209129_1005121 | Ga0209129_10051213 | 381 |
| 424 | 3300025261 | Ga0209233_1000002 | Ga0209233_1000002354 | 381 |
| 425 | 3300025261 | Ga0209233_1000020 | Ga0209233_1000020557 | 381 |
| 426 | 3300025261 | Ga0209233_1000080 | Ga0209233_1000080294 | 381 |
| 427 | 3300025263 | Ga0209565_1000022 | Ga0209565_1000022146 | 381 |
| 428 | 3300025272 | Ga0209455_1000010 | Ga0209455_1000010249 | 381 |
| 429 | 3300025272 | Ga0209455_1000027 | Ga0209455_1000027190 | 381 |
| 430 | 3300025272 | Ga0209455_1000034 | Ga0209455_1000034454 | 381 |
| 431 | 3300025272 | Ga0209455_1000126 | Ga0209455_1000126156 | 381 |
| 432 | 3300025272 | Ga0209455_1000662 | Ga0209455_10006628 | 381 |
| 433 | 3300025273 | Ga0209673_1000110 | Ga0209673_1000110110 | 381 |
| 434 | 3300025291 | Ga0209675_1000060 | Ga0209675_1000060104 | 381 |
| 435 | 3300025292 | Ga0209676_1000219 | Ga0209676_100021930 | 381 |
| 436 | 3300025292 | Ga0209676_1000279 | Ga0209676_100027969 | 381 |
| 437 | 3300025295 | Ga0209564_1000304 | Ga0209564_100030445 | 381 |
| 438 | 3300025297 | Ga0209758_1002818 | Ga0209758_100281818 | 381 |
| 439 | 3300025297 | Ga0209758_1005835 | Ga0209758_10058359 | 381 |
| 440 | 3300025298 | Ga0209050_1000542 | Ga0209050_100054237 | 381 |
| 441 | 3300025298 | Ga0209050_1000825 | Ga0209050_100082518 | 381 |
| 442 | 3300025298 | Ga0209050_1022520 | Ga0209050_10225201 | 381 |
| 443 | 3300025299 | Ga0209256_1007442 | Ga0209256_10074424 | 381 |
| 444 | 3300025299 | Ga0209256_1008983 | Ga0209256_10089832 | 381 |
| 445 | 3300025303 | Ga0209051_1012166 | Ga0209051_10121662 | 381 |
| 446 | 3300025304 | Ga0209257_1000726 | Ga0209257_100072616 | 381 |
| 447 | 3300025321 | Ga0207656_10010701 | Ga0207656_100107012 | 381 |
| 448 | 3300025321 | Ga0207656_10017871 | Ga0207656_100178712 | 381 |
| 449 | 3300025735 | Ga0207713_1034419 | Ga0207713_10344192 | 381 |
| 450 | 3300025900 | Ga0207710_10079395 | Ga0207710_100793952 | 381 |
| 451 | 3300025903 | Ga0207680_10000005 | Ga0207680_10000005267 | 381 |
| 452 | 3300025904 | Ga0207647_10000056 | Ga0207647_1000005624 | 381 |
| 453 | 3300025904 | Ga0207647_10000213 | Ga0207647_1000021317 | 381 |
| 454 | 3300025904 | Ga0207647_10000229 | Ga0207647_100002298 | 381 |
| 455 | 3300025904 | Ga0207647_10004577 | Ga0207647_1000457710 | 381 |
| 456 | 3300025904 | Ga0207647_10005182 | Ga0207647_100051826 | 381 |
| 457 | 3300025909 | Ga0207705_10000128 | Ga0207705_1000012869 | 381 |
| 458 | 3300025909 | Ga0207705_10002200 | Ga0207705_100022005 | 381 |
| 459 | 3300025909 | Ga0207705_10003255 | Ga0207705_100032552 | 381 |
| 460 | 3300025909 | Ga0207705_10016797 | Ga0207705_100167973 | 381 |
| 461 | 3300025911 | Ga0207654_10000126 | Ga0207654_1000012633 | 381 |
| 462 | 3300025911 | Ga0207654_10012493 | Ga0207654_100124932 | 381 |
| 463 | 3300025911 | Ga0207654_10146572 | Ga0207654_101465721 | 381 |
| 464 | 3300025912 | Ga0207707_10000665 | Ga0207707_1000066510 | 381 |
| 465 | 3300025912 | Ga0207707_10000699 | Ga0207707_100006993 | 381 |
| 466 | 3300025912 | Ga0207707_10001116 | Ga0207707_1000111624 | 381 |
| 467 | 3300025912 | Ga0207707_10001210 | Ga0207707_1000121014 | 381 |
| 468 | 3300025912 | Ga0207707_10005504 | Ga0207707_100055047 | 381 |
| 469 | 3300025912 | Ga0207707_10007116 | Ga0207707_100071161 | 381 |
| 470 | 3300025913 | Ga0207695_10000094 | Ga0207695_1000009457 | 381 |
| 471 | 3300025913 | Ga0207695_10000869 | Ga0207695_1000086927 | 381 |
| 472 | 3300025913 | Ga0207695_10001748 | Ga0207695_1000174828 | 381 |
| 473 | 3300025913 | Ga0207695_10003671 | Ga0207695_1000367111 | 381 |
| 474 | 3300025913 | Ga0207695_10004041 | Ga0207695_1000404112 | 381 |
| 475 | 3300025913 | Ga0207695_10052537 | Ga0207695_100525374 | 381 |
| 476 | 3300025913 | Ga0207695_10101736 | Ga0207695_101017362 | 381 |
| 477 | 3300025913 | Ga0207695_10147442 | Ga0207695_101474422 | 381 |
| 478 | 3300025914 | Ga0207671_10000050 | Ga0207671_10000050153 | 381 |
| 479 | 3300025914 | Ga0207671_10000116 | Ga0207671_1000011657 | 381 |
| 480 | 3300025914 | Ga0207671_10003678 | Ga0207671_100036783 | 381 |
| 481 | 3300025914 | Ga0207671_10007188 | Ga0207671_100071882 | 381 |
| 482 | 3300025914 | Ga0207671_10007824 | Ga0207671_100078243 | 381 |
| 483 | 3300025914 | Ga0207671_10113998 | Ga0207671_101139982 | 381 |
| 484 | 3300025914 | Ga0207671_10147784 | Ga0207671_101477842 | 381 |
| 485 | 3300025917 | Ga0207660_10001431 | Ga0207660_100014319 | 381 |
| 486 | 3300025917 | Ga0207660_10001647 | Ga0207660_1000164711 | 381 |
| 487 | 3300025917 | Ga0207660_10003057 | Ga0207660_1000305711 | 381 |
| 488 | 3300025919 | Ga0207657_10004614 | Ga0207657_1000461410 | 381 |
| 489 | 3300025919 | Ga0207657_10004766 | Ga0207657_1000476612 | 381 |
| 490 | 3300025919 | Ga0207657_10005275 | Ga0207657_100052752 | 381 |
| 491 | 3300025919 | Ga0207657_10097954 | Ga0207657_100979542 | 381 |
| 492 | 3300025920 | Ga0207649_10000493 | Ga0207649_100004937 | 381 |
| 493 | 3300025920 | Ga0207649_10001479 | Ga0207649_1000147910 | 381 |
| 494 | 3300025920 | Ga0207649_10010387 | Ga0207649_100103871 | 381 |
| 495 | 3300025920 | Ga0207649_10093259 | Ga0207649_100932592 | 381 |
| 496 | 3300025920 | Ga0207649_10193575 | Ga0207649_101935752 | 381 |
| 497 | 3300025921 | Ga0207652_10000030 | Ga0207652_1000003026 | 381 |
| 498 | 3300025921 | Ga0207652_10000820 | Ga0207652_100008205 | 381 |
| 499 | 3300025921 | Ga0207652_10000846 | Ga0207652_100008465 | 381 |
| 500 | 3300025921 | Ga0207652_10001111 | Ga0207652_1000111111 | 381 |
| 501 | 3300025921 | Ga0207652_10078652 | Ga0207652_100786523 | 381 |
| 502 | 3300025923 | Ga0207681_10016810 | Ga0207681_100168104 | 381 |
| 503 | 3300025924 | Ga0207694_10002059 | Ga0207694_100020593 | 381 |
| 504 | 3300025924 | Ga0207694_10005930 | Ga0207694_1000593011 | 381 |
| 505 | 3300025924 | Ga0207694_10008956 | Ga0207694_100089563 | 381 |
| 506 | 3300025924 | Ga0207694_10010172 | Ga0207694_100101725 | 381 |
| 507 | 3300025925 | Ga0207650_10000003 | Ga0207650_10000003868 | 381 |
| 508 | 3300025925 | Ga0207650_10245264 | Ga0207650_102452642 | 381 |
| 509 | 3300025927 | Ga0207687_10103069 | Ga0207687_101030692 | 381 |
| 510 | 3300025928 | Ga0207700_10034657 | Ga0207700_100346571 | 381 |
| 511 | 3300025929 | Ga0207664_10156749 | Ga0207664_101567492 | 381 |
| 512 | 3300025931 | Ga0207644_10001445 | Ga0207644_100014456 | 381 |
| 513 | 3300025932 | Ga0207690_10001014 | Ga0207690_1000101415 | 381 |
| 514 | 3300025932 | Ga0207690_10001119 | Ga0207690_100011196 | 381 |
| 515 | 3300025933 | Ga0207706_10070314 | Ga0207706_100703142 | 381 |
| 516 | 3300025935 | Ga0207709_10016265 | Ga0207709_100162653 | 381 |
| 517 | 3300025937 | Ga0207669_10219859 | Ga0207669_102198592 | 381 |
| 518 | 3300025938 | Ga0207704_10005509 | Ga0207704_100055097 | 381 |
| 519 | 3300025938 | Ga0207704_10022683 | Ga0207704_100226832 | 381 |
| 520 | 3300025940 | Ga0207691_10176412 | Ga0207691_101764122 | 381 |
| 521 | 3300025941 | Ga0207711_10001229 | Ga0207711_1000122919 | 381 |
| 522 | 3300025941 | Ga0207711_10005099 | Ga0207711_100050991 | 381 |
| 523 | 3300025942 | Ga0207689_10030973 | Ga0207689_100309734 | 381 |
| 524 | 3300025944 | Ga0207661_10014451 | Ga0207661_100144511 | 381 |
| 525 | 3300025944 | Ga0207661_10038955 | Ga0207661_100389554 | 381 |
| 526 | 3300025945 | Ga0207679_10008076 | Ga0207679_100080764 | 381 |
| 527 | 3300025945 | Ga0207679_10099435 | Ga0207679_100994352 | 381 |
| 528 | 3300025949 | Ga0207667_10000031 | Ga0207667_10000031169 | 381 |
| 529 | 3300025949 | Ga0207667_10000125 | Ga0207667_1000012511 | 381 |
| 530 | 3300025949 | Ga0207667_10000634 | Ga0207667_1000063439 | 381 |
| 531 | 3300025949 | Ga0207667_10000818 | Ga0207667_100008185 | 381 |
| 532 | 3300025949 | Ga0207667_10003528 | Ga0207667_100035289 | 381 |
| 533 | 3300025949 | Ga0207667_10007474 | Ga0207667_100074746 | 381 |
| 534 | 3300025949 | Ga0207667_10092266 | Ga0207667_100922662 | 381 |
| 535 | 3300025949 | Ga0207667_10368415 | Ga0207667_103684152 | 381 |
| 536 | 3300025961 | Ga0207712_10000169 | Ga0207712_1000016950 | 381 |
| 537 | 3300025961 | Ga0207712_10001183 | Ga0207712_1000118318 | 381 |
| 538 | 3300025972 | Ga0207668_10040485 | Ga0207668_100404852 | 381 |
| 539 | 3300025981 | Ga0207640_10000082 | Ga0207640_1000008211 | 381 |
| 540 | 3300025981 | Ga0207640_10001407 | Ga0207640_100014073 | 381 |
| 541 | 3300025981 | Ga0207640_10005086 | Ga0207640_100050863 | 381 |
| 542 | 3300025981 | Ga0207640_10015481 | Ga0207640_100154814 | 381 |
| 543 | 3300025981 | Ga0207640_10078855 | Ga0207640_100788552 | 381 |
| 544 | 3300025986 | Ga0207658_10000004 | Ga0207658_10000004315 | 381 |
| 545 | 3300025986 | Ga0207658_10000006 | Ga0207658_10000006341 | 381 |
| 546 | 3300025986 | Ga0207658_10009512 | Ga0207658_100095125 | 381 |
| 547 | 3300025986 | Ga0207658_10035251 | Ga0207658_100352513 | 381 |
| 548 | 3300026023 | Ga0207677_10170281 | Ga0207677_101702812 | 381 |
| 549 | 3300026023 | Ga0207677_10204134 | Ga0207677_102041342 | 381 |
| 550 | 3300026035 | Ga0207703_10011575 | Ga0207703_100115754 | 381 |
| 551 | 3300026035 | Ga0207703_10075899 | Ga0207703_100758992 | 381 |
| 552 | 3300026041 | Ga0207639_10001497 | Ga0207639_1000149710 | 381 |
| 553 | 3300026041 | Ga0207639_10001503 | Ga0207639_1000150311 | 381 |
| 554 | 3300026041 | Ga0207639_10001512 | Ga0207639_100015128 | 381 |
| 555 | 3300026041 | Ga0207639_10032218 | Ga0207639_100322182 | 381 |
| 556 | 3300026041 | Ga0207639_10090133 | Ga0207639_100901333 | 381 |
| 557 | 3300026067 | Ga0207678_10001435 | Ga0207678_1000143510 | 381 |
| 558 | 3300026067 | Ga0207678_10006920 | Ga0207678_100069203 | 381 |
| 559 | 3300026067 | Ga0207678_10014775 | Ga0207678_100147755 | 381 |
| 560 | 3300026067 | Ga0207678_10019278 | Ga0207678_100192785 | 381 |
| 561 | 3300026067 | Ga0207678_10025756 | Ga0207678_100257563 | 381 |
| 562 | 3300026067 | Ga0207678_10034586 | Ga0207678_100345862 | 381 |
| 563 | 3300026067 | Ga0207678_10080917 | Ga0207678_100809172 | 381 |
| 564 | 3300026075 | Ga0207708_10174009 | Ga0207708_101740092 | 381 |
| 565 | 3300026078 | Ga0207702_10000265 | Ga0207702_1000026545 | 381 |
| 566 | 3300026078 | Ga0207702_10000384 | Ga0207702_1000038411 | 381 |
| 567 | 3300026078 | Ga0207702_10005204 | Ga0207702_100052042 | 381 |
| 568 | 3300026078 | Ga0207702_10011335 | Ga0207702_100113357 | 381 |
| 569 | 3300026078 | Ga0207702_10011594 | Ga0207702_100115945 | 381 |
| 570 | 3300026078 | Ga0207702_10064781 | Ga0207702_100647812 | 381 |
| 571 | 3300026078 | Ga0207702_10125723 | Ga0207702_101257232 | 381 |
| 572 | 3300026078 | Ga0207702_10158328 | Ga0207702_101583282 | 381 |
| 573 | 3300026088 | Ga0207641_10009701 | Ga0207641_100097014 | 381 |
| 574 | 3300026088 | Ga0207641_10053431 | Ga0207641_100534313 | 381 |
| 575 | 3300026088 | Ga0207641_10083288 | Ga0207641_100832882 | 381 |
| 576 | 3300026089 | Ga0207648_10117566 | Ga0207648_101175662 | 381 |
| 577 | 3300026095 | Ga0207676_10000003 | Ga0207676_10000003227 | 381 |
| 578 | 3300026116 | Ga0207674_10002112 | Ga0207674_1000211213 | 381 |
| 579 | 3300026116 | Ga0207674_10004296 | Ga0207674_100042969 | 381 |
| 580 | 3300026116 | Ga0207674_10006067 | Ga0207674_1000606710 | 381 |
| 581 | 3300026116 | Ga0207674_10042792 | Ga0207674_100427923 | 381 |
| 582 | 3300026118 | Ga0207675_100131643 | Ga0207675_1001316432 | 381 |
| 583 | 3300026121 | Ga0207683_10038290 | Ga0207683_100382904 | 381 |
| 584 | 3300026121 | Ga0207683_10039725 | Ga0207683_100397252 | 381 |
| 585 | 3300026121 | Ga0207683_10045636 | Ga0207683_100456362 | 381 |
| 586 | 3300026121 | Ga0207683_10144088 | Ga0207683_101440882 | 381 |
| 587 | 3300026142 | Ga0207698_10001180 | Ga0207698_100011807 | 381 |
| 588 | 3300026142 | Ga0207698_10001757 | Ga0207698_100017573 | 381 |
| 589 | 3300026142 | Ga0207698_10006674 | Ga0207698_100066743 | 381 |
| 590 | 3300026142 | Ga0207698_10026723 | Ga0207698_100267232 | 381 |
| 591 | 3300026142 | Ga0207698_10031345 | Ga0207698_100313453 | 381 |
| 592 | 3300026142 | Ga0207698_10079147 | Ga0207698_100791472 | 381 |
| 593 | 3300026142 | Ga0207698_10081075 | Ga0207698_100810752 | 381 |
| 594 | 3300026142 | Ga0207698_10211122 | Ga0207698_102111222 | 381 |
| 595 | 3300027312 | Ga0209371_1000007 | Ga0209371_1000007268 | 381 |
| 596 | 3300027312 | Ga0209371_1000016 | Ga0209371_1000016209 | 381 |
| 597 | 3300028379 | Ga0268266_10000001 | Ga0268266_100000012799 | 381 |
| 598 | 3300028379 | Ga0268266_10000004 | Ga0268266_100000041258 | 381 |
| 599 | 3300028379 | Ga0268266_10000006 | Ga0268266_10000006670 | 381 |
| 600 | 3300028379 | Ga0268266_10004408 | Ga0268266_100044085 | 381 |
| 601 | 3300028379 | Ga0268266_10102131 | Ga0268266_101021312 | 381 |
| 602 | 3300028379 | Ga0268266_10111722 | Ga0268266_101117222 | 381 |
| 603 | 3300028380 | Ga0268265_10001087 | Ga0268265_1000108711 | 381 |
| 604 | 3300028380 | Ga0268265_10003544 | Ga0268265_100035443 | 381 |
| 605 | 3300028380 | Ga0268265_10233467 | Ga0268265_102334672 | 381 |
| 606 | 3300028380 | Ga0268265_10278620 | Ga0268265_102786202 | 381 |
| 607 | 3300028381 | Ga0268264_10000016 | Ga0268264_10000016366 | 381 |
| 608 | 3300028381 | Ga0268264_10305021 | Ga0268264_103050212 | 381 |
| 609 | 3300028786 | Ga0307517_10153775 | Ga0307517_101537751 | 381 |
| 610 | 3300030500 | Ga0268256_1000008 | Ga0268256_1000008682 | 381 |
| 611 | 3300030500 | Ga0268256_1000015 | Ga0268256_1000015361 | 381 |
| 612 | 3300030742 | Ga0316183_1072209 | Ga0316183_10722093 | 381 |
| 613 | 3300031238 | Ga0265332_10046656 | Ga0265332_100466562 | 381 |
| 614 | 3300031250 | Ga0265331_10039292 | Ga0265331_100392922 | 381 |
| 615 | 3300031251 | Ga0265327_10000044 | Ga0265327_10000044226 | 381 |
| 616 | 3300031344 | Ga0265316_10138153 | Ga0265316_101381532 | 381 |
| 617 | 3300031548 | Ga0307408_100106805 | Ga0307408_1001068052 | 381 |
| 618 | 3300031730 | Ga0307516_10052700 | Ga0307516_100527004 | 381 |
| 619 | 3300031911 | Ga0307412_10000684 | Ga0307412_1000068414 | 381 |
| 620 | 3300031911 | Ga0307412_10008621 | Ga0307412_100086212 | 381 |
| 621 | 3300031911 | Ga0307412_10144655 | Ga0307412_101446552 | 381 |
| 622 | 3300033179 | Ga0307507_10098766 | Ga0307507_100987662 | 381 |
| 623 | 3300033180 | Ga0307510_10000049 | Ga0307510_100000493 | 381 |
| 624 | 3300037312 | Ga0395899_0000133 | Ga0395899_0000133_57794_58939 | 381 |
| 625 | 3300037312 | Ga0395899_0075905 | Ga0395899_0075905_124_1269 | 381 |
| 626 | 3300037312 | Ga0395899_0088684 | Ga0395899_0088684_467_1612 | 381 |
| 627 | 3300037418 | Ga0395900_0000033 | Ga0395900_0000033_147339_148484 | 381 |
| 628 | 3300037418 | Ga0395900_0000061 | Ga0395900_0000061_125946_127091 | 381 |
| 629 | 3300037418 | Ga0395900_0068601 | Ga0395900_0068601_1507_2652 | 381 |
| 630 | 3300037418 | Ga0395900_0216503 | Ga0395900_0216503_474_1619 | 381 |
| 631 | 3300037466 | Ga0395898_0000034 | Ga0395898_0000034_71087_72232 | 381 |
| 632 | 3300037466 | Ga0395898_0000197 | Ga0395898_0000197_126026_127171 | 381 |
| 633 | 3300037466 | Ga0395898_0062735 | Ga0395898_0062735_1616_2761 | 381 |
| 634 | 3300037466 | Ga0395898_0090322 | Ga0395898_0090322_689_1834 | 381 |
| 635 | 3300037466 | Ga0395898_0100362 | Ga0395898_0100362_518_1663 | 381 |
| 636 | 3300037466 | Ga0395898_0218030 | Ga0395898_0218030_67_1212 | 381 |
| 637 | 3300037466 | Ga0395898_0218850 | Ga0395898_0218850_367_1512 | 381 |
| 638 | 3300037471 | Ga0395905_0051773 | Ga0395905_0051773_1610_2755 | 381 |
| 639 | 3300038443 | Ga0395901_0000772 | Ga0395901_0000772_786_1931 | 381 |
| 640 | 3300038443 | Ga0395901_0005878 | Ga0395901_0005878_8574_9719 | 381 |
| 641 | 3300038443 | Ga0395901_0021408 | Ga0395901_0021408_845_1990 | 381 |
| 642 | 3300038443 | Ga0395901_0071975 | Ga0395901_0071975_1614_2759 | 381 |
| 643 | 3300038705 | Ga0237819_05304 | Ga0237819_05304_116_1264 | 381 |
| 644 | 3300041404 | Ga0439436_0000042 | Ga0439436_0000042_7499_8644 | 381 |
| 645 | 3300041413 | Ga0439465_0002276 | Ga0439465_0002276_4356_5501 | 381 |
| 646 | 3300041452 | Ga0451793_0280819 | Ga0451793_0280819_342_1490 | 381 |
| 647 | 3300041459 | Ga0451800_1047982 | Ga0451800_1047982_120_1268 | 381 |
| 648 | 3300041462 | Ga0451806_243917 | Ga0451806_243917_202_1350 | 381 |
| 649 | 3300041463 | Ga0451804_0591474 | Ga0451804_0591474_148_1296 | 381 |
| 650 | 3300041486 | Ga0451807_0137290 | Ga0451807_0137290_97_1245 | 381 |
| 651 | 3300041496 | Ga0451839_0258198 | Ga0451839_0258198_128_1276 | 381 |
| 652 | 3300041509 | Ga0451843_0036637 | Ga0451843_0036637_817_1965 | 381 |
| 653 | 3300041512 | Ga0451853_0612520 | Ga0451853_0612520_1074_2234 | 381 |
| 654 | 3300042184 | Ga0450908_000392 | Ga0450908_000392_3411_4556 | 381 |
| 655 | 3300044656 | Ga0466969_0001628 | Ga0466969_0001628_6931_8076 | 381 |
| 656 | 3300044656 | Ga0466969_0005914 | Ga0466969_0005914_3252_4397 | 381 |
| 657 | 3300044658 | Ga0466972_0001288 | Ga0466972_0001288_9727_10875 | 381 |
| 658 | 3300044672 | Ga0466982_0000010 | Ga0466982_0000010_176107_177252 | 381 |
| 659 | 3300044672 | Ga0466982_0000196 | Ga0466982_0000196_1734_2879 | 381 |
| 660 | 3300044683 | Ga0466965_0022391 | Ga0466965_0022391_1735_2880 | 381 |
| 661 | 3300044684 | Ga0466966_0003629 | Ga0466966_0003629_4295_5440 | 381 |
| 662 | 3300044684 | Ga0466966_0017116 | Ga0466966_0017116_3056_4201 | 381 |
| 663 | 3300044693 | Ga0466961_0003687 | Ga0466961_0003687_1162_2307 | 381 |
| 664 | 3300044693 | Ga0466961_0004916 | Ga0466961_0004916_6237_7382 | 381 |
| 665 | 3300044693 | Ga0466961_0011932 | Ga0466961_0011932_3369_4514 | 381 |
| 666 | 3300044693 | Ga0466961_0043425 | Ga0466961_0043425_1462_2607 | 381 |
| 667 | 3300044693 | Ga0466961_0088931 | Ga0466961_0088931_251_1396 | 381 |
| 668 | 3300044706 | Ga0466964_0011053 | Ga0466964_0011053_1929_3074 | 381 |
| 669 | 3300044712 | Ga0453684_0002590 | Ga0453684_0002590_38303_39448 | 381 |
| 670 | 3300044719 | Ga0466971_0009268 | Ga0466971_0009268_54_1199 | 381 |
| 671 | 3300044735 | Ga0466968_0001991 | Ga0466968_0001991_4830_5975 | 381 |
| 672 | 3300044765 | Ga0466970_0000202 | Ga0466970_0000202_26574_27722 | 381 |
| 673 | 3300044765 | Ga0466970_0062608 | Ga0466970_0062608_579_1724 | 381 |
| 674 | 3300044842 | Ga0466957_0003347 | Ga0466957_0003347_3490_4635 | 381 |
| 675 | 3300044842 | Ga0466957_0022118 | Ga0466957_0022118_414_1559 | 381 |
| 676 | 3300044842 | Ga0466957_0041557 | Ga0466957_0041557_239_1384 | 381 |
| 677 | 3300045049 | Ga0466959_0000232 | Ga0466959_0000232_23587_24732 | 381 |
| 678 | 3300045049 | Ga0466959_0000888 | Ga0466959_0000888_9071_10219 | 381 |
| 679 | 3300045049 | Ga0466959_0024693 | Ga0466959_0024693_1790_2935 | 381 |
| 680 | 3300045049 | Ga0466959_0087654 | Ga0466959_0087654_72_1217 | 381 |
| 681 | 3300045051 | Ga0451576_0000840 | Ga0451576_0000840_3835_4980 | 381 |
| 682 | 3300046452 | Ga0495617_000016 | Ga0495617_000016_245785_246930 | 381 |
| 683 | 3300046452 | Ga0495617_002329 | Ga0495617_002329_4599_5744 | 381 |
| 684 | 3300046460 | Ga0495638_0000212 | Ga0495638_0000212_61454_62599 | 381 |
| 685 | 3300046460 | Ga0495638_0000938 | Ga0495638_0000938_17207_18352 | 381 |
| 686 | 3300046460 | Ga0495638_0001592 | Ga0495638_0001592_14579_15724 | 381 |
| 687 | 3300046471 | Ga0495650_0000614 | Ga0495650_0000614_3444_4589 | 381 |
| 688 | 3300046471 | Ga0495650_0001007 | Ga0495650_0001007_17407_18552 | 381 |
| 689 | 3300046471 | Ga0495650_0001927 | Ga0495650_0001927_13818_14963 | 381 |
| 690 | 3300046491 | Ga0495584_0000847 | Ga0495584_0000847_13871_15016 | 381 |
| 691 | 3300046492 | Ga0495585_0000007 | Ga0495585_0000007_71871_73016 | 381 |
| 692 | 3300046492 | Ga0495585_0002049 | Ga0495585_0002049_8212_9357 | 381 |
| 693 | 3300046501 | Ga0495607_0000003 | Ga0495607_0000003_64408_65553 | 381 |
| 694 | 3300046501 | Ga0495607_0000437 | Ga0495607_0000437_17512_18657 | 381 |
| 695 | 3300046507 | Ga0495606_0000610 | Ga0495606_0000610_15146_16291 | 381 |
| 696 | 3300046507 | Ga0495606_0001571 | Ga0495606_0001571_6605_7750 | 381 |
| 697 | 3300046507 | Ga0495606_0001761 | Ga0495606_0001761_12609_13754 | 381 |
| 698 | 3300046507 | Ga0495606_0012718 | Ga0495606_0012718_349_1494 | 381 |
| 699 | 3300046512 | Ga0495610_0008323 | Ga0495610_0008323_4744_5889 | 381 |
| 700 | 3300046513 | Ga0495616_0000001 | Ga0495616_0000001_620017_621162 | 381 |
| 701 | 3300046513 | Ga0495616_0016407 | Ga0495616_0016407_2175_3320 | 381 |
| 702 | 3300046515 | Ga0495620_0001003 | Ga0495620_0001003_6564_7709 | 381 |
| 703 | 3300046518 | Ga0495631_0000065 | Ga0495631_0000065_11566_12711 | 381 |
| 704 | 3300046518 | Ga0495631_0000217 | Ga0495631_0000217_33183_34328 | 381 |
| 705 | 3300046519 | Ga0495632_0000011 | Ga0495632_0000011_160615_161760 | 381 |
| 706 | 3300046519 | Ga0495632_0000581 | Ga0495632_0000581_12023_13168 | 381 |
| 707 | 3300046520 | Ga0495637_0006365 | Ga0495637_0006365_663_1808 | 381 |
| 708 | 3300046524 | Ga0495648_0002069 | Ga0495648_0002069_4550_5695 | 381 |
| 709 | 3300046524 | Ga0495648_0017405 | Ga0495648_0017405_3589_4734 | 381 |
| 710 | 3300046525 | Ga0495663_0016674 | Ga0495663_0016674_488_1636 | 381 |
| 711 | 3300046616 | Ga0495668_0064904 | Ga0495668_0064904_101_1246 | 381 |
| 712 | 3300046648 | Ga0495611_0000001 | Ga0495611_0000001_1384845_1385990 | 381 |
| 713 | 3300046648 | Ga0495611_0000068 | Ga0495611_0000068_48684_49829 | 381 |
| 714 | 3300046660 | Ga0495625_0000001 | Ga0495625_0000001_530047_531192 | 381 |
| 715 | 3300046660 | Ga0495625_0010620 | Ga0495625_0010620_4689_5834 | 381 |
| 716 | 3300046660 | Ga0495625_0018578 | Ga0495625_0018578_1987_3132 | 381 |
| 717 | 3300046660 | Ga0495625_0058667 | Ga0495625_0058667_1559_2704 | 381 |
| 718 | 3300046665 | Ga0495661_0001999 | Ga0495661_0001999_4517_5662 | 381 |
| 719 | 3300046675 | Ga0495657_0151105 | Ga0495657_0151105_180_1325 | 381 |
| 720 | 3300046691 | Ga0495670_0011736 | Ga0495670_0011736_1926_3071 | 381 |
| 721 | 3300046691 | Ga0495670_0019299 | Ga0495670_0019299_294_1439 | 381 |
| 722 | 3300046692 | Ga0495671_0004638 | Ga0495671_0004638_5800_6945 | 381 |
| 723 | 3300046694 | Ga0495649_0006750 | Ga0495649_0006750_3626_4771 | 381 |
| 724 | 3300046794 | Ga0495589_0000016 | Ga0495589_0000016_104183_105328 | 381 |
| 725 | 3300046810 | Ga0495660_0000018 | Ga0495660_0000018_299110_300255 | 381 |
| 726 | 3300046810 | Ga0495660_0000294 | Ga0495660_0000294_25844_26989 | 381 |
| 727 | 3300047446 | Ga0495679_000001 | Ga0495679_000001_200965_202110 | 381 |
| 728 | 3300047469 | Ga0495673_0000001 | Ga0495673_0000001_527775_528920 | 381 |
| 729 | 3300047469 | Ga0495673_0000018 | Ga0495673_0000018_6572_7717 | 381 |
| 730 | 3300047469 | Ga0495673_0006286 | Ga0495673_0006286_1245_2390 | 381 |
| 731 | 3300047472 | Ga0495686_0000026 | Ga0495686_0000026_96734_97879 | 381 |
| 732 | 3300047472 | Ga0495686_0000037 | Ga0495686_0000037_284057_285202 | 381 |
| 733 | 3300047472 | Ga0495686_0010946 | Ga0495686_0010946_3306_4454 | 381 |
| 734 | 3300047472 | Ga0495686_0011052 | Ga0495686_0011052_1871_3016 | 381 |
| 735 | 3300047472 | Ga0495686_0039726 | Ga0495686_0039726_1614_2759 | 381 |
| 736 | 3300048904 | Ga0496101_0015402 | Ga0496101_0015402_1875_3020 | 381 |
| 737 | 3300048916 | Ga0496113_0076306 | Ga0496113_0076306_931_2076 | 381 |
| 738 | 3300048918 | Ga0496115_0000140 | Ga0496115_0000140_6533_7678 | 381 |
| 739 | 3300048918 | Ga0496115_0000160 | Ga0496115_0000160_44686_45831 | 381 |
| 740 | 3300048919 | Ga0496116_0002429 | Ga0496116_0002429_6196_7344 | 381 |
| 741 | 3300048920 | Ga0496117_0000779 | Ga0496117_0000779_5223_6371 | 381 |
| 742 | 3300048920 | Ga0496117_0031479 | Ga0496117_0031479_1802_2962 | 381 |
| 743 | 3300048920 | Ga0496117_0045558 | Ga0496117_0045558_162_1307 | 381 |
| 744 | 3300048920 | Ga0496117_0058938 | Ga0496117_0058938_1218_2363 | 381 |
| 745 | 3300048921 | Ga0496118_0000497 | Ga0496118_0000497_9959_11107 | 381 |
| 746 | 3300048921 | Ga0496118_0001337 | Ga0496118_0001337_12217_13377 | 381 |
| 747 | 3300048921 | Ga0496118_0001789 | Ga0496118_0001789_36_1181 | 381 |
| 748 | 3300048921 | Ga0496118_0002288 | Ga0496118_0002288_2951_4099 | 381 |
| 749 | 3300048921 | Ga0496118_0002346 | Ga0496118_0002346_15004_16152 | 381 |
| 750 | 3300048921 | Ga0496118_0004535 | Ga0496118_0004535_1888_3033 | 381 |
| 751 | 3300048921 | Ga0496118_0004950 | Ga0496118_0004950_5548_6696 | 381 |
| 752 | 3300048921 | Ga0496118_0071155 | Ga0496118_0071155_119_1267 | 381 |
| 753 | 3300048922 | Ga0496119_0024864 | Ga0496119_0024864_2211_3356 | 381 |
| 754 | 3300048924 | Ga0496121_0000044 | Ga0496121_0000044_270653_271798 | 381 |
| 755 | 3300048924 | Ga0496121_0001002 | Ga0496121_0001002_23663_24808 | 381 |
| 756 | 3300048924 | Ga0496121_0001590 | Ga0496121_0001590_20002_21147 | 381 |
| 757 | 3300048924 | Ga0496121_0007287 | Ga0496121_0007287_11353_12498 | 381 |
| 758 | 3300048924 | Ga0496121_0025118 | Ga0496121_0025118_2794_3939 | 381 |
| 759 | 3300048924 | Ga0496121_0025582 | Ga0496121_0025582_2591_3739 | 381 |
| 760 | 3300048924 | Ga0496121_0061625 | Ga0496121_0061625_563_1708 | 381 |
| 761 | 3300048925 | Ga0496122_0000463 | Ga0496122_0000463_78323_79471 | 381 |
| 762 | 3300048925 | Ga0496122_0011204 | Ga0496122_0011204_7428_8573 | 381 |
| 763 | 3300048925 | Ga0496122_0012727 | Ga0496122_0012727_1347_2492 | 381 |
| 764 | 3300048925 | Ga0496122_0013601 | Ga0496122_0013601_5735_6883 | 381 |
| 765 | 3300048925 | Ga0496122_0016711 | Ga0496122_0016711_2941_4089 | 381 |
| 766 | 3300048926 | Ga0496123_0001598 | Ga0496123_0001598_19129_20277 | 381 |
| 767 | 3300048926 | Ga0496123_0012693 | Ga0496123_0012693_1130_2275 | 381 |
| 768 | 3300048926 | Ga0496123_0019840 | Ga0496123_0019840_1482_2630 | 381 |
| 769 | 3300048926 | Ga0496123_0037450 | Ga0496123_0037450_348_1493 | 381 |
| 770 | 3300048926 | Ga0496123_0051705 | Ga0496123_0051705_1098_2243 | 381 |
| 771 | 3300048926 | Ga0496123_0068423 | Ga0496123_0068423_76_1221 | 381 |
| 772 | 3300048927 | Ga0496124_0000840 | Ga0496124_0000840_16410_17555 | 381 |
| 773 | 3300048927 | Ga0496124_0000893 | Ga0496124_0000893_16378_17523 | 381 |
| 774 | 3300048927 | Ga0496124_0008226 | Ga0496124_0008226_6372_7520 | 381 |
| 775 | 3300048927 | Ga0496124_0008239 | Ga0496124_0008239_3019_4167 | 381 |
| 776 | 3300048927 | Ga0496124_0033579 | Ga0496124_0033579_3091_4239 | 381 |
| 777 | 3300048927 | Ga0496124_0166034 | Ga0496124_0166034_302_1450 | 381 |
| 778 | 3300048927 | Ga0496124_0171850 | Ga0496124_0171850_464_1609 | 381 |
| 779 | 3300048928 | Ga0496125_0000795 | Ga0496125_0000795_37277_38422 | 381 |
| 780 | 3300048928 | Ga0496125_0006055 | Ga0496125_0006055_11504_12652 | 381 |
| 781 | 3300048928 | Ga0496125_0017297 | Ga0496125_0017297_2694_3842 | 381 |
| 782 | 3300048928 | Ga0496125_0042716 | Ga0496125_0042716_149_1297 | 381 |
| 783 | 3300048928 | Ga0496125_0049534 | Ga0496125_0049534_530_1675 | 381 |
| 784 | 3300048928 | Ga0496125_0060411 | Ga0496125_0060411_376_1527 | 381 |
| 785 | 3300048928 | Ga0496125_0063681 | Ga0496125_0063681_1216_2361 | 381 |
| 786 | 3300048929 | Ga0496126_0052243 | Ga0496126_0052243_2131_3276 | 381 |
| 787 | 3300048929 | Ga0496126_0105529 | Ga0496126_0105529_427_1575 | 381 |
| 788 | 3300048929 | Ga0496126_0194845 | Ga0496126_0194845_311_1459 | 381 |
| 789 | 3300049459 | Ga0495678_001288 | Ga0495678_001288_4602_5747 | 381 |
| 790 | 3300049460 | Ga0495682_0000948 | Ga0495682_0000948_4561_5706 | 381 |
| 791 | 3300049460 | Ga0495682_0006512 | Ga0495682_0006512_362_1507 | 381 |
| 792 | 3300049460 | Ga0495682_0012133 | Ga0495682_0012133_1104_2249 | 381 |
| 793 | 3300049568 | Ga0501031_0025683 | Ga0501031_0025683_852_1997 | 381 |
| 794 | 3300049569 | Ga0501032_0044660 | Ga0501032_0044660_148_1293 | 381 |
| 795 | 3300049570 | Ga0501033_0000329 | Ga0501033_0000329_1882_3030 | 381 |
| 796 | 3300049570 | Ga0501033_0007277 | Ga0501033_0007277_3626_4771 | 381 |
| 797 | 3300049570 | Ga0501033_0020764 | Ga0501033_0020764_1756_2901 | 381 |
| 798 | 3300049570 | Ga0501033_0046423 | Ga0501033_0046423_195_1343 | 381 |
| 799 | 3300049570 | Ga0501033_0141220 | Ga0501033_0141220_353_1498 | 381 |
| 800 | 3300049571 | Ga0501034_0002728 | Ga0501034_0002728_16180_17325 | 381 |
| 801 | 3300049571 | Ga0501034_0006794 | Ga0501034_0006794_7482_8630 | 381 |
| 802 | 3300049571 | Ga0501034_0007130 | Ga0501034_0007130_7841_8986 | 381 |
| 803 | 3300049571 | Ga0501034_0019091 | Ga0501034_0019091_1265_2413 | 381 |
| 804 | 3300049571 | Ga0501034_0055591 | Ga0501034_0055591_1812_2957 | 381 |
| 805 | 3300049571 | Ga0501034_0165077 | Ga0501034_0165077_43_1188 | 381 |
| 806 | 3300049571 | Ga0501034_0217390 | Ga0501034_0217390_637_1785 | 381 |
| 807 | 3300049572 | Ga0501036_0005648 | Ga0501036_0005648_6826_7974 | 381 |
| 808 | 3300049572 | Ga0501036_0034329 | Ga0501036_0034329_2692_3837 | 381 |
| 809 | 3300049572 | Ga0501036_0040661 | Ga0501036_0040661_687_1832 | 381 |
| 810 | 3300049572 | Ga0501036_0190923 | Ga0501036_0190923_80_1228 | 381 |
| 811 | 3300049573 | Ga0501037_0007353 | Ga0501037_0007353_2060_3208 | 381 |
| 812 | 3300049573 | Ga0501037_0156826 | Ga0501037_0156826_321_1466 | 381 |
| 813 | 3300049574 | Ga0501038_0002332 | Ga0501038_0002332_15260_16408 | 381 |
| 814 | 3300049574 | Ga0501038_0038294 | Ga0501038_0038294_1558_2703 | 381 |
| 815 | 3300049574 | Ga0501038_0060216 | Ga0501038_0060216_1160_2308 | 381 |
| 816 | 3300049574 | Ga0501038_0109918 | Ga0501038_0109918_955_2100 | 381 |
| 817 | 3300049575 | Ga0501039_0003401 | Ga0501039_0003401_1532_2680 | 381 |
| 818 | 3300049576 | Ga0501040_0099063 | Ga0501040_0099063_752_1897 | 381 |
| 819 | 3300049578 | Ga0501042_0046076 | Ga0501042_0046076_1007_2152 | 381 |
| 820 | 3300049579 | Ga0501043_0046282 | Ga0501043_0046282_631_1776 | 381 |
| 821 | 3300049580 | Ga0501046_0016750 | Ga0501046_0016750_925_2073 | 381 |
| 822 | 3300049580 | Ga0501046_0030737 | Ga0501046_0030737_263_1411 | 381 |
| 823 | 3300049580 | Ga0501046_0043592 | Ga0501046_0043592_1660_2808 | 381 |
| 824 | 3300049580 | Ga0501046_0098393 | Ga0501046_0098393_783_1928 | 381 |
| 825 | 3300049581 | Ga0501047_0000925 | Ga0501047_0000925_13288_14433 | 381 |
| 826 | 3300049581 | Ga0501047_0005009 | Ga0501047_0005009_1231_2376 | 381 |
| 827 | 3300049581 | Ga0501047_0016805 | Ga0501047_0016805_1321_2466 | 381 |
| 828 | 3300049581 | Ga0501047_0028672 | Ga0501047_0028672_1231_2376 | 381 |
| 829 | 3300049581 | Ga0501047_0041719 | Ga0501047_0041719_2415_3560 | 381 |
| 830 | 3300049581 | Ga0501047_0217257 | Ga0501047_0217257_230_1378 | 381 |
| 831 | 3300049582 | Ga0501048_0011325 | Ga0501048_0011325_398_1546 | 381 |
| 832 | 3300049582 | Ga0501048_0084586 | Ga0501048_0084586_177_1322 | 381 |
| 833 | 3300049583 | Ga0501067_0000156 | Ga0501067_0000156_29677_30822 | 381 |
| 834 | 3300049583 | Ga0501067_0015309 | Ga0501067_0015309_272_1420 | 381 |
| 835 | 3300049584 | Ga0501068_0001884 | Ga0501068_0001884_3716_4861 | 381 |
| 836 | 3300049584 | Ga0501068_0012805 | Ga0501068_0012805_2459_3607 | 381 |
| 837 | 3300049585 | Ga0501069_0000829 | Ga0501069_0000829_11949_13094 | 381 |
| 838 | 3300049585 | Ga0501069_0005548 | Ga0501069_0005548_2142_3287 | 381 |
| 839 | 3300049585 | Ga0501069_0024160 | Ga0501069_0024160_1404_2552 | 381 |
| 840 | 3300049585 | Ga0501069_0147448 | Ga0501069_0147448_122_1270 | 381 |
| 841 | 3300049586 | Ga0501070_0000105 | Ga0501070_0000105_24211_25356 | 381 |
| 842 | 3300049586 | Ga0501070_0005394 | Ga0501070_0005394_9268_10416 | 381 |
| 843 | 3300049586 | Ga0501070_0011632 | Ga0501070_0011632_3316_4461 | 381 |
| 844 | 3300049586 | Ga0501070_0015227 | Ga0501070_0015227_3574_4719 | 381 |
| 845 | 3300049586 | Ga0501070_0025592 | Ga0501070_0025592_1188_2333 | 381 |
| 846 | 3300049586 | Ga0501070_0037811 | Ga0501070_0037811_1586_2734 | 381 |
| 847 | 3300049587 | Ga0501071_0080680 | Ga0501071_0080680_842_1990 | 381 |
| 848 | 3300049588 | Ga0501072_0000722 | Ga0501072_0000722_17117_18262 | 381 |
| 849 | 3300049588 | Ga0501072_0048402 | Ga0501072_0048402_1572_2720 | 381 |
| 850 | 3300049589 | Ga0501073_0000305 | Ga0501073_0000305_21424_22569 | 381 |
| 851 | 3300049589 | Ga0501073_0089506 | Ga0501073_0089506_625_1770 | 381 |
| 852 | 3300049590 | Ga0501074_0006157 | Ga0501074_0006157_720_1865 | 381 |
| 853 | 3300049590 | Ga0501074_0008079 | Ga0501074_0008079_5912_7060 | 381 |
| 854 | 3300049590 | Ga0501074_0011517 | Ga0501074_0011517_4382_5527 | 381 |
| 855 | 3300049590 | Ga0501074_0031601 | Ga0501074_0031601_1242_2390 | 381 |
| 856 | 3300049741 | Ga0501079_0065327 | Ga0501079_0065327_369_1517 | 381 |
| 857 | 3300049742 | Ga0501080_0000867 | Ga0501080_0000867_5993_7138 | 381 |
| 858 | 3300049742 | Ga0501080_0002410 | Ga0501080_0002410_6422_7570 | 381 |
| 859 | 3300049742 | Ga0501080_0004755 | Ga0501080_0004755_1212_2357 | 381 |
| 860 | 3300049742 | Ga0501080_0015663 | Ga0501080_0015663_3482_4627 | 381 |
| 861 | 3300049742 | Ga0501080_0027236 | Ga0501080_0027236_2972_4120 | 381 |
| 862 | 3300049742 | Ga0501080_0037361 | Ga0501080_0037361_2981_4126 | 381 |
| 863 | 3300049742 | Ga0501080_0365882 | Ga0501080_0365882_23_1168 | 381 |
| 864 | 3300049744 | Ga0501083_0001739 | Ga0501083_0001739_7864_9009 | 381 |
| 865 | 3300049744 | Ga0501083_0093581 | Ga0501083_0093581_404_1552 | 381 |
| 866 | 3300049822 | Ga0501035_0009302 | Ga0501035_0009302_6591_7736 | 381 |
| 867 | 3300049822 | Ga0501035_0025529 | Ga0501035_0025529_3496_4641 | 381 |
| 868 | 3300049822 | Ga0501035_0032477 | Ga0501035_0032477_2451_3599 | 381 |
| 869 | 3300049822 | Ga0501035_0051360 | Ga0501035_0051360_2221_3366 | 381 |
| 870 | 3300049822 | Ga0501035_0060203 | Ga0501035_0060203_327_1472 | 381 |
| 871 | 3300049822 | Ga0501035_0142923 | Ga0501035_0142923_43_1188 | 381 |
| 872 | 3300049822 | Ga0501035_0224597 | Ga0501035_0224597_120_1265 | 381 |
| 873 | 3300049822 | Ga0501035_0228920 | Ga0501035_0228920_174_1322 | 381 |
| 874 | 3300049823 | Ga0501044_0006675 | Ga0501044_0006675_9457_10605 | 381 |
| 875 | 3300049823 | Ga0501044_0028607 | Ga0501044_0028607_4010_5155 | 381 |
| 876 | 3300049823 | Ga0501044_0062567 | Ga0501044_0062567_2348_3493 | 381 |
| 877 | 3300049823 | Ga0501044_0072136 | Ga0501044_0072136_1505_2650 | 381 |
| 878 | 3300049823 | Ga0501044_0109658 | Ga0501044_0109658_994_2139 | 381 |
| 879 | 3300049823 | Ga0501044_0141185 | Ga0501044_0141185_579_1727 | 381 |
| 880 | 3300050516 | nmdc:mga0sz30_74114_c1 | nmdc:mga0sz30_74114_c1_43_1188 | 381 |
| 881 | 3300053080 | Ga0500635_0012551 | Ga0500635_0012551_435_1583 | 381 |
| 882 | 3300053087 | Ga0500643_000002 | Ga0500643_000002_430357_431502 | 381 |
| 883 | 3300053090 | Ga0500646_0010649 | Ga0500646_0010649_741_1886 | 381 |
| 884 | 3300053093 | Ga0500651_0000179 | Ga0500651_0000179_33754_34902 | 381 |
| 885 | 3300053093 | Ga0500651_0031023 | Ga0500651_0031023_179_1327 | 381 |
| 886 | 3300053098 | Ga0500650_0000027 | Ga0500650_0000027_54620_55774 | 381 |
| 887 | 3300053103 | Ga0500555_001867 | Ga0500555_001867_3024_4169 | 381 |
| 888 | 3300053120 | Ga0500597_000841 | Ga0500597_000841_4780_5928 | 381 |
| 889 | 3300053139 | Ga0500568_0001481 | Ga0500568_0001481_9225_10559 | 381 |
| 890 | 3300053160 | Ga0500633_0005906 | Ga0500633_0005906_1638_2783 | 381 |
| 891 | 3300053730 | Ga0500645_003001 | Ga0500645_003001_1482_2627 | 381 |
| 892 | 3300054114 | Ga0501084_0288880 | Ga0501084_0288880_172_1317 | 381 |
| 893 | 3300055283 | Ga0500661_004432 | Ga0500661_004432_891_2129 | 381 |
| 894 | 3300060353 | Ga0501082_0000082 | Ga0501082_0000082_63914_65062 | 381 |
| 895 | 3300060353 | Ga0501082_0122996 | Ga0501082_0122996_927_2072 | 381 |
| 896 | 3300060353 | Ga0501082_0173941 | Ga0501082_0173941_662_1810 | 381 |
| 897 | 3300061719 | Ga0466962_0004187 | Ga0466962_0004187_1646_2791 | 381 |
| 898 | 3300061719 | Ga0466962_0009563 | Ga0466962_0009563_900_2045 | 381 |
| 899 | 3300061719 | Ga0466962_0017220 | Ga0466962_0017220_943_2088 | 381 |
| 900 | 3300061719 | Ga0466962_0024084 | Ga0466962_0024084_964_2109 | 381 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1u08-assembly1.cif.gz_B | crystal structure and reactivity of ybdl from escherichia coli identify a methionine aminotransferase function. | 0.9794 | 1 | 381 |
| 1u08-assembly1.cif.gz_A | crystal structure and reactivity of ybdl from escherichia coli identify a methionine aminotransferase function. | 0.9776 | 1 | 381 |
| 1u08-assembly1.cif.gz_A | crystal structure and reactivity of ybdl from escherichia coli identify a methionine aminotransferase function. | 0.9751 | 1 | 381 |
| 1u08-assembly1.cif.gz_B | crystal structure and reactivity of ybdl from escherichia coli identify a methionine aminotransferase function. | 0.9743 | 1 | 381 |
| 2o0r-assembly1.cif.gz_B | the three-dimensional structure of n-succinyldiaminopimelate aminotransferase from mycobacterium tuberculosis | 0.9612 | 2 | 380 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P77806_47_284_3.40.640.10 | Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) | 0.9917 | 43 | 278 | 3.40.640.10 |
| af_A0A1D6I5Q5_168_402_3.40.640.10 | Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) | 0.9825 | 41 | 273 | 3.40.640.10 |
| af_P77806_47_284_3.40.640.10 | Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) | 0.9794 | 43 | 278 | 3.40.640.10 |
| af_P77806_286_386_3.90.1150.10 | Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Aspartate Aminotransferase, domain 1 | 0.973 | 282 | 381 | 3.90.1150.10 |
| af_Q7XDA3_47_275_3.40.640.10 | Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) | 0.9713 | 46 | 274 | 3.40.640.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-E7C4H4-F1-model_v4 | Aspartate/tyrosine/aromatic aminotransferase | 0.9904 | 67 | 256 |
GO:0005737
GO:0009058 GO:0016212 GO:0030170 |
| AF-A0A3S4LWV1-F1-model_v4 | Aminotransferase (EC 2.6.1.88) | 0.9878 | 84 | 249 |
GO:0005737
GO:0009058 GO:0010326 GO:0016212 GO:0030170 |
| AF-A0A1E5T4N5-F1-model_v4 | Aminotransferase | 0.9865 | 1 | 381 |
GO:0005737
GO:0009058 GO:0016212 GO:0030170 |
| AF-A0A228J593-F1-model_v4 | Methionine aminotransferase | 0.9843 | 1 | 381 |
GO:0005737
GO:0009058 GO:0016212 GO:0030170 |
| AF-A0A7H9F5E6-F1-model_v4 | deleted | 0.984 | 1 | 381 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar