F485154

General Info

Members Datasets Scaffolds Average Seq Length
900 372 859 381

Family's Representative Sequence

Representative Sequence 3300049589|Ga0501073_0006743|Ga0501073_0006743_2687_3814
Length 375
Sequence MQIETKLPKVGTTIFTVMSQLAQEHKAVNLGQGFPDFDGPQALRDALTAAMNAGRNQYAPMTGLPALREQIAKKTEALYGRKVNPDTDITVTSGATEALFAAIAAIVRPGDEVIVLDPCYDSYEPAIELNGGRAVHVPLDPRDFSPDWKRVRAAITPKTRMILVNTPHNPCGAVFTADDLDDRDIVVLSDEVYEHIVFDGKPHQGVLRHAELADRSFVVSSFGKTYHCTGWKVGYCVAPRSLSAEFRKVHQYLTFCTFTPAQVAFAEILEKDPQHYLDLPAFYQQKRDRFRDLLSGSKFRPLPVGGAYFQVVDYSALDGRDDLAFCEWLVKEGGVAAIPISAFYESPPPDQRLIRFCFAKSDATLEEAAKRLRAL

Samples

Sample ID Description Type Environment
1 2576861471 Stenotrophomonas rhizophila DSM 14405 Isolate Rhizosphere
2 2593339238 Luteibacter sp. UNCMF366Tsu5.1 Isolate Unclassified
3 2593339239 Luteibacter sp. UNCMF331Sha3.1 Isolate Unclassified
4 2643221577 Rhodanobacter sp. Root627 Isolate Unclassified
5 2643221685 Rhodanobacter sp. Root480 Isolate Unclassified
6 2718218334 Luteibacter rhizovicinus LJ96 Isolate Rhizosphere
7 2734482264 Dyella sp. AD052 Isolate Unclassified
8 2738543009 Luteibacter sp. OK325 Isolate Unclassified
9 2739367700 Dyella sp. YR388 Isolate Unclassified
10 2747842428 Stenotrophomonas sp. WCS2014-113 Isolate Unclassified
11 2765235840 Stenotrophomonas maltophilia AA1 Isolate Unclassified
12 2818991440 Luteibacter yeojuensis 583 Isolate Unclassified
13 2818991457 Xanthomonas translucens 569 Isolate Unclassified
14 2842757796 Stenotrophomonas sp. R-72406 Isolate Unclassified
15 2842914999 Luteibacter sp. R-72151 Isolate Unclassified
16 2842918807 Luteibacter sp. R-73110 Isolate Unclassified
17 2852684882 Xanthomonas sp. JAI131 Isolate Rhizosphere
18 2857442823 Stenotrophomonas sp. R-74235 Isolate Unclassified
19 2874220319 Stenotrophomonas maltophilia PS5 Isolate Unclassified
20 2884338543 Luteibacter pinisoli MAH-14 Isolate Rhizosphere
21 2884411467 Dyella sp. AD56 Isolate Rhizosphere
22 2904463128 Luteibacter yeojuensis 3191 Isolate Unclassified
23 2919085039 Luteibacter sp. 1214 Isolate Unclassified
24 2919089067 Stenotrophomonas sp. 1337 Isolate Rhizosphere
25 2919130084 Xanthomonas sp. 1678 Isolate Rhizosphere
26 2919404418 Luteibacter sp. 3190 Isolate Unclassified
27 2928496128 Stenotrophomonas indicatrix 1163 Isolate Unclassified
28 2928963466 Dyella japonica 1073 Isolate Unclassified
29 2929195423 Xanthomonas sp. R-73098 Hybrid assembly Isolate Unclassified
30 2931380184 Stenotrophomonas sp. DR822 Isolate Rhizosphere
31 2937610967 Stenotrophomonas maltophilia EP20 Isolate Unclassified
32 2939589442 Stenotrophomonas rhizophila 716 Isolate Rhizosphere
33 2939611941 Rhodanobacter soli 1757 Isolate Rhizosphere
34 2939622612 Stenotrophomonas sp. 2619 Isolate Rhizosphere
35 2939626828 Stenotrophomonas sp. 2694 Isolate Rhizosphere
36 2941471342 Luteibacter sp. 621 Isolate Unclassified
37 2953994433 Luteibacter sp. W1I16 Isolate Rhizosphere
38 2961047084 Stenotrophomonas maltophilia EP5 Isolate Unclassified
39 2974307012 Stenotrophomonas sp. SORGH_AS_0282 Isolate Unclassified
40 2977247770 Stenotrophomonas rhizophila SORGH_AS 457 Isolate Unclassified
41 2984514374 Stenotrophomonas sp. SORGH_AS282 Isolate Aerial Root
42 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
43 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
44 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
45 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
46 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
47 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
48 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
49 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
50 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
51 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
52 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
53 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
54 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
55 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
56 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
57 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
58 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
59 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
60 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
61 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
62 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
63 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
64 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
65 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
66 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
67 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
68 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
69 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
70 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
71 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
72 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
73 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
74 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
75 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
76 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
77 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
78 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
79 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
80 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
81 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
82 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
83 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
84 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
85 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
86 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
87 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
88 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
89 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
90 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
91 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
92 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
93 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
94 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
95 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
96 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
97 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
98 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
99 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
100 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
101 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
102 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
103 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
104 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
105 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
106 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
107 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
108 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
109 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
110 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
111 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
112 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
113 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
114 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
115 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
116 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
117 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
118 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
119 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
120 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
121 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
122 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
123 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
124 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
125 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
126 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
127 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
128 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
129 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
130 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
131 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
132 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
133 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
134 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
135 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
136 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
137 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
138 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
139 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
140 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
141 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
142 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
143 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
144 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
145 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
146 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
147 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
148 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
149 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
150 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
151 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
152 3300015687 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 Metagenome Rhizosphere
153 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
154 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
155 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
156 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
157 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
158 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
159 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
160 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
161 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
162 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
163 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
164 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
165 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
166 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
167 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
168 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
169 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
170 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
171 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
172 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
173 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
174 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
175 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
176 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
177 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
178 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
179 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
180 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
181 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
182 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
183 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
220 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
221 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
222 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
223 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
224 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
225 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
226 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
227 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
228 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
229 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
230 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
231 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
232 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
233 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
234 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
235 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
236 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
237 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
238 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
239 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
240 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
241 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
242 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
243 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
244 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
245 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
246 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
247 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
248 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
249 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
250 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
251 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
252 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
253 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
254 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
255 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
256 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
257 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
258 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
259 3300041462 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG Metagenome Rhizoplane
260 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
261 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
262 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
263 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
264 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
265 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
266 3300042132 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_070716_133 Metagenome Rhizosphere
267 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
268 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
269 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
270 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
271 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
272 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
273 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
274 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
275 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
276 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
277 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
278 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
279 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
280 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
281 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
282 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
283 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
284 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
285 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
286 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
287 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
288 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
289 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
290 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
291 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
292 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
293 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
294 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
295 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
296 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
297 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
298 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
299 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
300 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
301 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
302 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
303 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
304 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
305 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
306 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
307 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
308 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
309 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
310 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
311 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
312 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
313 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
314 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
315 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
316 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
317 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
318 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
319 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
320 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
321 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
322 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
323 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
324 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
325 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
326 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
327 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
328 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
329 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
330 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
331 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
332 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
333 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
334 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
335 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
336 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
337 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
338 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
339 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
340 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
341 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
342 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
343 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
344 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
345 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
346 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
347 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
348 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
349 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
350 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
351 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
352 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
353 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
354 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
355 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
356 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
357 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
358 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
359 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
360 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
361 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
362 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
363 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
364 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
365 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
366 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
367 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
368 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
369 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
370 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
371 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
372 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.67
Metatranscriptomes 0.78
Isolates 4.56

Biome Distribution

Category Percentage (%)
Aerial Root 0.11
Bulb 0
Endosphere 13.11
Nodule 0
Rhizoplane 1.11
Rhizosphere 73.78
Stem 0
Stem Tuber 0
Unclassified 11.89

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24736J21556_1004702 3300001904 Bacteria 2320
2 JGI24741J21665_1000222 3300001915 Bacteria 17088
3 JGI24741J21665_1004101 3300001915 Bacteria 3304
4 JGI24741J21665_1005082 3300001915 Bacteria 2811
5 JGI24740J21852_10001834 3300001979 Bacteria 9726
6 JGI24740J21852_10002844 3300001979 Bacteria 7737
7 JGI24740J21852_10005375 3300001979 Bacteria 5425
8 JGI24739J22299_10000752 3300001989 Bacteria 11806
9 JGI24737J22298_10000922 3300001990 Bacteria 10448
10 JGI24735J21928_10003438 3300002067 Bacteria 5393
11 JGI24735J21928_10007930 3300002067 Bacteria 3449
12 JGI25156J39149_1005799 3300002705 Bacteria 3493
13 JGI25162J39368_1000048 3300002737 Bacteria 159652
14 JGI25162J39368_1000665 3300002737 Bacteria 24271
15 JGI25162J39368_1000810 3300002737 Bacteria 20701
16 JGI25162J39368_1001000 3300002737 Bacteria 17747
17 JGI25162J39368_1003917 3300002737 Bacteria 3838
18 JGI25157J39369_1000269 3300002741 Bacteria 37975
19 JGI25157J39369_1000582 3300002741 Bacteria 21574
20 JGI25157J39369_1001539 3300002741 Bacteria 8345
21 JGI25157J39369_1002682 3300002741 Bacteria 4147
22 JGI25163J39215_1000651 3300002771 Bacteria 9382
23 JGI25164J39214_1000085 3300002772 Bacteria 92776
24 JGI25164J39214_1000284 3300002772 Bacteria 35665
25 JGI25165J46597_1000009 3300003214 Bacteria 467965
26 JGI25165J46597_1000090 3300003214 Bacteria 168833
27 JGI25153J46596_10017182 3300003215 Bacteria 2861
28 Ga0006562J51391_1191774 3300003578 Bacteria 6298
29 Ga0006562J51391_1191776 3300003578 Bacteria 2480
30 Ga0055538_1002276 3300003751 Bacteria 2925
31 Ga0055539_1000667 3300003752 Bacteria 9030
32 Ga0055533_1000487 3300003756 Bacteria 14705
33 Ga0055533_1001318 3300003756 Bacteria 6736
34 Ga0055525_1000097 3300003759 Bacteria 137371
35 Ga0055527_1000677 3300003760 Bacteria 10204
36 Ga0055527_1000689 3300003760 Bacteria 9874
37 Ga0055527_1001726 3300003760 Bacteria 4232
38 Ga0055535_1000016 3300003761 Bacteria 252398
39 Ga0055535_1001167 3300003761 Bacteria 15414
40 Ga0055535_1001556 3300003761 Bacteria 11182
41 Ga0055535_1001670 3300003761 Bacteria 10202
42 Ga0055535_1001681 3300003761 Bacteria 10147
43 Ga0055535_1001685 3300003761 Bacteria 10119
44 Ga0055542_1000045 3300003762 Bacteria 203558
45 Ga0055542_1000098 3300003762 Bacteria 117711
46 Ga0055542_1001145 3300003762 Bacteria 15627
47 Ga0055542_1001620 3300003762 Bacteria 10202
48 Ga0055542_1001628 3300003762 Bacteria 10147
49 Ga0055542_1001632 3300003762 Bacteria 10112
50 Ga0055529_1000020 3300003763 Bacteria 324857
51 Ga0055529_1001211 3300003763 Bacteria 10147
52 Ga0055529_1001215 3300003763 Bacteria 10116
53 Ga0055529_1001245 3300003763 Bacteria 9468
54 Ga0055526_1000263 3300003771 Bacteria 44141
55 Ga0055526_1002377 3300003771 Bacteria 12752
56 Ga0055537_1000164 3300003773 Bacteria 49285
57 Ga0055524_1016320 3300003775 Bacteria 2669
58 Ga0055536_1001874 3300003781 Bacteria 12248
59 Ga0055534_1000026 3300003784 Bacteria 130908
60 Ga0055530_10000772 3300003791 Bacteria 26697
61 Ga0058692_1000006 3300003856 Bacteria 398109
62 Ga0058692_1000012 3300003856 Bacteria 318930
63 Ga0065165_1000001 3300005262 Bacteria 494087
64 Ga0065165_1000940 3300005262 Bacteria 37166
65 Ga0070658_10002041 3300005327 Bacteria 16931
66 Ga0070658_10068626 3300005327 Bacteria 2899
67 Ga0070658_10133566 3300005327 Bacteria 2069
68 Ga0070690_100110876 3300005330 Bacteria 1831
69 Ga0070670_100000002 3300005331 Bacteria 568775
70 Ga0070670_100145951 3300005331 Bacteria 2047
71 Ga0068869_100037648 3300005334 Bacteria 3441
72 Ga0070666_10000034 3300005335 Bacteria 121537
73 Ga0070666_10000349 3300005335 Bacteria 28972
74 Ga0070666_10004505 3300005335 Bacteria 8489
75 Ga0070666_10006812 3300005335 Bacteria 7040
76 Ga0070666_10026150 3300005335 Bacteria 3810
77 Ga0070680_100000209 3300005336 Bacteria 38470
78 Ga0070680_100001172 3300005336 Bacteria 18843
79 Ga0070680_100095324 3300005336 Bacteria 2467
80 Ga0070682_100016224 3300005337 Bacteria 4328
81 Ga0070682_100023562 3300005337 Bacteria 3655
82 Ga0070660_100071018 3300005339 Bacteria 2718
83 Ga0070660_100076743 3300005339 Bacteria 2617
84 Ga0070691_10009542 3300005341 Bacteria 4431
85 Ga0070661_100001611 3300005344 Bacteria 15612
86 Ga0070661_100006432 3300005344 Bacteria 8102
87 Ga0070661_100008490 3300005344 Bacteria 7105
88 Ga0070661_100043425 3300005344 Bacteria 3283
89 Ga0070692_10001030 3300005345 Bacteria 9605
90 Ga0070668_100020437 3300005347 Bacteria 4997
91 Ga0070668_100096721 3300005347 Bacteria 2334
92 Ga0070668_100201816 3300005347 Bacteria 1632
93 Ga0070669_100008381 3300005353 Bacteria 7375
94 Ga0070669_100210889 3300005353 Bacteria 1532
95 Ga0070675_100198263 3300005354 Bacteria 1742
96 Ga0070671_100000071 3300005355 Bacteria 65048
97 Ga0070674_100194024 3300005356 Bacteria 1564
98 Ga0070659_100020340 3300005366 Bacteria 5040
99 Ga0070659_100079503 3300005366 Bacteria 2617
100 Ga0070667_100000005 3300005367 Bacteria 347268
101 Ga0070667_100000007 3300005367 Bacteria 292130
102 Ga0070667_100076048 3300005367 Bacteria 2866
103 Ga0070667_100120315 3300005367 Bacteria 2283
104 Ga0070714_100001173 3300005435 Bacteria 18879
105 Ga0070713_100000486 3300005436 Bacteria 25305
106 Ga0070663_100009827 3300005455 Bacteria 5943
107 Ga0070663_100019628 3300005455 Bacteria 4461
108 Ga0070663_100021767 3300005455 Bacteria 4271
109 Ga0070663_100058261 3300005455 Bacteria 2773
110 Ga0070663_100080133 3300005455 Bacteria 2397
111 Ga0070678_100012770 3300005456 Bacteria 5237
112 Ga0070678_100033970 3300005456 Bacteria 3547
113 Ga0070678_100086612 3300005456 Bacteria 2390
114 Ga0070662_100023627 3300005457 Bacteria 4225
115 Ga0070662_100087991 3300005457 Bacteria 2327
116 Ga0070681_10000007 3300005458 Bacteria 159821
117 Ga0070681_10000397 3300005458 Bacteria 35263
118 Ga0070681_10000998 3300005458 Bacteria 23956
119 Ga0070681_10017959 3300005458 Bacteria 7070
120 Ga0068867_100005929 3300005459 Bacteria 8667
121 Ga0070685_10000275 3300005466 Bacteria 33104
122 Ga0070679_100000412 3300005530 Bacteria 36448
123 Ga0070679_100004197 3300005530 Bacteria 13289
124 Ga0070679_100014507 3300005530 Bacteria 7569
125 Ga0070679_100084989 3300005530 Bacteria 3151
126 Ga0070679_100109154 3300005530 Bacteria 2753
127 Ga0070679_100231057 3300005530 Bacteria 1809
128 Ga0068853_100000206 3300005539 Bacteria 41721
129 Ga0068853_100003817 3300005539 Bacteria 11543
130 Ga0068853_100010874 3300005539 Bacteria 7374
131 Ga0068853_100013551 3300005539 Bacteria 6663
132 Ga0068853_100013620 3300005539 Bacteria 6646
133 Ga0068853_100014698 3300005539 Bacteria 6421
134 Ga0068853_100071311 3300005539 Bacteria 3025
135 Ga0070696_100041500 3300005546 Bacteria 3179
136 Ga0070696_100090932 3300005546 Bacteria 2172
137 Ga0070696_100217777 3300005546 Bacteria 1431
138 Ga0070693_100011214 3300005547 Bacteria 4510
139 Ga0070665_100000057 3300005548 Bacteria 237271
140 Ga0070665_100000227 3300005548 Bacteria 93439
141 Ga0070665_100034667 3300005548 Bacteria 5076
142 Ga0070665_100049290 3300005548 Bacteria 4226
143 Ga0070665_100083170 3300005548 Bacteria 3206
144 Ga0070665_100098700 3300005548 Bacteria 2925
145 Ga0070665_100102185 3300005548 Bacteria 2870
146 Ga0070665_100113007 3300005548 Bacteria 2719
147 Ga0070665_100122132 3300005548 Bacteria 2606
148 Ga0068855_100003573 3300005563 Bacteria 19011
149 Ga0068855_100004858 3300005563 Bacteria 16409
150 Ga0068855_100012573 3300005563 Bacteria 10217
151 Ga0068855_100014971 3300005563 Bacteria 9342
152 Ga0068855_100120621 3300005563 Bacteria 3001
153 Ga0070664_100092394 3300005564 Bacteria 2620
154 Ga0068857_100001801 3300005577 Bacteria 17237
155 Ga0068857_100039809 3300005577 Bacteria 4165
156 Ga0068857_100057497 3300005577 Bacteria 3452
157 Ga0068854_100000774 3300005578 Bacteria 18996
158 Ga0068854_100005461 3300005578 Bacteria 8028
159 Ga0068854_100009017 3300005578 Bacteria 6428
160 Ga0068854_100197937 3300005578 Bacteria 1578
161 Ga0068856_100000310 3300005614 Bacteria 53426
162 Ga0068856_100001563 3300005614 Bacteria 23973
163 Ga0068856_100128167 3300005614 Bacteria 2541
164 Ga0068856_100147658 3300005614 Bacteria 2359
165 Ga0068856_100174181 3300005614 Bacteria 2164
166 Ga0068852_100006743 3300005616 Bacteria 8330
167 Ga0068852_100010358 3300005616 Bacteria 6964
168 Ga0068852_100015345 3300005616 Bacteria 5936
169 Ga0068852_100016190 3300005616 Bacteria 5806
170 Ga0068852_100100870 3300005616 Bacteria 2605
171 Ga0068859_100001188 3300005617 Bacteria 26597
172 Ga0068859_100087241 3300005617 Bacteria 3168
173 Ga0068859_100089097 3300005617 Bacteria 3135
174 Ga0068859_100134405 3300005617 Bacteria 2545
175 Ga0068864_100000003 3300005618 Bacteria 568775
176 Ga0068861_100079415 3300005719 Bacteria 2565
177 Ga0068851_10001367 3300005834 Bacteria 10634
178 Ga0068851_10004040 3300005834 Bacteria 6586
179 Ga0068851_10004918 3300005834 Bacteria 6058
180 Ga0068863_100000773 3300005841 Bacteria 32109
181 Ga0068863_100286884 3300005841 Bacteria 1595
182 Ga0068858_100042553 3300005842 Bacteria 4211
183 Ga0068858_100187011 3300005842 Bacteria 1956
184 Ga0068860_100004261 3300005843 Bacteria 14649
185 Ga0068862_100000548 3300005844 Bacteria 39395
186 Ga0068862_100005287 3300005844 Bacteria 10818
187 Ga0068862_100255905 3300005844 Bacteria 1597
188 Ga0068862_100292956 3300005844 Bacteria 1495
189 Ga0081540_1003991 3300005983 Bacteria 11440
190 Ga0075364_10131251 3300006051 Bacteria 1681
191 Ga0075369_10004497 3300006186 Bacteria 5156
192 Ga0097621_100029605 3300006237 Bacteria 4326
193 Ga0097621_100111918 3300006237 Bacteria 2307
194 Ga0075431_100069913 3300006847 Bacteria 3622
195 Ga0068865_100009828 3300006881 Bacteria 5940
196 Ga0068865_100048270 3300006881 Bacteria 2929
197 Ga0097620_100001188 3300006931 Bacteria 26597
198 Ga0097620_100087241 3300006931 Bacteria 3168
199 Ga0097620_100089103 3300006931 Bacteria 3135
200 Ga0097620_100134403 3300006931 Bacteria 2545
201 Ga0105251_10007635 3300009011 Bacteria 6622
202 Ga0105240_10004166 3300009093 Bacteria 22164
203 Ga0105240_10092908 3300009093 Bacteria 3683
204 Ga0105240_10096470 3300009093 Bacteria 3603
205 Ga0105240_10097179 3300009093 Bacteria 3589
206 Ga0105240_10109408 3300009093 Bacteria 3346
207 Ga0105240_10115149 3300009093 Bacteria 3246
208 Ga0105240_10298749 3300009093 Bacteria 1843
209 Ga0105245_10090266 3300009098 Bacteria 2818
210 Ga0105247_10011228 3300009101 Bacteria 5403
211 Ga0105243_10057514 3300009148 Bacteria 3097
212 Ga0105241_10003106 3300009174 Bacteria 12356
213 Ga0105241_10005656 3300009174 Bacteria 9223
214 Ga0105241_10162852 3300009174 Bacteria 1835
215 Ga0105242_10404173 3300009176 Bacteria 1275
216 Ga0105248_10001462 3300009177 Bacteria 26311
217 Ga0105248_10198295 3300009177 Bacteria 2262
218 Ga0105237_10000250 3300009545 Bacteria 76317
219 Ga0105237_10000701 3300009545 Bacteria 46447
220 Ga0105237_10002972 3300009545 Bacteria 20494
221 Ga0105238_10001647 3300009551 Bacteria 22393
222 Ga0105238_10003680 3300009551 Bacteria 15278
223 Ga0105238_10010010 3300009551 Bacteria 9512
224 Ga0105238_10034239 3300009551 Bacteria 5169
225 Ga0105238_10128450 3300009551 Bacteria 2513
226 Ga0105238_10196202 3300009551 Bacteria 1995
227 Ga0105238_10299083 3300009551 Bacteria 1593
228 Ga0105249_10000763 3300009553 Bacteria 28922
229 Ga0105249_10009268 3300009553 Bacteria 8608
230 Ga0105249_10128256 3300009553 Bacteria 2418
231 Ga0105239_10003089 3300010375 Bacteria 20669
232 Ga0105239_10011101 3300010375 Bacteria 10053
233 Ga0105239_10027103 3300010375 Bacteria 6308
234 Ga0105239_10044717 3300010375 Bacteria 4853
235 Ga0105239_10076582 3300010375 Bacteria 3679
236 Ga0105239_10109250 3300010375 Bacteria 3065
237 Ga0157373_10057570 3300013100 Bacteria 2757
238 Ga0157373_10210362 3300013100 Bacteria 1371
239 Ga0157373_10210593 3300013100 Bacteria 1371
240 Ga0157371_10000400 3300013102 Bacteria 54327
241 Ga0157371_10005810 3300013102 Bacteria 10324
242 Ga0157371_10020709 3300013102 Bacteria 4837
243 Ga0157371_10098820 3300013102 Bacteria 2070
244 Ga0157370_10000204 3300013104 Bacteria 75030
245 Ga0157370_10006775 3300013104 Bacteria 12568
246 Ga0157370_10065744 3300013104 Bacteria 3430
247 Ga0157370_10157804 3300013104 Bacteria 2111
248 Ga0157369_10004267 3300013105 Bacteria 16901
249 Ga0157369_10014816 3300013105 Bacteria 8798
250 Ga0157369_10108550 3300013105 Bacteria 2952
251 Ga0157369_10361418 3300013105 Bacteria 1507
252 Ga0157374_10009835 3300013296 Bacteria 8207
253 Ga0157378_10000742 3300013297 Bacteria 30520
254 Ga0163162_10000106 3300013306 Bacteria 74934
255 Ga0163162_10033814 3300013306 Bacteria 5082
256 Ga0163162_10053513 3300013306 Bacteria 4057
257 Ga0157372_10000445 3300013307 Bacteria 45478
258 Ga0157372_10003420 3300013307 Bacteria 17127
259 Ga0157372_10007949 3300013307 Bacteria 11273
260 Ga0157372_10043583 3300013307 Bacteria 4968
261 Ga0157372_10065011 3300013307 Bacteria 4094
262 Ga0157372_10068579 3300013307 Bacteria 3987
263 Ga0157375_10003145 3300013308 Bacteria 14336
264 Ga0157375_10074274 3300013308 Bacteria 3421
265 Ga0163163_10000031 3300014325 Bacteria 169040
266 Ga0163163_10000863 3300014325 Bacteria 25845
267 Ga0163163_10013489 3300014325 Bacteria 7486
268 Ga0163163_10089563 3300014325 Bacteria 3089
269 Ga0182008_10000123 3300014497 Bacteria 58726
270 Ga0182008_10001033 3300014497 Bacteria 19349
271 Ga0157379_10004344 3300014968 Bacteria 12122
272 Ga0157379_10039177 3300014968 Bacteria 4228
273 Ga0157376_10001616 3300014969 Bacteria 14902
274 Ga0157376_10023869 3300014969 Bacteria 4795
275 Ga0182006_1000005 3300015261 Bacteria 621201
276 Ga0182006_1002024 3300015261 Bacteria 11384
277 Ga0182007_10006316 3300015262 Bacteria 5097
278 Ga0182005_1000004 3300015265 Bacteria 609645
279 Ga0182005_1000611 3300015265 Bacteria 17260
280 Ga0182005_1001305 3300015265 Bacteria 10217
281 Ga0182005_1005449 3300015265 Bacteria 3975
282 Ga0183368_1004 3300015687 Bacteria 1211761
283 Ga0163161_10001879 3300017792 Bacteria 15327
284 Ga0163161_10002326 3300017792 Bacteria 13623
285 Ga0163161_10004817 3300017792 Bacteria 9403
286 Ga0206350_11099119 3300020080 Bacteria 3094
287 Ga0206353_11265797 3300020082 Bacteria 2224
288 Ga0154015_1194426 3300020610 Bacteria 3262
289 Ga0154015_1205975 3300020610 Bacteria 3374
290 Ga0224712_10026609 3300022467 Bacteria 2047
291 Ga0209784_100013 3300025224 Bacteria 518664
292 Ga0209674_100062 3300025226 Bacteria 276316
293 Ga0209674_100108 3300025226 Bacteria 150893
294 Ga0209674_100193 3300025226 Bacteria 65447
295 Ga0209674_100776 3300025226 Bacteria 10798
296 Ga0209674_102155 3300025226 Bacteria 4431
297 Ga0209672_100007 3300025228 Bacteria 959482
298 Ga0209672_100078 3300025228 Bacteria 156926
299 Ga0209672_100551 3300025228 Bacteria 20261
300 Ga0209563_100079 3300025230 Bacteria 203017
301 Ga0207427_100033 3300025231 Bacteria 338459
302 Ga0207427_100073 3300025231 Bacteria 156503
303 Ga0207427_100112 3300025231 Bacteria 109224
304 Ga0207427_107381 3300025231 Bacteria 1295
305 Ga0209437_100012 3300025233 Bacteria 792625
306 Ga0209437_100020 3300025233 Bacteria 656374
307 Ga0209437_100105 3300025233 Bacteria 220034
308 Ga0209437_100151 3300025233 Bacteria 156418
309 Ga0209437_101420 3300025233 Bacteria 5923
310 Ga0209258_100012 3300025242 Bacteria 825544
311 Ga0209258_100019 3300025242 Bacteria 566728
312 Ga0209258_100046 3300025242 Bacteria 369794
313 Ga0209258_100582 3300025242 Bacteria 30641
314 Ga0209258_100600 3300025242 Bacteria 29489
315 Ga0209258_101514 3300025242 Bacteria 7876
316 Ga0209646_1000749 3300025246 Bacteria 11332
317 Ga0209646_1001723 3300025246 Bacteria 5527
318 Ga0209646_1003294 3300025246 Bacteria 3221
319 Ga0209026_1000015 3300025250 Bacteria 395555
320 Ga0209026_1000213 3300025250 Bacteria 80756
321 Ga0209026_1000381 3300025250 Bacteria 40677
322 Ga0209026_1001297 3300025250 Bacteria 11308
323 Ga0209677_100725 3300025253 Bacteria 16786
324 Ga0209148_1000001 3300025254 Bacteria 2545271
325 Ga0209148_1000005 3300025254 Bacteria 1806504
326 Ga0209148_1000013 3300025254 Bacteria 956684
327 Ga0209148_1000039 3300025254 Bacteria 482479
328 Ga0209148_1000084 3300025254 Bacteria 268147
329 Ga0209148_1000296 3300025254 Bacteria 73505
330 Ga0209759_1000462 3300025256 Bacteria 46113
331 Ga0209759_1000719 3300025256 Bacteria 29163
332 Ga0209759_1000802 3300025256 Bacteria 25445
333 Ga0209759_1002655 3300025256 Bacteria 7675
334 Ga0209759_1007906 3300025256 Bacteria 3366
335 Ga0209129_1001478 3300025258 Bacteria 13064
336 Ga0209129_1005121 3300025258 Bacteria 4795
337 Ga0209233_1000002 3300025261 Bacteria 2501366
338 Ga0209233_1000020 3300025261 Bacteria 798224
339 Ga0209233_1000080 3300025261 Bacteria 338459
340 Ga0209565_1000022 3300025263 Bacteria 390888
341 Ga0209455_1000010 3300025272 Bacteria 959482
342 Ga0209455_1000027 3300025272 Bacteria 566710
343 Ga0209455_1000034 3300025272 Bacteria 483129
344 Ga0209455_1000126 3300025272 Bacteria 165771
345 Ga0209455_1000662 3300025272 Bacteria 20911
346 Ga0209673_1000110 3300025273 Bacteria 181173
347 Ga0209675_1000060 3300025291 Bacteria 184316
348 Ga0209676_1000219 3300025292 Bacteria 125330
349 Ga0209676_1000279 3300025292 Bacteria 106358
350 Ga0209564_1000304 3300025295 Bacteria 97304
351 Ga0209758_1002818 3300025297 Bacteria 16919
352 Ga0209758_1005835 3300025297 Bacteria 9199
353 Ga0209050_1000542 3300025298 Bacteria 62500
354 Ga0209050_1000825 3300025298 Bacteria 43030
355 Ga0209050_1022520 3300025298 Bacteria 2254
356 Ga0209256_1007442 3300025299 Bacteria 5395
357 Ga0209256_1008983 3300025299 Bacteria 4487
358 Ga0209051_1012166 3300025303 Bacteria 4178
359 Ga0209257_1000726 3300025304 Bacteria 50193
360 Ga0207656_10010701 3300025321 Bacteria 3444
361 Ga0207656_10017871 3300025321 Bacteria 2784
362 Ga0207713_1034419 3300025735 Bacteria 2200
363 Ga0207710_10079395 3300025900 Bacteria 1520
364 Ga0207680_10000005 3300025903 Bacteria 660983
365 Ga0207647_10000056 3300025904 Bacteria 86476
366 Ga0207647_10000213 3300025904 Bacteria 47297
367 Ga0207647_10000229 3300025904 Bacteria 46400
368 Ga0207647_10004577 3300025904 Bacteria 10246
369 Ga0207647_10005182 3300025904 Bacteria 9592
370 Ga0207647_10007991 3300025904 Bacteria 7606
371 Ga0207705_10000128 3300025909 Bacteria 83519
372 Ga0207705_10002200 3300025909 Bacteria 15078
373 Ga0207705_10003255 3300025909 Bacteria 12367
374 Ga0207705_10016797 3300025909 Bacteria 5240
375 Ga0207654_10000126 3300025911 Bacteria 49852
376 Ga0207654_10012493 3300025911 Bacteria 4352
377 Ga0207654_10146572 3300025911 Bacteria 1511
378 Ga0207707_10000665 3300025912 Bacteria 34141
379 Ga0207707_10000699 3300025912 Bacteria 33304
380 Ga0207707_10001116 3300025912 Bacteria 25500
381 Ga0207707_10001210 3300025912 Bacteria 24269
382 Ga0207707_10003426 3300025912 Bacteria 14064
383 Ga0207707_10005504 3300025912 Bacteria 11067
384 Ga0207707_10007116 3300025912 Bacteria 9748
385 Ga0207695_10000094 3300025913 Bacteria 265779
386 Ga0207695_10000869 3300025913 Bacteria 55012
387 Ga0207695_10001748 3300025913 Bacteria 34501
388 Ga0207695_10003671 3300025913 Bacteria 21402
389 Ga0207695_10004041 3300025913 Bacteria 20186
390 Ga0207695_10052537 3300025913 Bacteria 4268
391 Ga0207695_10101736 3300025913 Bacteria 2868
392 Ga0207695_10147442 3300025913 Bacteria 2296
393 Ga0207671_10000050 3300025914 Bacteria 190479
394 Ga0207671_10000116 3300025914 Bacteria 122775
395 Ga0207671_10003678 3300025914 Bacteria 15116
396 Ga0207671_10007188 3300025914 Bacteria 9702
397 Ga0207671_10007824 3300025914 Bacteria 9191
398 Ga0207671_10113998 3300025914 Bacteria 2060
399 Ga0207671_10147784 3300025914 Bacteria 1814
400 Ga0207660_10001431 3300025917 Bacteria 16015
401 Ga0207660_10001647 3300025917 Bacteria 14968
402 Ga0207660_10003057 3300025917 Bacteria 10944
403 Ga0207657_10004614 3300025919 Bacteria 14556
404 Ga0207657_10004766 3300025919 Bacteria 14306
405 Ga0207657_10005275 3300025919 Bacteria 13543
406 Ga0207657_10015540 3300025919 Bacteria 7373
407 Ga0207657_10097954 3300025919 Bacteria 2437
408 Ga0207649_10000493 3300025920 Bacteria 28027
409 Ga0207649_10001479 3300025920 Bacteria 13790
410 Ga0207649_10010387 3300025920 Bacteria 5115
411 Ga0207649_10093259 3300025920 Bacteria 1975
412 Ga0207649_10193575 3300025920 Bacteria 1432
413 Ga0207652_10000030 3300025921 Bacteria 144884
414 Ga0207652_10000820 3300025921 Bacteria 29635
415 Ga0207652_10000846 3300025921 Bacteria 29174
416 Ga0207652_10001111 3300025921 Bacteria 24285
417 Ga0207652_10078652 3300025921 Bacteria 2880
418 Ga0207681_10016810 3300025923 Bacteria 4585
419 Ga0207694_10002059 3300025924 Bacteria 16629
420 Ga0207694_10005930 3300025924 Bacteria 9371
421 Ga0207694_10008956 3300025924 Bacteria 7557
422 Ga0207694_10010172 3300025924 Bacteria 7089
423 Ga0207650_10000003 3300025925 Bacteria 1123235
424 Ga0207650_10245264 3300025925 Bacteria 1449
425 Ga0207687_10103069 3300025927 Bacteria 2103
426 Ga0207700_10034657 3300025928 Bacteria 3626
427 Ga0207664_10000126 3300025929 Bacteria 66358
428 Ga0207664_10156749 3300025929 Bacteria 1939
429 Ga0207644_10001445 3300025931 Bacteria 15314
430 Ga0207690_10000266 3300025932 Bacteria 37573
431 Ga0207690_10001014 3300025932 Bacteria 17947
432 Ga0207690_10001119 3300025932 Bacteria 17096
433 Ga0207690_10011293 3300025932 Bacteria 5336
434 Ga0207706_10017013 3300025933 Bacteria 6559
435 Ga0207706_10021569 3300025933 Bacteria 5783
436 Ga0207706_10070314 3300025933 Bacteria 3079
437 Ga0207709_10016265 3300025935 Bacteria 4133
438 Ga0207669_10219859 3300025937 Bacteria 1393
439 Ga0207704_10005509 3300025938 Bacteria 5836
440 Ga0207704_10022683 3300025938 Bacteria 3369
441 Ga0207691_10176412 3300025940 Bacteria 1869
442 Ga0207711_10001229 3300025941 Bacteria 24284
443 Ga0207711_10005099 3300025941 Bacteria 11129
444 Ga0207689_10030973 3300025942 Bacteria 4457
445 Ga0207661_10014451 3300025944 Bacteria 5787
446 Ga0207661_10038955 3300025944 Bacteria 3728
447 Ga0207679_10008076 3300025945 Bacteria 6694
448 Ga0207679_10099435 3300025945 Bacteria 2271
449 Ga0207667_10000031 3300025949 Bacteria 323587
450 Ga0207667_10000125 3300025949 Bacteria 118155
451 Ga0207667_10000634 3300025949 Bacteria 45497
452 Ga0207667_10000818 3300025949 Bacteria 40208
453 Ga0207667_10003528 3300025949 Bacteria 19334
454 Ga0207667_10007474 3300025949 Bacteria 13129
455 Ga0207667_10092266 3300025949 Bacteria 3128
456 Ga0207667_10368415 3300025949 Bacteria 1464
457 Ga0207712_10000169 3300025961 Bacteria 67461
458 Ga0207712_10001183 3300025961 Bacteria 18055
459 Ga0207668_10040485 3300025972 Bacteria 3144
460 Ga0207640_10000082 3300025981 Bacteria 74895
461 Ga0207640_10001407 3300025981 Bacteria 13002
462 Ga0207640_10005086 3300025981 Bacteria 7152
463 Ga0207640_10015481 3300025981 Bacteria 4416
464 Ga0207640_10078855 3300025981 Bacteria 2243
465 Ga0207658_10000004 3300025986 Bacteria 569357
466 Ga0207658_10000006 3300025986 Bacteria 392309
467 Ga0207658_10009512 3300025986 Bacteria 6598
468 Ga0207658_10035251 3300025986 Bacteria 3583
469 Ga0207658_10102787 3300025986 Bacteria 2242
470 Ga0207677_10170281 3300026023 Bacteria 1702
471 Ga0207677_10204134 3300026023 Bacteria 1573
472 Ga0207703_10011575 3300026035 Bacteria 6859
473 Ga0207703_10075899 3300026035 Bacteria 2787
474 Ga0207639_10000230 3300026041 Bacteria 41807
475 Ga0207639_10001497 3300026041 Bacteria 15730
476 Ga0207639_10001503 3300026041 Bacteria 15684
477 Ga0207639_10001512 3300026041 Bacteria 15628
478 Ga0207639_10012848 3300026041 Bacteria 5842
479 Ga0207639_10032218 3300026041 Bacteria 3857
480 Ga0207639_10090133 3300026041 Bacteria 2452
481 Ga0207678_10001435 3300026067 Bacteria 21864
482 Ga0207678_10006920 3300026067 Bacteria 10062
483 Ga0207678_10014775 3300026067 Bacteria 6870
484 Ga0207678_10019278 3300026067 Bacteria 5991
485 Ga0207678_10025756 3300026067 Bacteria 5133
486 Ga0207678_10034586 3300026067 Bacteria 4401
487 Ga0207678_10080917 3300026067 Bacteria 2780
488 Ga0207708_10174009 3300026075 Bacteria 1706
489 Ga0207702_10000265 3300026078 Bacteria 60212
490 Ga0207702_10000384 3300026078 Bacteria 50456
491 Ga0207702_10005204 3300026078 Bacteria 11423
492 Ga0207702_10011335 3300026078 Bacteria 7432
493 Ga0207702_10011594 3300026078 Bacteria 7345
494 Ga0207702_10064781 3300026078 Bacteria 3128
495 Ga0207702_10125723 3300026078 Bacteria 2302
496 Ga0207702_10158328 3300026078 Bacteria 2066
497 Ga0207641_10009701 3300026088 Bacteria 7932
498 Ga0207641_10049188 3300026088 Bacteria 3561
499 Ga0207641_10053431 3300026088 Bacteria 3424
500 Ga0207641_10083288 3300026088 Bacteria 2781
501 Ga0207648_10117566 3300026089 Bacteria 2336
502 Ga0207676_10000003 3300026095 Bacteria 1123235
503 Ga0207674_10002112 3300026116 Bacteria 25126
504 Ga0207674_10004296 3300026116 Bacteria 17186
505 Ga0207674_10006067 3300026116 Bacteria 14293
506 Ga0207674_10015842 3300026116 Bacteria 8267
507 Ga0207674_10042792 3300026116 Bacteria 4674
508 Ga0207675_100131643 3300026118 Bacteria 2372
509 Ga0207683_10038290 3300026121 Bacteria 4179
510 Ga0207683_10039725 3300026121 Bacteria 4105
511 Ga0207683_10045636 3300026121 Bacteria 3832
512 Ga0207683_10144088 3300026121 Bacteria 2147
513 Ga0207698_10001180 3300026142 Bacteria 15239
514 Ga0207698_10001757 3300026142 Bacteria 12633
515 Ga0207698_10006674 3300026142 Bacteria 7212
516 Ga0207698_10026723 3300026142 Bacteria 4086
517 Ga0207698_10031345 3300026142 Bacteria 3836
518 Ga0207698_10079147 3300026142 Bacteria 2643
519 Ga0207698_10081075 3300026142 Bacteria 2617
520 Ga0207698_10211122 3300026142 Bacteria 1747
521 Ga0209371_1000007 3300027312 Bacteria 1050654
522 Ga0209371_1000016 3300027312 Bacteria 646301
523 Ga0268266_10000001 3300028379 Bacteria 4040580
524 Ga0268266_10000004 3300028379 Bacteria 1495817
525 Ga0268266_10000006 3300028379 Bacteria 1410021
526 Ga0268266_10004408 3300028379 Bacteria 13488
527 Ga0268266_10102131 3300028379 Bacteria 2529
528 Ga0268266_10111722 3300028379 Bacteria 2421
529 Ga0268265_10001087 3300028380 Bacteria 24196
530 Ga0268265_10003544 3300028380 Bacteria 11168
531 Ga0268265_10233467 3300028380 Bacteria 1618
532 Ga0268265_10278620 3300028380 Bacteria 1495
533 Ga0268264_10000016 3300028381 Bacteria 502537
534 Ga0268264_10305021 3300028381 Bacteria 1500
535 Ga0307517_10153775 3300028786 Bacteria 1569
536 Ga0307515_10164507 3300028794 Bacteria 2244
537 Ga0268256_1000008 3300030500 Bacteria 1050654
538 Ga0268256_1000015 3300030500 Bacteria 646300
539 Ga0316183_1072209 3300030742 Bacteria 4712
540 Ga0265332_10046656 3300031238 Bacteria 1866
541 Ga0265331_10039292 3300031250 Bacteria 2308
542 Ga0265327_10000044 3300031251 Bacteria 284808
543 Ga0265316_10138153 3300031344 Bacteria 1832
544 Ga0307408_100106805 3300031548 Bacteria 2143
545 Ga0307516_10052700 3300031730 Bacteria 3981
546 Ga0307412_10000684 3300031911 Bacteria 19615
547 Ga0307412_10008621 3300031911 Bacteria 5829
548 Ga0307412_10144655 3300031911 Bacteria 1746
549 Ga0307507_10098766 3300033179 Bacteria 2456
550 Ga0307510_10000049 3300033180 Bacteria 91546
551 Ga0395899_0000133 3300037312 Bacteria 114879
552 Ga0395899_0075905 3300037312 Bacteria 2454
553 Ga0395899_0088684 3300037312 Bacteria 2243
554 Ga0395900_0000033 3300037418 Bacteria 260271
555 Ga0395900_0000061 3300037418 Bacteria 202483
556 Ga0395900_0068601 3300037418 Bacteria 3644
557 Ga0395900_0216503 3300037418 Bacteria 1932
558 Ga0395898_0000034 3300037466 Bacteria 356745
559 Ga0395898_0000197 3300037466 Bacteria 155187
560 Ga0395898_0062735 3300037466 Bacteria 3608
561 Ga0395898_0090322 3300037466 Bacteria 2947
562 Ga0395898_0100362 3300037466 Bacteria 2779
563 Ga0395898_0218030 3300037466 Bacteria 1820
564 Ga0395898_0218850 3300037466 Bacteria 1816
565 Ga0395905_0051773 3300037471 Bacteria 3846
566 Ga0395901_0000772 3300038443 Bacteria 35860
567 Ga0395901_0005878 3300038443 Bacteria 12416
568 Ga0395901_0021408 3300038443 Bacteria 6624
569 Ga0395901_0071975 3300038443 Bacteria 3603
570 Ga0237819_05304 3300038705 Bacteria 2035
571 Ga0439436_0000042 3300041404 Bacteria 39617
572 Ga0439465_0002276 3300041413 Bacteria 6306
573 Ga0451793_0280819 3300041452 Bacteria 1579
574 Ga0451800_1047982 3300041459 Bacteria 1385
575 Ga0451806_243917 3300041462 Bacteria 1497
576 Ga0451804_0591474 3300041463 Bacteria 1403
577 Ga0451807_0137290 3300041486 Bacteria 1652
578 Ga0451837_0542554 3300041494 Bacteria 2057
579 Ga0451839_0258198 3300041496 Bacteria 1455
580 Ga0451843_0036637 3300041509 Bacteria 3045
581 Ga0451853_0612520 3300041512 Bacteria 6430
582 Ga0450895_000548 3300042132 Bacteria 2211
583 Ga0450896_000078 3300042133 Bacteria 6552
584 Ga0450907_003204 3300042146 Bacteria 2954
585 Ga0450908_000392 3300042184 Bacteria 8425
586 Ga0450918_004985 3300042531 Bacteria 2393
587 Ga0466969_0001628 3300044656 Bacteria 12034
588 Ga0466969_0005914 3300044656 Bacteria 6507
589 Ga0466972_0001288 3300044658 Bacteria 12110
590 Ga0466972_0103252 3300044658 Bacteria 1348
591 Ga0466982_0000010 3300044672 Bacteria 188341
592 Ga0466982_0000196 3300044672 Bacteria 15881
593 Ga0466965_0022391 3300044683 Bacteria 3046
594 Ga0466966_0003629 3300044684 Bacteria 10182
595 Ga0466966_0017116 3300044684 Bacteria 4795
596 Ga0466961_0003687 3300044693 Bacteria 9559
597 Ga0466961_0004916 3300044693 Bacteria 8403
598 Ga0466961_0011932 3300044693 Bacteria 5554
599 Ga0466961_0043425 3300044693 Bacteria 2879
600 Ga0466961_0088931 3300044693 Bacteria 1951
601 Ga0466964_0011053 3300044706 Bacteria 3410
602 Ga0453684_0002590 3300044712 Bacteria 43282
603 Ga0466971_0009268 3300044719 Bacteria 4300
604 Ga0466968_0001991 3300044735 Bacteria 7422
605 Ga0466970_0000202 3300044765 Bacteria 28937
606 Ga0466970_0062608 3300044765 Bacteria 1994
607 Ga0466957_0003347 3300044842 Bacteria 8785
608 Ga0466957_0022118 3300044842 Bacteria 3749
609 Ga0466957_0041557 3300044842 Bacteria 2781
610 Ga0466959_0000232 3300045049 Bacteria 35011
611 Ga0466959_0000888 3300045049 Bacteria 17606
612 Ga0466959_0024693 3300045049 Bacteria 4453
613 Ga0466959_0087654 3300045049 Bacteria 2238
614 Ga0451576_0000840 3300045051 Bacteria 59794
615 Ga0495617_000016 3300046452 Bacteria 253600
616 Ga0495617_002329 3300046452 Bacteria 7633
617 Ga0495638_0000212 3300046460 Bacteria 81733
618 Ga0495638_0000938 3300046460 Bacteria 29535
619 Ga0495638_0001592 3300046460 Bacteria 20319
620 Ga0495650_0000614 3300046471 Bacteria 48415
621 Ga0495650_0001007 3300046471 Bacteria 31805
622 Ga0495650_0001927 3300046471 Bacteria 18382
623 Ga0495584_0000847 3300046491 Bacteria 19760
624 Ga0495585_0000007 3300046492 Bacteria 288113
625 Ga0495585_0002049 3300046492 Bacteria 14849
626 Ga0495607_0000003 3300046501 Bacteria 366900
627 Ga0495607_0000437 3300046501 Bacteria 42089
628 Ga0495606_0000610 3300046507 Bacteria 56591
629 Ga0495606_0001571 3300046507 Bacteria 29944
630 Ga0495606_0001761 3300046507 Bacteria 27728
631 Ga0495606_0012718 3300046507 Bacteria 6712
632 Ga0495610_0008323 3300046512 Bacteria 6735
633 Ga0495616_0000001 3300046513 Bacteria 780061
634 Ga0495616_0016407 3300046513 Bacteria 4100
635 Ga0495620_0001003 3300046515 Bacteria 17446
636 Ga0495631_0000065 3300046518 Bacteria 65356
637 Ga0495631_0000217 3300046518 Bacteria 39565
638 Ga0495632_0000011 3300046519 Bacteria 266804
639 Ga0495632_0000581 3300046519 Bacteria 33896
640 Ga0495637_0006365 3300046520 Bacteria 5935
641 Ga0495648_0002069 3300046524 Bacteria 18985
642 Ga0495648_0017405 3300046524 Bacteria 5136
643 Ga0495663_0016674 3300046525 Bacteria 2077
644 Ga0495668_0064904 3300046616 Bacteria 2009
645 Ga0495611_0000001 3300046648 Bacteria 2628469
646 Ga0495611_0000068 3300046648 Bacteria 71983
647 Ga0495625_0000001 3300046660 Bacteria 1641829
648 Ga0495625_0010620 3300046660 Bacteria 7597
649 Ga0495625_0018578 3300046660 Bacteria 5421
650 Ga0495625_0058667 3300046660 Bacteria 2734
651 Ga0495661_0001999 3300046665 Bacteria 16088
652 Ga0495657_0151105 3300046675 Bacteria 1442
653 Ga0495670_0011736 3300046691 Bacteria 4313
654 Ga0495670_0019299 3300046691 Bacteria 3358
655 Ga0495671_0004638 3300046692 Bacteria 8148
656 Ga0495649_0006750 3300046694 Bacteria 7111
657 Ga0495589_0000016 3300046794 Bacteria 209027
658 Ga0495660_0000018 3300046810 Bacteria 317061
659 Ga0495660_0000294 3300046810 Bacteria 45736
660 Ga0495679_000001 3300047446 Bacteria 1607568
661 Ga0495673_0000001 3300047469 Bacteria 1630730
662 Ga0495673_0000018 3300047469 Bacteria 569190
663 Ga0495673_0006286 3300047469 Bacteria 6998
664 Ga0495686_0000026 3300047472 Bacteria 383637
665 Ga0495686_0000037 3300047472 Bacteria 307937
666 Ga0495686_0010946 3300047472 Bacteria 6422
667 Ga0495686_0011052 3300047472 Bacteria 6385
668 Ga0495686_0039726 3300047472 Bacteria 3003
669 Ga0496101_0015402 3300048904 Bacteria 5152
670 Ga0496113_0076306 3300048916 Bacteria 2560
671 Ga0496113_0216433 3300048916 Bacteria 1526
672 Ga0496115_0000140 3300048918 Bacteria 66883
673 Ga0496115_0000160 3300048918 Bacteria 63326
674 Ga0496116_0002429 3300048919 Bacteria 19630
675 Ga0496117_0000779 3300048920 Bacteria 50165
676 Ga0496117_0031479 3300048920 Bacteria 4048
677 Ga0496117_0045558 3300048920 Bacteria 3166
678 Ga0496117_0058938 3300048920 Bacteria 2656
679 Ga0496118_0000497 3300048921 Bacteria 65119
680 Ga0496118_0001337 3300048921 Bacteria 37414
681 Ga0496118_0001789 3300048921 Bacteria 31029
682 Ga0496118_0002288 3300048921 Bacteria 26119
683 Ga0496118_0002346 3300048921 Bacteria 25662
684 Ga0496118_0004535 3300048921 Bacteria 16392
685 Ga0496118_0004950 3300048921 Bacteria 15436
686 Ga0496118_0071155 3300048921 Bacteria 2505
687 Ga0496119_0024864 3300048922 Bacteria 4199
688 Ga0496121_0000044 3300048924 Bacteria 337672
689 Ga0496121_0001002 3300048924 Bacteria 50506
690 Ga0496121_0001590 3300048924 Bacteria 37776
691 Ga0496121_0007287 3300048924 Bacteria 13384
692 Ga0496121_0025118 3300048924 Bacteria 5669
693 Ga0496121_0025582 3300048924 Bacteria 5594
694 Ga0496121_0061625 3300048924 Bacteria 3077
695 Ga0496122_0000463 3300048925 Bacteria 84540
696 Ga0496122_0011204 3300048925 Bacteria 9121
697 Ga0496122_0012727 3300048925 Bacteria 8328
698 Ga0496122_0013601 3300048925 Bacteria 7947
699 Ga0496122_0016711 3300048925 Bacteria 6916
700 Ga0496123_0001598 3300048926 Bacteria 30746
701 Ga0496123_0012693 3300048926 Bacteria 7151
702 Ga0496123_0019840 3300048926 Bacteria 5278
703 Ga0496123_0037450 3300048926 Bacteria 3424
704 Ga0496123_0051705 3300048926 Bacteria 2734
705 Ga0496123_0068423 3300048926 Bacteria 2236
706 Ga0496124_0000840 3300048927 Bacteria 50101
707 Ga0496124_0000893 3300048927 Bacteria 48172
708 Ga0496124_0008226 3300048927 Bacteria 10940
709 Ga0496124_0008239 3300048927 Bacteria 10930
710 Ga0496124_0033579 3300048927 Bacteria 4512
711 Ga0496124_0166034 3300048927 Bacteria 1715
712 Ga0496124_0171850 3300048927 Bacteria 1677
713 Ga0496125_0000795 3300048928 Bacteria 51440
714 Ga0496125_0006055 3300048928 Bacteria 13220
715 Ga0496125_0017297 3300048928 Bacteria 6883
716 Ga0496125_0042716 3300048928 Bacteria 3857
717 Ga0496125_0049534 3300048928 Bacteria 3490
718 Ga0496125_0060411 3300048928 Bacteria 3046
719 Ga0496125_0063681 3300048928 Bacteria 2938
720 Ga0496126_0052243 3300048929 Bacteria 3715
721 Ga0496126_0105529 3300048929 Bacteria 2460
722 Ga0496126_0194845 3300048929 Bacteria 1714
723 Ga0495678_001288 3300049459 Bacteria 20269
724 Ga0495682_0000948 3300049460 Bacteria 17553
725 Ga0495682_0006512 3300049460 Bacteria 4719
726 Ga0495682_0012133 3300049460 Bacteria 3309
727 Ga0501031_0025683 3300049568 Bacteria 3842
728 Ga0501031_0026082 3300049568 Bacteria 3811
729 Ga0501032_0003271 3300049569 Bacteria 12472
730 Ga0501032_0044660 3300049569 Bacteria 2999
731 Ga0501033_0000329 3300049570 Bacteria 45324
732 Ga0501033_0005967 3300049570 Bacteria 9560
733 Ga0501033_0007277 3300049570 Bacteria 8632
734 Ga0501033_0020764 3300049570 Bacteria 4962
735 Ga0501033_0046423 3300049570 Bacteria 3229
736 Ga0501033_0141220 3300049570 Bacteria 1741
737 Ga0501034_0001661 3300049571 Bacteria 28667
738 Ga0501034_0002728 3300049571 Bacteria 20777
739 Ga0501034_0006794 3300049571 Bacteria 12236
740 Ga0501034_0007130 3300049571 Bacteria 11923
741 Ga0501034_0019091 3300049571 Bacteria 7019
742 Ga0501034_0045078 3300049571 Bacteria 4458
743 Ga0501034_0055591 3300049571 Bacteria 3983
744 Ga0501034_0165077 3300049571 Bacteria 2183
745 Ga0501034_0217390 3300049571 Bacteria 1864
746 Ga0501036_0005648 3300049572 Bacteria 10147
747 Ga0501036_0034329 3300049572 Bacteria 4291
748 Ga0501036_0040661 3300049572 Bacteria 3933
749 Ga0501036_0056274 3300049572 Bacteria 3332
750 Ga0501036_0190923 3300049572 Bacteria 1723
751 Ga0501037_0007353 3300049573 Bacteria 8055
752 Ga0501037_0103843 3300049573 Bacteria 2049
753 Ga0501037_0156826 3300049573 Bacteria 1624
754 Ga0501038_0002332 3300049574 Bacteria 17683
755 Ga0501038_0018266 3300049574 Bacteria 6330
756 Ga0501038_0038294 3300049574 Bacteria 4200
757 Ga0501038_0060216 3300049574 Bacteria 3249
758 Ga0501038_0109918 3300049574 Bacteria 2284
759 Ga0501039_0003401 3300049575 Bacteria 11893
760 Ga0501039_0004998 3300049575 Bacteria 10064
761 Ga0501040_0099063 3300049576 Bacteria 2032
762 Ga0501042_0046076 3300049578 Bacteria 3109
763 Ga0501043_0046282 3300049579 Bacteria 3421
764 Ga0501046_0016750 3300049580 Bacteria 6127
765 Ga0501046_0021887 3300049580 Bacteria 5270
766 Ga0501046_0030737 3300049580 Bacteria 4357
767 Ga0501046_0043592 3300049580 Bacteria 3571
768 Ga0501046_0098393 3300049580 Bacteria 2246
769 Ga0501046_0109128 3300049580 Bacteria 2116
770 Ga0501047_0000925 3300049581 Bacteria 30036
771 Ga0501047_0005009 3300049581 Bacteria 12432
772 Ga0501047_0009424 3300049581 Bacteria 9225
773 Ga0501047_0016805 3300049581 Bacteria 6991
774 Ga0501047_0028672 3300049581 Bacteria 5369
775 Ga0501047_0041719 3300049581 Bacteria 4433
776 Ga0501047_0128123 3300049581 Bacteria 2418
777 Ga0501047_0217257 3300049581 Bacteria 1768
778 Ga0501048_0011325 3300049582 Bacteria 6651
779 Ga0501048_0084586 3300049582 Bacteria 2237
780 Ga0501067_0000156 3300049583 Bacteria 37946
781 Ga0501067_0015309 3300049583 Bacteria 4244
782 Ga0501068_0001884 3300049584 Bacteria 11164
783 Ga0501068_0012805 3300049584 Bacteria 4762
784 Ga0501068_0103539 3300049584 Bacteria 1765
785 Ga0501069_0000829 3300049585 Bacteria 14614
786 Ga0501069_0005548 3300049585 Bacteria 6570
787 Ga0501069_0024160 3300049585 Bacteria 3315
788 Ga0501069_0147448 3300049585 Bacteria 1351
789 Ga0501070_0000105 3300049586 Bacteria 73931
790 Ga0501070_0005394 3300049586 Bacteria 10905
791 Ga0501070_0011632 3300049586 Bacteria 7429
792 Ga0501070_0015227 3300049586 Bacteria 6473
793 Ga0501070_0025592 3300049586 Bacteria 4949
794 Ga0501070_0037811 3300049586 Bacteria 4028
795 Ga0501070_0232991 3300049586 Bacteria 1508
796 Ga0501071_0080680 3300049587 Bacteria 2379
797 Ga0501071_0088189 3300049587 Bacteria 2276
798 Ga0501072_0000722 3300049588 Bacteria 24035
799 Ga0501072_0048402 3300049588 Bacteria 3348
800 Ga0501073_0000305 3300049589 Bacteria 32450
801 Ga0501073_0002931 3300049589 Bacteria 12802
802 Ga0501073_0006743 3300049589 Bacteria 8548
803 Ga0501073_0089506 3300049589 Bacteria 2140
804 Ga0501074_0006157 3300049590 Bacteria 8664
805 Ga0501074_0008079 3300049590 Bacteria 7623
806 Ga0501074_0011517 3300049590 Bacteria 6430
807 Ga0501074_0031601 3300049590 Bacteria 3835
808 Ga0501079_0065327 3300049741 Bacteria 2806
809 Ga0501080_0000867 3300049742 Bacteria 24781
810 Ga0501080_0002410 3300049742 Bacteria 16318
811 Ga0501080_0004755 3300049742 Bacteria 12111
812 Ga0501080_0015663 3300049742 Bacteria 6991
813 Ga0501080_0027236 3300049742 Bacteria 5316
814 Ga0501080_0037361 3300049742 Bacteria 4535
815 Ga0501080_0365882 3300049742 Bacteria 1301
816 Ga0501081_0045080 3300049743 Bacteria 3028
817 Ga0501083_0001739 3300049744 Bacteria 14853
818 Ga0501083_0093581 3300049744 Bacteria 1984
819 Ga0501035_0009302 3300049822 Bacteria 9131
820 Ga0501035_0025529 3300049822 Bacteria 5416
821 Ga0501035_0032477 3300049822 Bacteria 4749
822 Ga0501035_0032987 3300049822 Bacteria 4709
823 Ga0501035_0051360 3300049822 Bacteria 3692
824 Ga0501035_0060203 3300049822 Bacteria 3381
825 Ga0501035_0142923 3300049822 Bacteria 2079
826 Ga0501035_0224597 3300049822 Bacteria 1602
827 Ga0501035_0228920 3300049822 Bacteria 1584
828 Ga0501044_0006675 3300049823 Bacteria 12721
829 Ga0501044_0028607 3300049823 Bacteria 5882
830 Ga0501044_0042666 3300049823 Bacteria 4716
831 Ga0501044_0062567 3300049823 Bacteria 3804
832 Ga0501044_0072136 3300049823 Bacteria 3511
833 Ga0501044_0109658 3300049823 Bacteria 2769
834 Ga0501044_0141185 3300049823 Bacteria 2397
835 Ga0501045_0150712 3300049824 Bacteria 1730
836 nmdc:mga0sz30_74114_c1 3300050516 Bacteria 1468
837 Ga0500610_0000085 3300053079 Bacteria 28416
838 Ga0500635_0012551 3300053080 Bacteria 2437
839 Ga0500643_000002 3300053087 Bacteria 1277657
840 Ga0500646_0010649 3300053090 Bacteria 2360
841 Ga0500651_0000179 3300053093 Bacteria 41058
842 Ga0500651_0001442 3300053093 Bacteria 11965
843 Ga0500651_0031023 3300053093 Bacteria 3365
844 Ga0500650_0000027 3300053098 Bacteria 59407
845 Ga0500555_001867 3300053103 Bacteria 6265
846 Ga0500597_000841 3300053120 Bacteria 7048
847 Ga0500568_0001481 3300053139 Bacteria 15052
848 Ga0500633_0005906 3300053160 Bacteria 2956
849 Ga0500645_003001 3300053730 Bacteria 7140
850 Ga0501084_0288880 3300054114 Bacteria 1385
851 Ga0500661_004432 3300055283 Bacteria 2625
852 Ga0501082_0000082 3300060353 Bacteria 71065
853 Ga0501082_0103899 3300060353 Bacteria 2458
854 Ga0501082_0122996 3300060353 Bacteria 2250
855 Ga0501082_0173941 3300060353 Bacteria 1872
856 Ga0466962_0004187 3300061719 Bacteria 6910
857 Ga0466962_0009563 3300061719 Bacteria 4649
858 Ga0466962_0017220 3300061719 Bacteria 3481
859 Ga0466962_0024084 3300061719 Bacteria 2925

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300044658 Ga0466972_0103252 Ga0466972_0103252_236_1330 364
2 3300048916 Ga0496113_0216433 Ga0496113_0216433_28_1122 364
3 3300025933 Ga0207706_10021569 Ga0207706_100215692 366
4 3300005367 Ga0070667_100076048 Ga0070667_1000760483 367
5 3300005539 Ga0068853_100000206 Ga0068853_10000020611 367
6 3300005539 Ga0068853_100014698 Ga0068853_1000146986 367
7 3300005563 Ga0068855_100014971 Ga0068855_1000149714 367
8 3300005577 Ga0068857_100039809 Ga0068857_1000398093 367
9 3300009553 Ga0105249_10128256 Ga0105249_101282562 367
10 3300010375 Ga0105239_10003089 Ga0105239_100030898 367
11 3300025986 Ga0207658_10102787 Ga0207658_101027872 367
12 3300026041 Ga0207639_10000230 Ga0207639_1000023016 367
13 3300026041 Ga0207639_10012848 Ga0207639_100128482 367
14 3300026088 Ga0207641_10049188 Ga0207641_100491884 367
15 3300026116 Ga0207674_10015842 Ga0207674_100158426 367
16 3300041494 Ga0451837_0542554 Ga0451837_0542554_562_1710 367
17 3300049568 Ga0501031_0026082 Ga0501031_0026082_962_2110 367
18 3300049569 Ga0501032_0003271 Ga0501032_0003271_3758_4906 367
19 3300049570 Ga0501033_0005967 Ga0501033_0005967_8109_9257 367
20 3300049571 Ga0501034_0001661 Ga0501034_0001661_8141_9289 367
21 3300049572 Ga0501036_0056274 Ga0501036_0056274_447_1595 367
22 3300049573 Ga0501037_0103843 Ga0501037_0103843_330_1478 367
23 3300049574 Ga0501038_0018266 Ga0501038_0018266_1808_2956 367
24 3300049575 Ga0501039_0004998 Ga0501039_0004998_6130_7278 367
25 3300049581 Ga0501047_0009424 Ga0501047_0009424_278_1426 367
26 3300049589 Ga0501073_0002931 Ga0501073_0002931_8289_9437 367
27 3300049822 Ga0501035_0032987 Ga0501035_0032987_3360_4508 367
28 3300049823 Ga0501044_0042666 Ga0501044_0042666_202_1350 367
29 3300053093 Ga0500651_0001442 Ga0500651_0001442_2290_3438 367
30 3300053079 Ga0500610_0000085 Ga0500610_0000085_266_1414 368
31 3300049584 Ga0501068_0103539 Ga0501068_0103539_449_1591 369
32 3300049587 Ga0501071_0088189 Ga0501071_0088189_425_1567 369
33 3300049824 Ga0501045_0150712 Ga0501045_0150712_104_1246 369
34 3300060353 Ga0501082_0103899 Ga0501082_0103899_964_2106 369
35 3300049580 Ga0501046_0109128 Ga0501046_0109128_944_2086 371
36 3300049743 Ga0501081_0045080 Ga0501081_0045080_536_1678 371
37 3300049589 Ga0501073_0006743 Ga0501073_0006743_2687_3814 374
38 3300049586 Ga0501070_0232991 Ga0501070_0232991_13_1140 375
39 iso_pu_bacteria 2643221577 2643894964 376
40 iso_pu_bacteria 2643221685 2644477122 376
41 iso_pu_bacteria 2576861471 2578457767 377
42 iso_pu_bacteria 2593339238 2595446321 377
43 iso_pu_bacteria 2593339239 2595452250 377
44 iso_pu_bacteria 2718218334 2721027243 377
45 iso_pu_bacteria 2734482264 2735837164 377
46 iso_pu_bacteria 2738543009 2739226622 377
47 iso_pu_bacteria 2739367700 2739731521 377
48 iso_pu_bacteria 2747842428 2747949148 377
49 iso_pu_bacteria 2765235840 2765579726 377
50 iso_pu_bacteria 2818991440 2819562905 377
51 iso_pu_bacteria 2818991457 2819659901 377
52 iso_pu_bacteria 2842757796 2842760070 377
53 iso_pu_bacteria 2842914999 2842916602 377
54 iso_pu_bacteria 2842918807 2842919054 377
55 iso_pu_bacteria 2852684882 2852685271 377
56 iso_pu_bacteria 2857442823 2857446126 377
57 iso_pu_bacteria 2874220319 2874222421 377
58 iso_pu_bacteria 2884338543 2884340669 377
59 iso_pu_bacteria 2884411467 2884414932 377
60 iso_pu_bacteria 2904463128 2904463517 377
61 iso_pu_bacteria 2919085039 2919085268 377
62 iso_pu_bacteria 2919089067 2919090359 377
63 iso_pu_bacteria 2919130084 2919131392 377
64 iso_pu_bacteria 2919404418 2919405599 377
65 iso_pu_bacteria 2928496128 2928497746 377
66 iso_pu_bacteria 2928963466 2928967608 377
67 iso_pu_bacteria 2929195423 2929198186 377
68 iso_pu_bacteria 2931380184 2931384123 377
69 iso_pu_bacteria 2937610967 2937614714 377
70 iso_pu_bacteria 2939589442 2939590948 377
71 iso_pu_bacteria 2939611941 2939612215 377
72 iso_pu_bacteria 2939622612 2939625549 377
73 iso_pu_bacteria 2939626828 2939630600 377
74 iso_pu_bacteria 2941471342 2941471380 377
75 iso_pu_bacteria 2953994433 2953994665 377
76 iso_pu_bacteria 2961047084 2961049186 377
77 iso_pu_bacteria 2974307012 2974308378 377
78 iso_pu_bacteria 2977247770 2977249135 377
79 iso_pu_bacteria 2984514374 2984516413 377
80 3300028794 Ga0307515_10164507 Ga0307515_101645072 378
81 3300042132 Ga0450895_000548 Ga0450895_000548_842_1999 379
82 3300042133 Ga0450896_000078 Ga0450896_000078_4928_6085 379
83 3300042146 Ga0450907_003204 Ga0450907_003204_1095_2252 379
84 3300042531 Ga0450918_004985 Ga0450918_004985_799_1956 379
85 3300005337 Ga0070682_100016224 Ga0070682_1000162242 380
86 3300005366 Ga0070659_100020340 Ga0070659_1000203402 380
87 3300005435 Ga0070714_100001173 Ga0070714_1000011737 380
88 3300005457 Ga0070662_100087991 Ga0070662_1000879911 380
89 3300005530 Ga0070679_100231057 Ga0070679_1002310571 380
90 3300005614 Ga0068856_100174181 Ga0068856_1001741812 380
91 3300010375 Ga0105239_10027103 Ga0105239_100271034 380
92 3300020082 Ga0206353_11265797 Ga0206353_112657972 380
93 3300025904 Ga0207647_10007991 Ga0207647_100079918 380
94 3300025912 Ga0207707_10003426 Ga0207707_100034264 380
95 3300025919 Ga0207657_10015540 Ga0207657_100155407 380
96 3300025929 Ga0207664_10000126 Ga0207664_1000012644 380
97 3300025932 Ga0207690_10000266 Ga0207690_1000026620 380
98 3300025932 Ga0207690_10011293 Ga0207690_100112932 380
99 3300025933 Ga0207706_10017013 Ga0207706_100170132 380
100 3300049571 Ga0501034_0045078 Ga0501034_0045078_168_1310 380
101 3300049580 Ga0501046_0021887 Ga0501046_0021887_933_2075 380
102 3300049581 Ga0501047_0128123 Ga0501047_0128123_436_1578 380
103 3300001904 JGI24736J21556_1004702 JGI24736J21556_10047022 381
104 3300001915 JGI24741J21665_1000222 JGI24741J21665_100022211 381
105 3300001915 JGI24741J21665_1004101 JGI24741J21665_10041011 381
106 3300001915 JGI24741J21665_1005082 JGI24741J21665_10050822 381
107 3300001979 JGI24740J21852_10001834 JGI24740J21852_100018344 381
108 3300001979 JGI24740J21852_10002844 JGI24740J21852_100028448 381
109 3300001979 JGI24740J21852_10005375 JGI24740J21852_100053755 381
110 3300001989 JGI24739J22299_10000752 JGI24739J22299_100007524 381
111 3300001990 JGI24737J22298_10000922 JGI24737J22298_100009223 381
112 3300002067 JGI24735J21928_10003438 JGI24735J21928_100034387 381
113 3300002067 JGI24735J21928_10007930 JGI24735J21928_100079304 381
114 3300002705 JGI25156J39149_1005799 JGI25156J39149_10057993 381
115 3300002737 JGI25162J39368_1000048 JGI25162J39368_1000048123 381
116 3300002737 JGI25162J39368_1000665 JGI25162J39368_10006655 381
117 3300002737 JGI25162J39368_1000810 JGI25162J39368_10008104 381
118 3300002737 JGI25162J39368_1001000 JGI25162J39368_10010001 381
119 3300002737 JGI25162J39368_1003917 JGI25162J39368_10039174 381
120 3300002741 JGI25157J39369_1000269 JGI25157J39369_100026914 381
121 3300002741 JGI25157J39369_1000582 JGI25157J39369_100058221 381
122 3300002741 JGI25157J39369_1001539 JGI25157J39369_10015392 381
123 3300002741 JGI25157J39369_1002682 JGI25157J39369_10026824 381
124 3300002771 JGI25163J39215_1000651 JGI25163J39215_10006515 381
125 3300002772 JGI25164J39214_1000085 JGI25164J39214_100008571 381
126 3300002772 JGI25164J39214_1000284 JGI25164J39214_100028432 381
127 3300003214 JGI25165J46597_1000009 JGI25165J46597_1000009320 381
128 3300003214 JGI25165J46597_1000090 JGI25165J46597_1000090148 381
129 3300003215 JGI25153J46596_10017182 JGI25153J46596_100171822 381
130 3300003578 Ga0006562J51391_1191774 Ga0006562J51391_11917746 381
131 3300003578 Ga0006562J51391_1191776 Ga0006562J51391_11917762 381
132 3300003751 Ga0055538_1002276 Ga0055538_10022762 381
133 3300003752 Ga0055539_1000667 Ga0055539_100066711 381
134 3300003756 Ga0055533_1000487 Ga0055533_100048715 381
135 3300003756 Ga0055533_1001318 Ga0055533_10013182 381
136 3300003759 Ga0055525_1000097 Ga0055525_1000097115 381
137 3300003760 Ga0055527_1000677 Ga0055527_10006774 381
138 3300003760 Ga0055527_1000689 Ga0055527_10006893 381
139 3300003760 Ga0055527_1001726 Ga0055527_10017264 381
140 3300003761 Ga0055535_1000016 Ga0055535_1000016173 381
141 3300003761 Ga0055535_1001167 Ga0055535_100116714 381
142 3300003761 Ga0055535_1001556 Ga0055535_10015566 381
143 3300003761 Ga0055535_1001670 Ga0055535_10016708 381
144 3300003761 Ga0055535_1001681 Ga0055535_10016814 381
145 3300003761 Ga0055535_1001685 Ga0055535_10016858 381
146 3300003762 Ga0055542_1000045 Ga0055542_1000045122 381
147 3300003762 Ga0055542_1000098 Ga0055542_100009876 381
148 3300003762 Ga0055542_1001145 Ga0055542_10011456 381
149 3300003762 Ga0055542_1001620 Ga0055542_10016204 381
150 3300003762 Ga0055542_1001628 Ga0055542_10016284 381
151 3300003762 Ga0055542_1001632 Ga0055542_10016328 381
152 3300003763 Ga0055529_1000020 Ga0055529_1000020136 381
153 3300003763 Ga0055529_1001211 Ga0055529_10012114 381
154 3300003763 Ga0055529_1001215 Ga0055529_10012154 381
155 3300003763 Ga0055529_1001245 Ga0055529_10012457 381
156 3300003771 Ga0055526_1000263 Ga0055526_10002634 381
157 3300003771 Ga0055526_1002377 Ga0055526_100237713 381
158 3300003773 Ga0055537_1000164 Ga0055537_100016423 381
159 3300003775 Ga0055524_1016320 Ga0055524_10163201 381
160 3300003781 Ga0055536_1001874 Ga0055536_100187410 381
161 3300003784 Ga0055534_1000026 Ga0055534_100002657 381
162 3300003791 Ga0055530_10000772 Ga0055530_100007725 381
163 3300003856 Ga0058692_1000006 Ga0058692_1000006210 381
164 3300003856 Ga0058692_1000012 Ga0058692_1000012121 381
165 3300005262 Ga0065165_1000001 Ga0065165_1000001183 381
166 3300005262 Ga0065165_1000940 Ga0065165_100094027 381
167 3300005327 Ga0070658_10002041 Ga0070658_100020418 381
168 3300005327 Ga0070658_10068626 Ga0070658_100686262 381
169 3300005327 Ga0070658_10133566 Ga0070658_101335661 381
170 3300005330 Ga0070690_100110876 Ga0070690_1001108762 381
171 3300005331 Ga0070670_100000002 Ga0070670_100000002317 381
172 3300005331 Ga0070670_100145951 Ga0070670_1001459512 381
173 3300005334 Ga0068869_100037648 Ga0068869_1000376481 381
174 3300005335 Ga0070666_10000034 Ga0070666_1000003491 381
175 3300005335 Ga0070666_10000349 Ga0070666_1000034933 381
176 3300005335 Ga0070666_10004505 Ga0070666_100045054 381
177 3300005335 Ga0070666_10006812 Ga0070666_100068122 381
178 3300005335 Ga0070666_10026150 Ga0070666_100261502 381
179 3300005336 Ga0070680_100000209 Ga0070680_10000020915 381
180 3300005336 Ga0070680_100001172 Ga0070680_1000011724 381
181 3300005336 Ga0070680_100095324 Ga0070680_1000953242 381
182 3300005337 Ga0070682_100023562 Ga0070682_1000235622 381
183 3300005339 Ga0070660_100071018 Ga0070660_1000710182 381
184 3300005339 Ga0070660_100076743 Ga0070660_1000767432 381
185 3300005341 Ga0070691_10009542 Ga0070691_100095424 381
186 3300005344 Ga0070661_100001611 Ga0070661_1000016113 381
187 3300005344 Ga0070661_100006432 Ga0070661_1000064322 381
188 3300005344 Ga0070661_100008490 Ga0070661_1000084908 381
189 3300005344 Ga0070661_100043425 Ga0070661_1000434252 381
190 3300005345 Ga0070692_10001030 Ga0070692_100010307 381
191 3300005347 Ga0070668_100020437 Ga0070668_1000204373 381
192 3300005347 Ga0070668_100096721 Ga0070668_1000967212 381
193 3300005347 Ga0070668_100201816 Ga0070668_1002018161 381
194 3300005353 Ga0070669_100008381 Ga0070669_1000083815 381
195 3300005353 Ga0070669_100210889 Ga0070669_1002108891 381
196 3300005354 Ga0070675_100198263 Ga0070675_1001982632 381
197 3300005355 Ga0070671_100000071 Ga0070671_10000007123 381
198 3300005356 Ga0070674_100194024 Ga0070674_1001940242 381
199 3300005366 Ga0070659_100079503 Ga0070659_1000795032 381
200 3300005367 Ga0070667_100000005 Ga0070667_10000000530 381
201 3300005367 Ga0070667_100000007 Ga0070667_100000007185 381
202 3300005367 Ga0070667_100120315 Ga0070667_1001203152 381
203 3300005436 Ga0070713_100000486 Ga0070713_10000048622 381
204 3300005455 Ga0070663_100009827 Ga0070663_1000098273 381
205 3300005455 Ga0070663_100019628 Ga0070663_1000196283 381
206 3300005455 Ga0070663_100021767 Ga0070663_1000217672 381
207 3300005455 Ga0070663_100058261 Ga0070663_1000582611 381
208 3300005455 Ga0070663_100080133 Ga0070663_1000801332 381
209 3300005456 Ga0070678_100012770 Ga0070678_1000127702 381
210 3300005456 Ga0070678_100033970 Ga0070678_1000339704 381
211 3300005456 Ga0070678_100086612 Ga0070678_1000866121 381
212 3300005457 Ga0070662_100023627 Ga0070662_1000236274 381
213 3300005458 Ga0070681_10000007 Ga0070681_1000000726 381
214 3300005458 Ga0070681_10000397 Ga0070681_1000039710 381
215 3300005458 Ga0070681_10000998 Ga0070681_1000099815 381
216 3300005458 Ga0070681_10017959 Ga0070681_100179593 381
217 3300005459 Ga0068867_100005929 Ga0068867_1000059292 381
218 3300005466 Ga0070685_10000275 Ga0070685_100002756 381
219 3300005530 Ga0070679_100000412 Ga0070679_10000041225 381
220 3300005530 Ga0070679_100004197 Ga0070679_10000419712 381
221 3300005530 Ga0070679_100014507 Ga0070679_1000145078 381
222 3300005530 Ga0070679_100084989 Ga0070679_1000849892 381
223 3300005530 Ga0070679_100109154 Ga0070679_1001091542 381
224 3300005539 Ga0068853_100003817 Ga0068853_1000038173 381
225 3300005539 Ga0068853_100010874 Ga0068853_1000108746 381
226 3300005539 Ga0068853_100013551 Ga0068853_1000135515 381
227 3300005539 Ga0068853_100013620 Ga0068853_1000136207 381
228 3300005539 Ga0068853_100071311 Ga0068853_1000713111 381
229 3300005546 Ga0070696_100041500 Ga0070696_1000415003 381
230 3300005546 Ga0070696_100090932 Ga0070696_1000909322 381
231 3300005546 Ga0070696_100217777 Ga0070696_1002177771 381
232 3300005547 Ga0070693_100011214 Ga0070693_1000112145 381
233 3300005548 Ga0070665_100000057 Ga0070665_100000057238 381
234 3300005548 Ga0070665_100000227 Ga0070665_10000022732 381
235 3300005548 Ga0070665_100034667 Ga0070665_1000346676 381
236 3300005548 Ga0070665_100049290 Ga0070665_1000492905 381
237 3300005548 Ga0070665_100083170 Ga0070665_1000831701 381
238 3300005548 Ga0070665_100098700 Ga0070665_1000987003 381
239 3300005548 Ga0070665_100102185 Ga0070665_1001021852 381
240 3300005548 Ga0070665_100113007 Ga0070665_1001130074 381
241 3300005548 Ga0070665_100122132 Ga0070665_1001221322 381
242 3300005563 Ga0068855_100003573 Ga0068855_1000035737 381
243 3300005563 Ga0068855_100004858 Ga0068855_1000048587 381
244 3300005563 Ga0068855_100012573 Ga0068855_1000125734 381
245 3300005563 Ga0068855_100120621 Ga0068855_1001206212 381
246 3300005564 Ga0070664_100092394 Ga0070664_1000923943 381
247 3300005577 Ga0068857_100001801 Ga0068857_10000180111 381
248 3300005577 Ga0068857_100057497 Ga0068857_1000574972 381
249 3300005578 Ga0068854_100000774 Ga0068854_10000077416 381
250 3300005578 Ga0068854_100005461 Ga0068854_1000054616 381
251 3300005578 Ga0068854_100009017 Ga0068854_1000090175 381
252 3300005578 Ga0068854_100197937 Ga0068854_1001979372 381
253 3300005614 Ga0068856_100000310 Ga0068856_10000031022 381
254 3300005614 Ga0068856_100001563 Ga0068856_10000156311 381
255 3300005614 Ga0068856_100128167 Ga0068856_1001281673 381
256 3300005614 Ga0068856_100147658 Ga0068856_1001476582 381
257 3300005616 Ga0068852_100006743 Ga0068852_1000067434 381
258 3300005616 Ga0068852_100010358 Ga0068852_1000103584 381
259 3300005616 Ga0068852_100015345 Ga0068852_1000153456 381
260 3300005616 Ga0068852_100016190 Ga0068852_1000161903 381
261 3300005616 Ga0068852_100100870 Ga0068852_1001008702 381
262 3300005617 Ga0068859_100001188 Ga0068859_1000011884 381
263 3300005617 Ga0068859_100087241 Ga0068859_1000872412 381
264 3300005617 Ga0068859_100089097 Ga0068859_1000890972 381
265 3300005617 Ga0068859_100134405 Ga0068859_1001344053 381
266 3300005618 Ga0068864_100000003 Ga0068864_100000003323 381
267 3300005719 Ga0068861_100079415 Ga0068861_1000794153 381
268 3300005834 Ga0068851_10001367 Ga0068851_100013672 381
269 3300005834 Ga0068851_10004040 Ga0068851_100040406 381
270 3300005834 Ga0068851_10004918 Ga0068851_100049186 381
271 3300005841 Ga0068863_100000773 Ga0068863_10000077316 381
272 3300005841 Ga0068863_100286884 Ga0068863_1002868841 381
273 3300005842 Ga0068858_100042553 Ga0068858_1000425531 381
274 3300005842 Ga0068858_100187011 Ga0068858_1001870112 381
275 3300005843 Ga0068860_100004261 Ga0068860_1000042616 381
276 3300005844 Ga0068862_100000548 Ga0068862_1000005483 381
277 3300005844 Ga0068862_100005287 Ga0068862_1000052873 381
278 3300005844 Ga0068862_100255905 Ga0068862_1002559052 381
279 3300005844 Ga0068862_100292956 Ga0068862_1002929562 381
280 3300005983 Ga0081540_1003991 Ga0081540_10039913 381
281 3300006051 Ga0075364_10131251 Ga0075364_101312512 381
282 3300006186 Ga0075369_10004497 Ga0075369_100044972 381
283 3300006237 Ga0097621_100029605 Ga0097621_1000296053 381
284 3300006237 Ga0097621_100111918 Ga0097621_1001119182 381
285 3300006847 Ga0075431_100069913 Ga0075431_1000699132 381
286 3300006881 Ga0068865_100009828 Ga0068865_1000098284 381
287 3300006881 Ga0068865_100048270 Ga0068865_1000482701 381
288 3300006931 Ga0097620_100001188 Ga0097620_1000011884 381
289 3300006931 Ga0097620_100087241 Ga0097620_1000872412 381
290 3300006931 Ga0097620_100089103 Ga0097620_1000891031 381
291 3300006931 Ga0097620_100134403 Ga0097620_1001344033 381
292 3300009011 Ga0105251_10007635 Ga0105251_100076352 381
293 3300009093 Ga0105240_10004166 Ga0105240_100041665 381
294 3300009093 Ga0105240_10092908 Ga0105240_100929082 381
295 3300009093 Ga0105240_10096470 Ga0105240_100964704 381
296 3300009093 Ga0105240_10097179 Ga0105240_100971792 381
297 3300009093 Ga0105240_10109408 Ga0105240_101094083 381
298 3300009093 Ga0105240_10115149 Ga0105240_101151492 381
299 3300009093 Ga0105240_10298749 Ga0105240_102987492 381
300 3300009098 Ga0105245_10090266 Ga0105245_100902662 381
301 3300009101 Ga0105247_10011228 Ga0105247_100112282 381
302 3300009148 Ga0105243_10057514 Ga0105243_100575142 381
303 3300009174 Ga0105241_10003106 Ga0105241_100031063 381
304 3300009174 Ga0105241_10005656 Ga0105241_100056568 381
305 3300009174 Ga0105241_10162852 Ga0105241_101628522 381
306 3300009176 Ga0105242_10404173 Ga0105242_104041732 381
307 3300009177 Ga0105248_10001462 Ga0105248_1000146228 381
308 3300009177 Ga0105248_10198295 Ga0105248_101982951 381
309 3300009545 Ga0105237_10000250 Ga0105237_1000025074 381
310 3300009545 Ga0105237_10000701 Ga0105237_1000070133 381
311 3300009545 Ga0105237_10002972 Ga0105237_100029727 381
312 3300009551 Ga0105238_10001647 Ga0105238_1000164712 381
313 3300009551 Ga0105238_10003680 Ga0105238_100036804 381
314 3300009551 Ga0105238_10010010 Ga0105238_100100105 381
315 3300009551 Ga0105238_10034239 Ga0105238_100342392 381
316 3300009551 Ga0105238_10128450 Ga0105238_101284502 381
317 3300009551 Ga0105238_10196202 Ga0105238_101962022 381
318 3300009551 Ga0105238_10299083 Ga0105238_102990832 381
319 3300009553 Ga0105249_10000763 Ga0105249_1000076312 381
320 3300009553 Ga0105249_10009268 Ga0105249_100092689 381
321 3300010375 Ga0105239_10011101 Ga0105239_100111016 381
322 3300010375 Ga0105239_10044717 Ga0105239_100447173 381
323 3300010375 Ga0105239_10076582 Ga0105239_100765824 381
324 3300010375 Ga0105239_10109250 Ga0105239_101092502 381
325 3300013100 Ga0157373_10057570 Ga0157373_100575702 381
326 3300013100 Ga0157373_10210362 Ga0157373_102103621 381
327 3300013100 Ga0157373_10210593 Ga0157373_102105931 381
328 3300013102 Ga0157371_10000400 Ga0157371_1000040038 381
329 3300013102 Ga0157371_10005810 Ga0157371_1000581010 381
330 3300013102 Ga0157371_10020709 Ga0157371_100207096 381
331 3300013102 Ga0157371_10098820 Ga0157371_100988202 381
332 3300013104 Ga0157370_10000204 Ga0157370_1000020421 381
333 3300013104 Ga0157370_10006775 Ga0157370_100067758 381
334 3300013104 Ga0157370_10065744 Ga0157370_100657442 381
335 3300013104 Ga0157370_10157804 Ga0157370_101578042 381
336 3300013105 Ga0157369_10004267 Ga0157369_1000426711 381
337 3300013105 Ga0157369_10014816 Ga0157369_100148165 381
338 3300013105 Ga0157369_10108550 Ga0157369_101085502 381
339 3300013105 Ga0157369_10361418 Ga0157369_103614182 381
340 3300013296 Ga0157374_10009835 Ga0157374_100098354 381
341 3300013297 Ga0157378_10000742 Ga0157378_1000074227 381
342 3300013306 Ga0163162_10000106 Ga0163162_1000010668 381
343 3300013306 Ga0163162_10033814 Ga0163162_100338142 381
344 3300013306 Ga0163162_10053513 Ga0163162_100535132 381
345 3300013307 Ga0157372_10000445 Ga0157372_1000044526 381
346 3300013307 Ga0157372_10003420 Ga0157372_100034205 381
347 3300013307 Ga0157372_10007949 Ga0157372_100079496 381
348 3300013307 Ga0157372_10043583 Ga0157372_100435833 381
349 3300013307 Ga0157372_10065011 Ga0157372_100650114 381
350 3300013307 Ga0157372_10068579 Ga0157372_100685792 381
351 3300013308 Ga0157375_10003145 Ga0157375_1000314513 381
352 3300013308 Ga0157375_10074274 Ga0157375_100742742 381
353 3300014325 Ga0163163_10000031 Ga0163163_1000003146 381
354 3300014325 Ga0163163_10000863 Ga0163163_100008635 381
355 3300014325 Ga0163163_10013489 Ga0163163_100134894 381
356 3300014325 Ga0163163_10089563 Ga0163163_100895632 381
357 3300014497 Ga0182008_10000123 Ga0182008_1000012337 381
358 3300014497 Ga0182008_10001033 Ga0182008_100010337 381
359 3300014968 Ga0157379_10004344 Ga0157379_100043444 381
360 3300014968 Ga0157379_10039177 Ga0157379_100391772 381
361 3300014969 Ga0157376_10001616 Ga0157376_1000161611 381
362 3300014969 Ga0157376_10023869 Ga0157376_100238693 381
363 3300015261 Ga0182006_1000005 Ga0182006_1000005261 381
364 3300015261 Ga0182006_1002024 Ga0182006_10020243 381
365 3300015262 Ga0182007_10006316 Ga0182007_100063163 381
366 3300015265 Ga0182005_1000004 Ga0182005_1000004340 381
367 3300015265 Ga0182005_1000611 Ga0182005_10006118 381
368 3300015265 Ga0182005_1001305 Ga0182005_10013058 381
369 3300015265 Ga0182005_1005449 Ga0182005_10054493 381
370 3300015687 Ga0183368_1004 Ga0183368_1004983 381
371 3300017792 Ga0163161_10001879 Ga0163161_1000187912 381
372 3300017792 Ga0163161_10002326 Ga0163161_100023268 381
373 3300017792 Ga0163161_10004817 Ga0163161_100048173 381
374 3300020080 Ga0206350_11099119 Ga0206350_110991191 381
375 3300020610 Ga0154015_1194426 Ga0154015_11944263 381
376 3300020610 Ga0154015_1205975 Ga0154015_12059753 381
377 3300022467 Ga0224712_10026609 Ga0224712_100266092 381
378 3300025224 Ga0209784_100013 Ga0209784_100013184 381
379 3300025226 Ga0209674_100062 Ga0209674_100062146 381
380 3300025226 Ga0209674_100108 Ga0209674_100108108 381
381 3300025226 Ga0209674_100193 Ga0209674_10019333 381
382 3300025226 Ga0209674_100776 Ga0209674_1007762 381
383 3300025226 Ga0209674_102155 Ga0209674_1021552 381
384 3300025228 Ga0209672_100007 Ga0209672_100007249 381
385 3300025228 Ga0209672_100078 Ga0209672_1000784 381
386 3300025228 Ga0209672_100551 Ga0209672_1005514 381
387 3300025230 Ga0209563_100079 Ga0209563_100079114 381
388 3300025231 Ga0207427_100033 Ga0207427_100033294 381
389 3300025231 Ga0207427_100073 Ga0207427_100073115 381
390 3300025231 Ga0207427_100112 Ga0207427_10011286 381
391 3300025231 Ga0207427_107381 Ga0207427_1073811 381
392 3300025233 Ga0209437_100012 Ga0209437_100012435 381
393 3300025233 Ga0209437_100020 Ga0209437_10002068 381
394 3300025233 Ga0209437_100105 Ga0209437_100105193 381
395 3300025233 Ga0209437_100151 Ga0209437_100151116 381
396 3300025233 Ga0209437_101420 Ga0209437_1014206 381
397 3300025242 Ga0209258_100012 Ga0209258_100012698 381
398 3300025242 Ga0209258_100019 Ga0209258_100019355 381
399 3300025242 Ga0209258_100046 Ga0209258_10004688 381
400 3300025242 Ga0209258_100582 Ga0209258_10058220 381
401 3300025242 Ga0209258_100600 Ga0209258_10060015 381
402 3300025242 Ga0209258_101514 Ga0209258_1015147 381
403 3300025246 Ga0209646_1000749 Ga0209646_10007497 381
404 3300025246 Ga0209646_1001723 Ga0209646_10017238 381
405 3300025246 Ga0209646_1003294 Ga0209646_10032942 381
406 3300025250 Ga0209026_1000015 Ga0209026_100001579 381
407 3300025250 Ga0209026_1000213 Ga0209026_100021345 381
408 3300025250 Ga0209026_1000381 Ga0209026_100038117 381
409 3300025250 Ga0209026_1001297 Ga0209026_10012976 381
410 3300025253 Ga0209677_100725 Ga0209677_10072511 381
411 3300025254 Ga0209148_1000001 Ga0209148_10000011946 381
412 3300025254 Ga0209148_1000005 Ga0209148_1000005457 381
413 3300025254 Ga0209148_1000013 Ga0209148_1000013673 381
414 3300025254 Ga0209148_1000039 Ga0209148_1000039453 381
415 3300025254 Ga0209148_1000084 Ga0209148_100008442 381
416 3300025254 Ga0209148_1000296 Ga0209148_100029663 381
417 3300025256 Ga0209759_1000462 Ga0209759_100046226 381
418 3300025256 Ga0209759_1000719 Ga0209759_100071928 381
419 3300025256 Ga0209759_1000802 Ga0209759_100080222 381
420 3300025256 Ga0209759_1002655 Ga0209759_10026554 381
421 3300025256 Ga0209759_1007906 Ga0209759_10079063 381
422 3300025258 Ga0209129_1001478 Ga0209129_100147811 381
423 3300025258 Ga0209129_1005121 Ga0209129_10051213 381
424 3300025261 Ga0209233_1000002 Ga0209233_1000002354 381
425 3300025261 Ga0209233_1000020 Ga0209233_1000020557 381
426 3300025261 Ga0209233_1000080 Ga0209233_1000080294 381
427 3300025263 Ga0209565_1000022 Ga0209565_1000022146 381
428 3300025272 Ga0209455_1000010 Ga0209455_1000010249 381
429 3300025272 Ga0209455_1000027 Ga0209455_1000027190 381
430 3300025272 Ga0209455_1000034 Ga0209455_1000034454 381
431 3300025272 Ga0209455_1000126 Ga0209455_1000126156 381
432 3300025272 Ga0209455_1000662 Ga0209455_10006628 381
433 3300025273 Ga0209673_1000110 Ga0209673_1000110110 381
434 3300025291 Ga0209675_1000060 Ga0209675_1000060104 381
435 3300025292 Ga0209676_1000219 Ga0209676_100021930 381
436 3300025292 Ga0209676_1000279 Ga0209676_100027969 381
437 3300025295 Ga0209564_1000304 Ga0209564_100030445 381
438 3300025297 Ga0209758_1002818 Ga0209758_100281818 381
439 3300025297 Ga0209758_1005835 Ga0209758_10058359 381
440 3300025298 Ga0209050_1000542 Ga0209050_100054237 381
441 3300025298 Ga0209050_1000825 Ga0209050_100082518 381
442 3300025298 Ga0209050_1022520 Ga0209050_10225201 381
443 3300025299 Ga0209256_1007442 Ga0209256_10074424 381
444 3300025299 Ga0209256_1008983 Ga0209256_10089832 381
445 3300025303 Ga0209051_1012166 Ga0209051_10121662 381
446 3300025304 Ga0209257_1000726 Ga0209257_100072616 381
447 3300025321 Ga0207656_10010701 Ga0207656_100107012 381
448 3300025321 Ga0207656_10017871 Ga0207656_100178712 381
449 3300025735 Ga0207713_1034419 Ga0207713_10344192 381
450 3300025900 Ga0207710_10079395 Ga0207710_100793952 381
451 3300025903 Ga0207680_10000005 Ga0207680_10000005267 381
452 3300025904 Ga0207647_10000056 Ga0207647_1000005624 381
453 3300025904 Ga0207647_10000213 Ga0207647_1000021317 381
454 3300025904 Ga0207647_10000229 Ga0207647_100002298 381
455 3300025904 Ga0207647_10004577 Ga0207647_1000457710 381
456 3300025904 Ga0207647_10005182 Ga0207647_100051826 381
457 3300025909 Ga0207705_10000128 Ga0207705_1000012869 381
458 3300025909 Ga0207705_10002200 Ga0207705_100022005 381
459 3300025909 Ga0207705_10003255 Ga0207705_100032552 381
460 3300025909 Ga0207705_10016797 Ga0207705_100167973 381
461 3300025911 Ga0207654_10000126 Ga0207654_1000012633 381
462 3300025911 Ga0207654_10012493 Ga0207654_100124932 381
463 3300025911 Ga0207654_10146572 Ga0207654_101465721 381
464 3300025912 Ga0207707_10000665 Ga0207707_1000066510 381
465 3300025912 Ga0207707_10000699 Ga0207707_100006993 381
466 3300025912 Ga0207707_10001116 Ga0207707_1000111624 381
467 3300025912 Ga0207707_10001210 Ga0207707_1000121014 381
468 3300025912 Ga0207707_10005504 Ga0207707_100055047 381
469 3300025912 Ga0207707_10007116 Ga0207707_100071161 381
470 3300025913 Ga0207695_10000094 Ga0207695_1000009457 381
471 3300025913 Ga0207695_10000869 Ga0207695_1000086927 381
472 3300025913 Ga0207695_10001748 Ga0207695_1000174828 381
473 3300025913 Ga0207695_10003671 Ga0207695_1000367111 381
474 3300025913 Ga0207695_10004041 Ga0207695_1000404112 381
475 3300025913 Ga0207695_10052537 Ga0207695_100525374 381
476 3300025913 Ga0207695_10101736 Ga0207695_101017362 381
477 3300025913 Ga0207695_10147442 Ga0207695_101474422 381
478 3300025914 Ga0207671_10000050 Ga0207671_10000050153 381
479 3300025914 Ga0207671_10000116 Ga0207671_1000011657 381
480 3300025914 Ga0207671_10003678 Ga0207671_100036783 381
481 3300025914 Ga0207671_10007188 Ga0207671_100071882 381
482 3300025914 Ga0207671_10007824 Ga0207671_100078243 381
483 3300025914 Ga0207671_10113998 Ga0207671_101139982 381
484 3300025914 Ga0207671_10147784 Ga0207671_101477842 381
485 3300025917 Ga0207660_10001431 Ga0207660_100014319 381
486 3300025917 Ga0207660_10001647 Ga0207660_1000164711 381
487 3300025917 Ga0207660_10003057 Ga0207660_1000305711 381
488 3300025919 Ga0207657_10004614 Ga0207657_1000461410 381
489 3300025919 Ga0207657_10004766 Ga0207657_1000476612 381
490 3300025919 Ga0207657_10005275 Ga0207657_100052752 381
491 3300025919 Ga0207657_10097954 Ga0207657_100979542 381
492 3300025920 Ga0207649_10000493 Ga0207649_100004937 381
493 3300025920 Ga0207649_10001479 Ga0207649_1000147910 381
494 3300025920 Ga0207649_10010387 Ga0207649_100103871 381
495 3300025920 Ga0207649_10093259 Ga0207649_100932592 381
496 3300025920 Ga0207649_10193575 Ga0207649_101935752 381
497 3300025921 Ga0207652_10000030 Ga0207652_1000003026 381
498 3300025921 Ga0207652_10000820 Ga0207652_100008205 381
499 3300025921 Ga0207652_10000846 Ga0207652_100008465 381
500 3300025921 Ga0207652_10001111 Ga0207652_1000111111 381
501 3300025921 Ga0207652_10078652 Ga0207652_100786523 381
502 3300025923 Ga0207681_10016810 Ga0207681_100168104 381
503 3300025924 Ga0207694_10002059 Ga0207694_100020593 381
504 3300025924 Ga0207694_10005930 Ga0207694_1000593011 381
505 3300025924 Ga0207694_10008956 Ga0207694_100089563 381
506 3300025924 Ga0207694_10010172 Ga0207694_100101725 381
507 3300025925 Ga0207650_10000003 Ga0207650_10000003868 381
508 3300025925 Ga0207650_10245264 Ga0207650_102452642 381
509 3300025927 Ga0207687_10103069 Ga0207687_101030692 381
510 3300025928 Ga0207700_10034657 Ga0207700_100346571 381
511 3300025929 Ga0207664_10156749 Ga0207664_101567492 381
512 3300025931 Ga0207644_10001445 Ga0207644_100014456 381
513 3300025932 Ga0207690_10001014 Ga0207690_1000101415 381
514 3300025932 Ga0207690_10001119 Ga0207690_100011196 381
515 3300025933 Ga0207706_10070314 Ga0207706_100703142 381
516 3300025935 Ga0207709_10016265 Ga0207709_100162653 381
517 3300025937 Ga0207669_10219859 Ga0207669_102198592 381
518 3300025938 Ga0207704_10005509 Ga0207704_100055097 381
519 3300025938 Ga0207704_10022683 Ga0207704_100226832 381
520 3300025940 Ga0207691_10176412 Ga0207691_101764122 381
521 3300025941 Ga0207711_10001229 Ga0207711_1000122919 381
522 3300025941 Ga0207711_10005099 Ga0207711_100050991 381
523 3300025942 Ga0207689_10030973 Ga0207689_100309734 381
524 3300025944 Ga0207661_10014451 Ga0207661_100144511 381
525 3300025944 Ga0207661_10038955 Ga0207661_100389554 381
526 3300025945 Ga0207679_10008076 Ga0207679_100080764 381
527 3300025945 Ga0207679_10099435 Ga0207679_100994352 381
528 3300025949 Ga0207667_10000031 Ga0207667_10000031169 381
529 3300025949 Ga0207667_10000125 Ga0207667_1000012511 381
530 3300025949 Ga0207667_10000634 Ga0207667_1000063439 381
531 3300025949 Ga0207667_10000818 Ga0207667_100008185 381
532 3300025949 Ga0207667_10003528 Ga0207667_100035289 381
533 3300025949 Ga0207667_10007474 Ga0207667_100074746 381
534 3300025949 Ga0207667_10092266 Ga0207667_100922662 381
535 3300025949 Ga0207667_10368415 Ga0207667_103684152 381
536 3300025961 Ga0207712_10000169 Ga0207712_1000016950 381
537 3300025961 Ga0207712_10001183 Ga0207712_1000118318 381
538 3300025972 Ga0207668_10040485 Ga0207668_100404852 381
539 3300025981 Ga0207640_10000082 Ga0207640_1000008211 381
540 3300025981 Ga0207640_10001407 Ga0207640_100014073 381
541 3300025981 Ga0207640_10005086 Ga0207640_100050863 381
542 3300025981 Ga0207640_10015481 Ga0207640_100154814 381
543 3300025981 Ga0207640_10078855 Ga0207640_100788552 381
544 3300025986 Ga0207658_10000004 Ga0207658_10000004315 381
545 3300025986 Ga0207658_10000006 Ga0207658_10000006341 381
546 3300025986 Ga0207658_10009512 Ga0207658_100095125 381
547 3300025986 Ga0207658_10035251 Ga0207658_100352513 381
548 3300026023 Ga0207677_10170281 Ga0207677_101702812 381
549 3300026023 Ga0207677_10204134 Ga0207677_102041342 381
550 3300026035 Ga0207703_10011575 Ga0207703_100115754 381
551 3300026035 Ga0207703_10075899 Ga0207703_100758992 381
552 3300026041 Ga0207639_10001497 Ga0207639_1000149710 381
553 3300026041 Ga0207639_10001503 Ga0207639_1000150311 381
554 3300026041 Ga0207639_10001512 Ga0207639_100015128 381
555 3300026041 Ga0207639_10032218 Ga0207639_100322182 381
556 3300026041 Ga0207639_10090133 Ga0207639_100901333 381
557 3300026067 Ga0207678_10001435 Ga0207678_1000143510 381
558 3300026067 Ga0207678_10006920 Ga0207678_100069203 381
559 3300026067 Ga0207678_10014775 Ga0207678_100147755 381
560 3300026067 Ga0207678_10019278 Ga0207678_100192785 381
561 3300026067 Ga0207678_10025756 Ga0207678_100257563 381
562 3300026067 Ga0207678_10034586 Ga0207678_100345862 381
563 3300026067 Ga0207678_10080917 Ga0207678_100809172 381
564 3300026075 Ga0207708_10174009 Ga0207708_101740092 381
565 3300026078 Ga0207702_10000265 Ga0207702_1000026545 381
566 3300026078 Ga0207702_10000384 Ga0207702_1000038411 381
567 3300026078 Ga0207702_10005204 Ga0207702_100052042 381
568 3300026078 Ga0207702_10011335 Ga0207702_100113357 381
569 3300026078 Ga0207702_10011594 Ga0207702_100115945 381
570 3300026078 Ga0207702_10064781 Ga0207702_100647812 381
571 3300026078 Ga0207702_10125723 Ga0207702_101257232 381
572 3300026078 Ga0207702_10158328 Ga0207702_101583282 381
573 3300026088 Ga0207641_10009701 Ga0207641_100097014 381
574 3300026088 Ga0207641_10053431 Ga0207641_100534313 381
575 3300026088 Ga0207641_10083288 Ga0207641_100832882 381
576 3300026089 Ga0207648_10117566 Ga0207648_101175662 381
577 3300026095 Ga0207676_10000003 Ga0207676_10000003227 381
578 3300026116 Ga0207674_10002112 Ga0207674_1000211213 381
579 3300026116 Ga0207674_10004296 Ga0207674_100042969 381
580 3300026116 Ga0207674_10006067 Ga0207674_1000606710 381
581 3300026116 Ga0207674_10042792 Ga0207674_100427923 381
582 3300026118 Ga0207675_100131643 Ga0207675_1001316432 381
583 3300026121 Ga0207683_10038290 Ga0207683_100382904 381
584 3300026121 Ga0207683_10039725 Ga0207683_100397252 381
585 3300026121 Ga0207683_10045636 Ga0207683_100456362 381
586 3300026121 Ga0207683_10144088 Ga0207683_101440882 381
587 3300026142 Ga0207698_10001180 Ga0207698_100011807 381
588 3300026142 Ga0207698_10001757 Ga0207698_100017573 381
589 3300026142 Ga0207698_10006674 Ga0207698_100066743 381
590 3300026142 Ga0207698_10026723 Ga0207698_100267232 381
591 3300026142 Ga0207698_10031345 Ga0207698_100313453 381
592 3300026142 Ga0207698_10079147 Ga0207698_100791472 381
593 3300026142 Ga0207698_10081075 Ga0207698_100810752 381
594 3300026142 Ga0207698_10211122 Ga0207698_102111222 381
595 3300027312 Ga0209371_1000007 Ga0209371_1000007268 381
596 3300027312 Ga0209371_1000016 Ga0209371_1000016209 381
597 3300028379 Ga0268266_10000001 Ga0268266_100000012799 381
598 3300028379 Ga0268266_10000004 Ga0268266_100000041258 381
599 3300028379 Ga0268266_10000006 Ga0268266_10000006670 381
600 3300028379 Ga0268266_10004408 Ga0268266_100044085 381
601 3300028379 Ga0268266_10102131 Ga0268266_101021312 381
602 3300028379 Ga0268266_10111722 Ga0268266_101117222 381
603 3300028380 Ga0268265_10001087 Ga0268265_1000108711 381
604 3300028380 Ga0268265_10003544 Ga0268265_100035443 381
605 3300028380 Ga0268265_10233467 Ga0268265_102334672 381
606 3300028380 Ga0268265_10278620 Ga0268265_102786202 381
607 3300028381 Ga0268264_10000016 Ga0268264_10000016366 381
608 3300028381 Ga0268264_10305021 Ga0268264_103050212 381
609 3300028786 Ga0307517_10153775 Ga0307517_101537751 381
610 3300030500 Ga0268256_1000008 Ga0268256_1000008682 381
611 3300030500 Ga0268256_1000015 Ga0268256_1000015361 381
612 3300030742 Ga0316183_1072209 Ga0316183_10722093 381
613 3300031238 Ga0265332_10046656 Ga0265332_100466562 381
614 3300031250 Ga0265331_10039292 Ga0265331_100392922 381
615 3300031251 Ga0265327_10000044 Ga0265327_10000044226 381
616 3300031344 Ga0265316_10138153 Ga0265316_101381532 381
617 3300031548 Ga0307408_100106805 Ga0307408_1001068052 381
618 3300031730 Ga0307516_10052700 Ga0307516_100527004 381
619 3300031911 Ga0307412_10000684 Ga0307412_1000068414 381
620 3300031911 Ga0307412_10008621 Ga0307412_100086212 381
621 3300031911 Ga0307412_10144655 Ga0307412_101446552 381
622 3300033179 Ga0307507_10098766 Ga0307507_100987662 381
623 3300033180 Ga0307510_10000049 Ga0307510_100000493 381
624 3300037312 Ga0395899_0000133 Ga0395899_0000133_57794_58939 381
625 3300037312 Ga0395899_0075905 Ga0395899_0075905_124_1269 381
626 3300037312 Ga0395899_0088684 Ga0395899_0088684_467_1612 381
627 3300037418 Ga0395900_0000033 Ga0395900_0000033_147339_148484 381
628 3300037418 Ga0395900_0000061 Ga0395900_0000061_125946_127091 381
629 3300037418 Ga0395900_0068601 Ga0395900_0068601_1507_2652 381
630 3300037418 Ga0395900_0216503 Ga0395900_0216503_474_1619 381
631 3300037466 Ga0395898_0000034 Ga0395898_0000034_71087_72232 381
632 3300037466 Ga0395898_0000197 Ga0395898_0000197_126026_127171 381
633 3300037466 Ga0395898_0062735 Ga0395898_0062735_1616_2761 381
634 3300037466 Ga0395898_0090322 Ga0395898_0090322_689_1834 381
635 3300037466 Ga0395898_0100362 Ga0395898_0100362_518_1663 381
636 3300037466 Ga0395898_0218030 Ga0395898_0218030_67_1212 381
637 3300037466 Ga0395898_0218850 Ga0395898_0218850_367_1512 381
638 3300037471 Ga0395905_0051773 Ga0395905_0051773_1610_2755 381
639 3300038443 Ga0395901_0000772 Ga0395901_0000772_786_1931 381
640 3300038443 Ga0395901_0005878 Ga0395901_0005878_8574_9719 381
641 3300038443 Ga0395901_0021408 Ga0395901_0021408_845_1990 381
642 3300038443 Ga0395901_0071975 Ga0395901_0071975_1614_2759 381
643 3300038705 Ga0237819_05304 Ga0237819_05304_116_1264 381
644 3300041404 Ga0439436_0000042 Ga0439436_0000042_7499_8644 381
645 3300041413 Ga0439465_0002276 Ga0439465_0002276_4356_5501 381
646 3300041452 Ga0451793_0280819 Ga0451793_0280819_342_1490 381
647 3300041459 Ga0451800_1047982 Ga0451800_1047982_120_1268 381
648 3300041462 Ga0451806_243917 Ga0451806_243917_202_1350 381
649 3300041463 Ga0451804_0591474 Ga0451804_0591474_148_1296 381
650 3300041486 Ga0451807_0137290 Ga0451807_0137290_97_1245 381
651 3300041496 Ga0451839_0258198 Ga0451839_0258198_128_1276 381
652 3300041509 Ga0451843_0036637 Ga0451843_0036637_817_1965 381
653 3300041512 Ga0451853_0612520 Ga0451853_0612520_1074_2234 381
654 3300042184 Ga0450908_000392 Ga0450908_000392_3411_4556 381
655 3300044656 Ga0466969_0001628 Ga0466969_0001628_6931_8076 381
656 3300044656 Ga0466969_0005914 Ga0466969_0005914_3252_4397 381
657 3300044658 Ga0466972_0001288 Ga0466972_0001288_9727_10875 381
658 3300044672 Ga0466982_0000010 Ga0466982_0000010_176107_177252 381
659 3300044672 Ga0466982_0000196 Ga0466982_0000196_1734_2879 381
660 3300044683 Ga0466965_0022391 Ga0466965_0022391_1735_2880 381
661 3300044684 Ga0466966_0003629 Ga0466966_0003629_4295_5440 381
662 3300044684 Ga0466966_0017116 Ga0466966_0017116_3056_4201 381
663 3300044693 Ga0466961_0003687 Ga0466961_0003687_1162_2307 381
664 3300044693 Ga0466961_0004916 Ga0466961_0004916_6237_7382 381
665 3300044693 Ga0466961_0011932 Ga0466961_0011932_3369_4514 381
666 3300044693 Ga0466961_0043425 Ga0466961_0043425_1462_2607 381
667 3300044693 Ga0466961_0088931 Ga0466961_0088931_251_1396 381
668 3300044706 Ga0466964_0011053 Ga0466964_0011053_1929_3074 381
669 3300044712 Ga0453684_0002590 Ga0453684_0002590_38303_39448 381
670 3300044719 Ga0466971_0009268 Ga0466971_0009268_54_1199 381
671 3300044735 Ga0466968_0001991 Ga0466968_0001991_4830_5975 381
672 3300044765 Ga0466970_0000202 Ga0466970_0000202_26574_27722 381
673 3300044765 Ga0466970_0062608 Ga0466970_0062608_579_1724 381
674 3300044842 Ga0466957_0003347 Ga0466957_0003347_3490_4635 381
675 3300044842 Ga0466957_0022118 Ga0466957_0022118_414_1559 381
676 3300044842 Ga0466957_0041557 Ga0466957_0041557_239_1384 381
677 3300045049 Ga0466959_0000232 Ga0466959_0000232_23587_24732 381
678 3300045049 Ga0466959_0000888 Ga0466959_0000888_9071_10219 381
679 3300045049 Ga0466959_0024693 Ga0466959_0024693_1790_2935 381
680 3300045049 Ga0466959_0087654 Ga0466959_0087654_72_1217 381
681 3300045051 Ga0451576_0000840 Ga0451576_0000840_3835_4980 381
682 3300046452 Ga0495617_000016 Ga0495617_000016_245785_246930 381
683 3300046452 Ga0495617_002329 Ga0495617_002329_4599_5744 381
684 3300046460 Ga0495638_0000212 Ga0495638_0000212_61454_62599 381
685 3300046460 Ga0495638_0000938 Ga0495638_0000938_17207_18352 381
686 3300046460 Ga0495638_0001592 Ga0495638_0001592_14579_15724 381
687 3300046471 Ga0495650_0000614 Ga0495650_0000614_3444_4589 381
688 3300046471 Ga0495650_0001007 Ga0495650_0001007_17407_18552 381
689 3300046471 Ga0495650_0001927 Ga0495650_0001927_13818_14963 381
690 3300046491 Ga0495584_0000847 Ga0495584_0000847_13871_15016 381
691 3300046492 Ga0495585_0000007 Ga0495585_0000007_71871_73016 381
692 3300046492 Ga0495585_0002049 Ga0495585_0002049_8212_9357 381
693 3300046501 Ga0495607_0000003 Ga0495607_0000003_64408_65553 381
694 3300046501 Ga0495607_0000437 Ga0495607_0000437_17512_18657 381
695 3300046507 Ga0495606_0000610 Ga0495606_0000610_15146_16291 381
696 3300046507 Ga0495606_0001571 Ga0495606_0001571_6605_7750 381
697 3300046507 Ga0495606_0001761 Ga0495606_0001761_12609_13754 381
698 3300046507 Ga0495606_0012718 Ga0495606_0012718_349_1494 381
699 3300046512 Ga0495610_0008323 Ga0495610_0008323_4744_5889 381
700 3300046513 Ga0495616_0000001 Ga0495616_0000001_620017_621162 381
701 3300046513 Ga0495616_0016407 Ga0495616_0016407_2175_3320 381
702 3300046515 Ga0495620_0001003 Ga0495620_0001003_6564_7709 381
703 3300046518 Ga0495631_0000065 Ga0495631_0000065_11566_12711 381
704 3300046518 Ga0495631_0000217 Ga0495631_0000217_33183_34328 381
705 3300046519 Ga0495632_0000011 Ga0495632_0000011_160615_161760 381
706 3300046519 Ga0495632_0000581 Ga0495632_0000581_12023_13168 381
707 3300046520 Ga0495637_0006365 Ga0495637_0006365_663_1808 381
708 3300046524 Ga0495648_0002069 Ga0495648_0002069_4550_5695 381
709 3300046524 Ga0495648_0017405 Ga0495648_0017405_3589_4734 381
710 3300046525 Ga0495663_0016674 Ga0495663_0016674_488_1636 381
711 3300046616 Ga0495668_0064904 Ga0495668_0064904_101_1246 381
712 3300046648 Ga0495611_0000001 Ga0495611_0000001_1384845_1385990 381
713 3300046648 Ga0495611_0000068 Ga0495611_0000068_48684_49829 381
714 3300046660 Ga0495625_0000001 Ga0495625_0000001_530047_531192 381
715 3300046660 Ga0495625_0010620 Ga0495625_0010620_4689_5834 381
716 3300046660 Ga0495625_0018578 Ga0495625_0018578_1987_3132 381
717 3300046660 Ga0495625_0058667 Ga0495625_0058667_1559_2704 381
718 3300046665 Ga0495661_0001999 Ga0495661_0001999_4517_5662 381
719 3300046675 Ga0495657_0151105 Ga0495657_0151105_180_1325 381
720 3300046691 Ga0495670_0011736 Ga0495670_0011736_1926_3071 381
721 3300046691 Ga0495670_0019299 Ga0495670_0019299_294_1439 381
722 3300046692 Ga0495671_0004638 Ga0495671_0004638_5800_6945 381
723 3300046694 Ga0495649_0006750 Ga0495649_0006750_3626_4771 381
724 3300046794 Ga0495589_0000016 Ga0495589_0000016_104183_105328 381
725 3300046810 Ga0495660_0000018 Ga0495660_0000018_299110_300255 381
726 3300046810 Ga0495660_0000294 Ga0495660_0000294_25844_26989 381
727 3300047446 Ga0495679_000001 Ga0495679_000001_200965_202110 381
728 3300047469 Ga0495673_0000001 Ga0495673_0000001_527775_528920 381
729 3300047469 Ga0495673_0000018 Ga0495673_0000018_6572_7717 381
730 3300047469 Ga0495673_0006286 Ga0495673_0006286_1245_2390 381
731 3300047472 Ga0495686_0000026 Ga0495686_0000026_96734_97879 381
732 3300047472 Ga0495686_0000037 Ga0495686_0000037_284057_285202 381
733 3300047472 Ga0495686_0010946 Ga0495686_0010946_3306_4454 381
734 3300047472 Ga0495686_0011052 Ga0495686_0011052_1871_3016 381
735 3300047472 Ga0495686_0039726 Ga0495686_0039726_1614_2759 381
736 3300048904 Ga0496101_0015402 Ga0496101_0015402_1875_3020 381
737 3300048916 Ga0496113_0076306 Ga0496113_0076306_931_2076 381
738 3300048918 Ga0496115_0000140 Ga0496115_0000140_6533_7678 381
739 3300048918 Ga0496115_0000160 Ga0496115_0000160_44686_45831 381
740 3300048919 Ga0496116_0002429 Ga0496116_0002429_6196_7344 381
741 3300048920 Ga0496117_0000779 Ga0496117_0000779_5223_6371 381
742 3300048920 Ga0496117_0031479 Ga0496117_0031479_1802_2962 381
743 3300048920 Ga0496117_0045558 Ga0496117_0045558_162_1307 381
744 3300048920 Ga0496117_0058938 Ga0496117_0058938_1218_2363 381
745 3300048921 Ga0496118_0000497 Ga0496118_0000497_9959_11107 381
746 3300048921 Ga0496118_0001337 Ga0496118_0001337_12217_13377 381
747 3300048921 Ga0496118_0001789 Ga0496118_0001789_36_1181 381
748 3300048921 Ga0496118_0002288 Ga0496118_0002288_2951_4099 381
749 3300048921 Ga0496118_0002346 Ga0496118_0002346_15004_16152 381
750 3300048921 Ga0496118_0004535 Ga0496118_0004535_1888_3033 381
751 3300048921 Ga0496118_0004950 Ga0496118_0004950_5548_6696 381
752 3300048921 Ga0496118_0071155 Ga0496118_0071155_119_1267 381
753 3300048922 Ga0496119_0024864 Ga0496119_0024864_2211_3356 381
754 3300048924 Ga0496121_0000044 Ga0496121_0000044_270653_271798 381
755 3300048924 Ga0496121_0001002 Ga0496121_0001002_23663_24808 381
756 3300048924 Ga0496121_0001590 Ga0496121_0001590_20002_21147 381
757 3300048924 Ga0496121_0007287 Ga0496121_0007287_11353_12498 381
758 3300048924 Ga0496121_0025118 Ga0496121_0025118_2794_3939 381
759 3300048924 Ga0496121_0025582 Ga0496121_0025582_2591_3739 381
760 3300048924 Ga0496121_0061625 Ga0496121_0061625_563_1708 381
761 3300048925 Ga0496122_0000463 Ga0496122_0000463_78323_79471 381
762 3300048925 Ga0496122_0011204 Ga0496122_0011204_7428_8573 381
763 3300048925 Ga0496122_0012727 Ga0496122_0012727_1347_2492 381
764 3300048925 Ga0496122_0013601 Ga0496122_0013601_5735_6883 381
765 3300048925 Ga0496122_0016711 Ga0496122_0016711_2941_4089 381
766 3300048926 Ga0496123_0001598 Ga0496123_0001598_19129_20277 381
767 3300048926 Ga0496123_0012693 Ga0496123_0012693_1130_2275 381
768 3300048926 Ga0496123_0019840 Ga0496123_0019840_1482_2630 381
769 3300048926 Ga0496123_0037450 Ga0496123_0037450_348_1493 381
770 3300048926 Ga0496123_0051705 Ga0496123_0051705_1098_2243 381
771 3300048926 Ga0496123_0068423 Ga0496123_0068423_76_1221 381
772 3300048927 Ga0496124_0000840 Ga0496124_0000840_16410_17555 381
773 3300048927 Ga0496124_0000893 Ga0496124_0000893_16378_17523 381
774 3300048927 Ga0496124_0008226 Ga0496124_0008226_6372_7520 381
775 3300048927 Ga0496124_0008239 Ga0496124_0008239_3019_4167 381
776 3300048927 Ga0496124_0033579 Ga0496124_0033579_3091_4239 381
777 3300048927 Ga0496124_0166034 Ga0496124_0166034_302_1450 381
778 3300048927 Ga0496124_0171850 Ga0496124_0171850_464_1609 381
779 3300048928 Ga0496125_0000795 Ga0496125_0000795_37277_38422 381
780 3300048928 Ga0496125_0006055 Ga0496125_0006055_11504_12652 381
781 3300048928 Ga0496125_0017297 Ga0496125_0017297_2694_3842 381
782 3300048928 Ga0496125_0042716 Ga0496125_0042716_149_1297 381
783 3300048928 Ga0496125_0049534 Ga0496125_0049534_530_1675 381
784 3300048928 Ga0496125_0060411 Ga0496125_0060411_376_1527 381
785 3300048928 Ga0496125_0063681 Ga0496125_0063681_1216_2361 381
786 3300048929 Ga0496126_0052243 Ga0496126_0052243_2131_3276 381
787 3300048929 Ga0496126_0105529 Ga0496126_0105529_427_1575 381
788 3300048929 Ga0496126_0194845 Ga0496126_0194845_311_1459 381
789 3300049459 Ga0495678_001288 Ga0495678_001288_4602_5747 381
790 3300049460 Ga0495682_0000948 Ga0495682_0000948_4561_5706 381
791 3300049460 Ga0495682_0006512 Ga0495682_0006512_362_1507 381
792 3300049460 Ga0495682_0012133 Ga0495682_0012133_1104_2249 381
793 3300049568 Ga0501031_0025683 Ga0501031_0025683_852_1997 381
794 3300049569 Ga0501032_0044660 Ga0501032_0044660_148_1293 381
795 3300049570 Ga0501033_0000329 Ga0501033_0000329_1882_3030 381
796 3300049570 Ga0501033_0007277 Ga0501033_0007277_3626_4771 381
797 3300049570 Ga0501033_0020764 Ga0501033_0020764_1756_2901 381
798 3300049570 Ga0501033_0046423 Ga0501033_0046423_195_1343 381
799 3300049570 Ga0501033_0141220 Ga0501033_0141220_353_1498 381
800 3300049571 Ga0501034_0002728 Ga0501034_0002728_16180_17325 381
801 3300049571 Ga0501034_0006794 Ga0501034_0006794_7482_8630 381
802 3300049571 Ga0501034_0007130 Ga0501034_0007130_7841_8986 381
803 3300049571 Ga0501034_0019091 Ga0501034_0019091_1265_2413 381
804 3300049571 Ga0501034_0055591 Ga0501034_0055591_1812_2957 381
805 3300049571 Ga0501034_0165077 Ga0501034_0165077_43_1188 381
806 3300049571 Ga0501034_0217390 Ga0501034_0217390_637_1785 381
807 3300049572 Ga0501036_0005648 Ga0501036_0005648_6826_7974 381
808 3300049572 Ga0501036_0034329 Ga0501036_0034329_2692_3837 381
809 3300049572 Ga0501036_0040661 Ga0501036_0040661_687_1832 381
810 3300049572 Ga0501036_0190923 Ga0501036_0190923_80_1228 381
811 3300049573 Ga0501037_0007353 Ga0501037_0007353_2060_3208 381
812 3300049573 Ga0501037_0156826 Ga0501037_0156826_321_1466 381
813 3300049574 Ga0501038_0002332 Ga0501038_0002332_15260_16408 381
814 3300049574 Ga0501038_0038294 Ga0501038_0038294_1558_2703 381
815 3300049574 Ga0501038_0060216 Ga0501038_0060216_1160_2308 381
816 3300049574 Ga0501038_0109918 Ga0501038_0109918_955_2100 381
817 3300049575 Ga0501039_0003401 Ga0501039_0003401_1532_2680 381
818 3300049576 Ga0501040_0099063 Ga0501040_0099063_752_1897 381
819 3300049578 Ga0501042_0046076 Ga0501042_0046076_1007_2152 381
820 3300049579 Ga0501043_0046282 Ga0501043_0046282_631_1776 381
821 3300049580 Ga0501046_0016750 Ga0501046_0016750_925_2073 381
822 3300049580 Ga0501046_0030737 Ga0501046_0030737_263_1411 381
823 3300049580 Ga0501046_0043592 Ga0501046_0043592_1660_2808 381
824 3300049580 Ga0501046_0098393 Ga0501046_0098393_783_1928 381
825 3300049581 Ga0501047_0000925 Ga0501047_0000925_13288_14433 381
826 3300049581 Ga0501047_0005009 Ga0501047_0005009_1231_2376 381
827 3300049581 Ga0501047_0016805 Ga0501047_0016805_1321_2466 381
828 3300049581 Ga0501047_0028672 Ga0501047_0028672_1231_2376 381
829 3300049581 Ga0501047_0041719 Ga0501047_0041719_2415_3560 381
830 3300049581 Ga0501047_0217257 Ga0501047_0217257_230_1378 381
831 3300049582 Ga0501048_0011325 Ga0501048_0011325_398_1546 381
832 3300049582 Ga0501048_0084586 Ga0501048_0084586_177_1322 381
833 3300049583 Ga0501067_0000156 Ga0501067_0000156_29677_30822 381
834 3300049583 Ga0501067_0015309 Ga0501067_0015309_272_1420 381
835 3300049584 Ga0501068_0001884 Ga0501068_0001884_3716_4861 381
836 3300049584 Ga0501068_0012805 Ga0501068_0012805_2459_3607 381
837 3300049585 Ga0501069_0000829 Ga0501069_0000829_11949_13094 381
838 3300049585 Ga0501069_0005548 Ga0501069_0005548_2142_3287 381
839 3300049585 Ga0501069_0024160 Ga0501069_0024160_1404_2552 381
840 3300049585 Ga0501069_0147448 Ga0501069_0147448_122_1270 381
841 3300049586 Ga0501070_0000105 Ga0501070_0000105_24211_25356 381
842 3300049586 Ga0501070_0005394 Ga0501070_0005394_9268_10416 381
843 3300049586 Ga0501070_0011632 Ga0501070_0011632_3316_4461 381
844 3300049586 Ga0501070_0015227 Ga0501070_0015227_3574_4719 381
845 3300049586 Ga0501070_0025592 Ga0501070_0025592_1188_2333 381
846 3300049586 Ga0501070_0037811 Ga0501070_0037811_1586_2734 381
847 3300049587 Ga0501071_0080680 Ga0501071_0080680_842_1990 381
848 3300049588 Ga0501072_0000722 Ga0501072_0000722_17117_18262 381
849 3300049588 Ga0501072_0048402 Ga0501072_0048402_1572_2720 381
850 3300049589 Ga0501073_0000305 Ga0501073_0000305_21424_22569 381
851 3300049589 Ga0501073_0089506 Ga0501073_0089506_625_1770 381
852 3300049590 Ga0501074_0006157 Ga0501074_0006157_720_1865 381
853 3300049590 Ga0501074_0008079 Ga0501074_0008079_5912_7060 381
854 3300049590 Ga0501074_0011517 Ga0501074_0011517_4382_5527 381
855 3300049590 Ga0501074_0031601 Ga0501074_0031601_1242_2390 381
856 3300049741 Ga0501079_0065327 Ga0501079_0065327_369_1517 381
857 3300049742 Ga0501080_0000867 Ga0501080_0000867_5993_7138 381
858 3300049742 Ga0501080_0002410 Ga0501080_0002410_6422_7570 381
859 3300049742 Ga0501080_0004755 Ga0501080_0004755_1212_2357 381
860 3300049742 Ga0501080_0015663 Ga0501080_0015663_3482_4627 381
861 3300049742 Ga0501080_0027236 Ga0501080_0027236_2972_4120 381
862 3300049742 Ga0501080_0037361 Ga0501080_0037361_2981_4126 381
863 3300049742 Ga0501080_0365882 Ga0501080_0365882_23_1168 381
864 3300049744 Ga0501083_0001739 Ga0501083_0001739_7864_9009 381
865 3300049744 Ga0501083_0093581 Ga0501083_0093581_404_1552 381
866 3300049822 Ga0501035_0009302 Ga0501035_0009302_6591_7736 381
867 3300049822 Ga0501035_0025529 Ga0501035_0025529_3496_4641 381
868 3300049822 Ga0501035_0032477 Ga0501035_0032477_2451_3599 381
869 3300049822 Ga0501035_0051360 Ga0501035_0051360_2221_3366 381
870 3300049822 Ga0501035_0060203 Ga0501035_0060203_327_1472 381
871 3300049822 Ga0501035_0142923 Ga0501035_0142923_43_1188 381
872 3300049822 Ga0501035_0224597 Ga0501035_0224597_120_1265 381
873 3300049822 Ga0501035_0228920 Ga0501035_0228920_174_1322 381
874 3300049823 Ga0501044_0006675 Ga0501044_0006675_9457_10605 381
875 3300049823 Ga0501044_0028607 Ga0501044_0028607_4010_5155 381
876 3300049823 Ga0501044_0062567 Ga0501044_0062567_2348_3493 381
877 3300049823 Ga0501044_0072136 Ga0501044_0072136_1505_2650 381
878 3300049823 Ga0501044_0109658 Ga0501044_0109658_994_2139 381
879 3300049823 Ga0501044_0141185 Ga0501044_0141185_579_1727 381
880 3300050516 nmdc:mga0sz30_74114_c1 nmdc:mga0sz30_74114_c1_43_1188 381
881 3300053080 Ga0500635_0012551 Ga0500635_0012551_435_1583 381
882 3300053087 Ga0500643_000002 Ga0500643_000002_430357_431502 381
883 3300053090 Ga0500646_0010649 Ga0500646_0010649_741_1886 381
884 3300053093 Ga0500651_0000179 Ga0500651_0000179_33754_34902 381
885 3300053093 Ga0500651_0031023 Ga0500651_0031023_179_1327 381
886 3300053098 Ga0500650_0000027 Ga0500650_0000027_54620_55774 381
887 3300053103 Ga0500555_001867 Ga0500555_001867_3024_4169 381
888 3300053120 Ga0500597_000841 Ga0500597_000841_4780_5928 381
889 3300053139 Ga0500568_0001481 Ga0500568_0001481_9225_10559 381
890 3300053160 Ga0500633_0005906 Ga0500633_0005906_1638_2783 381
891 3300053730 Ga0500645_003001 Ga0500645_003001_1482_2627 381
892 3300054114 Ga0501084_0288880 Ga0501084_0288880_172_1317 381
893 3300055283 Ga0500661_004432 Ga0500661_004432_891_2129 381
894 3300060353 Ga0501082_0000082 Ga0501082_0000082_63914_65062 381
895 3300060353 Ga0501082_0122996 Ga0501082_0122996_927_2072 381
896 3300060353 Ga0501082_0173941 Ga0501082_0173941_662_1810 381
897 3300061719 Ga0466962_0004187 Ga0466962_0004187_1646_2791 381
898 3300061719 Ga0466962_0009563 Ga0466962_0009563_900_2045 381
899 3300061719 Ga0466962_0017220 Ga0466962_0017220_943_2088 381
900 3300061719 Ga0466962_0024084 Ga0466962_0024084_964_2109 381

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00155

Aminotran_1_2

Aminotransferase class I and II

25

372

0.95

PF01041

DegT_DnrJ_EryC1

DegT/DnrJ/EryC1/StrS aminotransferase family

71

190

0.89

PF01053

Cys_Met_Meta_PP

Cys/Met metabolism PLP-dependent enzyme

65

195

0.87

PF00266

Aminotran_5

Aminotransferase class-V

41

197

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
1u08-assembly1.cif.gz_B crystal structure and reactivity of ybdl from escherichia coli identify a methionine aminotransferase function. 0.9794 1 381
1u08-assembly1.cif.gz_A crystal structure and reactivity of ybdl from escherichia coli identify a methionine aminotransferase function. 0.9776 1 381
1u08-assembly1.cif.gz_A crystal structure and reactivity of ybdl from escherichia coli identify a methionine aminotransferase function. 0.9751 1 381
1u08-assembly1.cif.gz_B crystal structure and reactivity of ybdl from escherichia coli identify a methionine aminotransferase function. 0.9743 1 381
2o0r-assembly1.cif.gz_B the three-dimensional structure of n-succinyldiaminopimelate aminotransferase from mycobacterium tuberculosis 0.9612 2 380
ID Description Score Start End Superfamily
af_P77806_47_284_3.40.640.10 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.9917 43 278 3.40.640.10
af_A0A1D6I5Q5_168_402_3.40.640.10 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.9825 41 273 3.40.640.10
af_P77806_47_284_3.40.640.10 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.9794 43 278 3.40.640.10
af_P77806_286_386_3.90.1150.10 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Aspartate Aminotransferase, domain 1 0.973 282 381 3.90.1150.10
af_Q7XDA3_47_275_3.40.640.10 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.9713 46 274 3.40.640.10
ID Description Score Start End GO Terms
AF-E7C4H4-F1-model_v4 Aspartate/tyrosine/aromatic aminotransferase 0.9904 67 256 GO:0005737
GO:0009058
GO:0016212
GO:0030170
AF-A0A3S4LWV1-F1-model_v4 Aminotransferase (EC 2.6.1.88) 0.9878 84 249 GO:0005737
GO:0009058
GO:0010326
GO:0016212
GO:0030170
AF-A0A1E5T4N5-F1-model_v4 Aminotransferase 0.9865 1 381 GO:0005737
GO:0009058
GO:0016212
GO:0030170
AF-A0A228J593-F1-model_v4 Methionine aminotransferase 0.9843 1 381 GO:0005737
GO:0009058
GO:0016212
GO:0030170
AF-A0A7H9F5E6-F1-model_v4 deleted 0.984 1 381

Feature Viewer

pLDDT pTM Quality
92.85 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map