F485156

General Info

Members Datasets Scaffolds Average Seq Length
900 288 867 326

Family's Representative Sequence

Representative Sequence 3300050516|nmdc:mga0sz30_2095_c1|nmdc:mga0sz30_2095_c1_5993_7114
Length 373
Sequence MSALGVESGDGIALRVSLTHESDGTAWWNAKKGGLVAVMKFIRKMHAAAARRWSRRLVVSAVTALTLPGLIGFAGGSATAGAFSRPGLPVEYLDVFSPAMNRDIRVQFQGGGPRAVYLLDGLRARDDFSGWDINTPAFEWYYESGLSVVMPVGGQSSFYTDWYQPSRGNGQNYTYKWETFMTQELPAWLEANRGVSQTGNAVVGISMAGSSALTYAIYYPQKFIYAGSLSGFLNPSEGWWPTLIGLAMSDAGGYNAESMWGPTSDPAWRRNDPMININQLVANNTRVWVYCGTGTPSDLDAGSSGGGLAAAQFLEGFTLRTNQTFRDTYIAAGGTNGVFNFPPNGTHSWGYWGQQLLDMKPDIQRVLGAQAAA

Samples

Sample ID Description Type Environment
1 2643221687 Mycobacterium sp. Root135 Isolate Unclassified
2 2643221715 Mycobacterium sp. Root265 Isolate Unclassified
3 2738541264 Mycobacterium sp. OK889 Isolate Unclassified
4 2738541274 Mycobacterium sp. YR708 Isolate Unclassified
5 2738543028 Mycobacterium sp. YR782 Isolate Unclassified
6 2842134933 Mycolicibacterium obuense SEMIA 442 Isolate Nodule
7 2902792274 Mycolicibacterium sp. P9-64 Isolate Unclassified
8 2902799365 Mycolicibacterium sp. P1-5 Isolate Unclassified
9 2902810491 Mycolicibacterium sp. P9-22 Isolate Unclassified
10 2902837492 Mycolicibacterium sp. P1-18 Isolate Unclassified
11 2929212328 Mycolicibacterium sp. R-73050 Hybrid assembly Isolate Unclassified
12 2939582691 Mycolicibacterium sp. 624 Isolate Rhizosphere
13 3300000546 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled Metagenome Rhizosphere
14 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
15 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
16 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
17 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
18 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
19 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
20 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
21 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
22 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
23 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
24 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
25 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
26 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
27 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
28 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
29 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
30 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
31 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
32 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
33 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
34 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
35 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
36 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
37 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
38 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
39 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
40 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
41 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
42 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
43 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
44 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
45 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
46 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
47 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
48 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
49 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
50 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
51 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
52 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
53 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
54 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
55 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
56 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
57 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
58 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
59 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
60 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
61 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
62 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
63 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
64 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
65 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
66 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
67 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
68 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
69 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
70 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
71 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
72 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
73 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
74 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
75 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
76 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
77 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
78 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
79 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
80 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
81 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
82 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
83 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
84 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
85 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
86 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
87 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
88 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
89 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
90 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
91 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
92 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
93 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
94 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
95 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
96 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
97 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
98 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
99 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
100 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
101 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
102 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
150 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
151 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
152 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
153 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
154 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
155 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
156 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
157 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
158 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
159 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
160 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
161 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
162 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
163 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
164 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
165 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
166 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
167 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
168 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
169 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
170 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
171 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
172 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
173 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
174 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
175 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
176 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
177 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
178 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
179 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
180 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
181 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
182 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
183 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
184 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
185 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
186 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
187 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
188 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
189 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
190 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
191 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
192 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
193 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
194 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
195 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
196 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
197 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
198 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
199 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
200 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
201 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
202 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
203 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
204 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
205 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
206 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
207 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
208 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
209 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
210 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
211 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
212 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
213 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
214 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
215 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
216 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
217 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
218 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
219 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
220 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
221 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
222 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
223 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
224 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
225 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
226 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
227 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
228 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
229 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
230 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
231 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
232 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
233 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
234 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
235 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
236 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
237 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
238 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
239 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
240 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
241 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
242 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
243 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
244 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
245 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
246 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
247 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
248 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
249 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
250 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
251 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
252 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
253 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
254 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
255 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
256 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
257 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
258 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
259 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
260 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
261 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
262 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
263 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
264 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
265 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
266 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
267 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
268 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
269 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
270 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
271 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
272 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
273 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
274 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
275 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
276 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
277 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
278 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
279 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
280 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
281 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
282 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
283 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
284 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
285 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
286 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
287 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
288 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.44
Metatranscriptomes 0.11
Isolates 3.44

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 18.11
Nodule 0.33
Rhizoplane 14
Rhizosphere 54
Stem 0
Stem Tuber 0
Unclassified 13.56

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 LJNas_1006653 3300000546 Bacteria 1252
2 JGI24745J21846_1007035 3300002073 Bacteria 1258
3 JGI24744J21845_10009503 3300002077 Bacteria 1994
4 JGI24742J22300_10018751 3300002244 Bacteria 1173
5 Ga0055540_1000003 3300003792 Bacteria 428375
6 Ga0055540_1000913 3300003792 Bacteria 19334
7 Ga0055540_1003066 3300003792 Bacteria 8322
8 Ga0055540_1006127 3300003792 Bacteria 4845
9 Ga0055540_1022773 3300003792 Bacteria 1594
10 Ga0070676_10017923 3300005328 Bacteria 3920
11 Ga0070683_100041275 3300005329 Bacteria 4244
12 Ga0070683_100096618 3300005329 Bacteria 2779
13 Ga0068869_100038195 3300005334 Bacteria 3420
14 Ga0068869_100110989 3300005334 Bacteria 2086
15 Ga0070666_10051621 3300005335 Bacteria 2770
16 Ga0070682_100005205 3300005337 Bacteria 7236
17 Ga0070682_100082499 3300005337 Bacteria 2084
18 Ga0070682_100122383 3300005337 Bacteria 1749
19 Ga0070682_100143506 3300005337 Bacteria 1630
20 Ga0068868_100000582 3300005338 Bacteria 24501
21 Ga0068868_100008755 3300005338 Bacteria 7248
22 Ga0070687_100099572 3300005343 Bacteria 1625
23 Ga0070668_100001337 3300005347 Bacteria 17610
24 Ga0070669_100001646 3300005353 Bacteria 16179
25 Ga0070669_100002332 3300005353 Bacteria 13721
26 Ga0070669_100002998 3300005353 Bacteria 12164
27 Ga0070675_100059332 3300005354 Bacteria 3156
28 Ga0070671_100002936 3300005355 Bacteria 13260
29 Ga0070674_100050740 3300005356 Bacteria 2857
30 Ga0070673_100045830 3300005364 Bacteria 3393
31 Ga0070673_100053781 3300005364 Bacteria 3164
32 Ga0070659_100259142 3300005366 Bacteria 1443
33 Ga0070667_100000056 3300005367 Bacteria 150952
34 Ga0070667_100000075 3300005367 Bacteria 120953
35 Ga0070667_100000782 3300005367 Bacteria 29910
36 Ga0070667_100000909 3300005367 Bacteria 27344
37 Ga0070667_100006345 3300005367 Bacteria 9830
38 Ga0070667_100018573 3300005367 Bacteria 5768
39 Ga0070709_10088948 3300005434 Bacteria 2032
40 Ga0070709_10133021 3300005434 Bacteria 1700
41 Ga0070714_100022804 3300005435 Bacteria 5136
42 Ga0070713_100070072 3300005436 Bacteria 2959
43 Ga0070713_100127035 3300005436 Bacteria 2244
44 Ga0070710_10000230 3300005437 Bacteria 26115
45 Ga0070701_10002623 3300005438 Bacteria 6960
46 Ga0070711_100002822 3300005439 Bacteria 9972
47 Ga0070663_100017490 3300005455 Bacteria 4681
48 Ga0070663_100025982 3300005455 Bacteria 3960
49 Ga0070663_100134155 3300005455 Bacteria 1884
50 Ga0070678_100111460 3300005456 Bacteria 2141
51 Ga0070662_100005597 3300005457 Bacteria 8030
52 Ga0068867_100002882 3300005459 Bacteria 12102
53 Ga0068867_100065425 3300005459 Bacteria 2705
54 Ga0070685_10063041 3300005466 Bacteria 2175
55 Ga0070685_10176080 3300005466 Bacteria 1374
56 Ga0068853_100008899 3300005539 Bacteria 8079
57 Ga0068853_100014908 3300005539 Bacteria 6384
58 Ga0068853_100256334 3300005539 Bacteria 1607
59 Ga0070672_100061252 3300005543 Bacteria 2966
60 Ga0070695_100060503 3300005545 Bacteria 2454
61 Ga0070693_100060565 3300005547 Bacteria 2198
62 Ga0070665_100003729 3300005548 Bacteria 16134
63 Ga0070665_100005421 3300005548 Bacteria 13155
64 Ga0070665_100005636 3300005548 Bacteria 12873
65 Ga0070665_100040639 3300005548 Bacteria 4674
66 Ga0070665_100086922 3300005548 Bacteria 3132
67 Ga0070665_100307055 3300005548 Bacteria 1590
68 Ga0068855_100429238 3300005563 Bacteria 1445
69 Ga0068854_100210423 3300005578 Bacteria 1533
70 Ga0068854_100253224 3300005578 Bacteria 1407
71 Ga0070702_100117127 3300005615 Bacteria 1662
72 Ga0068852_100079232 3300005616 Bacteria 2909
73 Ga0068859_100002413 3300005617 Bacteria 19034
74 Ga0068859_100002568 3300005617 Bacteria 18446
75 Ga0068864_100057810 3300005618 Bacteria 3351
76 Ga0068851_10089836 3300005834 Bacteria 1616
77 Ga0068863_100000200 3300005841 Bacteria 63948
78 Ga0068863_100003502 3300005841 Bacteria 15485
79 Ga0068863_100005817 3300005841 Bacteria 12088
80 Ga0068863_100012525 3300005841 Bacteria 8182
81 Ga0068863_100061465 3300005841 Bacteria 3551
82 Ga0068858_100065696 3300005842 Bacteria 3357
83 Ga0068858_100103289 3300005842 Bacteria 2659
84 Ga0068858_100223992 3300005842 Bacteria 1782
85 Ga0068858_100287015 3300005842 Bacteria 1568
86 Ga0068860_100000021 3300005843 Bacteria 282612
87 Ga0068860_100000025 3300005843 Bacteria 271553
88 Ga0068860_100000092 3300005843 Bacteria 150190
89 Ga0068862_100000015 3300005844 Bacteria 250184
90 Ga0068862_100000035 3300005844 Bacteria 174953
91 Ga0068862_100000045 3300005844 Bacteria 155641
92 Ga0068862_100267410 3300005844 Bacteria 1563
93 Ga0068862_100436535 3300005844 Bacteria 1232
94 Ga0081455_10009898 3300005937 Bacteria 9755
95 Ga0081455_10014180 3300005937 Bacteria 7827
96 Ga0081455_10021426 3300005937 Bacteria 6062
97 Ga0081455_10087542 3300005937 Bacteria 2534
98 Ga0081455_10162312 3300005937 Bacteria 1711
99 Ga0075365_10003210 3300006038 Bacteria 8360
100 Ga0075365_10004632 3300006038 Bacteria 7319
101 Ga0075365_10026563 3300006038 Bacteria 3677
102 Ga0075365_10041785 3300006038 Bacteria 2996
103 Ga0075365_10069646 3300006038 Bacteria 2364
104 Ga0075365_10072393 3300006038 Bacteria 2321
105 Ga0075365_10216916 3300006038 Bacteria 1342
106 Ga0075365_10253145 3300006038 Bacteria 1238
107 Ga0075368_10001464 3300006042 Bacteria 7559
108 Ga0075363_100001338 3300006048 Bacteria 9242
109 Ga0075363_100002179 3300006048 Bacteria 7892
110 Ga0075363_100002254 3300006048 Bacteria 7808
111 Ga0075363_100002533 3300006048 Bacteria 7497
112 Ga0075363_100003311 3300006048 Bacteria 6826
113 Ga0075363_100007474 3300006048 Bacteria 5027
114 Ga0075363_100010144 3300006048 Bacteria 4456
115 Ga0075363_100018054 3300006048 Bacteria 3508
116 Ga0075363_100018698 3300006048 Bacteria 3456
117 Ga0075363_100029014 3300006048 Bacteria 2853
118 Ga0075363_100061281 3300006048 Bacteria 2027
119 Ga0075363_100080094 3300006048 Bacteria 1785
120 Ga0075364_10002509 3300006051 Bacteria 10275
121 Ga0075364_10006538 3300006051 Bacteria 6856
122 Ga0075364_10007223 3300006051 Bacteria 6583
123 Ga0075364_10007628 3300006051 Bacteria 6433
124 Ga0075364_10014429 3300006051 Bacteria 4882
125 Ga0075364_10016845 3300006051 Bacteria 4552
126 Ga0075364_10018315 3300006051 Bacteria 4382
127 Ga0075364_10039274 3300006051 Bacteria 3068
128 Ga0075364_10064383 3300006051 Bacteria 2406
129 Ga0075364_10077310 3300006051 Bacteria 2197
130 Ga0075364_10150714 3300006051 Bacteria 1567
131 Ga0075364_10183705 3300006051 Bacteria 1416
132 Ga0070715_10001069 3300006163 Bacteria 7760
133 Ga0075362_10006752 3300006177 Bacteria 4290
134 Ga0075362_10007440 3300006177 Bacteria 4148
135 Ga0075362_10033425 3300006177 Bacteria 2237
136 Ga0075362_10035769 3300006177 Bacteria 2169
137 Ga0075362_10052817 3300006177 Bacteria 1822
138 Ga0075362_10063740 3300006177 Bacteria 1672
139 Ga0075367_10002349 3300006178 Bacteria 8606
140 Ga0075367_10011089 3300006178 Bacteria 4754
141 Ga0075367_10017826 3300006178 Bacteria 3904
142 Ga0075367_10106939 3300006178 Bacteria 1714
143 Ga0075367_10188789 3300006178 Bacteria 1286
144 Ga0075369_10000569 3300006186 Bacteria 11663
145 Ga0075369_10001676 3300006186 Bacteria 7639
146 Ga0075369_10008161 3300006186 Bacteria 4019
147 Ga0075369_10010217 3300006186 Bacteria 3668
148 Ga0075369_10011905 3300006186 Bacteria 3428
149 Ga0075369_10018238 3300006186 Bacteria 2856
150 Ga0075369_10019166 3300006186 Bacteria 2792
151 Ga0075369_10022760 3300006186 Bacteria 2586
152 Ga0075369_10033391 3300006186 Bacteria 2180
153 Ga0075369_10037908 3300006186 Bacteria 2055
154 Ga0075369_10038102 3300006186 Bacteria 2050
155 Ga0075369_10045390 3300006186 Bacteria 1889
156 Ga0075369_10058395 3300006186 Bacteria 1680
157 Ga0075369_10084741 3300006186 Bacteria 1409
158 Ga0075369_10086335 3300006186 Bacteria 1397
159 Ga0075366_10072830 3300006195 Bacteria 2048
160 Ga0075370_10022009 3300006353 Bacteria 3495
161 Ga0075370_10062688 3300006353 Bacteria 2118
162 Ga0075370_10074386 3300006353 Bacteria 1947
163 Ga0075370_10092048 3300006353 Bacteria 1750
164 Ga0075370_10136363 3300006353 Bacteria 1434
165 Ga0075428_100008341 3300006844 Bacteria 11489
166 Ga0075428_100126333 3300006844 Bacteria 2783
167 Ga0075430_100023419 3300006846 Bacteria 5256
168 Ga0075430_100066408 3300006846 Bacteria 3029
169 Ga0075431_100154206 3300006847 Bacteria 2364
170 Ga0068865_100006687 3300006881 Bacteria 7052
171 Ga0097620_100002413 3300006931 Bacteria 19034
172 Ga0097620_100002568 3300006931 Bacteria 18446
173 Ga0111539_10365206 3300009094 Bacteria 1680
174 Ga0111539_10603888 3300009094 Bacteria 1278
175 Ga0105245_10194810 3300009098 Bacteria 1943
176 Ga0105247_10000010 3300009101 Bacteria 302475
177 Ga0105247_10000053 3300009101 Bacteria 141244
178 Ga0105247_10000328 3300009101 Bacteria 41940
179 Ga0105247_10012064 3300009101 Bacteria 5191
180 Ga0105247_10034300 3300009101 Bacteria 3091
181 Ga0105247_10146870 3300009101 Bacteria 1550
182 Ga0114129_10018524 3300009147 Bacteria 9912
183 Ga0114129_10027500 3300009147 Bacteria 8052
184 Ga0105243_10145836 3300009148 Bacteria 2025
185 Ga0105241_10074113 3300009174 Bacteria 2650
186 Ga0105241_10382170 3300009174 Bacteria 1231
187 Ga0105242_10128879 3300009176 Bacteria 2181
188 Ga0105248_10000036 3300009177 Bacteria 187421
189 Ga0105248_10000145 3300009177 Bacteria 81917
190 Ga0105248_10016483 3300009177 Bacteria 8134
191 Ga0105248_10023837 3300009177 Bacteria 6802
192 Ga0105248_10052591 3300009177 Bacteria 4570
193 Ga0105248_10111871 3300009177 Bacteria 3080
194 Ga0105248_10150478 3300009177 Bacteria 2626
195 Ga0105237_10002857 3300009545 Bacteria 21003
196 Ga0105237_10006567 3300009545 Bacteria 12864
197 Ga0105237_10010933 3300009545 Bacteria 9630
198 Ga0105238_10176436 3300009551 Bacteria 2114
199 Ga0105249_10000010 3300009553 Bacteria 306939
200 Ga0105249_10000046 3300009553 Bacteria 176363
201 Ga0105249_10000125 3300009553 Bacteria 103728
202 Ga0105249_10007211 3300009553 Bacteria 9699
203 Ga0105239_10006382 3300010375 Bacteria 13698
204 Ga0105239_10027466 3300010375 Bacteria 6265
205 Ga0105239_10136140 3300010375 Bacteria 2735
206 Ga0105239_10160449 3300010375 Bacteria 2512
207 Ga0105246_10078303 3300011119 Bacteria 2347
208 Ga0105246_10318246 3300011119 Bacteria 1263
209 Ga0105246_10362621 3300011119 Bacteria 1191
210 Ga0157369_10067305 3300013105 Bacteria 3851
211 Ga0157369_10329888 3300013105 Bacteria 1585
212 Ga0157374_10065452 3300013296 Bacteria 3414
213 Ga0163162_10104020 3300013306 Bacteria 2933
214 Ga0157375_10103882 3300013308 Bacteria 2929
215 Ga0163163_10048829 3300014325 Bacteria 4163
216 Ga0163163_10073653 3300014325 Bacteria 3406
217 Ga0163163_10125004 3300014325 Bacteria 2609
218 Ga0157379_10012726 3300014968 Bacteria 7355
219 Ga0157379_10059390 3300014968 Bacteria 3419
220 Ga0157379_10087121 3300014968 Bacteria 2800
221 Ga0163161_10010688 3300017792 Bacteria 6356
222 Ga0213874_10036841 3300021377 Bacteria 1444
223 Ga0213874_10072497 3300021377 Bacteria 1101
224 Ga0213876_10007576 3300021384 Bacteria 5895
225 Ga0213876_10015374 3300021384 Bacteria 4051
226 Ga0213876_10027794 3300021384 Bacteria 2983
227 Ga0213876_10081371 3300021384 Bacteria 1713
228 Ga0213875_10011913 3300021388 Bacteria 4312
229 Ga0213875_10015274 3300021388 Bacteria 3737
230 Ga0213875_10039674 3300021388 Bacteria 2218
231 Ga0213875_10040014 3300021388 Bacteria 2208
232 Ga0209673_1029218 3300025273 Bacteria 1758
233 Ga0209025_1041088 3300025294 Bacteria 1987
234 Ga0209051_1000011 3300025303 Bacteria 610828
235 Ga0209051_1000620 3300025303 Bacteria 40785
236 Ga0209051_1002038 3300025303 Bacteria 15354
237 Ga0209051_1002725 3300025303 Bacteria 12261
238 Ga0209051_1003712 3300025303 Bacteria 9843
239 Ga0209051_1008620 3300025303 Bacteria 5371
240 Ga0207653_10024221 3300025885 Bacteria 1937
241 Ga0207692_10073846 3300025898 Bacteria 1805
242 Ga0207642_10025868 3300025899 Bacteria 2381
243 Ga0207710_10000028 3300025900 Bacteria 304525
244 Ga0207710_10000060 3300025900 Bacteria 168230
245 Ga0207710_10000078 3300025900 Bacteria 141062
246 Ga0207710_10005233 3300025900 Bacteria 5607
247 Ga0207710_10071286 3300025900 Bacteria 1594
248 Ga0207688_10062565 3300025901 Bacteria 2098
249 Ga0207680_10006569 3300025903 Bacteria 5635
250 Ga0207680_10049816 3300025903 Bacteria 2495
251 Ga0207647_10024420 3300025904 Bacteria 3985
252 Ga0207685_10061835 3300025905 Bacteria 1486
253 Ga0207699_10030110 3300025906 Bacteria 3034
254 Ga0207645_10120764 3300025907 Bacteria 1701
255 Ga0207671_10018297 3300025914 Bacteria 5378
256 Ga0207671_10024065 3300025914 Bacteria 4584
257 Ga0207663_10079423 3300025916 Bacteria 2142
258 Ga0207657_10191122 3300025919 Bacteria 1651
259 Ga0207652_10390088 3300025921 Bacteria 1257
260 Ga0207681_10001300 3300025923 Bacteria 16118
261 Ga0207681_10002363 3300025923 Bacteria 11994
262 Ga0207681_10006641 3300025923 Bacteria 7103
263 Ga0207694_10070232 3300025924 Bacteria 2736
264 Ga0207659_10023921 3300025926 Bacteria 4086
265 Ga0207687_10001412 3300025927 Bacteria 16409
266 Ga0207700_10065821 3300025928 Bacteria 2767
267 Ga0207700_10204086 3300025928 Bacteria 1667
268 Ga0207664_10124226 3300025929 Bacteria 2164
269 Ga0207664_10150395 3300025929 Bacteria 1977
270 Ga0207644_10012729 3300025931 Bacteria 5593
271 Ga0207686_10129084 3300025934 Bacteria 1731
272 Ga0207709_10007965 3300025935 Bacteria 5870
273 Ga0207709_10317721 3300025935 Bacteria 1164
274 Ga0207669_10000309 3300025937 Bacteria 22278
275 Ga0207704_10001181 3300025938 Bacteria 11638
276 Ga0207691_10093429 3300025940 Bacteria 2693
277 Ga0207711_10000069 3300025941 Bacteria 115038
278 Ga0207711_10000073 3300025941 Bacteria 107878
279 Ga0207711_10010206 3300025941 Bacteria 7797
280 Ga0207711_10062968 3300025941 Bacteria 3201
281 Ga0207711_10064247 3300025941 Bacteria 3170
282 Ga0207689_10018308 3300025942 Bacteria 5912
283 Ga0207661_10219687 3300025944 Bacteria 1679
284 Ga0207679_10092910 3300025945 Bacteria 2338
285 Ga0207667_10154898 3300025949 Bacteria 2358
286 Ga0207651_10340246 3300025960 Bacteria 1260
287 Ga0207712_10000016 3300025961 Bacteria 343014
288 Ga0207712_10000028 3300025961 Bacteria 250190
289 Ga0207712_10000042 3300025961 Bacteria 176338
290 Ga0207712_10016281 3300025961 Bacteria 4811
291 Ga0207668_10000577 3300025972 Bacteria 22902
292 Ga0207668_10003056 3300025972 Bacteria 9814
293 Ga0207668_10006287 3300025972 Bacteria 7020
294 Ga0207640_10179100 3300025981 Bacteria 1588
295 Ga0207658_10000237 3300025986 Bacteria 58047
296 Ga0207658_10000449 3300025986 Bacteria 38511
297 Ga0207658_10000595 3300025986 Bacteria 32385
298 Ga0207658_10000679 3300025986 Bacteria 29645
299 Ga0207658_10008227 3300025986 Bacteria 7105
300 Ga0207658_10048169 3300025986 Bacteria 3123
301 Ga0207703_10164472 3300026035 Bacteria 1946
302 Ga0207703_10214004 3300026035 Bacteria 1720
303 Ga0207703_10579400 3300026035 Bacteria 1060
304 Ga0207639_10006131 3300026041 Bacteria 8160
305 Ga0207639_10021526 3300026041 Bacteria 4632
306 Ga0207639_10030885 3300026041 Bacteria 3933
307 Ga0207639_10224048 3300026041 Bacteria 1626
308 Ga0207678_10021313 3300026067 Bacteria 5682
309 Ga0207678_10037542 3300026067 Bacteria 4213
310 Ga0207678_10250879 3300026067 Bacteria 1515
311 Ga0207641_10000278 3300026088 Bacteria 64322
312 Ga0207641_10001106 3300026088 Bacteria 27091
313 Ga0207641_10003363 3300026088 Bacteria 14211
314 Ga0207641_10096267 3300026088 Bacteria 2599
315 Ga0207641_10198814 3300026088 Bacteria 1847
316 Ga0207648_10002032 3300026089 Bacteria 22089
317 Ga0207676_10092629 3300026095 Bacteria 2486
318 Ga0207675_100112485 3300026118 Bacteria 2570
319 Ga0207675_100297085 3300026118 Bacteria 1572
320 Ga0207683_10000040 3300026121 Bacteria 95127
321 Ga0207683_10209660 3300026121 Bacteria 1773
322 Ga0268266_10003565 3300028379 Bacteria 15420
323 Ga0268266_10014025 3300028379 Bacteria 6899
324 Ga0268266_10042527 3300028379 Bacteria 3881
325 Ga0268266_10146845 3300028379 Bacteria 2121
326 Ga0268266_10173470 3300028379 Bacteria 1958
327 Ga0268265_10000023 3300028380 Bacteria 268530
328 Ga0268265_10000051 3300028380 Bacteria 174968
329 Ga0268265_10000056 3300028380 Bacteria 155720
330 Ga0268265_10174703 3300028380 Bacteria 1840
331 Ga0268264_10000053 3300028381 Bacteria 320368
332 Ga0268264_10000099 3300028381 Bacteria 228666
333 Ga0268264_10000108 3300028381 Bacteria 208791
334 Ga0268264_10020195 3300028381 Bacteria 5445
335 Ga0265327_10000630 3300031251 Bacteria 57536
336 Ga0265327_10012693 3300031251 Bacteria 5660
337 Ga0307405_10067237 3300031731 Bacteria 2289
338 Ga0307405_10132250 3300031731 Bacteria 1726
339 Ga0307405_10156019 3300031731 Bacteria 1611
340 Ga0307413_10031846 3300031824 Bacteria 2981
341 Ga0307413_10113536 3300031824 Bacteria 1819
342 Ga0307413_10376274 3300031824 Bacteria 1105
343 Ga0307410_10018047 3300031852 Bacteria 4254
344 Ga0307410_10032993 3300031852 Bacteria 3339
345 Ga0307410_10045074 3300031852 Bacteria 2934
346 Ga0307410_10167929 3300031852 Bacteria 1650
347 Ga0307410_10259290 3300031852 Bacteria 1355
348 Ga0307406_10007792 3300031901 Bacteria 5955
349 Ga0307406_10029271 3300031901 Bacteria 3335
350 Ga0307406_10110940 3300031901 Bacteria 1888
351 Ga0307406_10138102 3300031901 Bacteria 1721
352 Ga0307407_10046930 3300031903 Bacteria 2448
353 Ga0307409_100100343 3300031995 Bacteria 2399
354 Ga0307409_100180745 3300031995 Bacteria 1867
355 Ga0307416_100031989 3300032002 Bacteria 3969
356 Ga0307416_100456204 3300032002 Bacteria 1332
357 Ga0307414_10357049 3300032004 Bacteria 1256
358 Ga0307411_10018444 3300032005 Bacteria 4003
359 Ga0307415_100032524 3300032126 Bacteria 3374
360 Ga0373958_0012687 3300034819 Bacteria 1446
361 Ga0373931_0010168 3300035691 Bacteria 4518
362 Ga0316582_0320732 3300036647 Bacteria 1065
363 Ga0316584_0015591 3300036712 Bacteria 5436
364 Ga0316584_0148448 3300036712 Bacteria 1746
365 Ga0436364_0033137 3300037853 Bacteria 28951
366 Ga0436364_0327816 3300037853 Bacteria 7403
367 Ga0436364_0776939 3300037853 Bacteria 7706
368 Ga0436364_0839430 3300037853 Bacteria 2853
369 Ga0436364_1133117 3300037853 Bacteria 3839
370 Ga0436364_1162640 3300037853 Bacteria 1183
371 Ga0436364_1328828 3300037853 Bacteria 5923
372 Ga0436365_0217155 3300039437 Bacteria 41866
373 Ga0436365_0410802 3300039437 Bacteria 48863
374 Ga0436365_0869447 3300039437 Bacteria 29465
375 Ga0436365_1023426 3300039437 Bacteria 23451
376 Ga0436365_1305825 3300039437 Bacteria 3428
377 Ga0436365_1353958 3300039437 Bacteria 1731
378 Ga0436365_1728003 3300039437 Bacteria 2320
379 Ga0436365_1920643 3300039437 Bacteria 5122
380 Ga0436361_0850467 3300039447 Bacteria 1553
381 Ga0436363_0564114 3300039450 Bacteria 13922
382 Ga0436363_0784449 3300039450 Bacteria 4282
383 Ga0436363_1133793 3300039450 Bacteria 5879
384 Ga0439461_0000386 3300041410 Bacteria 6298
385 Ga0439461_0000426 3300041410 Bacteria 6050
386 Ga0439461_0000796 3300041410 Bacteria 4636
387 Ga0439461_0000868 3300041410 Bacteria 4467
388 Ga0439461_0003852 3300041410 Bacteria 2483
389 Ga0439466_0003931 3300041411 Bacteria 5730
390 Ga0439466_0007490 3300041411 Bacteria 4130
391 Ga0439466_0016817 3300041411 Bacteria 2639
392 Ga0439466_0062648 3300041411 Bacteria 1195
393 Ga0439465_0002323 3300041413 Bacteria 6236
394 Ga0439465_0004304 3300041413 Bacteria 4618
395 Ga0439465_0014618 3300041413 Bacteria 2447
396 Ga0439465_0016749 3300041413 Bacteria 2287
397 Ga0439465_0058489 3300041413 Bacteria 1274
398 Ga0439465_0063919 3300041413 Bacteria 1223
399 Ga0451789_0148697 3300041443 Bacteria 2733
400 Ga0451789_0707226 3300041443 Bacteria 2302
401 Ga0451797_1304083 3300041453 Bacteria 1940
402 Ga0451795_0366770 3300041456 Bacteria 1555
403 Ga0451795_1199720 3300041456 Bacteria 4666
404 Ga0451802_0513608 3300041460 Bacteria 1837
405 Ga0451802_0840566 3300041460 Bacteria 3688
406 Ga0439431_0001293 3300041997 Bacteria 5501
407 Ga0439431_0004428 3300041997 Bacteria 3089
408 Ga0439431_0005145 3300041997 Bacteria 2884
409 Ga0439431_0013964 3300041997 Bacteria 1857
410 Ga0439431_0047118 3300041997 Bacteria 1110
411 Ga0439442_006960 3300042002 Bacteria 2272
412 Ga0439442_011406 3300042002 Bacteria 1810
413 Ga0439445_0001889 3300042004 Bacteria 4614
414 Ga0439445_0006099 3300042004 Bacteria 2764
415 Ga0439445_0034103 3300042004 Bacteria 1332
416 Ga0439445_0056945 3300042004 Bacteria 1063
417 Ga0439448_0084880 3300042005 Bacteria 1066
418 Ga0439434_0006009 3300042435 Bacteria 3543
419 Ga0439434_0006624 3300042435 Bacteria 3388
420 Ga0439460_0075277 3300042461 Bacteria 1052
421 Ga0466969_0084041 3300044656 Bacteria 1515
422 Ga0466969_0136614 3300044656 Bacteria 1135
423 Ga0466972_0007610 3300044658 Bacteria 5438
424 Ga0466972_0009396 3300044658 Bacteria 4912
425 Ga0466972_0011017 3300044658 Bacteria 4539
426 Ga0466972_0012965 3300044658 Bacteria 4188
427 Ga0466972_0014006 3300044658 Bacteria 4021
428 Ga0466972_0026711 3300044658 Bacteria 2860
429 Ga0466965_0000246 3300044683 Bacteria 17427
430 Ga0466965_0001452 3300044683 Bacteria 9575
431 Ga0466965_0003590 3300044683 Bacteria 6829
432 Ga0466965_0005097 3300044683 Bacteria 5895
433 Ga0466965_0015378 3300044683 Bacteria 3635
434 Ga0466965_0019854 3300044683 Bacteria 3227
435 Ga0466966_0000302 3300044684 Bacteria 32466
436 Ga0466966_0010324 3300044684 Bacteria 6199
437 Ga0466966_0013124 3300044684 Bacteria 5486
438 Ga0466966_0028129 3300044684 Bacteria 3663
439 Ga0466961_0014217 3300044693 Bacteria 5109
440 Ga0466961_0027756 3300044693 Bacteria 3641
441 Ga0466961_0080801 3300044693 Bacteria 2057
442 Ga0466961_0323242 3300044693 Bacteria 941
443 Ga0466963_0083271 3300044694 Bacteria 2170
444 Ga0466971_0021081 3300044719 Bacteria 2898
445 Ga0466971_0066359 3300044719 Bacteria 1635
446 Ga0466971_0111585 3300044719 Bacteria 1262
447 Ga0466968_0000108 3300044735 Bacteria 24579
448 Ga0466968_0000471 3300044735 Bacteria 13554
449 Ga0466968_0001160 3300044735 Bacteria 9344
450 Ga0466968_0001353 3300044735 Bacteria 8755
451 Ga0466968_0006237 3300044735 Bacteria 4485
452 Ga0466970_0007094 3300044765 Bacteria 5605
453 Ga0466970_0011766 3300044765 Bacteria 4464
454 Ga0466970_0013275 3300044765 Bacteria 4221
455 Ga0466970_0016648 3300044765 Bacteria 3793
456 Ga0466970_0036457 3300044765 Bacteria 2605
457 Ga0466970_0144904 3300044765 Bacteria 1310
458 Ga0466957_0002467 3300044842 Bacteria 9938
459 Ga0466957_0002759 3300044842 Bacteria 9504
460 Ga0466957_0009809 3300044842 Bacteria 5474
461 Ga0466957_0017116 3300044842 Bacteria 4241
462 Ga0466957_0022462 3300044842 Bacteria 3722
463 Ga0466957_0040777 3300044842 Bacteria 2805
464 Ga0466957_0054378 3300044842 Bacteria 2443
465 Ga0466957_0072143 3300044842 Bacteria 2137
466 Ga0466957_0228464 3300044842 Bacteria 1231
467 Ga0466957_0268502 3300044842 Bacteria 1139
468 Ga0466960_0000084 3300044901 Bacteria 31326
469 Ga0466960_0000196 3300044901 Bacteria 20894
470 Ga0466960_0000346 3300044901 Bacteria 15844
471 Ga0466960_0001105 3300044901 Bacteria 9679
472 Ga0466960_0001609 3300044901 Bacteria 8267
473 Ga0466960_0003532 3300044901 Bacteria 6021
474 Ga0466960_0059086 3300044901 Bacteria 1875
475 Ga0466960_0070375 3300044901 Bacteria 1740
476 Ga0466959_0008207 3300045049 Bacteria 7370
477 Ga0466959_0009475 3300045049 Bacteria 6928
478 Ga0466959_0010988 3300045049 Bacteria 6498
479 Ga0466959_0016474 3300045049 Bacteria 5401
480 Ga0466959_0017121 3300045049 Bacteria 5308
481 Ga0466959_0017475 3300045049 Bacteria 5258
482 Ga0466959_0028423 3300045049 Bacteria 4146
483 Ga0466959_0043353 3300045049 Bacteria 3316
484 Ga0466958_0000426 3300045836 Bacteria 17386
485 Ga0466958_0003206 3300045836 Bacteria 8444
486 Ga0466958_0011212 3300045836 Bacteria 5043
487 Ga0466958_0014966 3300045836 Bacteria 4437
488 Ga0466958_0031320 3300045836 Bacteria 3161
489 Ga0466958_0037539 3300045836 Bacteria 2903
490 Ga0466958_0051534 3300045836 Bacteria 2492
491 Ga0466967_0000693 3300045976 Bacteria 17131
492 Ga0466967_0012158 3300045976 Bacteria 6567
493 Ga0466967_0022841 3300045976 Bacteria 5114
494 Ga0466967_0023010 3300045976 Bacteria 5099
495 Ga0466967_0026345 3300045976 Bacteria 4815
496 Ga0466967_0047539 3300045976 Bacteria 3741
497 Ga0466967_0106649 3300045976 Bacteria 2568
498 Ga0466967_0133236 3300045976 Bacteria 2309
499 Ga0466967_0144643 3300045976 Bacteria 2217
500 Ga0466967_0146524 3300045976 Bacteria 2203
501 Ga0466967_0628222 3300045976 Bacteria 1061
502 Ga0495603_0027201 3300046455 Bacteria 3453
503 Ga0495603_0102480 3300046455 Bacteria 1671
504 Ga0495629_0024776 3300046459 Bacteria 4271
505 Ga0495638_0002356 3300046460 Bacteria 15479
506 Ga0495638_0004222 3300046460 Bacteria 10936
507 Ga0495582_0020061 3300046473 Bacteria 3657
508 Ga0495662_0023707 3300046476 Bacteria 2964
509 Ga0495594_0078457 3300046499 Bacteria 1843
510 Ga0495583_0038040 3300046506 Bacteria 2276
511 Ga0495606_0136554 3300046507 Bacteria 1452
512 Ga0495606_0181315 3300046507 Bacteria 1214
513 Ga0495606_0184396 3300046507 Bacteria 1201
514 Ga0495637_0084401 3300046520 Bacteria 1262
515 Ga0495648_0004819 3300046524 Bacteria 11386
516 Ga0495648_0016941 3300046524 Bacteria 5234
517 Ga0495648_0167588 3300046524 Bacteria 1129
518 Ga0495666_0134937 3300046526 Bacteria 1152
519 Ga0495654_0016783 3300046530 Bacteria 3860
520 Ga0495654_0094733 3300046530 Bacteria 1381
521 Ga0495668_0013112 3300046616 Bacteria 4904
522 Ga0495668_0019379 3300046616 Bacteria 3923
523 Ga0495647_0185932 3300046681 Bacteria 906
524 Ga0495671_0110471 3300046692 Bacteria 1343
525 Ga0495581_0045508 3300047315 Bacteria 2537
526 Ga0495674_0058368 3300047319 Bacteria 3374
527 Ga0495672_0004096 3300047320 Bacteria 12156
528 Ga0495672_0024419 3300047320 Bacteria 3893
529 Ga0495672_0044909 3300047320 Bacteria 2648
530 Ga0495672_0231010 3300047320 Bacteria 908
531 Ga0495673_0001764 3300047469 Bacteria 16470
532 Ga0495673_0002760 3300047469 Bacteria 12021
533 Ga0495673_0003409 3300047469 Bacteria 10497
534 Ga0495686_0000637 3300047472 Bacteria 48296
535 Ga0495686_0004830 3300047472 Bacteria 10881
536 Ga0495686_0006284 3300047472 Bacteria 9138
537 Ga0495686_0079346 3300047472 Bacteria 2007
538 Ga0495593_0004862 3300047673 Bacteria 7977
539 Ga0495593_0027422 3300047673 Bacteria 3136
540 Ga0496100_0000067 3300048903 Bacteria 58703
541 Ga0496100_0000077 3300048903 Bacteria 54852
542 Ga0496100_0000412 3300048903 Bacteria 20666
543 Ga0496100_0002024 3300048903 Bacteria 10145
544 Ga0496100_0014104 3300048903 Bacteria 4631
545 Ga0496100_0016807 3300048903 Bacteria 4304
546 Ga0496100_0019462 3300048903 Bacteria 4051
547 Ga0496100_0154576 3300048903 Bacteria 1639
548 Ga0496100_0281224 3300048903 Bacteria 1240
549 Ga0496101_0000042 3300048904 Bacteria 163148
550 Ga0496101_0000099 3300048904 Bacteria 90235
551 Ga0496101_0000108 3300048904 Bacteria 86290
552 Ga0496101_0000162 3300048904 Bacteria 56970
553 Ga0496101_0004118 3300048904 Bacteria 9103
554 Ga0496101_0004253 3300048904 Bacteria 8982
555 Ga0496101_0006009 3300048904 Bacteria 7785
556 Ga0496101_0006100 3300048904 Bacteria 7739
557 Ga0496101_0012156 3300048904 Bacteria 5738
558 Ga0496101_0013316 3300048904 Bacteria 5507
559 Ga0496101_0019497 3300048904 Bacteria 4630
560 Ga0496101_0041362 3300048904 Bacteria 3286
561 Ga0496101_0085900 3300048904 Bacteria 2332
562 Ga0496101_0279961 3300048904 Bacteria 1303
563 Ga0496102_0000005 3300048905 Bacteria 481937
564 Ga0496102_0000035 3300048905 Bacteria 213557
565 Ga0496102_0000070 3300048905 Bacteria 155087
566 Ga0496102_0000131 3300048905 Bacteria 104032
567 Ga0496102_0004377 3300048905 Bacteria 11928
568 Ga0496102_0004887 3300048905 Bacteria 11347
569 Ga0496102_0020979 3300048905 Bacteria 5777
570 Ga0496102_0026118 3300048905 Bacteria 5205
571 Ga0496102_0062880 3300048905 Bacteria 3398
572 Ga0496102_0065820 3300048905 Bacteria 3322
573 Ga0496102_0092751 3300048905 Bacteria 2797
574 Ga0496102_0142487 3300048905 Bacteria 2248
575 Ga0496102_0166789 3300048905 Bacteria 2072
576 Ga0496102_0212249 3300048905 Bacteria 1825
577 Ga0496103_0000002 3300048906 Bacteria 605387
578 Ga0496103_0000028 3300048906 Bacteria 213660
579 Ga0496103_0000341 3300048906 Bacteria 42518
580 Ga0496103_0000484 3300048906 Bacteria 33254
581 Ga0496103_0000779 3300048906 Bacteria 23459
582 Ga0496103_0004276 3300048906 Bacteria 8677
583 Ga0496103_0010678 3300048906 Bacteria 5433
584 Ga0496103_0020644 3300048906 Bacteria 3958
585 Ga0496104_0001295 3300048907 Bacteria 21567
586 Ga0496104_0008051 3300048907 Bacteria 9349
587 Ga0496104_0088673 3300048907 Bacteria 2955
588 Ga0496105_0012167 3300048908 Bacteria 6813
589 Ga0496105_0019044 3300048908 Bacteria 5532
590 Ga0496105_0155730 3300048908 Bacteria 1877
591 Ga0496105_0304811 3300048908 Bacteria 1280
592 Ga0496106_0002680 3300048909 Bacteria 13226
593 Ga0496106_0004631 3300048909 Bacteria 10203
594 Ga0496106_0005705 3300048909 Bacteria 9208
595 Ga0496106_0020609 3300048909 Bacteria 4895
596 Ga0496106_0021068 3300048909 Bacteria 4839
597 Ga0496106_0030736 3300048909 Bacteria 4003
598 Ga0496106_0031201 3300048909 Bacteria 3971
599 Ga0496106_0140052 3300048909 Bacteria 1902
600 Ga0496107_0000718 3300048910 Bacteria 18910
601 Ga0496107_0012252 3300048910 Bacteria 5985
602 Ga0496107_0028979 3300048910 Bacteria 3937
603 Ga0496107_0030647 3300048910 Bacteria 3834
604 Ga0496107_0055590 3300048910 Bacteria 2858
605 Ga0496107_0065992 3300048910 Bacteria 2624
606 Ga0496107_0072617 3300048910 Bacteria 2501
607 Ga0496107_0075435 3300048910 Bacteria 2454
608 Ga0496107_0098611 3300048910 Bacteria 2140
609 Ga0496108_0006748 3300048911 Bacteria 9294
610 Ga0496108_0034491 3300048911 Bacteria 4205
611 Ga0496108_0052385 3300048911 Bacteria 3420
612 Ga0496108_0112979 3300048911 Bacteria 2324
613 Ga0496108_0141767 3300048911 Bacteria 2071
614 Ga0496109_0000159 3300048912 Bacteria 66124
615 Ga0496109_0000452 3300048912 Bacteria 35174
616 Ga0496109_0011184 3300048912 Bacteria 7702
617 Ga0496109_0037368 3300048912 Bacteria 4387
618 Ga0496109_0146170 3300048912 Bacteria 2212
619 Ga0496109_0378912 3300048912 Bacteria 1336
620 Ga0496110_0004131 3300048913 Bacteria 11221
621 Ga0496110_0054179 3300048913 Bacteria 3527
622 Ga0496110_0106236 3300048913 Bacteria 2519
623 Ga0496110_0112174 3300048913 Bacteria 2451
624 Ga0496110_0115788 3300048913 Bacteria 2413
625 Ga0496111_0027696 3300048914 Bacteria 4012
626 Ga0496111_0088265 3300048914 Bacteria 2271
627 Ga0496111_0125000 3300048914 Bacteria 1901
628 Ga0496112_0000750 3300048915 Bacteria 22692
629 Ga0496112_0002212 3300048915 Bacteria 15511
630 Ga0496112_0010839 3300048915 Bacteria 8295
631 Ga0496112_0012968 3300048915 Bacteria 7681
632 Ga0496112_0014213 3300048915 Bacteria 7377
633 Ga0496112_0020666 3300048915 Bacteria 6244
634 Ga0496112_0026123 3300048915 Bacteria 5614
635 Ga0496112_0036124 3300048915 Bacteria 4818
636 Ga0496112_0050194 3300048915 Bacteria 4091
637 Ga0496112_0062456 3300048915 Bacteria 3674
638 Ga0496112_0133231 3300048915 Bacteria 2456
639 Ga0496112_0242577 3300048915 Bacteria 1754
640 Ga0496113_0003095 3300048916 Bacteria 9879
641 Ga0496113_0030331 3300048916 Bacteria 3914
642 Ga0496113_0059404 3300048916 Bacteria 2880
643 Ga0496113_0060286 3300048916 Bacteria 2860
644 Ga0496113_0157802 3300048916 Bacteria 1792
645 Ga0496113_0163484 3300048916 Bacteria 1760
646 Ga0496113_0630195 3300048916 Bacteria 858
647 Ga0496114_0000116 3300048917 Bacteria 57632
648 Ga0496114_0000319 3300048917 Bacteria 35245
649 Ga0496114_0000848 3300048917 Bacteria 22900
650 Ga0496114_0007296 3300048917 Bacteria 8731
651 Ga0496114_0066904 3300048917 Bacteria 3013
652 Ga0496114_0076627 3300048917 Bacteria 2818
653 Ga0496115_0000807 3300048918 Bacteria 22983
654 Ga0496115_0001191 3300048918 Bacteria 18655
655 Ga0496115_0025602 3300048918 Bacteria 4596
656 Ga0496115_0030309 3300048918 Bacteria 4255
657 Ga0496115_0244881 3300048918 Bacteria 1477
658 Ga0496116_0000034 3300048919 Bacteria 409567
659 Ga0496116_0000090 3300048919 Bacteria 212651
660 Ga0496116_0001408 3300048919 Bacteria 27021
661 Ga0496116_0004012 3300048919 Bacteria 14275
662 Ga0496116_0009583 3300048919 Bacteria 8242
663 Ga0496116_0010238 3300048919 Bacteria 7885
664 Ga0496116_0167328 3300048919 Bacteria 1196
665 Ga0496117_0000003 3300048920 Bacteria 1881097
666 Ga0496117_0000051 3300048920 Bacteria 285716
667 Ga0496117_0000319 3300048920 Bacteria 84245
668 Ga0496117_0001155 3300048920 Bacteria 39752
669 Ga0496117_0006001 3300048920 Bacteria 12506
670 Ga0496118_0000001 3300048921 Bacteria 1881100
671 Ga0496118_0000029 3300048921 Bacteria 340978
672 Ga0496118_0000043 3300048921 Bacteria 285716
673 Ga0496118_0000165 3300048921 Bacteria 119376
674 Ga0496118_0001467 3300048921 Bacteria 35366
675 Ga0496118_0027781 3300048921 Bacteria 4779
676 Ga0496118_0087035 3300048921 Bacteria 2168
677 Ga0496119_0000318 3300048922 Bacteria 67383
678 Ga0496119_0000669 3300048922 Bacteria 45985
679 Ga0496119_0003584 3300048922 Bacteria 16034
680 Ga0496119_0005099 3300048922 Bacteria 12750
681 Ga0496119_0008747 3300048922 Bacteria 8834
682 Ga0496119_0009760 3300048922 Bacteria 8169
683 Ga0496119_0011044 3300048922 Bacteria 7531
684 Ga0496120_0000274 3300048923 Bacteria 86195
685 Ga0496120_0000594 3300048923 Bacteria 54781
686 Ga0496120_0019034 3300048923 Bacteria 4406
687 Ga0496120_0032214 3300048923 Bacteria 3162
688 Ga0496120_0034069 3300048923 Bacteria 3055
689 Ga0496120_0148608 3300048923 Bacteria 1180
690 Ga0496121_0000016 3300048924 Bacteria 562911
691 Ga0496121_0000080 3300048924 Bacteria 230195
692 Ga0496121_0000139 3300048924 Bacteria 163176
693 Ga0496121_0002593 3300048924 Bacteria 27292
694 Ga0496121_0003648 3300048924 Bacteria 21655
695 Ga0496121_0013545 3300048924 Bacteria 8746
696 Ga0496121_0028180 3300048924 Bacteria 5234
697 Ga0496122_0000149 3300048925 Bacteria 163504
698 Ga0496122_0000284 3300048925 Bacteria 113244
699 Ga0496122_0007197 3300048925 Bacteria 12459
700 Ga0496122_0080832 3300048925 Bacteria 2264
701 Ga0496122_0089014 3300048925 Bacteria 2112
702 Ga0496122_0090279 3300048925 Bacteria 2091
703 Ga0496123_0004868 3300048926 Bacteria 13811
704 Ga0496123_0006672 3300048926 Bacteria 11123
705 Ga0496123_0006983 3300048926 Bacteria 10773
706 Ga0496123_0057749 3300048926 Bacteria 2523
707 Ga0496124_0000015 3300048927 Bacteria 460700
708 Ga0496124_0000114 3300048927 Bacteria 165215
709 Ga0496124_0050318 3300048927 Bacteria 3551
710 Ga0496124_0074199 3300048927 Bacteria 2812
711 Ga0496125_0000021 3300048928 Bacteria 460688
712 Ga0496125_0000130 3300048928 Bacteria 163176
713 Ga0496125_0012786 3300048928 Bacteria 8297
714 Ga0496125_0018213 3300048928 Bacteria 6673
715 Ga0496125_0027348 3300048928 Bacteria 5172
716 Ga0496125_0133662 3300048928 Bacteria 1740
717 Ga0496126_0000015 3300048929 Bacteria 663212
718 Ga0496126_0000149 3300048929 Bacteria 163176
719 Ga0496126_0000178 3300048929 Bacteria 145079
720 Ga0496126_0000807 3300048929 Bacteria 56090
721 Ga0496126_0005371 3300048929 Bacteria 14636
722 Ga0496126_0005992 3300048929 Bacteria 13654
723 Ga0496126_0007273 3300048929 Bacteria 12173
724 Ga0496126_0007315 3300048929 Bacteria 12128
725 Ga0496126_0015987 3300048929 Bacteria 7525
726 Ga0496126_0022736 3300048929 Bacteria 6090
727 Ga0501032_0001911 3300049569 Bacteria 16448
728 Ga0501032_0006353 3300049569 Bacteria 8709
729 Ga0501033_0065605 3300049570 Bacteria 2671
730 Ga0501034_0001916 3300049571 Bacteria 26328
731 Ga0501034_0001919 3300049571 Bacteria 26321
732 Ga0501034_0005958 3300049571 Bacteria 13196
733 Ga0501034_0014466 3300049571 Bacteria 8126
734 Ga0501036_0024018 3300049572 Bacteria 5138
735 Ga0501037_0000167 3300049573 Bacteria 61779
736 Ga0501037_0000434 3300049573 Bacteria 34407
737 Ga0501037_0049529 3300049573 Bacteria 3076
738 Ga0501038_0002867 3300049574 Bacteria 16063
739 Ga0501039_0000583 3300049575 Bacteria 26350
740 Ga0501043_0002476 3300049579 Bacteria 15626
741 Ga0501043_0003282 3300049579 Bacteria 13329
742 Ga0501046_0001059 3300049580 Bacteria 26939
743 Ga0501047_0004729 3300049581 Bacteria 12799
744 Ga0501047_0007602 3300049581 Bacteria 10199
745 Ga0501047_0051467 3300049581 Bacteria 3980
746 Ga0501047_0135868 3300049581 Bacteria 2339
747 Ga0501048_0001266 3300049582 Bacteria 19121
748 Ga0501048_0122628 3300049582 Bacteria 1837
749 Ga0501067_0194130 3300049583 Bacteria 1131
750 Ga0501069_0085788 3300049585 Bacteria 1777
751 Ga0501070_0001462 3300049586 Bacteria 21149
752 Ga0501070_0006251 3300049586 Bacteria 10135
753 Ga0501070_0076680 3300049586 Bacteria 2767
754 Ga0501073_0215868 3300049589 Bacteria 1325
755 Ga0501077_0076711 3300049593 Bacteria 2117
756 Ga0501080_0077234 3300049742 Bacteria 3097
757 Ga0501080_0142952 3300049742 Bacteria 2212
758 Ga0501080_0396950 3300049742 Bacteria 1241
759 Ga0501035_0000542 3300049822 Bacteria 41925
760 Ga0501035_0000818 3300049822 Bacteria 33183
761 Ga0501035_0018298 3300049822 Bacteria 6455
762 Ga0501044_0000153 3300049823 Bacteria 85673
763 Ga0501044_0000373 3300049823 Bacteria 56176
764 Ga0501044_0003155 3300049823 Bacteria 18643
765 Ga0501044_0010960 3300049823 Bacteria 9839
766 Ga0501044_0029694 3300049823 Bacteria 5764
767 Ga0501044_0085386 3300049823 Bacteria 3190
768 nmdc:mga03683_24850_c1 3300050489 Bacteria 2347
769 nmdc:mga03683_26274_c1 3300050489 Bacteria 2295
770 nmdc:mga03683_28487_c1 3300050489 Bacteria 2221
771 nmdc:mga03683_32168_c2 3300050489 Bacteria 1675
772 nmdc:mga03683_52334_c1 3300050489 Bacteria 1706
773 nmdc:mga03683_56181_c1 3300050489 Bacteria 1654
774 nmdc:mga03683_69585_c1 3300050489 Bacteria 1502
775 nmdc:mga03n38_14961_c1 3300050490 Bacteria 2988
776 nmdc:mga03n38_20064_c1 3300050490 Bacteria 2668
777 nmdc:mga03n38_2563_c1 3300050490 Bacteria 5647
778 nmdc:mga03n38_30600_c1 3300050490 Bacteria 2265
779 nmdc:mga03n38_34659_c1 3300050490 Bacteria 2157
780 nmdc:mga03n38_36112_c1 3300050490 Bacteria 2123
781 nmdc:mga03n38_38264_c1 3300050490 Bacteria 2074
782 nmdc:mga03n38_57355_c1 3300050490 Bacteria 1761
783 nmdc:mga03n38_57403_c1 3300050490 Bacteria 1760
784 nmdc:mga03n38_59192_c1 3300050490 Bacteria 1738
785 nmdc:mga03n38_611_c1 3300050490 Bacteria 9136
786 nmdc:mga03n38_64893_c1 3300050490 Bacteria 1673
787 nmdc:mga03n38_7217_c1 3300050490 Bacteria 3918
788 nmdc:mga03n38_7409_c1 3300050490 Bacteria 3882
789 nmdc:mga00v17_10441_c1 3300050491 Bacteria 5071
790 nmdc:mga00v17_13704_c1 3300050491 Bacteria 4506
791 nmdc:mga00v17_147916_c1 3300050491 Bacteria 1508
792 nmdc:mga00v17_193254_c1 3300050491 Bacteria 1315
793 nmdc:mga00v17_2146_c1 3300050491 Bacteria 10137
794 nmdc:mga00v17_29528_c1 3300050491 Bacteria 3219
795 nmdc:mga00v17_29653_c2 3300050491 Bacteria 2277
796 nmdc:mga00v17_52686_c1 3300050491 Bacteria 2477
797 nmdc:mga00v17_5821_c1 3300050491 Bacteria 6508
798 nmdc:mga00v17_65935_c1 3300050491 Bacteria 2235
799 nmdc:mga00v17_92137_c1 3300050491 Bacteria 1905
800 nmdc:mga0yw44_104752_c1 3300050492 Bacteria 1806
801 nmdc:mga0yw44_149080_c1 3300050492 Bacteria 1525
802 nmdc:mga0yw44_24933_c1 3300050492 Bacteria 3393
803 nmdc:mga0yw44_25526_c1 3300050492 Bacteria 3361
804 nmdc:mga0yw44_58321_c1 3300050492 Bacteria 2358
805 nmdc:mga0yw44_67315_c1 3300050492 Bacteria 2213
806 nmdc:mga0yw44_79245_c1 3300050492 Bacteria 2055
807 nmdc:mga0yw44_7942_c1 3300050492 Bacteria 5258
808 nmdc:mga0yw44_97225_c1 3300050492 Bacteria 1870
809 nmdc:mga0yw44_973_c1 3300050492 Bacteria 10912
810 nmdc:mga0k408_25200_c1 3300050493 Bacteria 3367
811 nmdc:mga06z11_20181_c1 3300050494 Bacteria 3077
812 nmdc:mga06z11_30343_c1 3300050494 Bacteria 2615
813 nmdc:mga04h51_3469_c1 3300050495 Bacteria 3835
814 nmdc:mga04h51_8193_c1 3300050495 Bacteria 2789
815 nmdc:mga07m45_13146_c1 3300050496 Bacteria 4384
816 nmdc:mga07m45_14446_c1 3300050496 Bacteria 4205
817 nmdc:mga07m45_23230_c1 3300050496 Bacteria 3388
818 nmdc:mga07m45_2381_c2 3300050496 Bacteria 1924
819 nmdc:mga07m45_26614_c1 3300050496 Bacteria 3180
820 nmdc:mga07m45_34805_c1 3300050496 Bacteria 2800
821 nmdc:mga07m45_3674_c1 3300050496 Bacteria 7416
822 nmdc:mga07m45_93155_c1 3300050496 Bacteria 1727
823 nmdc:mga05p37_26956_c1 3300050507 Bacteria 6991
824 nmdc:mga05p37_45271_c1 3300050507 Bacteria 5413
825 nmdc:mga05p37_6127_c1 3300050507 Bacteria 5321
826 nmdc:mga09592_647828_c1 3300050508 Bacteria 902
827 nmdc:mga0qj67_13608_c1 3300050509 Bacteria 6137
828 nmdc:mga0qj67_33040_c1 3300050509 Bacteria 4036
829 nmdc:mga0qj67_74038_c1 3300050509 Bacteria 2721
830 nmdc:mga06r32_148327_c1 3300050510 Bacteria 2323
831 nmdc:mga08y16_107492_c1 3300050511 Bacteria 2904
832 nmdc:mga08y16_366072_c1 3300050511 Bacteria 1479
833 nmdc:mga0sz30_14921_c1 3300050516 Bacteria 2428
834 nmdc:mga0sz30_19876_c1 3300050516 Bacteria 2704
835 nmdc:mga0sz30_2095_c1 3300050516 Bacteria 7124
836 nmdc:mga0sz30_2257_c2 3300050516 Bacteria 3609
837 nmdc:mga0sz30_31158_c1 3300050516 Bacteria 2206
838 nmdc:mga0sz30_3424_c1 3300050516 Bacteria 5715
839 nmdc:mga0sz30_3473_c1 3300050516 Bacteria 5680
840 nmdc:mga0sz30_38546_c1 3300050516 Bacteria 2003
841 nmdc:mga0sz30_39244_c1 3300050516 Bacteria 1986
842 nmdc:mga0sz30_43725_c1 3300050516 Bacteria 1886
843 nmdc:mga0sz30_48159_c1 3300050516 Bacteria 1802
844 nmdc:mga0sz30_4841_c1 3300050516 Bacteria 4900
845 nmdc:mga0sz30_52133_c1 3300050516 Bacteria 1737
846 nmdc:mga0sz30_52440_c1 3300050516 Bacteria 1732
847 nmdc:mga0sz30_6497_c1 3300050516 Bacteria 4341
848 nmdc:mga0sz30_8592_c1 3300050516 Bacteria 3858
849 Ga0500643_011807 3300053087 Bacteria 3162
850 Ga0500643_056975 3300053087 Bacteria 1103
851 Ga0500583_0176602 3300053092 Bacteria 1064
852 Ga0500641_0041678 3300053096 Bacteria 1858
853 Ga0500556_0007416 3300053104 Bacteria 3137
854 Ga0500557_042863 3300053105 Bacteria 1426
855 Ga0500642_0073937 3300053130 Bacteria 1555
856 Ga0500642_0080805 3300053130 Bacteria 1493
857 Ga0500588_0012261 3300053146 Bacteria 2122
858 Ga0500616_0005141 3300053153 Bacteria 8997
859 Ga0500616_0034800 3300053153 Bacteria 2743
860 Ga0500620_089335 3300053155 Bacteria 1073
861 Ga0500645_000006 3300053730 Bacteria 276677
862 Ga0500645_000032 3300053730 Bacteria 119506
863 Ga0587082_021006 3300059504 Bacteria 1063
864 Ga0501082_0322120 3300060353 Bacteria 1347
865 Ga0466962_0008905 3300061719 Bacteria 4811
866 Ga0466962_0013132 3300061719 Bacteria 3985
867 Ga0466962_0029180 3300061719 Bacteria 2640

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046455 Ga0495603_0102480 Ga0495603_0102480_18_818 250
2 3300046681 Ga0495647_0185932 Ga0495647_0185932_60_860 250
3 3300047673 Ga0495593_0027422 Ga0495593_0027422_2222_3022 250
4 3300026067 Ga0207678_10250879 Ga0207678_102508791 255
5 3300041413 Ga0439465_0014618 Ga0439465_0014618_1564_2364 255
6 3300009147 Ga0114129_10018524 Ga0114129_100185248 258
7 3300050507 nmdc:mga05p37_45271_c1 nmdc:mga05p37_45271_c1_1469_2290 258
8 3300050508 nmdc:mga09592_647828_c1 nmdc:mga09592_647828_c1_35_856 258
9 3300050509 nmdc:mga0qj67_33040_c1 nmdc:mga0qj67_33040_c1_2664_3485 258
10 3300006177 Ga0075362_10052817 Ga0075362_100528171 262
11 3300050489 nmdc:mga03683_32168_c2 nmdc:mga03683_32168_c2_792_1613 262
12 3300042005 Ga0439448_0084880 Ga0439448_0084880_185_1054 265
13 3300046507 Ga0495606_0184396 Ga0495606_0184396_76_975 265
14 3300048910 Ga0496107_0065992 Ga0496107_0065992_28_834 265
15 3300048916 Ga0496113_0630195 Ga0496113_0630195_15_827 265
16 3300050492 nmdc:mga0yw44_97225_c1 nmdc:mga0yw44_97225_c1_24_875 265
17 3300044693 Ga0466961_0323242 Ga0466961_0323242_29_904 266
18 3300044842 Ga0466957_0228464 Ga0466957_0228464_73_948 266
19 3300049583 Ga0501067_0194130 Ga0501067_0194130_169_996 266
20 3300061719 Ga0466962_0029180 Ga0466962_0029180_11_886 266
21 3300048913 Ga0496110_0115788 Ga0496110_0115788_1554_2399 270
22 3300006353 Ga0075370_10136363 Ga0075370_101363631 271
23 3300047320 Ga0495672_0231010 Ga0495672_0231010_35_862 271
24 3300006051 Ga0075364_10077310 Ga0075364_100773102 272
25 3300042435 Ga0439434_0006624 Ga0439434_0006624_81_983 272
26 3300005539 Ga0068853_100014908 Ga0068853_1000149086 273
27 3300046616 Ga0495668_0019379 Ga0495668_0019379_63_914 275
28 3300006186 Ga0075369_10000569 Ga0075369_100005699 286
29 3300041411 Ga0439466_0016817 Ga0439466_0016817_294_1244 287
30 3300005539 Ga0068853_100008899 Ga0068853_1000088992 292
31 3300006186 Ga0075369_10084741 Ga0075369_100847411 292
32 3300026041 Ga0207639_10006131 Ga0207639_100061312 292
33 3300031731 Ga0307405_10132250 Ga0307405_101322502 292
34 3300047472 Ga0495686_0006284 Ga0495686_0006284_3743_4705 292
35 3300050491 nmdc:mga00v17_2146_c1 nmdc:mga00v17_2146_c1_359_1306 292
36 3300041443 Ga0451789_0148697 Ga0451789_0148697_1108_2061 294
37 3300041453 Ga0451797_1304083 Ga0451797_1304083_271_1224 294
38 3300041456 Ga0451795_1199720 Ga0451795_1199720_2427_3380 294
39 3300044901 Ga0466960_0070375 Ga0466960_0070375_49_972 294
40 3300021377 Ga0213874_10036841 Ga0213874_100368411 295
41 3300031731 Ga0307405_10156019 Ga0307405_101560191 295
42 3300039450 Ga0436363_0784449 Ga0436363_0784449_3182_4174 295
43 3300009545 Ga0105237_10006567 Ga0105237_100065676 296
44 3300010375 Ga0105239_10027466 Ga0105239_100274666 296
45 3300025972 Ga0207668_10006287 Ga0207668_100062877 296
46 3300039450 Ga0436363_0564114 Ga0436363_0564114_11041_11979 296
47 3300048904 Ga0496101_0000108 Ga0496101_0000108_42088_42987 296
48 3300048905 Ga0496102_0000005 Ga0496102_0000005_85565_86464 296
49 3300048906 Ga0496103_0000002 Ga0496103_0000002_395504_396403 296
50 3300048908 Ga0496105_0304811 Ga0496105_0304811_119_1018 296
51 3300048919 Ga0496116_0000034 Ga0496116_0000034_13431_14330 296
52 3300048920 Ga0496117_0000003 Ga0496117_0000003_987640_988539 296
53 3300048921 Ga0496118_0000001 Ga0496118_0000001_987643_988542 296
54 3300048922 Ga0496119_0000669 Ga0496119_0000669_3004_3903 296
55 3300048923 Ga0496120_0000594 Ga0496120_0000594_11800_12699 296
56 3300048924 Ga0496121_0003648 Ga0496121_0003648_13601_14500 296
57 3300048929 Ga0496126_0000178 Ga0496126_0000178_43226_44125 296
58 3300050516 nmdc:mga0sz30_14921_c1 nmdc:mga0sz30_14921_c1_674_1573 296
59 3300005844 Ga0068862_100267410 Ga0068862_1002674102 297
60 3300028380 Ga0268265_10174703 Ga0268265_101747032 297
61 3300041413 Ga0439465_0063919 Ga0439465_0063919_295_1212 297
62 3300061719 Ga0466962_0013132 Ga0466962_0013132_16_927 297
63 3300006186 Ga0075369_10019166 Ga0075369_100191663 298
64 3300037853 Ga0436364_1133117 Ga0436364_1133117_815_1771 298
65 3300050516 nmdc:mga0sz30_3424_c1 nmdc:mga0sz30_3424_c1_635_1564 298
66 iso_pu_bacteria 2902837492 2902837999 298
67 3300042461 Ga0439460_0075277 Ga0439460_0075277_82_984 299
68 3300044842 Ga0466957_0268502 Ga0466957_0268502_103_1071 300
69 3300045976 Ga0466967_0133236 Ga0466967_0133236_515_1552 300
70 3300048905 Ga0496102_0020979 Ga0496102_0020979_1095_2135 300
71 3300002244 JGI24742J22300_10018751 JGI24742J22300_100187511 301
72 3300006048 Ga0075363_100007474 Ga0075363_1000074743 301
73 3300006177 Ga0075362_10007440 Ga0075362_100074405 301
74 3300006178 Ga0075367_10002349 Ga0075367_100023499 301
75 3300021384 Ga0213876_10015374 Ga0213876_100153745 301
76 3300037853 Ga0436364_0033137 Ga0436364_0033137_9894_10862 301
77 3300039437 Ga0436365_1728003 Ga0436365_1728003_1012_1989 301
78 3300041443 Ga0451789_0707226 Ga0451789_0707226_777_1754 301
79 3300041456 Ga0451795_0366770 Ga0451795_0366770_496_1473 301
80 3300041460 Ga0451802_0513608 Ga0451802_0513608_333_1310 301
81 3300044658 Ga0466972_0014006 Ga0466972_0014006_1399_2328 301
82 3300044765 Ga0466970_0011766 Ga0466970_0011766_87_1016 301
83 3300005436 Ga0070713_100070072 Ga0070713_1000700723 302
84 3300006051 Ga0075364_10006538 Ga0075364_100065383 302
85 3300006186 Ga0075369_10022760 Ga0075369_100227602 302
86 3300006186 Ga0075369_10058395 Ga0075369_100583952 302
87 3300025303 Ga0209051_1002725 Ga0209051_100272510 302
88 3300047472 Ga0495686_0004830 Ga0495686_0004830_9879_10808 302
89 3300050491 nmdc:mga00v17_52686_c1 nmdc:mga00v17_52686_c1_316_1284 302
90 3300050516 nmdc:mga0sz30_31158_c1 nmdc:mga0sz30_31158_c1_450_1430 302
91 3300005434 Ga0070709_10133021 Ga0070709_101330211 303
92 3300031901 Ga0307406_10110940 Ga0307406_101109402 303
93 3300041410 Ga0439461_0000386 Ga0439461_0000386_714_1670 303
94 3300041411 Ga0439466_0007490 Ga0439466_0007490_375_1331 303
95 3300041997 Ga0439431_0047118 Ga0439431_0047118_33_989 303
96 3300042435 Ga0439434_0006009 Ga0439434_0006009_374_1330 303
97 3300044719 Ga0466971_0066359 Ga0466971_0066359_218_1159 303
98 3300053153 Ga0500616_0005141 Ga0500616_0005141_4965_5957 303
99 iso_pu_bacteria 2842134933 2842139885 303
100 3300005337 Ga0070682_100122383 Ga0070682_1001223831 304
101 3300005436 Ga0070713_100127035 Ga0070713_1001270351 304
102 3300006048 Ga0075363_100002254 Ga0075363_1000022543 304
103 3300006844 Ga0075428_100126333 Ga0075428_1001263331 304
104 3300006846 Ga0075430_100066408 Ga0075430_1000664082 304
105 3300006847 Ga0075431_100154206 Ga0075431_1001542062 304
106 3300009551 Ga0105238_10176436 Ga0105238_101764362 304
107 3300031731 Ga0307405_10067237 Ga0307405_100672372 304
108 3300031824 Ga0307413_10376274 Ga0307413_103762741 304
109 3300031901 Ga0307406_10029271 Ga0307406_100292713 304
110 3300031901 Ga0307406_10138102 Ga0307406_101381021 304
111 3300032002 Ga0307416_100456204 Ga0307416_1004562041 304
112 3300041410 Ga0439461_0000426 Ga0439461_0000426_4510_5460 304
113 3300041411 Ga0439466_0003931 Ga0439466_0003931_3040_3990 304
114 3300041997 Ga0439431_0001293 Ga0439431_0001293_4506_5453 304
115 3300041997 Ga0439431_0005145 Ga0439431_0005145_136_1095 304
116 3300042004 Ga0439445_0001889 Ga0439445_0001889_325_1284 304
117 3300048911 Ga0496108_0052385 Ga0496108_0052385_1437_2390 304
118 3300048912 Ga0496109_0146170 Ga0496109_0146170_1057_2010 304
119 3300048915 Ga0496112_0036124 Ga0496112_0036124_1763_2716 304
120 3300049742 Ga0501080_0077234 Ga0501080_0077234_858_1829 304
121 3300005334 Ga0068869_100038195 Ga0068869_1000381953 305
122 3300005335 Ga0070666_10051621 Ga0070666_100516213 305
123 3300005338 Ga0068868_100008755 Ga0068868_1000087557 305
124 3300005364 Ga0070673_100053781 Ga0070673_1000537812 305
125 3300005459 Ga0068867_100065425 Ga0068867_1000654251 305
126 3300005547 Ga0070693_100060565 Ga0070693_1000605652 305
127 3300005578 Ga0068854_100210423 Ga0068854_1002104232 305
128 3300005842 Ga0068858_100103289 Ga0068858_1001032893 305
129 3300005842 Ga0068858_100223992 Ga0068858_1002239922 305
130 3300009553 Ga0105249_10007211 Ga0105249_100072113 305
131 3300025900 Ga0207710_10071286 Ga0207710_100712862 305
132 3300025960 Ga0207651_10340246 Ga0207651_103402461 305
133 3300026035 Ga0207703_10164472 Ga0207703_101644722 305
134 3300026118 Ga0207675_100297085 Ga0207675_1002970853 305
135 3300044658 Ga0466972_0009396 Ga0466972_0009396_1977_2981 305
136 3300044683 Ga0466965_0003590 Ga0466965_0003590_897_1901 305
137 3300044719 Ga0466971_0111585 Ga0466971_0111585_186_1190 305
138 3300044735 Ga0466968_0000108 Ga0466968_0000108_20171_21175 305
139 3300044765 Ga0466970_0016648 Ga0466970_0016648_169_1173 305
140 3300044842 Ga0466957_0054378 Ga0466957_0054378_517_1521 305
141 3300044901 Ga0466960_0003532 Ga0466960_0003532_1267_2271 305
142 3300045049 Ga0466959_0028423 Ga0466959_0028423_2220_3224 305
143 3300045836 Ga0466958_0037539 Ga0466958_0037539_103_1107 305
144 3300046524 Ga0495648_0167588 Ga0495648_0167588_39_956 305
145 3300048903 Ga0496100_0281224 Ga0496100_0281224_114_1121 305
146 3300048904 Ga0496101_0019497 Ga0496101_0019497_2517_3521 305
147 3300048905 Ga0496102_0142487 Ga0496102_0142487_171_1178 305
148 3300048909 Ga0496106_0031201 Ga0496106_0031201_35_1042 305
149 3300048915 Ga0496112_0002212 Ga0496112_0002212_11776_12780 305
150 3300048916 Ga0496113_0030331 Ga0496113_0030331_2662_3666 305
151 3300048916 Ga0496113_0163484 Ga0496113_0163484_640_1587 305
152 3300048925 Ga0496122_0007197 Ga0496122_0007197_6751_7755 305
153 3300048926 Ga0496123_0004868 Ga0496123_0004868_5423_6427 305
154 3300011119 Ga0105246_10318246 Ga0105246_103182461 306
155 3300045049 Ga0466959_0017475 Ga0466959_0017475_3517_4506 306
156 3300046499 Ga0495594_0078457 Ga0495594_0078457_167_1138 306
157 3300046526 Ga0495666_0134937 Ga0495666_0134937_16_987 306
158 3300048904 Ga0496101_0006009 Ga0496101_0006009_4849_5799 306
159 3300048904 Ga0496101_0279961 Ga0496101_0279961_88_1095 306
160 3300048905 Ga0496102_0212249 Ga0496102_0212249_131_1117 306
161 3300048908 Ga0496105_0155730 Ga0496105_0155730_119_1126 306
162 3300048915 Ga0496112_0062456 Ga0496112_0062456_2655_3608 306
163 3300048923 Ga0496120_0019034 Ga0496120_0019034_1633_2583 306
164 3300048924 Ga0496121_0002593 Ga0496121_0002593_12340_13290 306
165 3300048928 Ga0496125_0027348 Ga0496125_0027348_2302_3252 306
166 3300048929 Ga0496126_0007315 Ga0496126_0007315_8696_9646 306
167 3300049581 Ga0501047_0135868 Ga0501047_0135868_97_1035 306
168 3300009177 Ga0105248_10111871 Ga0105248_101118712 307
169 3300011119 Ga0105246_10362621 Ga0105246_103626211 307
170 3300031824 Ga0307413_10113536 Ga0307413_101135362 307
171 3300044658 Ga0466972_0011017 Ga0466972_0011017_3176_4129 307
172 3300044683 Ga0466965_0019854 Ga0466965_0019854_255_1208 307
173 3300044684 Ga0466966_0013124 Ga0466966_0013124_3620_4573 307
174 3300044693 Ga0466961_0014217 Ga0466961_0014217_1974_2927 307
175 3300044719 Ga0466971_0021081 Ga0466971_0021081_246_1199 307
176 3300044765 Ga0466970_0007094 Ga0466970_0007094_4394_5347 307
177 3300044842 Ga0466957_0017116 Ga0466957_0017116_1580_2533 307
178 3300045836 Ga0466958_0014966 Ga0466958_0014966_1899_2852 307
179 3300046524 Ga0495648_0016941 Ga0495648_0016941_510_1466 307
180 3300046530 Ga0495654_0094733 Ga0495654_0094733_13_969 307
181 3300047469 Ga0495673_0002760 Ga0495673_0002760_637_1593 307
182 3300048905 Ga0496102_0000070 Ga0496102_0000070_102575_103528 307
183 3300048906 Ga0496103_0000484 Ga0496103_0000484_5696_6649 307
184 3300048919 Ga0496116_0167328 Ga0496116_0167328_62_1015 307
185 3300048920 Ga0496117_0000319 Ga0496117_0000319_751_1704 307
186 3300048922 Ga0496119_0003584 Ga0496119_0003584_13178_14131 307
187 3300053087 Ga0500643_011807 Ga0500643_011807_427_1383 307
188 3300053155 Ga0500620_089335 Ga0500620_089335_86_1039 307
189 3300061719 Ga0466962_0008905 Ga0466962_0008905_2241_3194 307
190 3300005548 Ga0070665_100307055 Ga0070665_1003070552 308
191 3300005937 Ga0081455_10087542 Ga0081455_100875423 308
192 3300025303 Ga0209051_1000620 Ga0209051_10006202 308
193 3300047472 Ga0495686_0000637 Ga0495686_0000637_13782_14708 308
194 iso_pu_bacteria 2643221715 2644636222 308
195 3300041410 Ga0439461_0000796 Ga0439461_0000796_184_1179 309
196 3300041997 Ga0439431_0013964 Ga0439431_0013964_396_1391 309
197 3300042004 Ga0439445_0006099 Ga0439445_0006099_1737_2732 309
198 3300044658 Ga0466972_0026711 Ga0466972_0026711_526_1497 309
199 3300002077 JGI24744J21845_10009503 JGI24744J21845_100095032 310
200 3300005329 Ga0070683_100096618 Ga0070683_1000966182 310
201 3300005337 Ga0070682_100005205 Ga0070682_1000052055 310
202 3300005337 Ga0070682_100082499 Ga0070682_1000824991 310
203 3300005343 Ga0070687_100099572 Ga0070687_1000995722 310
204 3300005367 Ga0070667_100000909 Ga0070667_10000090921 310
205 3300005455 Ga0070663_100134155 Ga0070663_1001341552 310
206 3300005466 Ga0070685_10063041 Ga0070685_100630412 310
207 3300005539 Ga0068853_100256334 Ga0068853_1002563342 310
208 3300005615 Ga0070702_100117127 Ga0070702_1001171271 310
209 3300005618 Ga0068864_100057810 Ga0068864_1000578102 310
210 3300005834 Ga0068851_10089836 Ga0068851_100898362 310
211 3300006048 Ga0075363_100001338 Ga0075363_1000013384 310
212 3300006048 Ga0075363_100018698 Ga0075363_1000186984 310
213 3300006353 Ga0075370_10022009 Ga0075370_100220093 310
214 3300006353 Ga0075370_10092048 Ga0075370_100920482 310
215 3300009101 Ga0105247_10000328 Ga0105247_100003285 310
216 3300009101 Ga0105247_10012064 Ga0105247_100120643 310
217 3300009174 Ga0105241_10074113 Ga0105241_100741132 310
218 3300009177 Ga0105248_10052591 Ga0105248_100525913 310
219 3300025901 Ga0207688_10062565 Ga0207688_100625652 310
220 3300025903 Ga0207680_10049816 Ga0207680_100498162 310
221 3300025924 Ga0207694_10070232 Ga0207694_100702322 310
222 3300025928 Ga0207700_10065821 Ga0207700_100658213 310
223 3300025986 Ga0207658_10008227 Ga0207658_100082275 310
224 3300034819 Ga0373958_0012687 Ga0373958_0012687_36_998 310
225 3300045976 Ga0466967_0012158 Ga0466967_0012158_874_1848 310
226 3300045976 Ga0466967_0628222 Ga0466967_0628222_40_1023 310
227 3300046507 Ga0495606_0181315 Ga0495606_0181315_146_1111 310
228 3300048903 Ga0496100_0000077 Ga0496100_0000077_45540_46502 310
229 3300048904 Ga0496101_0000042 Ga0496101_0000042_154776_155738 310
230 3300048904 Ga0496101_0006100 Ga0496101_0006100_2697_3659 310
231 3300048905 Ga0496102_0026118 Ga0496102_0026118_3570_4532 310
232 3300048906 Ga0496103_0004276 Ga0496103_0004276_5155_6117 310
233 3300048909 Ga0496106_0005705 Ga0496106_0005705_4738_5700 310
234 3300048910 Ga0496107_0000718 Ga0496107_0000718_4659_5621 310
235 3300048910 Ga0496107_0098611 Ga0496107_0098611_447_1409 310
236 3300048911 Ga0496108_0034491 Ga0496108_0034491_29_991 310
237 3300048912 Ga0496109_0000452 Ga0496109_0000452_26799_27761 310
238 3300048912 Ga0496109_0037368 Ga0496109_0037368_260_1225 310
239 3300048913 Ga0496110_0054179 Ga0496110_0054179_411_1373 310
240 3300048914 Ga0496111_0027696 Ga0496111_0027696_2345_3307 310
241 3300048915 Ga0496112_0000750 Ga0496112_0000750_3029_4006 310
242 3300048915 Ga0496112_0014213 Ga0496112_0014213_5349_6314 310
243 3300048915 Ga0496112_0026123 Ga0496112_0026123_1698_2669 310
244 3300048916 Ga0496113_0003095 Ga0496113_0003095_8323_9294 310
245 3300048917 Ga0496114_0000319 Ga0496114_0000319_3641_4603 310
246 3300048918 Ga0496115_0000807 Ga0496115_0000807_16980_17942 310
247 3300048918 Ga0496115_0244881 Ga0496115_0244881_167_1129 310
248 3300048919 Ga0496116_0004012 Ga0496116_0004012_5812_6774 310
249 3300048921 Ga0496118_0087035 Ga0496118_0087035_1070_2032 310
250 3300048922 Ga0496119_0011044 Ga0496119_0011044_5654_6616 310
251 3300048924 Ga0496121_0000139 Ga0496121_0000139_154776_155738 310
252 3300048925 Ga0496122_0000149 Ga0496122_0000149_155004_155966 310
253 3300048925 Ga0496122_0090279 Ga0496122_0090279_816_1787 310
254 3300048927 Ga0496124_0000114 Ga0496124_0000114_156815_157777 310
255 3300048928 Ga0496125_0000130 Ga0496125_0000130_154776_155738 310
256 3300048929 Ga0496126_0000149 Ga0496126_0000149_7439_8401 310
257 3300048929 Ga0496126_0005371 Ga0496126_0005371_8640_9611 310
258 3300049742 Ga0501080_0396950 Ga0501080_0396950_35_997 310
259 3300050489 nmdc:mga03683_69585_c1 nmdc:mga03683_69585_c1_320_1282 310
260 3300050490 nmdc:mga03n38_2563_c1 nmdc:mga03n38_2563_c1_813_1778 310
261 3300050490 nmdc:mga03n38_57403_c1 nmdc:mga03n38_57403_c1_71_1033 310
262 3300050490 nmdc:mga03n38_64893_c1 nmdc:mga03n38_64893_c1_474_1436 310
263 3300050496 nmdc:mga07m45_26614_c1 nmdc:mga07m45_26614_c1_399_1361 310
264 3300050511 nmdc:mga08y16_366072_c1 nmdc:mga08y16_366072_c1_354_1316 310
265 3300050516 nmdc:mga0sz30_6497_c1 nmdc:mga0sz30_6497_c1_1739_2731 310
266 3300003792 Ga0055540_1000913 Ga0055540_10009138 311
267 3300005843 Ga0068860_100000021 Ga0068860_1000000216 311
268 3300005844 Ga0068862_100000015 Ga0068862_1000000157 311
269 3300006186 Ga0075369_10010217 Ga0075369_100102171 311
270 3300025273 Ga0209673_1029218 Ga0209673_10292182 311
271 3300025303 Ga0209051_1003712 Ga0209051_10037129 311
272 3300025900 Ga0207710_10000078 Ga0207710_100000786 311
273 3300025945 Ga0207679_10092910 Ga0207679_100929102 311
274 3300025961 Ga0207712_10000028 Ga0207712_10000028209 311
275 3300025986 Ga0207658_10000679 Ga0207658_100006792 311
276 3300026121 Ga0207683_10209660 Ga0207683_102096602 311
277 3300028380 Ga0268265_10000023 Ga0268265_100000237 311
278 3300028381 Ga0268264_10000099 Ga0268264_100000996 311
279 3300039437 Ga0436365_0410802 Ga0436365_0410802_35157_36158 311
280 3300048903 Ga0496100_0002024 Ga0496100_0002024_4023_5006 311
281 3300048904 Ga0496101_0004118 Ga0496101_0004118_5322_6305 311
282 3300048907 Ga0496104_0001295 Ga0496104_0001295_12907_13890 311
283 3300048909 Ga0496106_0002680 Ga0496106_0002680_7110_8093 311
284 3300048917 Ga0496114_0000848 Ga0496114_0000848_9474_10457 311
285 3300048918 Ga0496115_0001191 Ga0496115_0001191_6454_7437 311
286 3300048921 Ga0496118_0000029 Ga0496118_0000029_77716_78738 311
287 iso_pu_bacteria 2738541274 2738703914 311
288 iso_pu_bacteria 2738543028 2739330788 311
289 3300006178 Ga0075367_10106939 Ga0075367_101069392 312
290 3300009101 Ga0105247_10034300 Ga0105247_100343003 312
291 3300009176 Ga0105242_10128879 Ga0105242_101288792 312
292 3300013105 Ga0157369_10067305 Ga0157369_100673052 312
293 3300013308 Ga0157375_10103882 Ga0157375_101038822 312
294 3300025899 Ga0207642_10025868 Ga0207642_100258682 312
295 3300025934 Ga0207686_10129084 Ga0207686_101290842 312
296 3300025941 Ga0207711_10062968 Ga0207711_100629682 312
297 3300026088 Ga0207641_10198814 Ga0207641_101988142 312
298 3300041410 Ga0439461_0003852 Ga0439461_0003852_1213_2184 312
299 3300042002 Ga0439442_006960 Ga0439442_006960_10_981 312
300 3300042004 Ga0439445_0034103 Ga0439445_0034103_94_1065 312
301 3300044658 Ga0466972_0012965 Ga0466972_0012965_2744_3688 312
302 3300044683 Ga0466965_0015378 Ga0466965_0015378_2297_3241 312
303 3300044735 Ga0466968_0001353 Ga0466968_0001353_3881_4825 312
304 3300044765 Ga0466970_0013275 Ga0466970_0013275_2004_2948 312
305 3300044842 Ga0466957_0009809 Ga0466957_0009809_1623_2567 312
306 3300044901 Ga0466960_0000346 Ga0466960_0000346_12295_13239 312
307 3300045049 Ga0466959_0016474 Ga0466959_0016474_568_1512 312
308 3300045836 Ga0466958_0051534 Ga0466958_0051534_1257_2201 312
309 3300045976 Ga0466967_0106649 Ga0466967_0106649_365_1309 312
310 3300048915 Ga0496112_0242577 Ga0496112_0242577_477_1421 312
311 3300048916 Ga0496113_0059404 Ga0496113_0059404_466_1410 312
312 3300048925 Ga0496122_0080832 Ga0496122_0080832_213_1157 312
313 3300048926 Ga0496123_0057749 Ga0496123_0057749_1367_2311 312
314 3300048929 Ga0496126_0005992 Ga0496126_0005992_10385_11329 312
315 3300049571 Ga0501034_0014466 Ga0501034_0014466_6708_7712 312
316 3300049581 Ga0501047_0007602 Ga0501047_0007602_6469_7473 312
317 3300049582 Ga0501048_0122628 Ga0501048_0122628_21_1025 312
318 3300049822 Ga0501035_0000818 Ga0501035_0000818_28435_29439 312
319 3300049823 Ga0501044_0000373 Ga0501044_0000373_51300_52304 312
320 3300050490 nmdc:mga03n38_7409_c1 nmdc:mga03n38_7409_c1_2311_3285 312
321 3300050492 nmdc:mga0yw44_58321_c1 nmdc:mga0yw44_58321_c1_620_1594 312
322 3300005353 Ga0070669_100002332 Ga0070669_1000023326 313
323 3300005367 Ga0070667_100000782 Ga0070667_10000078229 313
324 3300005548 Ga0070665_100086922 Ga0070665_1000869223 313
325 3300005617 Ga0068859_100002413 Ga0068859_1000024136 313
326 3300005841 Ga0068863_100012525 Ga0068863_1000125256 313
327 3300006931 Ga0097620_100002413 Ga0097620_1000024136 313
328 3300009101 Ga0105247_10000053 Ga0105247_100000536 313
329 3300009177 Ga0105248_10016483 Ga0105248_100164836 313
330 3300009545 Ga0105237_10010933 Ga0105237_100109335 313
331 3300009553 Ga0105249_10000125 Ga0105249_1000012573 313
332 3300010375 Ga0105239_10136140 Ga0105239_101361403 313
333 3300025923 Ga0207681_10001300 Ga0207681_1000130011 313
334 3300025941 Ga0207711_10010206 Ga0207711_100102062 313
335 3300026088 Ga0207641_10003363 Ga0207641_100033639 313
336 3300028379 Ga0268266_10173470 Ga0268266_101734702 313
337 3300039437 Ga0436365_1023426 Ga0436365_1023426_1126_2157 313
338 3300046460 Ga0495638_0004222 Ga0495638_0004222_8771_9763 313
339 3300048903 Ga0496100_0000412 Ga0496100_0000412_5927_6937 313
340 3300048904 Ga0496101_0004253 Ga0496101_0004253_3635_4600 313
341 3300048905 Ga0496102_0004377 Ga0496102_0004377_4244_5209 313
342 3300048906 Ga0496103_0000341 Ga0496103_0000341_7039_8004 313
343 3300048910 Ga0496107_0012252 Ga0496107_0012252_2914_3879 313
344 3300048919 Ga0496116_0009583 Ga0496116_0009583_2340_3305 313
345 3300048920 Ga0496117_0006001 Ga0496117_0006001_6557_7522 313
346 3300048921 Ga0496118_0001467 Ga0496118_0001467_26906_27871 313
347 3300048922 Ga0496119_0009760 Ga0496119_0009760_6464_7429 313
348 3300048924 Ga0496121_0013545 Ga0496121_0013545_532_1497 313
349 3300048927 Ga0496124_0074199 Ga0496124_0074199_649_1614 313
350 3300048928 Ga0496125_0012786 Ga0496125_0012786_5973_6938 313
351 3300048929 Ga0496126_0007273 Ga0496126_0007273_11140_12105 313
352 3300053096 Ga0500641_0041678 Ga0500641_0041678_624_1616 313
353 3300005937 Ga0081455_10162312 Ga0081455_101623122 314
354 3300006178 Ga0075367_10188789 Ga0075367_101887891 314
355 3300009174 Ga0105241_10382170 Ga0105241_103821701 314
356 3300031251 Ga0265327_10012693 Ga0265327_100126935 314
357 3300048905 Ga0496102_0065820 Ga0496102_0065820_165_1169 314
358 3300006038 Ga0075365_10072393 Ga0075365_100723931 315
359 3300006051 Ga0075364_10150714 Ga0075364_101507141 315
360 3300006186 Ga0075369_10037908 Ga0075369_100379082 315
361 3300006353 Ga0075370_10074386 Ga0075370_100743862 315
362 3300039437 Ga0436365_1353958 Ga0436365_1353958_697_1668 315
363 3300041460 Ga0451802_0840566 Ga0451802_0840566_1375_2355 315
364 3300050490 nmdc:mga03n38_20064_c1 nmdc:mga03n38_20064_c1_827_1858 315
365 3300050496 nmdc:mga07m45_34805_c1 nmdc:mga07m45_34805_c1_712_1689 315
366 3300050496 nmdc:mga07m45_93155_c1 nmdc:mga07m45_93155_c1_295_1326 315
367 3300050516 nmdc:mga0sz30_52440_c1 nmdc:mga0sz30_52440_c1_400_1431 315
368 iso_pu_bacteria 2902792274 2902795254 315
369 iso_pu_bacteria 2902810491 2902815740 315
370 3300039447 Ga0436361_0850467 Ga0436361_0850467_500_1477 316
371 iso_pu_bacteria 2643221687 2644485478 316
372 iso_pu_bacteria 2643221687 2644488338 316
373 iso_pu_bacteria 2643221715 2644634156 316
374 iso_pu_bacteria 2643221715 2644639981 316
375 iso_pu_bacteria 2738541274 2738704322 316
376 iso_pu_bacteria 2738543028 2739331195 316
377 iso_pu_bacteria 2902792274 2902798144 316
378 iso_pu_bacteria 2902799365 2902804466 316
379 iso_pu_bacteria 2902810491 2902811314 316
380 iso_pu_bacteria 2902810491 2902811810 316
381 iso_pu_bacteria 2902837492 2902841431 316
382 3300005844 Ga0068862_100436535 Ga0068862_1004365351 317
383 3300006186 Ga0075369_10001676 Ga0075369_100016762 317
384 3300009147 Ga0114129_10027500 Ga0114129_100275003 317
385 3300021384 Ga0213876_10027794 Ga0213876_100277942 317
386 3300021388 Ga0213875_10011913 Ga0213875_100119131 317
387 3300037853 Ga0436364_0327816 Ga0436364_0327816_2953_3942 317
388 3300039437 Ga0436365_1305825 Ga0436365_1305825_1516_2505 317
389 3300039437 Ga0436365_1920643 Ga0436365_1920643_2507_3493 317
390 3300041413 Ga0439465_0002323 Ga0439465_0002323_1724_2758 317
391 3300041413 Ga0439465_0016749 Ga0439465_0016749_549_1598 317
392 3300041997 Ga0439431_0004428 Ga0439431_0004428_1516_2565 317
393 3300042002 Ga0439442_011406 Ga0439442_011406_13_1062 317
394 3300044658 Ga0466972_0007610 Ga0466972_0007610_3978_4967 317
395 3300044683 Ga0466965_0001452 Ga0466965_0001452_8036_9025 317
396 3300044901 Ga0466960_0000084 Ga0466960_0000084_21379_22368 317
397 3300048905 Ga0496102_0166789 Ga0496102_0166789_852_1886 317
398 3300049581 Ga0501047_0004729 Ga0501047_0004729_2755_3753 317
399 3300049585 Ga0501069_0085788 Ga0501069_0085788_505_1494 317
400 3300050490 nmdc:mga03n38_7217_c1 nmdc:mga03n38_7217_c1_2043_3029 317
401 3300050491 nmdc:mga00v17_29528_c1 nmdc:mga00v17_29528_c1_1474_2460 317
402 3300050492 nmdc:mga0yw44_67315_c1 nmdc:mga0yw44_67315_c1_255_1241 317
403 3300050507 nmdc:mga05p37_26956_c1 nmdc:mga05p37_26956_c1_1893_2930 317
404 3300050509 nmdc:mga0qj67_74038_c1 nmdc:mga0qj67_74038_c1_535_1572 317
405 3300050510 nmdc:mga06r32_148327_c1 nmdc:mga06r32_148327_c1_1266_2303 317
406 3300050516 nmdc:mga0sz30_3473_c1 nmdc:mga0sz30_3473_c1_1184_2173 317
407 3300005435 Ga0070714_100022804 Ga0070714_1000228043 318
408 3300006038 Ga0075365_10216916 Ga0075365_102169161 318
409 3300006048 Ga0075363_100002533 Ga0075363_1000025339 318
410 3300025929 Ga0207664_10150395 Ga0207664_101503952 318
411 3300031852 Ga0307410_10259290 Ga0307410_102592902 318
412 3300050490 nmdc:mga03n38_611_c1 nmdc:mga03n38_611_c1_1954_2925 318
413 3300050491 nmdc:mga00v17_5821_c1 nmdc:mga00v17_5821_c1_5238_6209 318
414 3300050496 nmdc:mga07m45_23230_c1 nmdc:mga07m45_23230_c1_2059_3030 318
415 3300050516 nmdc:mga0sz30_43725_c1 nmdc:mga0sz30_43725_c1_489_1460 318
416 iso_pu_bacteria 2738541264 2738663837 318
417 iso_pu_bacteria 2738541274 2738708649 318
418 iso_pu_bacteria 2738543028 2739335169 318
419 iso_pu_bacteria 2842134933 2842136167 318
420 iso_pu_bacteria 2842134933 2842138769 318
421 iso_pu_bacteria 2902792274 2902799068 318
422 iso_pu_bacteria 2902799365 2902804368 318
423 iso_pu_bacteria 2929212328 2929214406 318
424 iso_pu_bacteria 2929212328 2929218437 318
425 iso_pu_bacteria 2939582691 2939583638 318
426 iso_pu_bacteria 2939582691 2939586296 318
427 3300002073 JGI24745J21846_1007035 JGI24745J21846_10070351 319
428 3300003792 Ga0055540_1003066 Ga0055540_10030665 319
429 3300003792 Ga0055540_1006127 Ga0055540_10061276 319
430 3300003792 Ga0055540_1022773 Ga0055540_10227732 319
431 3300005328 Ga0070676_10017923 Ga0070676_100179234 319
432 3300005334 Ga0068869_100110989 Ga0068869_1001109891 319
433 3300005337 Ga0070682_100143506 Ga0070682_1001435061 319
434 3300005338 Ga0068868_100000582 Ga0068868_1000005822 319
435 3300005347 Ga0070668_100001337 Ga0070668_1000013374 319
436 3300005353 Ga0070669_100001646 Ga0070669_1000016464 319
437 3300005354 Ga0070675_100059332 Ga0070675_1000593322 319
438 3300005355 Ga0070671_100002936 Ga0070671_1000029369 319
439 3300005356 Ga0070674_100050740 Ga0070674_1000507402 319
440 3300005364 Ga0070673_100045830 Ga0070673_1000458303 319
441 3300005367 Ga0070667_100000075 Ga0070667_10000007517 319
442 3300005434 Ga0070709_10088948 Ga0070709_100889482 319
443 3300005437 Ga0070710_10000230 Ga0070710_1000023012 319
444 3300005438 Ga0070701_10002623 Ga0070701_100026232 319
445 3300005439 Ga0070711_100002822 Ga0070711_1000028224 319
446 3300005455 Ga0070663_100025982 Ga0070663_1000259822 319
447 3300005456 Ga0070678_100111460 Ga0070678_1001114602 319
448 3300005457 Ga0070662_100005597 Ga0070662_1000055973 319
449 3300005459 Ga0068867_100002882 Ga0068867_10000288212 319
450 3300005543 Ga0070672_100061252 Ga0070672_1000612522 319
451 3300005545 Ga0070695_100060503 Ga0070695_1000605032 319
452 3300005548 Ga0070665_100005421 Ga0070665_10000542110 319
453 3300005548 Ga0070665_100005636 Ga0070665_10000563611 319
454 3300005563 Ga0068855_100429238 Ga0068855_1004292382 319
455 3300005616 Ga0068852_100079232 Ga0068852_1000792322 319
456 3300005841 Ga0068863_100003502 Ga0068863_1000035023 319
457 3300005842 Ga0068858_100287015 Ga0068858_1002870151 319
458 3300005843 Ga0068860_100000025 Ga0068860_100000025132 319
459 3300005844 Ga0068862_100000045 Ga0068862_100000045132 319
460 3300005937 Ga0081455_10009898 Ga0081455_100098988 319
461 3300005937 Ga0081455_10021426 Ga0081455_100214262 319
462 3300006038 Ga0075365_10026563 Ga0075365_100265632 319
463 3300006038 Ga0075365_10041785 Ga0075365_100417851 319
464 3300006038 Ga0075365_10069646 Ga0075365_100696462 319
465 3300006038 Ga0075365_10253145 Ga0075365_102531451 319
466 3300006042 Ga0075368_10001464 Ga0075368_100014644 319
467 3300006048 Ga0075363_100002179 Ga0075363_1000021792 319
468 3300006048 Ga0075363_100018054 Ga0075363_1000180543 319
469 3300006048 Ga0075363_100061281 Ga0075363_1000612812 319
470 3300006051 Ga0075364_10002509 Ga0075364_1000250910 319
471 3300006051 Ga0075364_10007223 Ga0075364_100072235 319
472 3300006051 Ga0075364_10016845 Ga0075364_100168452 319
473 3300006051 Ga0075364_10064383 Ga0075364_100643832 319
474 3300006051 Ga0075364_10183705 Ga0075364_101837051 319
475 3300006163 Ga0070715_10001069 Ga0070715_100010694 319
476 3300006177 Ga0075362_10006752 Ga0075362_100067523 319
477 3300006177 Ga0075362_10063740 Ga0075362_100637402 319
478 3300006178 Ga0075367_10011089 Ga0075367_100110893 319
479 3300006186 Ga0075369_10008161 Ga0075369_100081612 319
480 3300006186 Ga0075369_10018238 Ga0075369_100182382 319
481 3300006186 Ga0075369_10033391 Ga0075369_100333912 319
482 3300006186 Ga0075369_10038102 Ga0075369_100381022 319
483 3300006186 Ga0075369_10086335 Ga0075369_100863352 319
484 3300006195 Ga0075366_10072830 Ga0075366_100728302 319
485 3300006881 Ga0068865_100006687 Ga0068865_1000066875 319
486 3300009094 Ga0111539_10365206 Ga0111539_103652062 319
487 3300009101 Ga0105247_10000010 Ga0105247_10000010202 319
488 3300009101 Ga0105247_10146870 Ga0105247_101468701 319
489 3300009148 Ga0105243_10145836 Ga0105243_101458362 319
490 3300009177 Ga0105248_10000145 Ga0105248_1000014529 319
491 3300009177 Ga0105248_10023837 Ga0105248_100238374 319
492 3300009545 Ga0105237_10002857 Ga0105237_1000285712 319
493 3300009553 Ga0105249_10000010 Ga0105249_10000010197 319
494 3300010375 Ga0105239_10006382 Ga0105239_100063828 319
495 3300010375 Ga0105239_10160449 Ga0105239_101604492 319
496 3300011119 Ga0105246_10078303 Ga0105246_100783032 319
497 3300013105 Ga0157369_10329888 Ga0157369_103298881 319
498 3300013296 Ga0157374_10065452 Ga0157374_100654523 319
499 3300013306 Ga0163162_10104020 Ga0163162_101040202 319
500 3300014325 Ga0163163_10048829 Ga0163163_100488291 319
501 3300014325 Ga0163163_10073653 Ga0163163_100736533 319
502 3300014968 Ga0157379_10012726 Ga0157379_100127264 319
503 3300014968 Ga0157379_10087121 Ga0157379_100871213 319
504 3300017792 Ga0163161_10010688 Ga0163161_100106883 319
505 3300021377 Ga0213874_10072497 Ga0213874_100724971 319
506 3300021384 Ga0213876_10007576 Ga0213876_100075763 319
507 3300025303 Ga0209051_1002038 Ga0209051_10020386 319
508 3300025303 Ga0209051_1008620 Ga0209051_10086204 319
509 3300025885 Ga0207653_10024221 Ga0207653_100242212 319
510 3300025898 Ga0207692_10073846 Ga0207692_100738462 319
511 3300025900 Ga0207710_10000028 Ga0207710_10000028204 319
512 3300025900 Ga0207710_10005233 Ga0207710_100052332 319
513 3300025904 Ga0207647_10024420 Ga0207647_100244203 319
514 3300025905 Ga0207685_10061835 Ga0207685_100618351 319
515 3300025906 Ga0207699_10030110 Ga0207699_100301102 319
516 3300025907 Ga0207645_10120764 Ga0207645_101207642 319
517 3300025914 Ga0207671_10018297 Ga0207671_100182974 319
518 3300025916 Ga0207663_10079423 Ga0207663_100794232 319
519 3300025919 Ga0207657_10191122 Ga0207657_101911222 319
520 3300025923 Ga0207681_10006641 Ga0207681_100066415 319
521 3300025926 Ga0207659_10023921 Ga0207659_100239213 319
522 3300025927 Ga0207687_10001412 Ga0207687_100014124 319
523 3300025928 Ga0207700_10204086 Ga0207700_102040862 319
524 3300025931 Ga0207644_10012729 Ga0207644_100127294 319
525 3300025935 Ga0207709_10007965 Ga0207709_100079654 319
526 3300025935 Ga0207709_10317721 Ga0207709_103177211 319
527 3300025937 Ga0207669_10000309 Ga0207669_1000030916 319
528 3300025938 Ga0207704_10001181 Ga0207704_1000118114 319
529 3300025940 Ga0207691_10093429 Ga0207691_100934291 319
530 3300025941 Ga0207711_10000069 Ga0207711_100000692 319
531 3300025941 Ga0207711_10064247 Ga0207711_100642473 319
532 3300025942 Ga0207689_10018308 Ga0207689_100183083 319
533 3300025949 Ga0207667_10154898 Ga0207667_101548984 319
534 3300025961 Ga0207712_10000016 Ga0207712_10000016198 319
535 3300025961 Ga0207712_10016281 Ga0207712_100162813 319
536 3300025972 Ga0207668_10000577 Ga0207668_1000057716 319
537 3300025972 Ga0207668_10003056 Ga0207668_100030562 319
538 3300025986 Ga0207658_10000237 Ga0207658_1000023739 319
539 3300025986 Ga0207658_10048169 Ga0207658_100481693 319
540 3300026035 Ga0207703_10214004 Ga0207703_102140042 319
541 3300026041 Ga0207639_10021526 Ga0207639_100215263 319
542 3300026041 Ga0207639_10224048 Ga0207639_102240481 319
543 3300026067 Ga0207678_10037542 Ga0207678_100375422 319
544 3300026088 Ga0207641_10001106 Ga0207641_1000110622 319
545 3300026088 Ga0207641_10096267 Ga0207641_100962672 319
546 3300026089 Ga0207648_10002032 Ga0207648_100020323 319
547 3300026121 Ga0207683_10000040 Ga0207683_1000004086 319
548 3300028379 Ga0268266_10003565 Ga0268266_100035658 319
549 3300028379 Ga0268266_10042527 Ga0268266_100425274 319
550 3300028379 Ga0268266_10146845 Ga0268266_101468452 319
551 3300028380 Ga0268265_10000056 Ga0268265_10000056126 319
552 3300028381 Ga0268264_10000053 Ga0268264_10000053156 319
553 3300028381 Ga0268264_10020195 Ga0268264_100201954 319
554 3300031852 Ga0307410_10018047 Ga0307410_100180472 319
555 3300031852 Ga0307410_10167929 Ga0307410_101679292 319
556 3300031901 Ga0307406_10007792 Ga0307406_100077924 319
557 3300031995 Ga0307409_100180745 Ga0307409_1001807451 319
558 3300035691 Ga0373931_0010168 Ga0373931_0010168_3091_4086 319
559 3300036712 Ga0316584_0015591 Ga0316584_0015591_837_1835 319
560 3300039437 Ga0436365_0217155 Ga0436365_0217155_39454_40476 319
561 3300039450 Ga0436363_1133793 Ga0436363_1133793_3614_4612 319
562 3300041410 Ga0439461_0000868 Ga0439461_0000868_2564_3598 319
563 3300041411 Ga0439466_0062648 Ga0439466_0062648_180_1175 319
564 3300041413 Ga0439465_0004304 Ga0439465_0004304_2341_3336 319
565 3300042004 Ga0439445_0056945 Ga0439445_0056945_29_1033 319
566 3300044656 Ga0466969_0136614 Ga0466969_0136614_134_1123 319
567 3300044683 Ga0466965_0000246 Ga0466965_0000246_7033_8028 319
568 3300044684 Ga0466966_0028129 Ga0466966_0028129_1529_2518 319
569 3300044693 Ga0466961_0080801 Ga0466961_0080801_139_1128 319
570 3300044735 Ga0466968_0000471 Ga0466968_0000471_9188_10177 319
571 3300044735 Ga0466968_0001160 Ga0466968_0001160_4393_5388 319
572 3300044765 Ga0466970_0036457 Ga0466970_0036457_1146_2141 319
573 3300044765 Ga0466970_0144904 Ga0466970_0144904_306_1295 319
574 3300044842 Ga0466957_0022462 Ga0466957_0022462_2524_3519 319
575 3300044901 Ga0466960_0001105 Ga0466960_0001105_4565_5560 319
576 3300045049 Ga0466959_0008207 Ga0466959_0008207_3274_4263 319
577 3300045049 Ga0466959_0009475 Ga0466959_0009475_4946_5941 319
578 3300045836 Ga0466958_0031320 Ga0466958_0031320_1892_2881 319
579 3300045976 Ga0466967_0026345 Ga0466967_0026345_2962_3957 319
580 3300045976 Ga0466967_0047539 Ga0466967_0047539_238_1233 319
581 3300045976 Ga0466967_0146524 Ga0466967_0146524_958_1953 319
582 3300046455 Ga0495603_0027201 Ga0495603_0027201_1806_2804 319
583 3300046459 Ga0495629_0024776 Ga0495629_0024776_1434_2432 319
584 3300046476 Ga0495662_0023707 Ga0495662_0023707_547_1545 319
585 3300046520 Ga0495637_0084401 Ga0495637_0084401_53_1132 319
586 3300046530 Ga0495654_0016783 Ga0495654_0016783_1190_2185 319
587 3300046616 Ga0495668_0013112 Ga0495668_0013112_1612_2607 319
588 3300046692 Ga0495671_0110471 Ga0495671_0110471_187_1182 319
589 3300047315 Ga0495581_0045508 Ga0495581_0045508_800_1798 319
590 3300047319 Ga0495674_0058368 Ga0495674_0058368_255_1253 319
591 3300047320 Ga0495672_0024419 Ga0495672_0024419_2729_3724 319
592 3300047320 Ga0495672_0044909 Ga0495672_0044909_684_1694 319
593 3300047469 Ga0495673_0003409 Ga0495673_0003409_8684_9679 319
594 3300047472 Ga0495686_0079346 Ga0495686_0079346_137_1132 319
595 3300047673 Ga0495593_0004862 Ga0495593_0004862_285_1283 319
596 3300048903 Ga0496100_0014104 Ga0496100_0014104_3309_4304 319
597 3300048903 Ga0496100_0016807 Ga0496100_0016807_81_1076 319
598 3300048903 Ga0496100_0154576 Ga0496100_0154576_177_1172 319
599 3300048904 Ga0496101_0000162 Ga0496101_0000162_52447_53442 319
600 3300048904 Ga0496101_0013316 Ga0496101_0013316_1448_2443 319
601 3300048904 Ga0496101_0085900 Ga0496101_0085900_333_1310 319
602 3300048905 Ga0496102_0000035 Ga0496102_0000035_77682_78677 319
603 3300048905 Ga0496102_0004887 Ga0496102_0004887_360_1355 319
604 3300048906 Ga0496103_0000028 Ga0496103_0000028_134984_135979 319
605 3300048906 Ga0496103_0020644 Ga0496103_0020644_2721_3716 319
606 3300048907 Ga0496104_0008051 Ga0496104_0008051_5192_6187 319
607 3300048907 Ga0496104_0088673 Ga0496104_0088673_1516_2511 319
608 3300048908 Ga0496105_0012167 Ga0496105_0012167_5614_6609 319
609 3300048908 Ga0496105_0019044 Ga0496105_0019044_3822_4817 319
610 3300048909 Ga0496106_0030736 Ga0496106_0030736_2533_3528 319
611 3300048909 Ga0496106_0140052 Ga0496106_0140052_360_1337 319
612 3300048910 Ga0496107_0055590 Ga0496107_0055590_532_1527 319
613 3300048910 Ga0496107_0072617 Ga0496107_0072617_1261_2256 319
614 3300048910 Ga0496107_0075435 Ga0496107_0075435_878_1873 319
615 3300048911 Ga0496108_0141767 Ga0496108_0141767_977_1954 319
616 3300048912 Ga0496109_0011184 Ga0496109_0011184_2207_3202 319
617 3300048912 Ga0496109_0378912 Ga0496109_0378912_26_1045 319
618 3300048913 Ga0496110_0112174 Ga0496110_0112174_659_1654 319
619 3300048914 Ga0496111_0088265 Ga0496111_0088265_932_1951 319
620 3300048915 Ga0496112_0010839 Ga0496112_0010839_3831_4826 319
621 3300048915 Ga0496112_0012968 Ga0496112_0012968_6541_7560 319
622 3300048915 Ga0496112_0050194 Ga0496112_0050194_953_1948 319
623 3300048915 Ga0496112_0133231 Ga0496112_0133231_50_1048 319
624 3300048916 Ga0496113_0157802 Ga0496113_0157802_574_1569 319
625 3300048917 Ga0496114_0007296 Ga0496114_0007296_3788_4783 319
626 3300048917 Ga0496114_0066904 Ga0496114_0066904_1725_2744 319
627 3300048918 Ga0496115_0025602 Ga0496115_0025602_2928_3923 319
628 3300048919 Ga0496116_0000090 Ga0496116_0000090_77682_78677 319
629 3300048920 Ga0496117_0000051 Ga0496117_0000051_77682_78677 319
630 3300048921 Ga0496118_0000043 Ga0496118_0000043_77682_78677 319
631 3300048922 Ga0496119_0000318 Ga0496119_0000318_59785_60780 319
632 3300048923 Ga0496120_0000274 Ga0496120_0000274_16402_17397 319
633 3300048923 Ga0496120_0148608 Ga0496120_0148608_43_1038 319
634 3300048924 Ga0496121_0000080 Ga0496121_0000080_117230_118225 319
635 3300048925 Ga0496122_0089014 Ga0496122_0089014_183_1178 319
636 3300048926 Ga0496123_0006983 Ga0496123_0006983_9364_10359 319
637 3300048928 Ga0496125_0133662 Ga0496125_0133662_258_1268 319
638 3300048929 Ga0496126_0015987 Ga0496126_0015987_3105_4100 319
639 3300050489 nmdc:mga03683_26274_c1 nmdc:mga03683_26274_c1_962_1957 319
640 3300050489 nmdc:mga03683_28487_c1 nmdc:mga03683_28487_c1_554_1597 319
641 3300050489 nmdc:mga03683_52334_c1 nmdc:mga03683_52334_c1_682_1677 319
642 3300050490 nmdc:mga03n38_59192_c1 nmdc:mga03n38_59192_c1_405_1400 319
643 3300050491 nmdc:mga00v17_10441_c1 nmdc:mga00v17_10441_c1_1683_2813 319
644 3300050491 nmdc:mga00v17_65935_c1 nmdc:mga00v17_65935_c1_174_1169 319
645 3300050492 nmdc:mga0yw44_104752_c1 nmdc:mga0yw44_104752_c1_483_1490 319
646 3300050492 nmdc:mga0yw44_149080_c1 nmdc:mga0yw44_149080_c1_290_1285 319
647 3300050492 nmdc:mga0yw44_25526_c1 nmdc:mga0yw44_25526_c1_2073_3083 319
648 3300050492 nmdc:mga0yw44_7942_c1 nmdc:mga0yw44_7942_c1_1854_2849 319
649 3300050493 nmdc:mga0k408_25200_c1 nmdc:mga0k408_25200_c1_413_1408 319
650 3300050494 nmdc:mga06z11_20181_c1 nmdc:mga06z11_20181_c1_2003_3046 319
651 3300050495 nmdc:mga04h51_3469_c1 nmdc:mga04h51_3469_c1_1416_2411 319
652 3300050496 nmdc:mga07m45_14446_c1 nmdc:mga07m45_14446_c1_1132_2175 319
653 3300050507 nmdc:mga05p37_6127_c1 nmdc:mga05p37_6127_c1_1487_2482 319
654 3300050509 nmdc:mga0qj67_13608_c1 nmdc:mga0qj67_13608_c1_5072_6067 319
655 3300050511 nmdc:mga08y16_107492_c1 nmdc:mga08y16_107492_c1_1665_2660 319
656 3300050516 nmdc:mga0sz30_38546_c1 nmdc:mga0sz30_38546_c1_997_1992 319
657 3300050516 nmdc:mga0sz30_52133_c1 nmdc:mga0sz30_52133_c1_115_1110 319
658 3300053087 Ga0500643_056975 Ga0500643_056975_25_1020 319
659 3300053092 Ga0500583_0176602 Ga0500583_0176602_22_1032 319
660 3300053104 Ga0500556_0007416 Ga0500556_0007416_1851_2846 319
661 3300053105 Ga0500557_042863 Ga0500557_042863_103_1113 319
662 3300053153 Ga0500616_0034800 Ga0500616_0034800_1238_2233 319
663 3300053730 Ga0500645_000006 Ga0500645_000006_78777_79787 319
664 iso_pu_bacteria 2929212328 2929215882 319
665 iso_pu_bacteria 2939582691 2939585482 319
666 3300003792 Ga0055540_1000003 Ga0055540_100000328 320
667 3300005329 Ga0070683_100041275 Ga0070683_1000412752 320
668 3300005367 Ga0070667_100006345 Ga0070667_1000063457 320
669 3300006038 Ga0075365_10003210 Ga0075365_100032104 320
670 3300006038 Ga0075365_10004632 Ga0075365_100046322 320
671 3300006051 Ga0075364_10007628 Ga0075364_100076282 320
672 3300006186 Ga0075369_10045390 Ga0075369_100453902 320
673 3300021384 Ga0213876_10081371 Ga0213876_100813712 320
674 3300021388 Ga0213875_10015274 Ga0213875_100152742 320
675 3300021388 Ga0213875_10039674 Ga0213875_100396743 320
676 3300021388 Ga0213875_10040014 Ga0213875_100400142 320
677 3300025294 Ga0209025_1041088 Ga0209025_10410882 320
678 3300025303 Ga0209051_1000011 Ga0209051_1000011568 320
679 3300025903 Ga0207680_10006569 Ga0207680_100065695 320
680 3300025921 Ga0207652_10390088 Ga0207652_103900881 320
681 3300025929 Ga0207664_10124226 Ga0207664_101242261 320
682 3300025986 Ga0207658_10000449 Ga0207658_100004498 320
683 3300031251 Ga0265327_10000630 Ga0265327_1000063042 320
684 3300036647 Ga0316582_0320732 Ga0316582_0320732_16_1011 320
685 3300036712 Ga0316584_0148448 Ga0316584_0148448_255_1250 320
686 3300037853 Ga0436364_0839430 Ga0436364_0839430_1241_2245 320
687 3300037853 Ga0436364_1162640 Ga0436364_1162640_92_1072 320
688 3300037853 Ga0436364_1328828 Ga0436364_1328828_550_1542 320
689 3300039437 Ga0436365_0869447 Ga0436365_0869447_13575_14579 320
690 3300044656 Ga0466969_0084041 Ga0466969_0084041_394_1437 320
691 3300044683 Ga0466965_0005097 Ga0466965_0005097_2849_3856 320
692 3300044684 Ga0466966_0000302 Ga0466966_0000302_16730_17773 320
693 3300044684 Ga0466966_0010324 Ga0466966_0010324_4551_5588 320
694 3300044693 Ga0466961_0027756 Ga0466961_0027756_2106_3098 320
695 3300044694 Ga0466963_0083271 Ga0466963_0083271_1119_2132 320
696 3300044735 Ga0466968_0006237 Ga0466968_0006237_648_1685 320
697 3300044842 Ga0466957_0002467 Ga0466957_0002467_3930_4973 320
698 3300044842 Ga0466957_0002759 Ga0466957_0002759_5459_6451 320
699 3300044842 Ga0466957_0040777 Ga0466957_0040777_726_1751 320
700 3300044842 Ga0466957_0072143 Ga0466957_0072143_721_1713 320
701 3300044901 Ga0466960_0000196 Ga0466960_0000196_2116_3123 320
702 3300044901 Ga0466960_0001609 Ga0466960_0001609_5901_6944 320
703 3300044901 Ga0466960_0059086 Ga0466960_0059086_333_1376 320
704 3300045049 Ga0466959_0010988 Ga0466959_0010988_59_1051 320
705 3300045049 Ga0466959_0017121 Ga0466959_0017121_3808_4845 320
706 3300045049 Ga0466959_0043353 Ga0466959_0043353_296_1339 320
707 3300045836 Ga0466958_0000426 Ga0466958_0000426_8930_9922 320
708 3300045836 Ga0466958_0003206 Ga0466958_0003206_5049_6092 320
709 3300045836 Ga0466958_0011212 Ga0466958_0011212_2520_3557 320
710 3300045976 Ga0466967_0000693 Ga0466967_0000693_517_1560 320
711 3300045976 Ga0466967_0022841 Ga0466967_0022841_662_1687 320
712 3300045976 Ga0466967_0144643 Ga0466967_0144643_260_1249 320
713 3300048903 Ga0496100_0000067 Ga0496100_0000067_18114_19103 320
714 3300048904 Ga0496101_0000099 Ga0496101_0000099_50684_51673 320
715 3300048905 Ga0496102_0062880 Ga0496102_0062880_1754_2743 320
716 3300048906 Ga0496103_0010678 Ga0496103_0010678_4292_5281 320
717 3300048909 Ga0496106_0004631 Ga0496106_0004631_6694_7683 320
718 3300048910 Ga0496107_0028979 Ga0496107_0028979_1239_2228 320
719 3300048911 Ga0496108_0006748 Ga0496108_0006748_2204_3193 320
720 3300048912 Ga0496109_0000159 Ga0496109_0000159_39999_40988 320
721 3300048913 Ga0496110_0004131 Ga0496110_0004131_3706_4695 320
722 3300048917 Ga0496114_0000116 Ga0496114_0000116_50673_51662 320
723 3300048918 Ga0496115_0030309 Ga0496115_0030309_3250_4239 320
724 3300048919 Ga0496116_0001408 Ga0496116_0001408_528_1517 320
725 3300048921 Ga0496118_0027781 Ga0496118_0027781_769_1758 320
726 3300048922 Ga0496119_0008747 Ga0496119_0008747_1974_2963 320
727 3300048924 Ga0496121_0000016 Ga0496121_0000016_326707_327696 320
728 3300048925 Ga0496122_0000284 Ga0496122_0000284_40626_41615 320
729 3300048926 Ga0496123_0006672 Ga0496123_0006672_7055_8044 320
730 3300048927 Ga0496124_0000015 Ga0496124_0000015_50694_51683 320
731 3300048928 Ga0496125_0000021 Ga0496125_0000021_409018_410007 320
732 3300048929 Ga0496126_0000015 Ga0496126_0000015_409018_410007 320
733 3300048929 Ga0496126_0022736 Ga0496126_0022736_2483_3511 320
734 3300049569 Ga0501032_0001911 Ga0501032_0001911_12040_13047 320
735 3300049570 Ga0501033_0065605 Ga0501033_0065605_1482_2504 320
736 3300049571 Ga0501034_0001916 Ga0501034_0001916_17289_18311 320
737 3300049571 Ga0501034_0005958 Ga0501034_0005958_608_1615 320
738 3300049572 Ga0501036_0024018 Ga0501036_0024018_175_1167 320
739 3300049573 Ga0501037_0000434 Ga0501037_0000434_32796_33803 320
740 3300049573 Ga0501037_0049529 Ga0501037_0049529_1361_2383 320
741 3300049579 Ga0501043_0002476 Ga0501043_0002476_2770_3777 320
742 3300049580 Ga0501046_0001059 Ga0501046_0001059_19238_20260 320
743 3300049581 Ga0501047_0051467 Ga0501047_0051467_595_1587 320
744 3300049582 Ga0501048_0001266 Ga0501048_0001266_6018_7040 320
745 3300049586 Ga0501070_0006251 Ga0501070_0006251_608_1615 320
746 3300049589 Ga0501073_0215868 Ga0501073_0215868_69_1076 320
747 3300049742 Ga0501080_0142952 Ga0501080_0142952_1090_2112 320
748 3300049822 Ga0501035_0000542 Ga0501035_0000542_8924_9916 320
749 3300049822 Ga0501035_0018298 Ga0501035_0018298_206_1228 320
750 3300049823 Ga0501044_0000153 Ga0501044_0000153_54015_55007 320
751 3300049823 Ga0501044_0003155 Ga0501044_0003155_6967_7989 320
752 3300049823 Ga0501044_0029694 Ga0501044_0029694_4615_5622 320
753 3300050492 nmdc:mga0yw44_973_c1 nmdc:mga0yw44_973_c1_5702_6742 320
754 3300050496 nmdc:mga07m45_13146_c1 nmdc:mga07m45_13146_c1_1372_2385 320
755 3300050516 nmdc:mga0sz30_2095_c1 nmdc:mga0sz30_2095_c1_5993_7114 320
756 3300050516 nmdc:mga0sz30_48159_c1 nmdc:mga0sz30_48159_c1_278_1261 320
757 3300050516 nmdc:mga0sz30_8592_c1 nmdc:mga0sz30_8592_c1_957_1970 320
758 3300053130 Ga0500642_0073937 Ga0500642_0073937_514_1497 320
759 3300053146 Ga0500588_0012261 Ga0500588_0012261_206_1198 320
760 3300053730 Ga0500645_000032 Ga0500645_000032_95075_96103 320
761 3300005337 Ga0070682_100005205 Ga0070682_1000052054 321
762 3300005366 Ga0070659_100259142 Ga0070659_1002591421 321
763 3300005455 Ga0070663_100017490 Ga0070663_1000174902 321
764 3300005578 Ga0068854_100253224 Ga0068854_1002532242 321
765 3300005841 Ga0068863_100061465 Ga0068863_1000614651 321
766 3300006048 Ga0075363_100003311 Ga0075363_1000033114 321
767 3300006048 Ga0075363_100010144 Ga0075363_1000101444 321
768 3300006048 Ga0075363_100080094 Ga0075363_1000800942 321
769 3300006051 Ga0075364_10018315 Ga0075364_100183153 321
770 3300006051 Ga0075364_10039274 Ga0075364_100392741 321
771 3300006177 Ga0075362_10033425 Ga0075362_100334251 321
772 3300006177 Ga0075362_10035769 Ga0075362_100357692 321
773 3300006178 Ga0075367_10017826 Ga0075367_100178262 321
774 3300006353 Ga0075370_10062688 Ga0075370_100626882 321
775 3300009094 Ga0111539_10603888 Ga0111539_106038882 321
776 3300009098 Ga0105245_10194810 Ga0105245_101948101 321
777 3300025944 Ga0207661_10219687 Ga0207661_102196872 321
778 3300025981 Ga0207640_10179100 Ga0207640_101791002 321
779 3300026067 Ga0207678_10021313 Ga0207678_100213133 321
780 3300031824 Ga0307413_10031846 Ga0307413_100318461 321
781 3300031852 Ga0307410_10032993 Ga0307410_100329933 321
782 3300031903 Ga0307407_10046930 Ga0307407_100469303 321
783 3300031995 Ga0307409_100100343 Ga0307409_1001003432 321
784 3300032002 Ga0307416_100031989 Ga0307416_1000319893 321
785 3300032004 Ga0307414_10357049 Ga0307414_103570492 321
786 3300032005 Ga0307411_10018444 Ga0307411_100184443 321
787 3300032126 Ga0307415_100032524 Ga0307415_1000325243 321
788 3300037853 Ga0436364_0776939 Ga0436364_0776939_5412_6413 321
789 3300041413 Ga0439465_0058489 Ga0439465_0058489_56_1135 321
790 3300045976 Ga0466967_0023010 Ga0466967_0023010_2149_3186 321
791 3300046473 Ga0495582_0020061 Ga0495582_0020061_2040_3104 321
792 3300048904 Ga0496101_0041362 Ga0496101_0041362_2047_3090 321
793 3300048905 Ga0496102_0092751 Ga0496102_0092751_881_1924 321
794 3300048909 Ga0496106_0020609 Ga0496106_0020609_270_1268 321
795 3300048909 Ga0496106_0021068 Ga0496106_0021068_2452_3495 321
796 3300048910 Ga0496107_0030647 Ga0496107_0030647_1692_2735 321
797 3300048915 Ga0496112_0000750 Ga0496112_0000750_1829_2899 321
798 3300048916 Ga0496113_0060286 Ga0496113_0060286_1234_2304 321
799 3300048917 Ga0496114_0076627 Ga0496114_0076627_1265_2308 321
800 3300048923 Ga0496120_0034069 Ga0496120_0034069_809_1885 321
801 3300049586 Ga0501070_0076680 Ga0501070_0076680_305_1351 321
802 3300049823 Ga0501044_0010960 Ga0501044_0010960_8563_9612 321
803 3300050489 nmdc:mga03683_24850_c1 nmdc:mga03683_24850_c1_483_1565 321
804 3300050489 nmdc:mga03683_56181_c1 nmdc:mga03683_56181_c1_355_1440 321
805 3300050490 nmdc:mga03n38_14961_c1 nmdc:mga03n38_14961_c1_157_1245 321
806 3300050490 nmdc:mga03n38_30600_c1 nmdc:mga03n38_30600_c1_747_1832 321
807 3300050490 nmdc:mga03n38_34659_c1 nmdc:mga03n38_34659_c1_513_1595 321
808 3300050490 nmdc:mga03n38_36112_c1 nmdc:mga03n38_36112_c1_279_1367 321
809 3300050490 nmdc:mga03n38_57355_c1 nmdc:mga03n38_57355_c1_357_1439 321
810 3300050491 nmdc:mga00v17_13704_c1 nmdc:mga00v17_13704_c1_1324_2406 321
811 3300050491 nmdc:mga00v17_193254_c1 nmdc:mga00v17_193254_c1_110_1198 321
812 3300050491 nmdc:mga00v17_29653_c2 nmdc:mga00v17_29653_c2_1017_2078 321
813 3300050492 nmdc:mga0yw44_24933_c1 nmdc:mga0yw44_24933_c1_218_1303 321
814 3300050492 nmdc:mga0yw44_79245_c1 nmdc:mga0yw44_79245_c1_202_1284 321
815 3300050494 nmdc:mga06z11_30343_c1 nmdc:mga06z11_30343_c1_617_1699 321
816 3300050495 nmdc:mga04h51_8193_c1 nmdc:mga04h51_8193_c1_514_1596 321
817 3300050496 nmdc:mga07m45_2381_c2 nmdc:mga07m45_2381_c2_39_1124 321
818 3300050496 nmdc:mga07m45_3674_c1 nmdc:mga07m45_3674_c1_6106_7188 321
819 3300050516 nmdc:mga0sz30_39244_c1 nmdc:mga0sz30_39244_c1_827_1909 321
820 3300050516 nmdc:mga0sz30_4841_c1 nmdc:mga0sz30_4841_c1_481_1488 321
821 3300060353 Ga0501082_0322120 Ga0501082_0322120_216_1262 321
822 3300005367 Ga0070667_100018573 Ga0070667_1000185734 322
823 3300005466 Ga0070685_10176080 Ga0070685_101760801 322
824 3300005548 Ga0070665_100040639 Ga0070665_1000406393 322
825 3300005841 Ga0068863_100005817 Ga0068863_1000058171 322
826 3300005937 Ga0081455_10014180 Ga0081455_100141806 322
827 3300006048 Ga0075363_100029014 Ga0075363_1000290144 322
828 3300006051 Ga0075364_10014429 Ga0075364_100144292 322
829 3300006186 Ga0075369_10011905 Ga0075369_100119052 322
830 3300006844 Ga0075428_100008341 Ga0075428_1000083416 322
831 3300006846 Ga0075430_100023419 Ga0075430_1000234195 322
832 3300009177 Ga0105248_10150478 Ga0105248_101504782 322
833 3300025914 Ga0207671_10024065 Ga0207671_100240656 322
834 3300026095 Ga0207676_10092629 Ga0207676_100926292 322
835 3300026118 Ga0207675_100112485 Ga0207675_1001124852 322
836 3300031852 Ga0307410_10045074 Ga0307410_100450743 322
837 3300046460 Ga0495638_0002356 Ga0495638_0002356_7428_8408 322
838 3300046506 Ga0495583_0038040 Ga0495583_0038040_209_1186 322
839 3300046507 Ga0495606_0136554 Ga0495606_0136554_283_1260 322
840 3300046524 Ga0495648_0004819 Ga0495648_0004819_9744_10721 322
841 3300047320 Ga0495672_0004096 Ga0495672_0004096_11000_11977 322
842 3300047469 Ga0495673_0001764 Ga0495673_0001764_13109_14086 322
843 3300048911 Ga0496108_0112979 Ga0496108_0112979_984_2036 322
844 3300048913 Ga0496110_0106236 Ga0496110_0106236_776_1828 322
845 3300048914 Ga0496111_0125000 Ga0496111_0125000_153_1205 322
846 3300048915 Ga0496112_0020666 Ga0496112_0020666_647_1699 322
847 3300049569 Ga0501032_0006353 Ga0501032_0006353_7423_8430 322
848 3300049571 Ga0501034_0001919 Ga0501034_0001919_11852_12859 322
849 3300049573 Ga0501037_0000167 Ga0501037_0000167_35038_36045 322
850 3300049574 Ga0501038_0002867 Ga0501038_0002867_13885_14892 322
851 3300049575 Ga0501039_0000583 Ga0501039_0000583_6175_7182 322
852 3300049579 Ga0501043_0003282 Ga0501043_0003282_4914_5921 322
853 3300049586 Ga0501070_0001462 Ga0501070_0001462_7577_8584 322
854 3300049593 Ga0501077_0076711 Ga0501077_0076711_932_1939 322
855 3300049823 Ga0501044_0085386 Ga0501044_0085386_1896_2903 322
856 3300050490 nmdc:mga03n38_38264_c1 nmdc:mga03n38_38264_c1_165_1214 322
857 3300050491 nmdc:mga00v17_147916_c1 nmdc:mga00v17_147916_c1_417_1487 322
858 3300050491 nmdc:mga00v17_92137_c1 nmdc:mga00v17_92137_c1_154_1203 322
859 3300050516 nmdc:mga0sz30_19876_c1 nmdc:mga0sz30_19876_c1_1178_2227 322
860 3300050516 nmdc:mga0sz30_2257_c2 nmdc:mga0sz30_2257_c2_1750_2724 322
861 3300053130 Ga0500642_0080805 Ga0500642_0080805_204_1184 322
862 3300059504 Ga0587082_021006 Ga0587082_021006_12_1025 322
863 3300000546 LJNas_1006653 LJNas_10066531 323
864 3300005353 Ga0070669_100002998 Ga0070669_10000299812 323
865 3300005367 Ga0070667_100000056 Ga0070667_10000005685 323
866 3300005548 Ga0070665_100003729 Ga0070665_10000372914 323
867 3300005617 Ga0068859_100002568 Ga0068859_10000256813 323
868 3300005841 Ga0068863_100000200 Ga0068863_10000020067 323
869 3300005842 Ga0068858_100065696 Ga0068858_1000656962 323
870 3300005843 Ga0068860_100000092 Ga0068860_10000009271 323
871 3300005844 Ga0068862_100000035 Ga0068862_10000003574 323
872 3300006931 Ga0097620_100002568 Ga0097620_10000256813 323
873 3300009177 Ga0105248_10000036 Ga0105248_1000003684 323
874 3300009553 Ga0105249_10000046 Ga0105249_10000046106 323
875 3300014325 Ga0163163_10125004 Ga0163163_101250044 323
876 3300014968 Ga0157379_10059390 Ga0157379_100593904 323
877 3300025900 Ga0207710_10000060 Ga0207710_10000060122 323
878 3300025923 Ga0207681_10002363 Ga0207681_1000236312 323
879 3300025941 Ga0207711_10000073 Ga0207711_1000007367 323
880 3300025961 Ga0207712_10000042 Ga0207712_1000004275 323
881 3300025986 Ga0207658_10000595 Ga0207658_1000059523 323
882 3300026035 Ga0207703_10579400 Ga0207703_105794001 323
883 3300026041 Ga0207639_10030885 Ga0207639_100308852 323
884 3300026088 Ga0207641_10000278 Ga0207641_100002784 323
885 3300028379 Ga0268266_10014025 Ga0268266_100140256 323
886 3300028380 Ga0268265_10000051 Ga0268265_10000051106 323
887 3300028381 Ga0268264_10000108 Ga0268264_10000108100 323
888 3300048903 Ga0496100_0019462 Ga0496100_0019462_2401_3372 323
889 3300048904 Ga0496101_0012156 Ga0496101_0012156_464_1435 323
890 3300048905 Ga0496102_0000131 Ga0496102_0000131_102597_103568 323
891 3300048906 Ga0496103_0000779 Ga0496103_0000779_13377_14348 323
892 3300048919 Ga0496116_0010238 Ga0496116_0010238_210_1181 323
893 3300048920 Ga0496117_0001155 Ga0496117_0001155_25443_26414 323
894 3300048921 Ga0496118_0000165 Ga0496118_0000165_13211_14182 323
895 3300048922 Ga0496119_0005099 Ga0496119_0005099_6969_7940 323
896 3300048923 Ga0496120_0032214 Ga0496120_0032214_55_1026 323
897 3300048924 Ga0496121_0028180 Ga0496121_0028180_1618_2589 323
898 3300048927 Ga0496124_0050318 Ga0496124_0050318_980_1951 323
899 3300048928 Ga0496125_0018213 Ga0496125_0018213_3188_4159 323
900 3300048929 Ga0496126_0000807 Ga0496126_0000807_9406_10377 323

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00756

Esterase

Putative esterase

97

363

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
4qdz-assembly1.cif.gz_A crystal structure of antigen 85c-e228q mutant 0.9804 45 322
7myg-assembly2.cif.gz_B m. tb ag85c modified by thl-10d 0.974 46 322
5vns-assembly1.cif.gz_A m.tb antigen 85c acyl-enzyme intermediate with tetrahydrolipstatin 0.9736 40 322
4qe3-assembly1.cif.gz_A crystal structure of antigen 85c-h260q mutant 0.9699 45 322
4qdz-assembly1.cif.gz_A crystal structure of antigen 85c-e228q mutant 0.9696 45 322
ID Description Score Start End Superfamily
1va5A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9424 40 322 3.40.50.1820
1va5A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9294 40 322 3.40.50.1820
1r88A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9273 46 323 3.40.50.1820
1r88A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9172 46 323 3.40.50.1820
4h18C00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8978 47 322 3.40.50.1820
ID Description Score Start End GO Terms
AF-P71519-F1-model_v4 32-kDa protein 0.9932 118 254 GO:0005576
GO:0016747
AF-A0A1C9H8U3-F1-model_v4 Mycolyl transferase 85B (EC 2.3.1.122) 0.986 50 243 GO:0005576
GO:0050348
AF-P71519-F1-model_v4 32-kDa protein 0.9859 118 254 GO:0005576
GO:0016747
AF-A0A2S9FLT1-F1-model_v4 Diacylglycerol acyltransferase/mycolyltransferase Ag85A 0.9821 96 246 GO:0005576
GO:0016747
AF-A0A2S8MRB0-F1-model_v4 deleted 0.9807 71 194

Feature Viewer

pLDDT pTM Quality
82.8 0.82 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map