F485156
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 900 | 288 | 867 | 326 |
Family's Representative Sequence
| Representative Sequence | 3300050516|nmdc:mga0sz30_2095_c1|nmdc:mga0sz30_2095_c1_5993_7114 |
| Length | 373 |
| Sequence | MSALGVESGDGIALRVSLTHESDGTAWWNAKKGGLVAVMKFIRKMHAAAARRWSRRLVVSAVTALTLPGLIGFAGGSATAGAFSRPGLPVEYLDVFSPAMNRDIRVQFQGGGPRAVYLLDGLRARDDFSGWDINTPAFEWYYESGLSVVMPVGGQSSFYTDWYQPSRGNGQNYTYKWETFMTQELPAWLEANRGVSQTGNAVVGISMAGSSALTYAIYYPQKFIYAGSLSGFLNPSEGWWPTLIGLAMSDAGGYNAESMWGPTSDPAWRRNDPMININQLVANNTRVWVYCGTGTPSDLDAGSSGGGLAAAQFLEGFTLRTNQTFRDTYIAAGGTNGVFNFPPNGTHSWGYWGQQLLDMKPDIQRVLGAQAAA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2643221687 | Mycobacterium sp. Root135 | Isolate | Unclassified |
| 2 | 2643221715 | Mycobacterium sp. Root265 | Isolate | Unclassified |
| 3 | 2738541264 | Mycobacterium sp. OK889 | Isolate | Unclassified |
| 4 | 2738541274 | Mycobacterium sp. YR708 | Isolate | Unclassified |
| 5 | 2738543028 | Mycobacterium sp. YR782 | Isolate | Unclassified |
| 6 | 2842134933 | Mycolicibacterium obuense SEMIA 442 | Isolate | Nodule |
| 7 | 2902792274 | Mycolicibacterium sp. P9-64 | Isolate | Unclassified |
| 8 | 2902799365 | Mycolicibacterium sp. P1-5 | Isolate | Unclassified |
| 9 | 2902810491 | Mycolicibacterium sp. P9-22 | Isolate | Unclassified |
| 10 | 2902837492 | Mycolicibacterium sp. P1-18 | Isolate | Unclassified |
| 11 | 2929212328 | Mycolicibacterium sp. R-73050 Hybrid assembly | Isolate | Unclassified |
| 12 | 2939582691 | Mycolicibacterium sp. 624 | Isolate | Rhizosphere |
| 13 | 3300000546 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled | Metagenome | Rhizosphere |
| 14 | 3300002073 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 | Metagenome | Rhizosphere |
| 15 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 16 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 17 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 18 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 20 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 21 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 23 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 24 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 25 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 34 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 43 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 44 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 45 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 47 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 50 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 51 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 53 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 54 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 55 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 56 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 57 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 58 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 59 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 60 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 61 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 62 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 63 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 64 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 65 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 66 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 67 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 68 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 69 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 70 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 71 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 72 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 73 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 74 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 75 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 97 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 98 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 99 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 100 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 101 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 102 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 150 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 151 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 152 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 153 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 154 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 155 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 156 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 157 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 158 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 159 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 160 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 161 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 162 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 163 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 164 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 165 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 166 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 167 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 168 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 169 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 170 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 171 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 172 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 173 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 174 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 175 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 176 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 177 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 178 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 179 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 180 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 181 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 182 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 183 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 184 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 185 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 186 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 187 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 188 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 189 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 190 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 191 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 192 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 193 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 194 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 195 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 217 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 218 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 219 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 220 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 221 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 222 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 223 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 224 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 225 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 226 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 227 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 228 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 229 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 230 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 231 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 232 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 233 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 234 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 235 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 236 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 237 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 238 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 239 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 240 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 241 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 242 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 243 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 244 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 245 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 246 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 247 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 248 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 249 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 250 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 251 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 252 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 253 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 254 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 255 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 256 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 257 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 258 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 259 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 260 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 261 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 262 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 263 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 264 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 265 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 266 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 267 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 268 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 269 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 270 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 271 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 272 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 273 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 274 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 275 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 276 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 277 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 278 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 279 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 280 | 3300053105 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere | Metagenome | Endosphere |
| 281 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 282 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 283 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 284 | 3300053155 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere | Metagenome | Endosphere |
| 285 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 286 | 3300059504 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 287 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 288 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 96.44 |
| Metatranscriptomes | 0.11 |
| Isolates | 3.44 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 18.11 |
| Nodule | 0.33 |
| Rhizoplane | 14 |
| Rhizosphere | 54 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 13.56 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | LJNas_1006653 | 3300000546 | Bacteria | 1252 |
| 2 | JGI24745J21846_1007035 | 3300002073 | Bacteria | 1258 |
| 3 | JGI24744J21845_10009503 | 3300002077 | Bacteria | 1994 |
| 4 | JGI24742J22300_10018751 | 3300002244 | Bacteria | 1173 |
| 5 | Ga0055540_1000003 | 3300003792 | Bacteria | 428375 |
| 6 | Ga0055540_1000913 | 3300003792 | Bacteria | 19334 |
| 7 | Ga0055540_1003066 | 3300003792 | Bacteria | 8322 |
| 8 | Ga0055540_1006127 | 3300003792 | Bacteria | 4845 |
| 9 | Ga0055540_1022773 | 3300003792 | Bacteria | 1594 |
| 10 | Ga0070676_10017923 | 3300005328 | Bacteria | 3920 |
| 11 | Ga0070683_100041275 | 3300005329 | Bacteria | 4244 |
| 12 | Ga0070683_100096618 | 3300005329 | Bacteria | 2779 |
| 13 | Ga0068869_100038195 | 3300005334 | Bacteria | 3420 |
| 14 | Ga0068869_100110989 | 3300005334 | Bacteria | 2086 |
| 15 | Ga0070666_10051621 | 3300005335 | Bacteria | 2770 |
| 16 | Ga0070682_100005205 | 3300005337 | Bacteria | 7236 |
| 17 | Ga0070682_100082499 | 3300005337 | Bacteria | 2084 |
| 18 | Ga0070682_100122383 | 3300005337 | Bacteria | 1749 |
| 19 | Ga0070682_100143506 | 3300005337 | Bacteria | 1630 |
| 20 | Ga0068868_100000582 | 3300005338 | Bacteria | 24501 |
| 21 | Ga0068868_100008755 | 3300005338 | Bacteria | 7248 |
| 22 | Ga0070687_100099572 | 3300005343 | Bacteria | 1625 |
| 23 | Ga0070668_100001337 | 3300005347 | Bacteria | 17610 |
| 24 | Ga0070669_100001646 | 3300005353 | Bacteria | 16179 |
| 25 | Ga0070669_100002332 | 3300005353 | Bacteria | 13721 |
| 26 | Ga0070669_100002998 | 3300005353 | Bacteria | 12164 |
| 27 | Ga0070675_100059332 | 3300005354 | Bacteria | 3156 |
| 28 | Ga0070671_100002936 | 3300005355 | Bacteria | 13260 |
| 29 | Ga0070674_100050740 | 3300005356 | Bacteria | 2857 |
| 30 | Ga0070673_100045830 | 3300005364 | Bacteria | 3393 |
| 31 | Ga0070673_100053781 | 3300005364 | Bacteria | 3164 |
| 32 | Ga0070659_100259142 | 3300005366 | Bacteria | 1443 |
| 33 | Ga0070667_100000056 | 3300005367 | Bacteria | 150952 |
| 34 | Ga0070667_100000075 | 3300005367 | Bacteria | 120953 |
| 35 | Ga0070667_100000782 | 3300005367 | Bacteria | 29910 |
| 36 | Ga0070667_100000909 | 3300005367 | Bacteria | 27344 |
| 37 | Ga0070667_100006345 | 3300005367 | Bacteria | 9830 |
| 38 | Ga0070667_100018573 | 3300005367 | Bacteria | 5768 |
| 39 | Ga0070709_10088948 | 3300005434 | Bacteria | 2032 |
| 40 | Ga0070709_10133021 | 3300005434 | Bacteria | 1700 |
| 41 | Ga0070714_100022804 | 3300005435 | Bacteria | 5136 |
| 42 | Ga0070713_100070072 | 3300005436 | Bacteria | 2959 |
| 43 | Ga0070713_100127035 | 3300005436 | Bacteria | 2244 |
| 44 | Ga0070710_10000230 | 3300005437 | Bacteria | 26115 |
| 45 | Ga0070701_10002623 | 3300005438 | Bacteria | 6960 |
| 46 | Ga0070711_100002822 | 3300005439 | Bacteria | 9972 |
| 47 | Ga0070663_100017490 | 3300005455 | Bacteria | 4681 |
| 48 | Ga0070663_100025982 | 3300005455 | Bacteria | 3960 |
| 49 | Ga0070663_100134155 | 3300005455 | Bacteria | 1884 |
| 50 | Ga0070678_100111460 | 3300005456 | Bacteria | 2141 |
| 51 | Ga0070662_100005597 | 3300005457 | Bacteria | 8030 |
| 52 | Ga0068867_100002882 | 3300005459 | Bacteria | 12102 |
| 53 | Ga0068867_100065425 | 3300005459 | Bacteria | 2705 |
| 54 | Ga0070685_10063041 | 3300005466 | Bacteria | 2175 |
| 55 | Ga0070685_10176080 | 3300005466 | Bacteria | 1374 |
| 56 | Ga0068853_100008899 | 3300005539 | Bacteria | 8079 |
| 57 | Ga0068853_100014908 | 3300005539 | Bacteria | 6384 |
| 58 | Ga0068853_100256334 | 3300005539 | Bacteria | 1607 |
| 59 | Ga0070672_100061252 | 3300005543 | Bacteria | 2966 |
| 60 | Ga0070695_100060503 | 3300005545 | Bacteria | 2454 |
| 61 | Ga0070693_100060565 | 3300005547 | Bacteria | 2198 |
| 62 | Ga0070665_100003729 | 3300005548 | Bacteria | 16134 |
| 63 | Ga0070665_100005421 | 3300005548 | Bacteria | 13155 |
| 64 | Ga0070665_100005636 | 3300005548 | Bacteria | 12873 |
| 65 | Ga0070665_100040639 | 3300005548 | Bacteria | 4674 |
| 66 | Ga0070665_100086922 | 3300005548 | Bacteria | 3132 |
| 67 | Ga0070665_100307055 | 3300005548 | Bacteria | 1590 |
| 68 | Ga0068855_100429238 | 3300005563 | Bacteria | 1445 |
| 69 | Ga0068854_100210423 | 3300005578 | Bacteria | 1533 |
| 70 | Ga0068854_100253224 | 3300005578 | Bacteria | 1407 |
| 71 | Ga0070702_100117127 | 3300005615 | Bacteria | 1662 |
| 72 | Ga0068852_100079232 | 3300005616 | Bacteria | 2909 |
| 73 | Ga0068859_100002413 | 3300005617 | Bacteria | 19034 |
| 74 | Ga0068859_100002568 | 3300005617 | Bacteria | 18446 |
| 75 | Ga0068864_100057810 | 3300005618 | Bacteria | 3351 |
| 76 | Ga0068851_10089836 | 3300005834 | Bacteria | 1616 |
| 77 | Ga0068863_100000200 | 3300005841 | Bacteria | 63948 |
| 78 | Ga0068863_100003502 | 3300005841 | Bacteria | 15485 |
| 79 | Ga0068863_100005817 | 3300005841 | Bacteria | 12088 |
| 80 | Ga0068863_100012525 | 3300005841 | Bacteria | 8182 |
| 81 | Ga0068863_100061465 | 3300005841 | Bacteria | 3551 |
| 82 | Ga0068858_100065696 | 3300005842 | Bacteria | 3357 |
| 83 | Ga0068858_100103289 | 3300005842 | Bacteria | 2659 |
| 84 | Ga0068858_100223992 | 3300005842 | Bacteria | 1782 |
| 85 | Ga0068858_100287015 | 3300005842 | Bacteria | 1568 |
| 86 | Ga0068860_100000021 | 3300005843 | Bacteria | 282612 |
| 87 | Ga0068860_100000025 | 3300005843 | Bacteria | 271553 |
| 88 | Ga0068860_100000092 | 3300005843 | Bacteria | 150190 |
| 89 | Ga0068862_100000015 | 3300005844 | Bacteria | 250184 |
| 90 | Ga0068862_100000035 | 3300005844 | Bacteria | 174953 |
| 91 | Ga0068862_100000045 | 3300005844 | Bacteria | 155641 |
| 92 | Ga0068862_100267410 | 3300005844 | Bacteria | 1563 |
| 93 | Ga0068862_100436535 | 3300005844 | Bacteria | 1232 |
| 94 | Ga0081455_10009898 | 3300005937 | Bacteria | 9755 |
| 95 | Ga0081455_10014180 | 3300005937 | Bacteria | 7827 |
| 96 | Ga0081455_10021426 | 3300005937 | Bacteria | 6062 |
| 97 | Ga0081455_10087542 | 3300005937 | Bacteria | 2534 |
| 98 | Ga0081455_10162312 | 3300005937 | Bacteria | 1711 |
| 99 | Ga0075365_10003210 | 3300006038 | Bacteria | 8360 |
| 100 | Ga0075365_10004632 | 3300006038 | Bacteria | 7319 |
| 101 | Ga0075365_10026563 | 3300006038 | Bacteria | 3677 |
| 102 | Ga0075365_10041785 | 3300006038 | Bacteria | 2996 |
| 103 | Ga0075365_10069646 | 3300006038 | Bacteria | 2364 |
| 104 | Ga0075365_10072393 | 3300006038 | Bacteria | 2321 |
| 105 | Ga0075365_10216916 | 3300006038 | Bacteria | 1342 |
| 106 | Ga0075365_10253145 | 3300006038 | Bacteria | 1238 |
| 107 | Ga0075368_10001464 | 3300006042 | Bacteria | 7559 |
| 108 | Ga0075363_100001338 | 3300006048 | Bacteria | 9242 |
| 109 | Ga0075363_100002179 | 3300006048 | Bacteria | 7892 |
| 110 | Ga0075363_100002254 | 3300006048 | Bacteria | 7808 |
| 111 | Ga0075363_100002533 | 3300006048 | Bacteria | 7497 |
| 112 | Ga0075363_100003311 | 3300006048 | Bacteria | 6826 |
| 113 | Ga0075363_100007474 | 3300006048 | Bacteria | 5027 |
| 114 | Ga0075363_100010144 | 3300006048 | Bacteria | 4456 |
| 115 | Ga0075363_100018054 | 3300006048 | Bacteria | 3508 |
| 116 | Ga0075363_100018698 | 3300006048 | Bacteria | 3456 |
| 117 | Ga0075363_100029014 | 3300006048 | Bacteria | 2853 |
| 118 | Ga0075363_100061281 | 3300006048 | Bacteria | 2027 |
| 119 | Ga0075363_100080094 | 3300006048 | Bacteria | 1785 |
| 120 | Ga0075364_10002509 | 3300006051 | Bacteria | 10275 |
| 121 | Ga0075364_10006538 | 3300006051 | Bacteria | 6856 |
| 122 | Ga0075364_10007223 | 3300006051 | Bacteria | 6583 |
| 123 | Ga0075364_10007628 | 3300006051 | Bacteria | 6433 |
| 124 | Ga0075364_10014429 | 3300006051 | Bacteria | 4882 |
| 125 | Ga0075364_10016845 | 3300006051 | Bacteria | 4552 |
| 126 | Ga0075364_10018315 | 3300006051 | Bacteria | 4382 |
| 127 | Ga0075364_10039274 | 3300006051 | Bacteria | 3068 |
| 128 | Ga0075364_10064383 | 3300006051 | Bacteria | 2406 |
| 129 | Ga0075364_10077310 | 3300006051 | Bacteria | 2197 |
| 130 | Ga0075364_10150714 | 3300006051 | Bacteria | 1567 |
| 131 | Ga0075364_10183705 | 3300006051 | Bacteria | 1416 |
| 132 | Ga0070715_10001069 | 3300006163 | Bacteria | 7760 |
| 133 | Ga0075362_10006752 | 3300006177 | Bacteria | 4290 |
| 134 | Ga0075362_10007440 | 3300006177 | Bacteria | 4148 |
| 135 | Ga0075362_10033425 | 3300006177 | Bacteria | 2237 |
| 136 | Ga0075362_10035769 | 3300006177 | Bacteria | 2169 |
| 137 | Ga0075362_10052817 | 3300006177 | Bacteria | 1822 |
| 138 | Ga0075362_10063740 | 3300006177 | Bacteria | 1672 |
| 139 | Ga0075367_10002349 | 3300006178 | Bacteria | 8606 |
| 140 | Ga0075367_10011089 | 3300006178 | Bacteria | 4754 |
| 141 | Ga0075367_10017826 | 3300006178 | Bacteria | 3904 |
| 142 | Ga0075367_10106939 | 3300006178 | Bacteria | 1714 |
| 143 | Ga0075367_10188789 | 3300006178 | Bacteria | 1286 |
| 144 | Ga0075369_10000569 | 3300006186 | Bacteria | 11663 |
| 145 | Ga0075369_10001676 | 3300006186 | Bacteria | 7639 |
| 146 | Ga0075369_10008161 | 3300006186 | Bacteria | 4019 |
| 147 | Ga0075369_10010217 | 3300006186 | Bacteria | 3668 |
| 148 | Ga0075369_10011905 | 3300006186 | Bacteria | 3428 |
| 149 | Ga0075369_10018238 | 3300006186 | Bacteria | 2856 |
| 150 | Ga0075369_10019166 | 3300006186 | Bacteria | 2792 |
| 151 | Ga0075369_10022760 | 3300006186 | Bacteria | 2586 |
| 152 | Ga0075369_10033391 | 3300006186 | Bacteria | 2180 |
| 153 | Ga0075369_10037908 | 3300006186 | Bacteria | 2055 |
| 154 | Ga0075369_10038102 | 3300006186 | Bacteria | 2050 |
| 155 | Ga0075369_10045390 | 3300006186 | Bacteria | 1889 |
| 156 | Ga0075369_10058395 | 3300006186 | Bacteria | 1680 |
| 157 | Ga0075369_10084741 | 3300006186 | Bacteria | 1409 |
| 158 | Ga0075369_10086335 | 3300006186 | Bacteria | 1397 |
| 159 | Ga0075366_10072830 | 3300006195 | Bacteria | 2048 |
| 160 | Ga0075370_10022009 | 3300006353 | Bacteria | 3495 |
| 161 | Ga0075370_10062688 | 3300006353 | Bacteria | 2118 |
| 162 | Ga0075370_10074386 | 3300006353 | Bacteria | 1947 |
| 163 | Ga0075370_10092048 | 3300006353 | Bacteria | 1750 |
| 164 | Ga0075370_10136363 | 3300006353 | Bacteria | 1434 |
| 165 | Ga0075428_100008341 | 3300006844 | Bacteria | 11489 |
| 166 | Ga0075428_100126333 | 3300006844 | Bacteria | 2783 |
| 167 | Ga0075430_100023419 | 3300006846 | Bacteria | 5256 |
| 168 | Ga0075430_100066408 | 3300006846 | Bacteria | 3029 |
| 169 | Ga0075431_100154206 | 3300006847 | Bacteria | 2364 |
| 170 | Ga0068865_100006687 | 3300006881 | Bacteria | 7052 |
| 171 | Ga0097620_100002413 | 3300006931 | Bacteria | 19034 |
| 172 | Ga0097620_100002568 | 3300006931 | Bacteria | 18446 |
| 173 | Ga0111539_10365206 | 3300009094 | Bacteria | 1680 |
| 174 | Ga0111539_10603888 | 3300009094 | Bacteria | 1278 |
| 175 | Ga0105245_10194810 | 3300009098 | Bacteria | 1943 |
| 176 | Ga0105247_10000010 | 3300009101 | Bacteria | 302475 |
| 177 | Ga0105247_10000053 | 3300009101 | Bacteria | 141244 |
| 178 | Ga0105247_10000328 | 3300009101 | Bacteria | 41940 |
| 179 | Ga0105247_10012064 | 3300009101 | Bacteria | 5191 |
| 180 | Ga0105247_10034300 | 3300009101 | Bacteria | 3091 |
| 181 | Ga0105247_10146870 | 3300009101 | Bacteria | 1550 |
| 182 | Ga0114129_10018524 | 3300009147 | Bacteria | 9912 |
| 183 | Ga0114129_10027500 | 3300009147 | Bacteria | 8052 |
| 184 | Ga0105243_10145836 | 3300009148 | Bacteria | 2025 |
| 185 | Ga0105241_10074113 | 3300009174 | Bacteria | 2650 |
| 186 | Ga0105241_10382170 | 3300009174 | Bacteria | 1231 |
| 187 | Ga0105242_10128879 | 3300009176 | Bacteria | 2181 |
| 188 | Ga0105248_10000036 | 3300009177 | Bacteria | 187421 |
| 189 | Ga0105248_10000145 | 3300009177 | Bacteria | 81917 |
| 190 | Ga0105248_10016483 | 3300009177 | Bacteria | 8134 |
| 191 | Ga0105248_10023837 | 3300009177 | Bacteria | 6802 |
| 192 | Ga0105248_10052591 | 3300009177 | Bacteria | 4570 |
| 193 | Ga0105248_10111871 | 3300009177 | Bacteria | 3080 |
| 194 | Ga0105248_10150478 | 3300009177 | Bacteria | 2626 |
| 195 | Ga0105237_10002857 | 3300009545 | Bacteria | 21003 |
| 196 | Ga0105237_10006567 | 3300009545 | Bacteria | 12864 |
| 197 | Ga0105237_10010933 | 3300009545 | Bacteria | 9630 |
| 198 | Ga0105238_10176436 | 3300009551 | Bacteria | 2114 |
| 199 | Ga0105249_10000010 | 3300009553 | Bacteria | 306939 |
| 200 | Ga0105249_10000046 | 3300009553 | Bacteria | 176363 |
| 201 | Ga0105249_10000125 | 3300009553 | Bacteria | 103728 |
| 202 | Ga0105249_10007211 | 3300009553 | Bacteria | 9699 |
| 203 | Ga0105239_10006382 | 3300010375 | Bacteria | 13698 |
| 204 | Ga0105239_10027466 | 3300010375 | Bacteria | 6265 |
| 205 | Ga0105239_10136140 | 3300010375 | Bacteria | 2735 |
| 206 | Ga0105239_10160449 | 3300010375 | Bacteria | 2512 |
| 207 | Ga0105246_10078303 | 3300011119 | Bacteria | 2347 |
| 208 | Ga0105246_10318246 | 3300011119 | Bacteria | 1263 |
| 209 | Ga0105246_10362621 | 3300011119 | Bacteria | 1191 |
| 210 | Ga0157369_10067305 | 3300013105 | Bacteria | 3851 |
| 211 | Ga0157369_10329888 | 3300013105 | Bacteria | 1585 |
| 212 | Ga0157374_10065452 | 3300013296 | Bacteria | 3414 |
| 213 | Ga0163162_10104020 | 3300013306 | Bacteria | 2933 |
| 214 | Ga0157375_10103882 | 3300013308 | Bacteria | 2929 |
| 215 | Ga0163163_10048829 | 3300014325 | Bacteria | 4163 |
| 216 | Ga0163163_10073653 | 3300014325 | Bacteria | 3406 |
| 217 | Ga0163163_10125004 | 3300014325 | Bacteria | 2609 |
| 218 | Ga0157379_10012726 | 3300014968 | Bacteria | 7355 |
| 219 | Ga0157379_10059390 | 3300014968 | Bacteria | 3419 |
| 220 | Ga0157379_10087121 | 3300014968 | Bacteria | 2800 |
| 221 | Ga0163161_10010688 | 3300017792 | Bacteria | 6356 |
| 222 | Ga0213874_10036841 | 3300021377 | Bacteria | 1444 |
| 223 | Ga0213874_10072497 | 3300021377 | Bacteria | 1101 |
| 224 | Ga0213876_10007576 | 3300021384 | Bacteria | 5895 |
| 225 | Ga0213876_10015374 | 3300021384 | Bacteria | 4051 |
| 226 | Ga0213876_10027794 | 3300021384 | Bacteria | 2983 |
| 227 | Ga0213876_10081371 | 3300021384 | Bacteria | 1713 |
| 228 | Ga0213875_10011913 | 3300021388 | Bacteria | 4312 |
| 229 | Ga0213875_10015274 | 3300021388 | Bacteria | 3737 |
| 230 | Ga0213875_10039674 | 3300021388 | Bacteria | 2218 |
| 231 | Ga0213875_10040014 | 3300021388 | Bacteria | 2208 |
| 232 | Ga0209673_1029218 | 3300025273 | Bacteria | 1758 |
| 233 | Ga0209025_1041088 | 3300025294 | Bacteria | 1987 |
| 234 | Ga0209051_1000011 | 3300025303 | Bacteria | 610828 |
| 235 | Ga0209051_1000620 | 3300025303 | Bacteria | 40785 |
| 236 | Ga0209051_1002038 | 3300025303 | Bacteria | 15354 |
| 237 | Ga0209051_1002725 | 3300025303 | Bacteria | 12261 |
| 238 | Ga0209051_1003712 | 3300025303 | Bacteria | 9843 |
| 239 | Ga0209051_1008620 | 3300025303 | Bacteria | 5371 |
| 240 | Ga0207653_10024221 | 3300025885 | Bacteria | 1937 |
| 241 | Ga0207692_10073846 | 3300025898 | Bacteria | 1805 |
| 242 | Ga0207642_10025868 | 3300025899 | Bacteria | 2381 |
| 243 | Ga0207710_10000028 | 3300025900 | Bacteria | 304525 |
| 244 | Ga0207710_10000060 | 3300025900 | Bacteria | 168230 |
| 245 | Ga0207710_10000078 | 3300025900 | Bacteria | 141062 |
| 246 | Ga0207710_10005233 | 3300025900 | Bacteria | 5607 |
| 247 | Ga0207710_10071286 | 3300025900 | Bacteria | 1594 |
| 248 | Ga0207688_10062565 | 3300025901 | Bacteria | 2098 |
| 249 | Ga0207680_10006569 | 3300025903 | Bacteria | 5635 |
| 250 | Ga0207680_10049816 | 3300025903 | Bacteria | 2495 |
| 251 | Ga0207647_10024420 | 3300025904 | Bacteria | 3985 |
| 252 | Ga0207685_10061835 | 3300025905 | Bacteria | 1486 |
| 253 | Ga0207699_10030110 | 3300025906 | Bacteria | 3034 |
| 254 | Ga0207645_10120764 | 3300025907 | Bacteria | 1701 |
| 255 | Ga0207671_10018297 | 3300025914 | Bacteria | 5378 |
| 256 | Ga0207671_10024065 | 3300025914 | Bacteria | 4584 |
| 257 | Ga0207663_10079423 | 3300025916 | Bacteria | 2142 |
| 258 | Ga0207657_10191122 | 3300025919 | Bacteria | 1651 |
| 259 | Ga0207652_10390088 | 3300025921 | Bacteria | 1257 |
| 260 | Ga0207681_10001300 | 3300025923 | Bacteria | 16118 |
| 261 | Ga0207681_10002363 | 3300025923 | Bacteria | 11994 |
| 262 | Ga0207681_10006641 | 3300025923 | Bacteria | 7103 |
| 263 | Ga0207694_10070232 | 3300025924 | Bacteria | 2736 |
| 264 | Ga0207659_10023921 | 3300025926 | Bacteria | 4086 |
| 265 | Ga0207687_10001412 | 3300025927 | Bacteria | 16409 |
| 266 | Ga0207700_10065821 | 3300025928 | Bacteria | 2767 |
| 267 | Ga0207700_10204086 | 3300025928 | Bacteria | 1667 |
| 268 | Ga0207664_10124226 | 3300025929 | Bacteria | 2164 |
| 269 | Ga0207664_10150395 | 3300025929 | Bacteria | 1977 |
| 270 | Ga0207644_10012729 | 3300025931 | Bacteria | 5593 |
| 271 | Ga0207686_10129084 | 3300025934 | Bacteria | 1731 |
| 272 | Ga0207709_10007965 | 3300025935 | Bacteria | 5870 |
| 273 | Ga0207709_10317721 | 3300025935 | Bacteria | 1164 |
| 274 | Ga0207669_10000309 | 3300025937 | Bacteria | 22278 |
| 275 | Ga0207704_10001181 | 3300025938 | Bacteria | 11638 |
| 276 | Ga0207691_10093429 | 3300025940 | Bacteria | 2693 |
| 277 | Ga0207711_10000069 | 3300025941 | Bacteria | 115038 |
| 278 | Ga0207711_10000073 | 3300025941 | Bacteria | 107878 |
| 279 | Ga0207711_10010206 | 3300025941 | Bacteria | 7797 |
| 280 | Ga0207711_10062968 | 3300025941 | Bacteria | 3201 |
| 281 | Ga0207711_10064247 | 3300025941 | Bacteria | 3170 |
| 282 | Ga0207689_10018308 | 3300025942 | Bacteria | 5912 |
| 283 | Ga0207661_10219687 | 3300025944 | Bacteria | 1679 |
| 284 | Ga0207679_10092910 | 3300025945 | Bacteria | 2338 |
| 285 | Ga0207667_10154898 | 3300025949 | Bacteria | 2358 |
| 286 | Ga0207651_10340246 | 3300025960 | Bacteria | 1260 |
| 287 | Ga0207712_10000016 | 3300025961 | Bacteria | 343014 |
| 288 | Ga0207712_10000028 | 3300025961 | Bacteria | 250190 |
| 289 | Ga0207712_10000042 | 3300025961 | Bacteria | 176338 |
| 290 | Ga0207712_10016281 | 3300025961 | Bacteria | 4811 |
| 291 | Ga0207668_10000577 | 3300025972 | Bacteria | 22902 |
| 292 | Ga0207668_10003056 | 3300025972 | Bacteria | 9814 |
| 293 | Ga0207668_10006287 | 3300025972 | Bacteria | 7020 |
| 294 | Ga0207640_10179100 | 3300025981 | Bacteria | 1588 |
| 295 | Ga0207658_10000237 | 3300025986 | Bacteria | 58047 |
| 296 | Ga0207658_10000449 | 3300025986 | Bacteria | 38511 |
| 297 | Ga0207658_10000595 | 3300025986 | Bacteria | 32385 |
| 298 | Ga0207658_10000679 | 3300025986 | Bacteria | 29645 |
| 299 | Ga0207658_10008227 | 3300025986 | Bacteria | 7105 |
| 300 | Ga0207658_10048169 | 3300025986 | Bacteria | 3123 |
| 301 | Ga0207703_10164472 | 3300026035 | Bacteria | 1946 |
| 302 | Ga0207703_10214004 | 3300026035 | Bacteria | 1720 |
| 303 | Ga0207703_10579400 | 3300026035 | Bacteria | 1060 |
| 304 | Ga0207639_10006131 | 3300026041 | Bacteria | 8160 |
| 305 | Ga0207639_10021526 | 3300026041 | Bacteria | 4632 |
| 306 | Ga0207639_10030885 | 3300026041 | Bacteria | 3933 |
| 307 | Ga0207639_10224048 | 3300026041 | Bacteria | 1626 |
| 308 | Ga0207678_10021313 | 3300026067 | Bacteria | 5682 |
| 309 | Ga0207678_10037542 | 3300026067 | Bacteria | 4213 |
| 310 | Ga0207678_10250879 | 3300026067 | Bacteria | 1515 |
| 311 | Ga0207641_10000278 | 3300026088 | Bacteria | 64322 |
| 312 | Ga0207641_10001106 | 3300026088 | Bacteria | 27091 |
| 313 | Ga0207641_10003363 | 3300026088 | Bacteria | 14211 |
| 314 | Ga0207641_10096267 | 3300026088 | Bacteria | 2599 |
| 315 | Ga0207641_10198814 | 3300026088 | Bacteria | 1847 |
| 316 | Ga0207648_10002032 | 3300026089 | Bacteria | 22089 |
| 317 | Ga0207676_10092629 | 3300026095 | Bacteria | 2486 |
| 318 | Ga0207675_100112485 | 3300026118 | Bacteria | 2570 |
| 319 | Ga0207675_100297085 | 3300026118 | Bacteria | 1572 |
| 320 | Ga0207683_10000040 | 3300026121 | Bacteria | 95127 |
| 321 | Ga0207683_10209660 | 3300026121 | Bacteria | 1773 |
| 322 | Ga0268266_10003565 | 3300028379 | Bacteria | 15420 |
| 323 | Ga0268266_10014025 | 3300028379 | Bacteria | 6899 |
| 324 | Ga0268266_10042527 | 3300028379 | Bacteria | 3881 |
| 325 | Ga0268266_10146845 | 3300028379 | Bacteria | 2121 |
| 326 | Ga0268266_10173470 | 3300028379 | Bacteria | 1958 |
| 327 | Ga0268265_10000023 | 3300028380 | Bacteria | 268530 |
| 328 | Ga0268265_10000051 | 3300028380 | Bacteria | 174968 |
| 329 | Ga0268265_10000056 | 3300028380 | Bacteria | 155720 |
| 330 | Ga0268265_10174703 | 3300028380 | Bacteria | 1840 |
| 331 | Ga0268264_10000053 | 3300028381 | Bacteria | 320368 |
| 332 | Ga0268264_10000099 | 3300028381 | Bacteria | 228666 |
| 333 | Ga0268264_10000108 | 3300028381 | Bacteria | 208791 |
| 334 | Ga0268264_10020195 | 3300028381 | Bacteria | 5445 |
| 335 | Ga0265327_10000630 | 3300031251 | Bacteria | 57536 |
| 336 | Ga0265327_10012693 | 3300031251 | Bacteria | 5660 |
| 337 | Ga0307405_10067237 | 3300031731 | Bacteria | 2289 |
| 338 | Ga0307405_10132250 | 3300031731 | Bacteria | 1726 |
| 339 | Ga0307405_10156019 | 3300031731 | Bacteria | 1611 |
| 340 | Ga0307413_10031846 | 3300031824 | Bacteria | 2981 |
| 341 | Ga0307413_10113536 | 3300031824 | Bacteria | 1819 |
| 342 | Ga0307413_10376274 | 3300031824 | Bacteria | 1105 |
| 343 | Ga0307410_10018047 | 3300031852 | Bacteria | 4254 |
| 344 | Ga0307410_10032993 | 3300031852 | Bacteria | 3339 |
| 345 | Ga0307410_10045074 | 3300031852 | Bacteria | 2934 |
| 346 | Ga0307410_10167929 | 3300031852 | Bacteria | 1650 |
| 347 | Ga0307410_10259290 | 3300031852 | Bacteria | 1355 |
| 348 | Ga0307406_10007792 | 3300031901 | Bacteria | 5955 |
| 349 | Ga0307406_10029271 | 3300031901 | Bacteria | 3335 |
| 350 | Ga0307406_10110940 | 3300031901 | Bacteria | 1888 |
| 351 | Ga0307406_10138102 | 3300031901 | Bacteria | 1721 |
| 352 | Ga0307407_10046930 | 3300031903 | Bacteria | 2448 |
| 353 | Ga0307409_100100343 | 3300031995 | Bacteria | 2399 |
| 354 | Ga0307409_100180745 | 3300031995 | Bacteria | 1867 |
| 355 | Ga0307416_100031989 | 3300032002 | Bacteria | 3969 |
| 356 | Ga0307416_100456204 | 3300032002 | Bacteria | 1332 |
| 357 | Ga0307414_10357049 | 3300032004 | Bacteria | 1256 |
| 358 | Ga0307411_10018444 | 3300032005 | Bacteria | 4003 |
| 359 | Ga0307415_100032524 | 3300032126 | Bacteria | 3374 |
| 360 | Ga0373958_0012687 | 3300034819 | Bacteria | 1446 |
| 361 | Ga0373931_0010168 | 3300035691 | Bacteria | 4518 |
| 362 | Ga0316582_0320732 | 3300036647 | Bacteria | 1065 |
| 363 | Ga0316584_0015591 | 3300036712 | Bacteria | 5436 |
| 364 | Ga0316584_0148448 | 3300036712 | Bacteria | 1746 |
| 365 | Ga0436364_0033137 | 3300037853 | Bacteria | 28951 |
| 366 | Ga0436364_0327816 | 3300037853 | Bacteria | 7403 |
| 367 | Ga0436364_0776939 | 3300037853 | Bacteria | 7706 |
| 368 | Ga0436364_0839430 | 3300037853 | Bacteria | 2853 |
| 369 | Ga0436364_1133117 | 3300037853 | Bacteria | 3839 |
| 370 | Ga0436364_1162640 | 3300037853 | Bacteria | 1183 |
| 371 | Ga0436364_1328828 | 3300037853 | Bacteria | 5923 |
| 372 | Ga0436365_0217155 | 3300039437 | Bacteria | 41866 |
| 373 | Ga0436365_0410802 | 3300039437 | Bacteria | 48863 |
| 374 | Ga0436365_0869447 | 3300039437 | Bacteria | 29465 |
| 375 | Ga0436365_1023426 | 3300039437 | Bacteria | 23451 |
| 376 | Ga0436365_1305825 | 3300039437 | Bacteria | 3428 |
| 377 | Ga0436365_1353958 | 3300039437 | Bacteria | 1731 |
| 378 | Ga0436365_1728003 | 3300039437 | Bacteria | 2320 |
| 379 | Ga0436365_1920643 | 3300039437 | Bacteria | 5122 |
| 380 | Ga0436361_0850467 | 3300039447 | Bacteria | 1553 |
| 381 | Ga0436363_0564114 | 3300039450 | Bacteria | 13922 |
| 382 | Ga0436363_0784449 | 3300039450 | Bacteria | 4282 |
| 383 | Ga0436363_1133793 | 3300039450 | Bacteria | 5879 |
| 384 | Ga0439461_0000386 | 3300041410 | Bacteria | 6298 |
| 385 | Ga0439461_0000426 | 3300041410 | Bacteria | 6050 |
| 386 | Ga0439461_0000796 | 3300041410 | Bacteria | 4636 |
| 387 | Ga0439461_0000868 | 3300041410 | Bacteria | 4467 |
| 388 | Ga0439461_0003852 | 3300041410 | Bacteria | 2483 |
| 389 | Ga0439466_0003931 | 3300041411 | Bacteria | 5730 |
| 390 | Ga0439466_0007490 | 3300041411 | Bacteria | 4130 |
| 391 | Ga0439466_0016817 | 3300041411 | Bacteria | 2639 |
| 392 | Ga0439466_0062648 | 3300041411 | Bacteria | 1195 |
| 393 | Ga0439465_0002323 | 3300041413 | Bacteria | 6236 |
| 394 | Ga0439465_0004304 | 3300041413 | Bacteria | 4618 |
| 395 | Ga0439465_0014618 | 3300041413 | Bacteria | 2447 |
| 396 | Ga0439465_0016749 | 3300041413 | Bacteria | 2287 |
| 397 | Ga0439465_0058489 | 3300041413 | Bacteria | 1274 |
| 398 | Ga0439465_0063919 | 3300041413 | Bacteria | 1223 |
| 399 | Ga0451789_0148697 | 3300041443 | Bacteria | 2733 |
| 400 | Ga0451789_0707226 | 3300041443 | Bacteria | 2302 |
| 401 | Ga0451797_1304083 | 3300041453 | Bacteria | 1940 |
| 402 | Ga0451795_0366770 | 3300041456 | Bacteria | 1555 |
| 403 | Ga0451795_1199720 | 3300041456 | Bacteria | 4666 |
| 404 | Ga0451802_0513608 | 3300041460 | Bacteria | 1837 |
| 405 | Ga0451802_0840566 | 3300041460 | Bacteria | 3688 |
| 406 | Ga0439431_0001293 | 3300041997 | Bacteria | 5501 |
| 407 | Ga0439431_0004428 | 3300041997 | Bacteria | 3089 |
| 408 | Ga0439431_0005145 | 3300041997 | Bacteria | 2884 |
| 409 | Ga0439431_0013964 | 3300041997 | Bacteria | 1857 |
| 410 | Ga0439431_0047118 | 3300041997 | Bacteria | 1110 |
| 411 | Ga0439442_006960 | 3300042002 | Bacteria | 2272 |
| 412 | Ga0439442_011406 | 3300042002 | Bacteria | 1810 |
| 413 | Ga0439445_0001889 | 3300042004 | Bacteria | 4614 |
| 414 | Ga0439445_0006099 | 3300042004 | Bacteria | 2764 |
| 415 | Ga0439445_0034103 | 3300042004 | Bacteria | 1332 |
| 416 | Ga0439445_0056945 | 3300042004 | Bacteria | 1063 |
| 417 | Ga0439448_0084880 | 3300042005 | Bacteria | 1066 |
| 418 | Ga0439434_0006009 | 3300042435 | Bacteria | 3543 |
| 419 | Ga0439434_0006624 | 3300042435 | Bacteria | 3388 |
| 420 | Ga0439460_0075277 | 3300042461 | Bacteria | 1052 |
| 421 | Ga0466969_0084041 | 3300044656 | Bacteria | 1515 |
| 422 | Ga0466969_0136614 | 3300044656 | Bacteria | 1135 |
| 423 | Ga0466972_0007610 | 3300044658 | Bacteria | 5438 |
| 424 | Ga0466972_0009396 | 3300044658 | Bacteria | 4912 |
| 425 | Ga0466972_0011017 | 3300044658 | Bacteria | 4539 |
| 426 | Ga0466972_0012965 | 3300044658 | Bacteria | 4188 |
| 427 | Ga0466972_0014006 | 3300044658 | Bacteria | 4021 |
| 428 | Ga0466972_0026711 | 3300044658 | Bacteria | 2860 |
| 429 | Ga0466965_0000246 | 3300044683 | Bacteria | 17427 |
| 430 | Ga0466965_0001452 | 3300044683 | Bacteria | 9575 |
| 431 | Ga0466965_0003590 | 3300044683 | Bacteria | 6829 |
| 432 | Ga0466965_0005097 | 3300044683 | Bacteria | 5895 |
| 433 | Ga0466965_0015378 | 3300044683 | Bacteria | 3635 |
| 434 | Ga0466965_0019854 | 3300044683 | Bacteria | 3227 |
| 435 | Ga0466966_0000302 | 3300044684 | Bacteria | 32466 |
| 436 | Ga0466966_0010324 | 3300044684 | Bacteria | 6199 |
| 437 | Ga0466966_0013124 | 3300044684 | Bacteria | 5486 |
| 438 | Ga0466966_0028129 | 3300044684 | Bacteria | 3663 |
| 439 | Ga0466961_0014217 | 3300044693 | Bacteria | 5109 |
| 440 | Ga0466961_0027756 | 3300044693 | Bacteria | 3641 |
| 441 | Ga0466961_0080801 | 3300044693 | Bacteria | 2057 |
| 442 | Ga0466961_0323242 | 3300044693 | Bacteria | 941 |
| 443 | Ga0466963_0083271 | 3300044694 | Bacteria | 2170 |
| 444 | Ga0466971_0021081 | 3300044719 | Bacteria | 2898 |
| 445 | Ga0466971_0066359 | 3300044719 | Bacteria | 1635 |
| 446 | Ga0466971_0111585 | 3300044719 | Bacteria | 1262 |
| 447 | Ga0466968_0000108 | 3300044735 | Bacteria | 24579 |
| 448 | Ga0466968_0000471 | 3300044735 | Bacteria | 13554 |
| 449 | Ga0466968_0001160 | 3300044735 | Bacteria | 9344 |
| 450 | Ga0466968_0001353 | 3300044735 | Bacteria | 8755 |
| 451 | Ga0466968_0006237 | 3300044735 | Bacteria | 4485 |
| 452 | Ga0466970_0007094 | 3300044765 | Bacteria | 5605 |
| 453 | Ga0466970_0011766 | 3300044765 | Bacteria | 4464 |
| 454 | Ga0466970_0013275 | 3300044765 | Bacteria | 4221 |
| 455 | Ga0466970_0016648 | 3300044765 | Bacteria | 3793 |
| 456 | Ga0466970_0036457 | 3300044765 | Bacteria | 2605 |
| 457 | Ga0466970_0144904 | 3300044765 | Bacteria | 1310 |
| 458 | Ga0466957_0002467 | 3300044842 | Bacteria | 9938 |
| 459 | Ga0466957_0002759 | 3300044842 | Bacteria | 9504 |
| 460 | Ga0466957_0009809 | 3300044842 | Bacteria | 5474 |
| 461 | Ga0466957_0017116 | 3300044842 | Bacteria | 4241 |
| 462 | Ga0466957_0022462 | 3300044842 | Bacteria | 3722 |
| 463 | Ga0466957_0040777 | 3300044842 | Bacteria | 2805 |
| 464 | Ga0466957_0054378 | 3300044842 | Bacteria | 2443 |
| 465 | Ga0466957_0072143 | 3300044842 | Bacteria | 2137 |
| 466 | Ga0466957_0228464 | 3300044842 | Bacteria | 1231 |
| 467 | Ga0466957_0268502 | 3300044842 | Bacteria | 1139 |
| 468 | Ga0466960_0000084 | 3300044901 | Bacteria | 31326 |
| 469 | Ga0466960_0000196 | 3300044901 | Bacteria | 20894 |
| 470 | Ga0466960_0000346 | 3300044901 | Bacteria | 15844 |
| 471 | Ga0466960_0001105 | 3300044901 | Bacteria | 9679 |
| 472 | Ga0466960_0001609 | 3300044901 | Bacteria | 8267 |
| 473 | Ga0466960_0003532 | 3300044901 | Bacteria | 6021 |
| 474 | Ga0466960_0059086 | 3300044901 | Bacteria | 1875 |
| 475 | Ga0466960_0070375 | 3300044901 | Bacteria | 1740 |
| 476 | Ga0466959_0008207 | 3300045049 | Bacteria | 7370 |
| 477 | Ga0466959_0009475 | 3300045049 | Bacteria | 6928 |
| 478 | Ga0466959_0010988 | 3300045049 | Bacteria | 6498 |
| 479 | Ga0466959_0016474 | 3300045049 | Bacteria | 5401 |
| 480 | Ga0466959_0017121 | 3300045049 | Bacteria | 5308 |
| 481 | Ga0466959_0017475 | 3300045049 | Bacteria | 5258 |
| 482 | Ga0466959_0028423 | 3300045049 | Bacteria | 4146 |
| 483 | Ga0466959_0043353 | 3300045049 | Bacteria | 3316 |
| 484 | Ga0466958_0000426 | 3300045836 | Bacteria | 17386 |
| 485 | Ga0466958_0003206 | 3300045836 | Bacteria | 8444 |
| 486 | Ga0466958_0011212 | 3300045836 | Bacteria | 5043 |
| 487 | Ga0466958_0014966 | 3300045836 | Bacteria | 4437 |
| 488 | Ga0466958_0031320 | 3300045836 | Bacteria | 3161 |
| 489 | Ga0466958_0037539 | 3300045836 | Bacteria | 2903 |
| 490 | Ga0466958_0051534 | 3300045836 | Bacteria | 2492 |
| 491 | Ga0466967_0000693 | 3300045976 | Bacteria | 17131 |
| 492 | Ga0466967_0012158 | 3300045976 | Bacteria | 6567 |
| 493 | Ga0466967_0022841 | 3300045976 | Bacteria | 5114 |
| 494 | Ga0466967_0023010 | 3300045976 | Bacteria | 5099 |
| 495 | Ga0466967_0026345 | 3300045976 | Bacteria | 4815 |
| 496 | Ga0466967_0047539 | 3300045976 | Bacteria | 3741 |
| 497 | Ga0466967_0106649 | 3300045976 | Bacteria | 2568 |
| 498 | Ga0466967_0133236 | 3300045976 | Bacteria | 2309 |
| 499 | Ga0466967_0144643 | 3300045976 | Bacteria | 2217 |
| 500 | Ga0466967_0146524 | 3300045976 | Bacteria | 2203 |
| 501 | Ga0466967_0628222 | 3300045976 | Bacteria | 1061 |
| 502 | Ga0495603_0027201 | 3300046455 | Bacteria | 3453 |
| 503 | Ga0495603_0102480 | 3300046455 | Bacteria | 1671 |
| 504 | Ga0495629_0024776 | 3300046459 | Bacteria | 4271 |
| 505 | Ga0495638_0002356 | 3300046460 | Bacteria | 15479 |
| 506 | Ga0495638_0004222 | 3300046460 | Bacteria | 10936 |
| 507 | Ga0495582_0020061 | 3300046473 | Bacteria | 3657 |
| 508 | Ga0495662_0023707 | 3300046476 | Bacteria | 2964 |
| 509 | Ga0495594_0078457 | 3300046499 | Bacteria | 1843 |
| 510 | Ga0495583_0038040 | 3300046506 | Bacteria | 2276 |
| 511 | Ga0495606_0136554 | 3300046507 | Bacteria | 1452 |
| 512 | Ga0495606_0181315 | 3300046507 | Bacteria | 1214 |
| 513 | Ga0495606_0184396 | 3300046507 | Bacteria | 1201 |
| 514 | Ga0495637_0084401 | 3300046520 | Bacteria | 1262 |
| 515 | Ga0495648_0004819 | 3300046524 | Bacteria | 11386 |
| 516 | Ga0495648_0016941 | 3300046524 | Bacteria | 5234 |
| 517 | Ga0495648_0167588 | 3300046524 | Bacteria | 1129 |
| 518 | Ga0495666_0134937 | 3300046526 | Bacteria | 1152 |
| 519 | Ga0495654_0016783 | 3300046530 | Bacteria | 3860 |
| 520 | Ga0495654_0094733 | 3300046530 | Bacteria | 1381 |
| 521 | Ga0495668_0013112 | 3300046616 | Bacteria | 4904 |
| 522 | Ga0495668_0019379 | 3300046616 | Bacteria | 3923 |
| 523 | Ga0495647_0185932 | 3300046681 | Bacteria | 906 |
| 524 | Ga0495671_0110471 | 3300046692 | Bacteria | 1343 |
| 525 | Ga0495581_0045508 | 3300047315 | Bacteria | 2537 |
| 526 | Ga0495674_0058368 | 3300047319 | Bacteria | 3374 |
| 527 | Ga0495672_0004096 | 3300047320 | Bacteria | 12156 |
| 528 | Ga0495672_0024419 | 3300047320 | Bacteria | 3893 |
| 529 | Ga0495672_0044909 | 3300047320 | Bacteria | 2648 |
| 530 | Ga0495672_0231010 | 3300047320 | Bacteria | 908 |
| 531 | Ga0495673_0001764 | 3300047469 | Bacteria | 16470 |
| 532 | Ga0495673_0002760 | 3300047469 | Bacteria | 12021 |
| 533 | Ga0495673_0003409 | 3300047469 | Bacteria | 10497 |
| 534 | Ga0495686_0000637 | 3300047472 | Bacteria | 48296 |
| 535 | Ga0495686_0004830 | 3300047472 | Bacteria | 10881 |
| 536 | Ga0495686_0006284 | 3300047472 | Bacteria | 9138 |
| 537 | Ga0495686_0079346 | 3300047472 | Bacteria | 2007 |
| 538 | Ga0495593_0004862 | 3300047673 | Bacteria | 7977 |
| 539 | Ga0495593_0027422 | 3300047673 | Bacteria | 3136 |
| 540 | Ga0496100_0000067 | 3300048903 | Bacteria | 58703 |
| 541 | Ga0496100_0000077 | 3300048903 | Bacteria | 54852 |
| 542 | Ga0496100_0000412 | 3300048903 | Bacteria | 20666 |
| 543 | Ga0496100_0002024 | 3300048903 | Bacteria | 10145 |
| 544 | Ga0496100_0014104 | 3300048903 | Bacteria | 4631 |
| 545 | Ga0496100_0016807 | 3300048903 | Bacteria | 4304 |
| 546 | Ga0496100_0019462 | 3300048903 | Bacteria | 4051 |
| 547 | Ga0496100_0154576 | 3300048903 | Bacteria | 1639 |
| 548 | Ga0496100_0281224 | 3300048903 | Bacteria | 1240 |
| 549 | Ga0496101_0000042 | 3300048904 | Bacteria | 163148 |
| 550 | Ga0496101_0000099 | 3300048904 | Bacteria | 90235 |
| 551 | Ga0496101_0000108 | 3300048904 | Bacteria | 86290 |
| 552 | Ga0496101_0000162 | 3300048904 | Bacteria | 56970 |
| 553 | Ga0496101_0004118 | 3300048904 | Bacteria | 9103 |
| 554 | Ga0496101_0004253 | 3300048904 | Bacteria | 8982 |
| 555 | Ga0496101_0006009 | 3300048904 | Bacteria | 7785 |
| 556 | Ga0496101_0006100 | 3300048904 | Bacteria | 7739 |
| 557 | Ga0496101_0012156 | 3300048904 | Bacteria | 5738 |
| 558 | Ga0496101_0013316 | 3300048904 | Bacteria | 5507 |
| 559 | Ga0496101_0019497 | 3300048904 | Bacteria | 4630 |
| 560 | Ga0496101_0041362 | 3300048904 | Bacteria | 3286 |
| 561 | Ga0496101_0085900 | 3300048904 | Bacteria | 2332 |
| 562 | Ga0496101_0279961 | 3300048904 | Bacteria | 1303 |
| 563 | Ga0496102_0000005 | 3300048905 | Bacteria | 481937 |
| 564 | Ga0496102_0000035 | 3300048905 | Bacteria | 213557 |
| 565 | Ga0496102_0000070 | 3300048905 | Bacteria | 155087 |
| 566 | Ga0496102_0000131 | 3300048905 | Bacteria | 104032 |
| 567 | Ga0496102_0004377 | 3300048905 | Bacteria | 11928 |
| 568 | Ga0496102_0004887 | 3300048905 | Bacteria | 11347 |
| 569 | Ga0496102_0020979 | 3300048905 | Bacteria | 5777 |
| 570 | Ga0496102_0026118 | 3300048905 | Bacteria | 5205 |
| 571 | Ga0496102_0062880 | 3300048905 | Bacteria | 3398 |
| 572 | Ga0496102_0065820 | 3300048905 | Bacteria | 3322 |
| 573 | Ga0496102_0092751 | 3300048905 | Bacteria | 2797 |
| 574 | Ga0496102_0142487 | 3300048905 | Bacteria | 2248 |
| 575 | Ga0496102_0166789 | 3300048905 | Bacteria | 2072 |
| 576 | Ga0496102_0212249 | 3300048905 | Bacteria | 1825 |
| 577 | Ga0496103_0000002 | 3300048906 | Bacteria | 605387 |
| 578 | Ga0496103_0000028 | 3300048906 | Bacteria | 213660 |
| 579 | Ga0496103_0000341 | 3300048906 | Bacteria | 42518 |
| 580 | Ga0496103_0000484 | 3300048906 | Bacteria | 33254 |
| 581 | Ga0496103_0000779 | 3300048906 | Bacteria | 23459 |
| 582 | Ga0496103_0004276 | 3300048906 | Bacteria | 8677 |
| 583 | Ga0496103_0010678 | 3300048906 | Bacteria | 5433 |
| 584 | Ga0496103_0020644 | 3300048906 | Bacteria | 3958 |
| 585 | Ga0496104_0001295 | 3300048907 | Bacteria | 21567 |
| 586 | Ga0496104_0008051 | 3300048907 | Bacteria | 9349 |
| 587 | Ga0496104_0088673 | 3300048907 | Bacteria | 2955 |
| 588 | Ga0496105_0012167 | 3300048908 | Bacteria | 6813 |
| 589 | Ga0496105_0019044 | 3300048908 | Bacteria | 5532 |
| 590 | Ga0496105_0155730 | 3300048908 | Bacteria | 1877 |
| 591 | Ga0496105_0304811 | 3300048908 | Bacteria | 1280 |
| 592 | Ga0496106_0002680 | 3300048909 | Bacteria | 13226 |
| 593 | Ga0496106_0004631 | 3300048909 | Bacteria | 10203 |
| 594 | Ga0496106_0005705 | 3300048909 | Bacteria | 9208 |
| 595 | Ga0496106_0020609 | 3300048909 | Bacteria | 4895 |
| 596 | Ga0496106_0021068 | 3300048909 | Bacteria | 4839 |
| 597 | Ga0496106_0030736 | 3300048909 | Bacteria | 4003 |
| 598 | Ga0496106_0031201 | 3300048909 | Bacteria | 3971 |
| 599 | Ga0496106_0140052 | 3300048909 | Bacteria | 1902 |
| 600 | Ga0496107_0000718 | 3300048910 | Bacteria | 18910 |
| 601 | Ga0496107_0012252 | 3300048910 | Bacteria | 5985 |
| 602 | Ga0496107_0028979 | 3300048910 | Bacteria | 3937 |
| 603 | Ga0496107_0030647 | 3300048910 | Bacteria | 3834 |
| 604 | Ga0496107_0055590 | 3300048910 | Bacteria | 2858 |
| 605 | Ga0496107_0065992 | 3300048910 | Bacteria | 2624 |
| 606 | Ga0496107_0072617 | 3300048910 | Bacteria | 2501 |
| 607 | Ga0496107_0075435 | 3300048910 | Bacteria | 2454 |
| 608 | Ga0496107_0098611 | 3300048910 | Bacteria | 2140 |
| 609 | Ga0496108_0006748 | 3300048911 | Bacteria | 9294 |
| 610 | Ga0496108_0034491 | 3300048911 | Bacteria | 4205 |
| 611 | Ga0496108_0052385 | 3300048911 | Bacteria | 3420 |
| 612 | Ga0496108_0112979 | 3300048911 | Bacteria | 2324 |
| 613 | Ga0496108_0141767 | 3300048911 | Bacteria | 2071 |
| 614 | Ga0496109_0000159 | 3300048912 | Bacteria | 66124 |
| 615 | Ga0496109_0000452 | 3300048912 | Bacteria | 35174 |
| 616 | Ga0496109_0011184 | 3300048912 | Bacteria | 7702 |
| 617 | Ga0496109_0037368 | 3300048912 | Bacteria | 4387 |
| 618 | Ga0496109_0146170 | 3300048912 | Bacteria | 2212 |
| 619 | Ga0496109_0378912 | 3300048912 | Bacteria | 1336 |
| 620 | Ga0496110_0004131 | 3300048913 | Bacteria | 11221 |
| 621 | Ga0496110_0054179 | 3300048913 | Bacteria | 3527 |
| 622 | Ga0496110_0106236 | 3300048913 | Bacteria | 2519 |
| 623 | Ga0496110_0112174 | 3300048913 | Bacteria | 2451 |
| 624 | Ga0496110_0115788 | 3300048913 | Bacteria | 2413 |
| 625 | Ga0496111_0027696 | 3300048914 | Bacteria | 4012 |
| 626 | Ga0496111_0088265 | 3300048914 | Bacteria | 2271 |
| 627 | Ga0496111_0125000 | 3300048914 | Bacteria | 1901 |
| 628 | Ga0496112_0000750 | 3300048915 | Bacteria | 22692 |
| 629 | Ga0496112_0002212 | 3300048915 | Bacteria | 15511 |
| 630 | Ga0496112_0010839 | 3300048915 | Bacteria | 8295 |
| 631 | Ga0496112_0012968 | 3300048915 | Bacteria | 7681 |
| 632 | Ga0496112_0014213 | 3300048915 | Bacteria | 7377 |
| 633 | Ga0496112_0020666 | 3300048915 | Bacteria | 6244 |
| 634 | Ga0496112_0026123 | 3300048915 | Bacteria | 5614 |
| 635 | Ga0496112_0036124 | 3300048915 | Bacteria | 4818 |
| 636 | Ga0496112_0050194 | 3300048915 | Bacteria | 4091 |
| 637 | Ga0496112_0062456 | 3300048915 | Bacteria | 3674 |
| 638 | Ga0496112_0133231 | 3300048915 | Bacteria | 2456 |
| 639 | Ga0496112_0242577 | 3300048915 | Bacteria | 1754 |
| 640 | Ga0496113_0003095 | 3300048916 | Bacteria | 9879 |
| 641 | Ga0496113_0030331 | 3300048916 | Bacteria | 3914 |
| 642 | Ga0496113_0059404 | 3300048916 | Bacteria | 2880 |
| 643 | Ga0496113_0060286 | 3300048916 | Bacteria | 2860 |
| 644 | Ga0496113_0157802 | 3300048916 | Bacteria | 1792 |
| 645 | Ga0496113_0163484 | 3300048916 | Bacteria | 1760 |
| 646 | Ga0496113_0630195 | 3300048916 | Bacteria | 858 |
| 647 | Ga0496114_0000116 | 3300048917 | Bacteria | 57632 |
| 648 | Ga0496114_0000319 | 3300048917 | Bacteria | 35245 |
| 649 | Ga0496114_0000848 | 3300048917 | Bacteria | 22900 |
| 650 | Ga0496114_0007296 | 3300048917 | Bacteria | 8731 |
| 651 | Ga0496114_0066904 | 3300048917 | Bacteria | 3013 |
| 652 | Ga0496114_0076627 | 3300048917 | Bacteria | 2818 |
| 653 | Ga0496115_0000807 | 3300048918 | Bacteria | 22983 |
| 654 | Ga0496115_0001191 | 3300048918 | Bacteria | 18655 |
| 655 | Ga0496115_0025602 | 3300048918 | Bacteria | 4596 |
| 656 | Ga0496115_0030309 | 3300048918 | Bacteria | 4255 |
| 657 | Ga0496115_0244881 | 3300048918 | Bacteria | 1477 |
| 658 | Ga0496116_0000034 | 3300048919 | Bacteria | 409567 |
| 659 | Ga0496116_0000090 | 3300048919 | Bacteria | 212651 |
| 660 | Ga0496116_0001408 | 3300048919 | Bacteria | 27021 |
| 661 | Ga0496116_0004012 | 3300048919 | Bacteria | 14275 |
| 662 | Ga0496116_0009583 | 3300048919 | Bacteria | 8242 |
| 663 | Ga0496116_0010238 | 3300048919 | Bacteria | 7885 |
| 664 | Ga0496116_0167328 | 3300048919 | Bacteria | 1196 |
| 665 | Ga0496117_0000003 | 3300048920 | Bacteria | 1881097 |
| 666 | Ga0496117_0000051 | 3300048920 | Bacteria | 285716 |
| 667 | Ga0496117_0000319 | 3300048920 | Bacteria | 84245 |
| 668 | Ga0496117_0001155 | 3300048920 | Bacteria | 39752 |
| 669 | Ga0496117_0006001 | 3300048920 | Bacteria | 12506 |
| 670 | Ga0496118_0000001 | 3300048921 | Bacteria | 1881100 |
| 671 | Ga0496118_0000029 | 3300048921 | Bacteria | 340978 |
| 672 | Ga0496118_0000043 | 3300048921 | Bacteria | 285716 |
| 673 | Ga0496118_0000165 | 3300048921 | Bacteria | 119376 |
| 674 | Ga0496118_0001467 | 3300048921 | Bacteria | 35366 |
| 675 | Ga0496118_0027781 | 3300048921 | Bacteria | 4779 |
| 676 | Ga0496118_0087035 | 3300048921 | Bacteria | 2168 |
| 677 | Ga0496119_0000318 | 3300048922 | Bacteria | 67383 |
| 678 | Ga0496119_0000669 | 3300048922 | Bacteria | 45985 |
| 679 | Ga0496119_0003584 | 3300048922 | Bacteria | 16034 |
| 680 | Ga0496119_0005099 | 3300048922 | Bacteria | 12750 |
| 681 | Ga0496119_0008747 | 3300048922 | Bacteria | 8834 |
| 682 | Ga0496119_0009760 | 3300048922 | Bacteria | 8169 |
| 683 | Ga0496119_0011044 | 3300048922 | Bacteria | 7531 |
| 684 | Ga0496120_0000274 | 3300048923 | Bacteria | 86195 |
| 685 | Ga0496120_0000594 | 3300048923 | Bacteria | 54781 |
| 686 | Ga0496120_0019034 | 3300048923 | Bacteria | 4406 |
| 687 | Ga0496120_0032214 | 3300048923 | Bacteria | 3162 |
| 688 | Ga0496120_0034069 | 3300048923 | Bacteria | 3055 |
| 689 | Ga0496120_0148608 | 3300048923 | Bacteria | 1180 |
| 690 | Ga0496121_0000016 | 3300048924 | Bacteria | 562911 |
| 691 | Ga0496121_0000080 | 3300048924 | Bacteria | 230195 |
| 692 | Ga0496121_0000139 | 3300048924 | Bacteria | 163176 |
| 693 | Ga0496121_0002593 | 3300048924 | Bacteria | 27292 |
| 694 | Ga0496121_0003648 | 3300048924 | Bacteria | 21655 |
| 695 | Ga0496121_0013545 | 3300048924 | Bacteria | 8746 |
| 696 | Ga0496121_0028180 | 3300048924 | Bacteria | 5234 |
| 697 | Ga0496122_0000149 | 3300048925 | Bacteria | 163504 |
| 698 | Ga0496122_0000284 | 3300048925 | Bacteria | 113244 |
| 699 | Ga0496122_0007197 | 3300048925 | Bacteria | 12459 |
| 700 | Ga0496122_0080832 | 3300048925 | Bacteria | 2264 |
| 701 | Ga0496122_0089014 | 3300048925 | Bacteria | 2112 |
| 702 | Ga0496122_0090279 | 3300048925 | Bacteria | 2091 |
| 703 | Ga0496123_0004868 | 3300048926 | Bacteria | 13811 |
| 704 | Ga0496123_0006672 | 3300048926 | Bacteria | 11123 |
| 705 | Ga0496123_0006983 | 3300048926 | Bacteria | 10773 |
| 706 | Ga0496123_0057749 | 3300048926 | Bacteria | 2523 |
| 707 | Ga0496124_0000015 | 3300048927 | Bacteria | 460700 |
| 708 | Ga0496124_0000114 | 3300048927 | Bacteria | 165215 |
| 709 | Ga0496124_0050318 | 3300048927 | Bacteria | 3551 |
| 710 | Ga0496124_0074199 | 3300048927 | Bacteria | 2812 |
| 711 | Ga0496125_0000021 | 3300048928 | Bacteria | 460688 |
| 712 | Ga0496125_0000130 | 3300048928 | Bacteria | 163176 |
| 713 | Ga0496125_0012786 | 3300048928 | Bacteria | 8297 |
| 714 | Ga0496125_0018213 | 3300048928 | Bacteria | 6673 |
| 715 | Ga0496125_0027348 | 3300048928 | Bacteria | 5172 |
| 716 | Ga0496125_0133662 | 3300048928 | Bacteria | 1740 |
| 717 | Ga0496126_0000015 | 3300048929 | Bacteria | 663212 |
| 718 | Ga0496126_0000149 | 3300048929 | Bacteria | 163176 |
| 719 | Ga0496126_0000178 | 3300048929 | Bacteria | 145079 |
| 720 | Ga0496126_0000807 | 3300048929 | Bacteria | 56090 |
| 721 | Ga0496126_0005371 | 3300048929 | Bacteria | 14636 |
| 722 | Ga0496126_0005992 | 3300048929 | Bacteria | 13654 |
| 723 | Ga0496126_0007273 | 3300048929 | Bacteria | 12173 |
| 724 | Ga0496126_0007315 | 3300048929 | Bacteria | 12128 |
| 725 | Ga0496126_0015987 | 3300048929 | Bacteria | 7525 |
| 726 | Ga0496126_0022736 | 3300048929 | Bacteria | 6090 |
| 727 | Ga0501032_0001911 | 3300049569 | Bacteria | 16448 |
| 728 | Ga0501032_0006353 | 3300049569 | Bacteria | 8709 |
| 729 | Ga0501033_0065605 | 3300049570 | Bacteria | 2671 |
| 730 | Ga0501034_0001916 | 3300049571 | Bacteria | 26328 |
| 731 | Ga0501034_0001919 | 3300049571 | Bacteria | 26321 |
| 732 | Ga0501034_0005958 | 3300049571 | Bacteria | 13196 |
| 733 | Ga0501034_0014466 | 3300049571 | Bacteria | 8126 |
| 734 | Ga0501036_0024018 | 3300049572 | Bacteria | 5138 |
| 735 | Ga0501037_0000167 | 3300049573 | Bacteria | 61779 |
| 736 | Ga0501037_0000434 | 3300049573 | Bacteria | 34407 |
| 737 | Ga0501037_0049529 | 3300049573 | Bacteria | 3076 |
| 738 | Ga0501038_0002867 | 3300049574 | Bacteria | 16063 |
| 739 | Ga0501039_0000583 | 3300049575 | Bacteria | 26350 |
| 740 | Ga0501043_0002476 | 3300049579 | Bacteria | 15626 |
| 741 | Ga0501043_0003282 | 3300049579 | Bacteria | 13329 |
| 742 | Ga0501046_0001059 | 3300049580 | Bacteria | 26939 |
| 743 | Ga0501047_0004729 | 3300049581 | Bacteria | 12799 |
| 744 | Ga0501047_0007602 | 3300049581 | Bacteria | 10199 |
| 745 | Ga0501047_0051467 | 3300049581 | Bacteria | 3980 |
| 746 | Ga0501047_0135868 | 3300049581 | Bacteria | 2339 |
| 747 | Ga0501048_0001266 | 3300049582 | Bacteria | 19121 |
| 748 | Ga0501048_0122628 | 3300049582 | Bacteria | 1837 |
| 749 | Ga0501067_0194130 | 3300049583 | Bacteria | 1131 |
| 750 | Ga0501069_0085788 | 3300049585 | Bacteria | 1777 |
| 751 | Ga0501070_0001462 | 3300049586 | Bacteria | 21149 |
| 752 | Ga0501070_0006251 | 3300049586 | Bacteria | 10135 |
| 753 | Ga0501070_0076680 | 3300049586 | Bacteria | 2767 |
| 754 | Ga0501073_0215868 | 3300049589 | Bacteria | 1325 |
| 755 | Ga0501077_0076711 | 3300049593 | Bacteria | 2117 |
| 756 | Ga0501080_0077234 | 3300049742 | Bacteria | 3097 |
| 757 | Ga0501080_0142952 | 3300049742 | Bacteria | 2212 |
| 758 | Ga0501080_0396950 | 3300049742 | Bacteria | 1241 |
| 759 | Ga0501035_0000542 | 3300049822 | Bacteria | 41925 |
| 760 | Ga0501035_0000818 | 3300049822 | Bacteria | 33183 |
| 761 | Ga0501035_0018298 | 3300049822 | Bacteria | 6455 |
| 762 | Ga0501044_0000153 | 3300049823 | Bacteria | 85673 |
| 763 | Ga0501044_0000373 | 3300049823 | Bacteria | 56176 |
| 764 | Ga0501044_0003155 | 3300049823 | Bacteria | 18643 |
| 765 | Ga0501044_0010960 | 3300049823 | Bacteria | 9839 |
| 766 | Ga0501044_0029694 | 3300049823 | Bacteria | 5764 |
| 767 | Ga0501044_0085386 | 3300049823 | Bacteria | 3190 |
| 768 | nmdc:mga03683_24850_c1 | 3300050489 | Bacteria | 2347 |
| 769 | nmdc:mga03683_26274_c1 | 3300050489 | Bacteria | 2295 |
| 770 | nmdc:mga03683_28487_c1 | 3300050489 | Bacteria | 2221 |
| 771 | nmdc:mga03683_32168_c2 | 3300050489 | Bacteria | 1675 |
| 772 | nmdc:mga03683_52334_c1 | 3300050489 | Bacteria | 1706 |
| 773 | nmdc:mga03683_56181_c1 | 3300050489 | Bacteria | 1654 |
| 774 | nmdc:mga03683_69585_c1 | 3300050489 | Bacteria | 1502 |
| 775 | nmdc:mga03n38_14961_c1 | 3300050490 | Bacteria | 2988 |
| 776 | nmdc:mga03n38_20064_c1 | 3300050490 | Bacteria | 2668 |
| 777 | nmdc:mga03n38_2563_c1 | 3300050490 | Bacteria | 5647 |
| 778 | nmdc:mga03n38_30600_c1 | 3300050490 | Bacteria | 2265 |
| 779 | nmdc:mga03n38_34659_c1 | 3300050490 | Bacteria | 2157 |
| 780 | nmdc:mga03n38_36112_c1 | 3300050490 | Bacteria | 2123 |
| 781 | nmdc:mga03n38_38264_c1 | 3300050490 | Bacteria | 2074 |
| 782 | nmdc:mga03n38_57355_c1 | 3300050490 | Bacteria | 1761 |
| 783 | nmdc:mga03n38_57403_c1 | 3300050490 | Bacteria | 1760 |
| 784 | nmdc:mga03n38_59192_c1 | 3300050490 | Bacteria | 1738 |
| 785 | nmdc:mga03n38_611_c1 | 3300050490 | Bacteria | 9136 |
| 786 | nmdc:mga03n38_64893_c1 | 3300050490 | Bacteria | 1673 |
| 787 | nmdc:mga03n38_7217_c1 | 3300050490 | Bacteria | 3918 |
| 788 | nmdc:mga03n38_7409_c1 | 3300050490 | Bacteria | 3882 |
| 789 | nmdc:mga00v17_10441_c1 | 3300050491 | Bacteria | 5071 |
| 790 | nmdc:mga00v17_13704_c1 | 3300050491 | Bacteria | 4506 |
| 791 | nmdc:mga00v17_147916_c1 | 3300050491 | Bacteria | 1508 |
| 792 | nmdc:mga00v17_193254_c1 | 3300050491 | Bacteria | 1315 |
| 793 | nmdc:mga00v17_2146_c1 | 3300050491 | Bacteria | 10137 |
| 794 | nmdc:mga00v17_29528_c1 | 3300050491 | Bacteria | 3219 |
| 795 | nmdc:mga00v17_29653_c2 | 3300050491 | Bacteria | 2277 |
| 796 | nmdc:mga00v17_52686_c1 | 3300050491 | Bacteria | 2477 |
| 797 | nmdc:mga00v17_5821_c1 | 3300050491 | Bacteria | 6508 |
| 798 | nmdc:mga00v17_65935_c1 | 3300050491 | Bacteria | 2235 |
| 799 | nmdc:mga00v17_92137_c1 | 3300050491 | Bacteria | 1905 |
| 800 | nmdc:mga0yw44_104752_c1 | 3300050492 | Bacteria | 1806 |
| 801 | nmdc:mga0yw44_149080_c1 | 3300050492 | Bacteria | 1525 |
| 802 | nmdc:mga0yw44_24933_c1 | 3300050492 | Bacteria | 3393 |
| 803 | nmdc:mga0yw44_25526_c1 | 3300050492 | Bacteria | 3361 |
| 804 | nmdc:mga0yw44_58321_c1 | 3300050492 | Bacteria | 2358 |
| 805 | nmdc:mga0yw44_67315_c1 | 3300050492 | Bacteria | 2213 |
| 806 | nmdc:mga0yw44_79245_c1 | 3300050492 | Bacteria | 2055 |
| 807 | nmdc:mga0yw44_7942_c1 | 3300050492 | Bacteria | 5258 |
| 808 | nmdc:mga0yw44_97225_c1 | 3300050492 | Bacteria | 1870 |
| 809 | nmdc:mga0yw44_973_c1 | 3300050492 | Bacteria | 10912 |
| 810 | nmdc:mga0k408_25200_c1 | 3300050493 | Bacteria | 3367 |
| 811 | nmdc:mga06z11_20181_c1 | 3300050494 | Bacteria | 3077 |
| 812 | nmdc:mga06z11_30343_c1 | 3300050494 | Bacteria | 2615 |
| 813 | nmdc:mga04h51_3469_c1 | 3300050495 | Bacteria | 3835 |
| 814 | nmdc:mga04h51_8193_c1 | 3300050495 | Bacteria | 2789 |
| 815 | nmdc:mga07m45_13146_c1 | 3300050496 | Bacteria | 4384 |
| 816 | nmdc:mga07m45_14446_c1 | 3300050496 | Bacteria | 4205 |
| 817 | nmdc:mga07m45_23230_c1 | 3300050496 | Bacteria | 3388 |
| 818 | nmdc:mga07m45_2381_c2 | 3300050496 | Bacteria | 1924 |
| 819 | nmdc:mga07m45_26614_c1 | 3300050496 | Bacteria | 3180 |
| 820 | nmdc:mga07m45_34805_c1 | 3300050496 | Bacteria | 2800 |
| 821 | nmdc:mga07m45_3674_c1 | 3300050496 | Bacteria | 7416 |
| 822 | nmdc:mga07m45_93155_c1 | 3300050496 | Bacteria | 1727 |
| 823 | nmdc:mga05p37_26956_c1 | 3300050507 | Bacteria | 6991 |
| 824 | nmdc:mga05p37_45271_c1 | 3300050507 | Bacteria | 5413 |
| 825 | nmdc:mga05p37_6127_c1 | 3300050507 | Bacteria | 5321 |
| 826 | nmdc:mga09592_647828_c1 | 3300050508 | Bacteria | 902 |
| 827 | nmdc:mga0qj67_13608_c1 | 3300050509 | Bacteria | 6137 |
| 828 | nmdc:mga0qj67_33040_c1 | 3300050509 | Bacteria | 4036 |
| 829 | nmdc:mga0qj67_74038_c1 | 3300050509 | Bacteria | 2721 |
| 830 | nmdc:mga06r32_148327_c1 | 3300050510 | Bacteria | 2323 |
| 831 | nmdc:mga08y16_107492_c1 | 3300050511 | Bacteria | 2904 |
| 832 | nmdc:mga08y16_366072_c1 | 3300050511 | Bacteria | 1479 |
| 833 | nmdc:mga0sz30_14921_c1 | 3300050516 | Bacteria | 2428 |
| 834 | nmdc:mga0sz30_19876_c1 | 3300050516 | Bacteria | 2704 |
| 835 | nmdc:mga0sz30_2095_c1 | 3300050516 | Bacteria | 7124 |
| 836 | nmdc:mga0sz30_2257_c2 | 3300050516 | Bacteria | 3609 |
| 837 | nmdc:mga0sz30_31158_c1 | 3300050516 | Bacteria | 2206 |
| 838 | nmdc:mga0sz30_3424_c1 | 3300050516 | Bacteria | 5715 |
| 839 | nmdc:mga0sz30_3473_c1 | 3300050516 | Bacteria | 5680 |
| 840 | nmdc:mga0sz30_38546_c1 | 3300050516 | Bacteria | 2003 |
| 841 | nmdc:mga0sz30_39244_c1 | 3300050516 | Bacteria | 1986 |
| 842 | nmdc:mga0sz30_43725_c1 | 3300050516 | Bacteria | 1886 |
| 843 | nmdc:mga0sz30_48159_c1 | 3300050516 | Bacteria | 1802 |
| 844 | nmdc:mga0sz30_4841_c1 | 3300050516 | Bacteria | 4900 |
| 845 | nmdc:mga0sz30_52133_c1 | 3300050516 | Bacteria | 1737 |
| 846 | nmdc:mga0sz30_52440_c1 | 3300050516 | Bacteria | 1732 |
| 847 | nmdc:mga0sz30_6497_c1 | 3300050516 | Bacteria | 4341 |
| 848 | nmdc:mga0sz30_8592_c1 | 3300050516 | Bacteria | 3858 |
| 849 | Ga0500643_011807 | 3300053087 | Bacteria | 3162 |
| 850 | Ga0500643_056975 | 3300053087 | Bacteria | 1103 |
| 851 | Ga0500583_0176602 | 3300053092 | Bacteria | 1064 |
| 852 | Ga0500641_0041678 | 3300053096 | Bacteria | 1858 |
| 853 | Ga0500556_0007416 | 3300053104 | Bacteria | 3137 |
| 854 | Ga0500557_042863 | 3300053105 | Bacteria | 1426 |
| 855 | Ga0500642_0073937 | 3300053130 | Bacteria | 1555 |
| 856 | Ga0500642_0080805 | 3300053130 | Bacteria | 1493 |
| 857 | Ga0500588_0012261 | 3300053146 | Bacteria | 2122 |
| 858 | Ga0500616_0005141 | 3300053153 | Bacteria | 8997 |
| 859 | Ga0500616_0034800 | 3300053153 | Bacteria | 2743 |
| 860 | Ga0500620_089335 | 3300053155 | Bacteria | 1073 |
| 861 | Ga0500645_000006 | 3300053730 | Bacteria | 276677 |
| 862 | Ga0500645_000032 | 3300053730 | Bacteria | 119506 |
| 863 | Ga0587082_021006 | 3300059504 | Bacteria | 1063 |
| 864 | Ga0501082_0322120 | 3300060353 | Bacteria | 1347 |
| 865 | Ga0466962_0008905 | 3300061719 | Bacteria | 4811 |
| 866 | Ga0466962_0013132 | 3300061719 | Bacteria | 3985 |
| 867 | Ga0466962_0029180 | 3300061719 | Bacteria | 2640 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300046455 | Ga0495603_0102480 | Ga0495603_0102480_18_818 | 250 |
| 2 | 3300046681 | Ga0495647_0185932 | Ga0495647_0185932_60_860 | 250 |
| 3 | 3300047673 | Ga0495593_0027422 | Ga0495593_0027422_2222_3022 | 250 |
| 4 | 3300026067 | Ga0207678_10250879 | Ga0207678_102508791 | 255 |
| 5 | 3300041413 | Ga0439465_0014618 | Ga0439465_0014618_1564_2364 | 255 |
| 6 | 3300009147 | Ga0114129_10018524 | Ga0114129_100185248 | 258 |
| 7 | 3300050507 | nmdc:mga05p37_45271_c1 | nmdc:mga05p37_45271_c1_1469_2290 | 258 |
| 8 | 3300050508 | nmdc:mga09592_647828_c1 | nmdc:mga09592_647828_c1_35_856 | 258 |
| 9 | 3300050509 | nmdc:mga0qj67_33040_c1 | nmdc:mga0qj67_33040_c1_2664_3485 | 258 |
| 10 | 3300006177 | Ga0075362_10052817 | Ga0075362_100528171 | 262 |
| 11 | 3300050489 | nmdc:mga03683_32168_c2 | nmdc:mga03683_32168_c2_792_1613 | 262 |
| 12 | 3300042005 | Ga0439448_0084880 | Ga0439448_0084880_185_1054 | 265 |
| 13 | 3300046507 | Ga0495606_0184396 | Ga0495606_0184396_76_975 | 265 |
| 14 | 3300048910 | Ga0496107_0065992 | Ga0496107_0065992_28_834 | 265 |
| 15 | 3300048916 | Ga0496113_0630195 | Ga0496113_0630195_15_827 | 265 |
| 16 | 3300050492 | nmdc:mga0yw44_97225_c1 | nmdc:mga0yw44_97225_c1_24_875 | 265 |
| 17 | 3300044693 | Ga0466961_0323242 | Ga0466961_0323242_29_904 | 266 |
| 18 | 3300044842 | Ga0466957_0228464 | Ga0466957_0228464_73_948 | 266 |
| 19 | 3300049583 | Ga0501067_0194130 | Ga0501067_0194130_169_996 | 266 |
| 20 | 3300061719 | Ga0466962_0029180 | Ga0466962_0029180_11_886 | 266 |
| 21 | 3300048913 | Ga0496110_0115788 | Ga0496110_0115788_1554_2399 | 270 |
| 22 | 3300006353 | Ga0075370_10136363 | Ga0075370_101363631 | 271 |
| 23 | 3300047320 | Ga0495672_0231010 | Ga0495672_0231010_35_862 | 271 |
| 24 | 3300006051 | Ga0075364_10077310 | Ga0075364_100773102 | 272 |
| 25 | 3300042435 | Ga0439434_0006624 | Ga0439434_0006624_81_983 | 272 |
| 26 | 3300005539 | Ga0068853_100014908 | Ga0068853_1000149086 | 273 |
| 27 | 3300046616 | Ga0495668_0019379 | Ga0495668_0019379_63_914 | 275 |
| 28 | 3300006186 | Ga0075369_10000569 | Ga0075369_100005699 | 286 |
| 29 | 3300041411 | Ga0439466_0016817 | Ga0439466_0016817_294_1244 | 287 |
| 30 | 3300005539 | Ga0068853_100008899 | Ga0068853_1000088992 | 292 |
| 31 | 3300006186 | Ga0075369_10084741 | Ga0075369_100847411 | 292 |
| 32 | 3300026041 | Ga0207639_10006131 | Ga0207639_100061312 | 292 |
| 33 | 3300031731 | Ga0307405_10132250 | Ga0307405_101322502 | 292 |
| 34 | 3300047472 | Ga0495686_0006284 | Ga0495686_0006284_3743_4705 | 292 |
| 35 | 3300050491 | nmdc:mga00v17_2146_c1 | nmdc:mga00v17_2146_c1_359_1306 | 292 |
| 36 | 3300041443 | Ga0451789_0148697 | Ga0451789_0148697_1108_2061 | 294 |
| 37 | 3300041453 | Ga0451797_1304083 | Ga0451797_1304083_271_1224 | 294 |
| 38 | 3300041456 | Ga0451795_1199720 | Ga0451795_1199720_2427_3380 | 294 |
| 39 | 3300044901 | Ga0466960_0070375 | Ga0466960_0070375_49_972 | 294 |
| 40 | 3300021377 | Ga0213874_10036841 | Ga0213874_100368411 | 295 |
| 41 | 3300031731 | Ga0307405_10156019 | Ga0307405_101560191 | 295 |
| 42 | 3300039450 | Ga0436363_0784449 | Ga0436363_0784449_3182_4174 | 295 |
| 43 | 3300009545 | Ga0105237_10006567 | Ga0105237_100065676 | 296 |
| 44 | 3300010375 | Ga0105239_10027466 | Ga0105239_100274666 | 296 |
| 45 | 3300025972 | Ga0207668_10006287 | Ga0207668_100062877 | 296 |
| 46 | 3300039450 | Ga0436363_0564114 | Ga0436363_0564114_11041_11979 | 296 |
| 47 | 3300048904 | Ga0496101_0000108 | Ga0496101_0000108_42088_42987 | 296 |
| 48 | 3300048905 | Ga0496102_0000005 | Ga0496102_0000005_85565_86464 | 296 |
| 49 | 3300048906 | Ga0496103_0000002 | Ga0496103_0000002_395504_396403 | 296 |
| 50 | 3300048908 | Ga0496105_0304811 | Ga0496105_0304811_119_1018 | 296 |
| 51 | 3300048919 | Ga0496116_0000034 | Ga0496116_0000034_13431_14330 | 296 |
| 52 | 3300048920 | Ga0496117_0000003 | Ga0496117_0000003_987640_988539 | 296 |
| 53 | 3300048921 | Ga0496118_0000001 | Ga0496118_0000001_987643_988542 | 296 |
| 54 | 3300048922 | Ga0496119_0000669 | Ga0496119_0000669_3004_3903 | 296 |
| 55 | 3300048923 | Ga0496120_0000594 | Ga0496120_0000594_11800_12699 | 296 |
| 56 | 3300048924 | Ga0496121_0003648 | Ga0496121_0003648_13601_14500 | 296 |
| 57 | 3300048929 | Ga0496126_0000178 | Ga0496126_0000178_43226_44125 | 296 |
| 58 | 3300050516 | nmdc:mga0sz30_14921_c1 | nmdc:mga0sz30_14921_c1_674_1573 | 296 |
| 59 | 3300005844 | Ga0068862_100267410 | Ga0068862_1002674102 | 297 |
| 60 | 3300028380 | Ga0268265_10174703 | Ga0268265_101747032 | 297 |
| 61 | 3300041413 | Ga0439465_0063919 | Ga0439465_0063919_295_1212 | 297 |
| 62 | 3300061719 | Ga0466962_0013132 | Ga0466962_0013132_16_927 | 297 |
| 63 | 3300006186 | Ga0075369_10019166 | Ga0075369_100191663 | 298 |
| 64 | 3300037853 | Ga0436364_1133117 | Ga0436364_1133117_815_1771 | 298 |
| 65 | 3300050516 | nmdc:mga0sz30_3424_c1 | nmdc:mga0sz30_3424_c1_635_1564 | 298 |
| 66 | iso_pu_bacteria | 2902837492 | 2902837999 | 298 |
| 67 | 3300042461 | Ga0439460_0075277 | Ga0439460_0075277_82_984 | 299 |
| 68 | 3300044842 | Ga0466957_0268502 | Ga0466957_0268502_103_1071 | 300 |
| 69 | 3300045976 | Ga0466967_0133236 | Ga0466967_0133236_515_1552 | 300 |
| 70 | 3300048905 | Ga0496102_0020979 | Ga0496102_0020979_1095_2135 | 300 |
| 71 | 3300002244 | JGI24742J22300_10018751 | JGI24742J22300_100187511 | 301 |
| 72 | 3300006048 | Ga0075363_100007474 | Ga0075363_1000074743 | 301 |
| 73 | 3300006177 | Ga0075362_10007440 | Ga0075362_100074405 | 301 |
| 74 | 3300006178 | Ga0075367_10002349 | Ga0075367_100023499 | 301 |
| 75 | 3300021384 | Ga0213876_10015374 | Ga0213876_100153745 | 301 |
| 76 | 3300037853 | Ga0436364_0033137 | Ga0436364_0033137_9894_10862 | 301 |
| 77 | 3300039437 | Ga0436365_1728003 | Ga0436365_1728003_1012_1989 | 301 |
| 78 | 3300041443 | Ga0451789_0707226 | Ga0451789_0707226_777_1754 | 301 |
| 79 | 3300041456 | Ga0451795_0366770 | Ga0451795_0366770_496_1473 | 301 |
| 80 | 3300041460 | Ga0451802_0513608 | Ga0451802_0513608_333_1310 | 301 |
| 81 | 3300044658 | Ga0466972_0014006 | Ga0466972_0014006_1399_2328 | 301 |
| 82 | 3300044765 | Ga0466970_0011766 | Ga0466970_0011766_87_1016 | 301 |
| 83 | 3300005436 | Ga0070713_100070072 | Ga0070713_1000700723 | 302 |
| 84 | 3300006051 | Ga0075364_10006538 | Ga0075364_100065383 | 302 |
| 85 | 3300006186 | Ga0075369_10022760 | Ga0075369_100227602 | 302 |
| 86 | 3300006186 | Ga0075369_10058395 | Ga0075369_100583952 | 302 |
| 87 | 3300025303 | Ga0209051_1002725 | Ga0209051_100272510 | 302 |
| 88 | 3300047472 | Ga0495686_0004830 | Ga0495686_0004830_9879_10808 | 302 |
| 89 | 3300050491 | nmdc:mga00v17_52686_c1 | nmdc:mga00v17_52686_c1_316_1284 | 302 |
| 90 | 3300050516 | nmdc:mga0sz30_31158_c1 | nmdc:mga0sz30_31158_c1_450_1430 | 302 |
| 91 | 3300005434 | Ga0070709_10133021 | Ga0070709_101330211 | 303 |
| 92 | 3300031901 | Ga0307406_10110940 | Ga0307406_101109402 | 303 |
| 93 | 3300041410 | Ga0439461_0000386 | Ga0439461_0000386_714_1670 | 303 |
| 94 | 3300041411 | Ga0439466_0007490 | Ga0439466_0007490_375_1331 | 303 |
| 95 | 3300041997 | Ga0439431_0047118 | Ga0439431_0047118_33_989 | 303 |
| 96 | 3300042435 | Ga0439434_0006009 | Ga0439434_0006009_374_1330 | 303 |
| 97 | 3300044719 | Ga0466971_0066359 | Ga0466971_0066359_218_1159 | 303 |
| 98 | 3300053153 | Ga0500616_0005141 | Ga0500616_0005141_4965_5957 | 303 |
| 99 | iso_pu_bacteria | 2842134933 | 2842139885 | 303 |
| 100 | 3300005337 | Ga0070682_100122383 | Ga0070682_1001223831 | 304 |
| 101 | 3300005436 | Ga0070713_100127035 | Ga0070713_1001270351 | 304 |
| 102 | 3300006048 | Ga0075363_100002254 | Ga0075363_1000022543 | 304 |
| 103 | 3300006844 | Ga0075428_100126333 | Ga0075428_1001263331 | 304 |
| 104 | 3300006846 | Ga0075430_100066408 | Ga0075430_1000664082 | 304 |
| 105 | 3300006847 | Ga0075431_100154206 | Ga0075431_1001542062 | 304 |
| 106 | 3300009551 | Ga0105238_10176436 | Ga0105238_101764362 | 304 |
| 107 | 3300031731 | Ga0307405_10067237 | Ga0307405_100672372 | 304 |
| 108 | 3300031824 | Ga0307413_10376274 | Ga0307413_103762741 | 304 |
| 109 | 3300031901 | Ga0307406_10029271 | Ga0307406_100292713 | 304 |
| 110 | 3300031901 | Ga0307406_10138102 | Ga0307406_101381021 | 304 |
| 111 | 3300032002 | Ga0307416_100456204 | Ga0307416_1004562041 | 304 |
| 112 | 3300041410 | Ga0439461_0000426 | Ga0439461_0000426_4510_5460 | 304 |
| 113 | 3300041411 | Ga0439466_0003931 | Ga0439466_0003931_3040_3990 | 304 |
| 114 | 3300041997 | Ga0439431_0001293 | Ga0439431_0001293_4506_5453 | 304 |
| 115 | 3300041997 | Ga0439431_0005145 | Ga0439431_0005145_136_1095 | 304 |
| 116 | 3300042004 | Ga0439445_0001889 | Ga0439445_0001889_325_1284 | 304 |
| 117 | 3300048911 | Ga0496108_0052385 | Ga0496108_0052385_1437_2390 | 304 |
| 118 | 3300048912 | Ga0496109_0146170 | Ga0496109_0146170_1057_2010 | 304 |
| 119 | 3300048915 | Ga0496112_0036124 | Ga0496112_0036124_1763_2716 | 304 |
| 120 | 3300049742 | Ga0501080_0077234 | Ga0501080_0077234_858_1829 | 304 |
| 121 | 3300005334 | Ga0068869_100038195 | Ga0068869_1000381953 | 305 |
| 122 | 3300005335 | Ga0070666_10051621 | Ga0070666_100516213 | 305 |
| 123 | 3300005338 | Ga0068868_100008755 | Ga0068868_1000087557 | 305 |
| 124 | 3300005364 | Ga0070673_100053781 | Ga0070673_1000537812 | 305 |
| 125 | 3300005459 | Ga0068867_100065425 | Ga0068867_1000654251 | 305 |
| 126 | 3300005547 | Ga0070693_100060565 | Ga0070693_1000605652 | 305 |
| 127 | 3300005578 | Ga0068854_100210423 | Ga0068854_1002104232 | 305 |
| 128 | 3300005842 | Ga0068858_100103289 | Ga0068858_1001032893 | 305 |
| 129 | 3300005842 | Ga0068858_100223992 | Ga0068858_1002239922 | 305 |
| 130 | 3300009553 | Ga0105249_10007211 | Ga0105249_100072113 | 305 |
| 131 | 3300025900 | Ga0207710_10071286 | Ga0207710_100712862 | 305 |
| 132 | 3300025960 | Ga0207651_10340246 | Ga0207651_103402461 | 305 |
| 133 | 3300026035 | Ga0207703_10164472 | Ga0207703_101644722 | 305 |
| 134 | 3300026118 | Ga0207675_100297085 | Ga0207675_1002970853 | 305 |
| 135 | 3300044658 | Ga0466972_0009396 | Ga0466972_0009396_1977_2981 | 305 |
| 136 | 3300044683 | Ga0466965_0003590 | Ga0466965_0003590_897_1901 | 305 |
| 137 | 3300044719 | Ga0466971_0111585 | Ga0466971_0111585_186_1190 | 305 |
| 138 | 3300044735 | Ga0466968_0000108 | Ga0466968_0000108_20171_21175 | 305 |
| 139 | 3300044765 | Ga0466970_0016648 | Ga0466970_0016648_169_1173 | 305 |
| 140 | 3300044842 | Ga0466957_0054378 | Ga0466957_0054378_517_1521 | 305 |
| 141 | 3300044901 | Ga0466960_0003532 | Ga0466960_0003532_1267_2271 | 305 |
| 142 | 3300045049 | Ga0466959_0028423 | Ga0466959_0028423_2220_3224 | 305 |
| 143 | 3300045836 | Ga0466958_0037539 | Ga0466958_0037539_103_1107 | 305 |
| 144 | 3300046524 | Ga0495648_0167588 | Ga0495648_0167588_39_956 | 305 |
| 145 | 3300048903 | Ga0496100_0281224 | Ga0496100_0281224_114_1121 | 305 |
| 146 | 3300048904 | Ga0496101_0019497 | Ga0496101_0019497_2517_3521 | 305 |
| 147 | 3300048905 | Ga0496102_0142487 | Ga0496102_0142487_171_1178 | 305 |
| 148 | 3300048909 | Ga0496106_0031201 | Ga0496106_0031201_35_1042 | 305 |
| 149 | 3300048915 | Ga0496112_0002212 | Ga0496112_0002212_11776_12780 | 305 |
| 150 | 3300048916 | Ga0496113_0030331 | Ga0496113_0030331_2662_3666 | 305 |
| 151 | 3300048916 | Ga0496113_0163484 | Ga0496113_0163484_640_1587 | 305 |
| 152 | 3300048925 | Ga0496122_0007197 | Ga0496122_0007197_6751_7755 | 305 |
| 153 | 3300048926 | Ga0496123_0004868 | Ga0496123_0004868_5423_6427 | 305 |
| 154 | 3300011119 | Ga0105246_10318246 | Ga0105246_103182461 | 306 |
| 155 | 3300045049 | Ga0466959_0017475 | Ga0466959_0017475_3517_4506 | 306 |
| 156 | 3300046499 | Ga0495594_0078457 | Ga0495594_0078457_167_1138 | 306 |
| 157 | 3300046526 | Ga0495666_0134937 | Ga0495666_0134937_16_987 | 306 |
| 158 | 3300048904 | Ga0496101_0006009 | Ga0496101_0006009_4849_5799 | 306 |
| 159 | 3300048904 | Ga0496101_0279961 | Ga0496101_0279961_88_1095 | 306 |
| 160 | 3300048905 | Ga0496102_0212249 | Ga0496102_0212249_131_1117 | 306 |
| 161 | 3300048908 | Ga0496105_0155730 | Ga0496105_0155730_119_1126 | 306 |
| 162 | 3300048915 | Ga0496112_0062456 | Ga0496112_0062456_2655_3608 | 306 |
| 163 | 3300048923 | Ga0496120_0019034 | Ga0496120_0019034_1633_2583 | 306 |
| 164 | 3300048924 | Ga0496121_0002593 | Ga0496121_0002593_12340_13290 | 306 |
| 165 | 3300048928 | Ga0496125_0027348 | Ga0496125_0027348_2302_3252 | 306 |
| 166 | 3300048929 | Ga0496126_0007315 | Ga0496126_0007315_8696_9646 | 306 |
| 167 | 3300049581 | Ga0501047_0135868 | Ga0501047_0135868_97_1035 | 306 |
| 168 | 3300009177 | Ga0105248_10111871 | Ga0105248_101118712 | 307 |
| 169 | 3300011119 | Ga0105246_10362621 | Ga0105246_103626211 | 307 |
| 170 | 3300031824 | Ga0307413_10113536 | Ga0307413_101135362 | 307 |
| 171 | 3300044658 | Ga0466972_0011017 | Ga0466972_0011017_3176_4129 | 307 |
| 172 | 3300044683 | Ga0466965_0019854 | Ga0466965_0019854_255_1208 | 307 |
| 173 | 3300044684 | Ga0466966_0013124 | Ga0466966_0013124_3620_4573 | 307 |
| 174 | 3300044693 | Ga0466961_0014217 | Ga0466961_0014217_1974_2927 | 307 |
| 175 | 3300044719 | Ga0466971_0021081 | Ga0466971_0021081_246_1199 | 307 |
| 176 | 3300044765 | Ga0466970_0007094 | Ga0466970_0007094_4394_5347 | 307 |
| 177 | 3300044842 | Ga0466957_0017116 | Ga0466957_0017116_1580_2533 | 307 |
| 178 | 3300045836 | Ga0466958_0014966 | Ga0466958_0014966_1899_2852 | 307 |
| 179 | 3300046524 | Ga0495648_0016941 | Ga0495648_0016941_510_1466 | 307 |
| 180 | 3300046530 | Ga0495654_0094733 | Ga0495654_0094733_13_969 | 307 |
| 181 | 3300047469 | Ga0495673_0002760 | Ga0495673_0002760_637_1593 | 307 |
| 182 | 3300048905 | Ga0496102_0000070 | Ga0496102_0000070_102575_103528 | 307 |
| 183 | 3300048906 | Ga0496103_0000484 | Ga0496103_0000484_5696_6649 | 307 |
| 184 | 3300048919 | Ga0496116_0167328 | Ga0496116_0167328_62_1015 | 307 |
| 185 | 3300048920 | Ga0496117_0000319 | Ga0496117_0000319_751_1704 | 307 |
| 186 | 3300048922 | Ga0496119_0003584 | Ga0496119_0003584_13178_14131 | 307 |
| 187 | 3300053087 | Ga0500643_011807 | Ga0500643_011807_427_1383 | 307 |
| 188 | 3300053155 | Ga0500620_089335 | Ga0500620_089335_86_1039 | 307 |
| 189 | 3300061719 | Ga0466962_0008905 | Ga0466962_0008905_2241_3194 | 307 |
| 190 | 3300005548 | Ga0070665_100307055 | Ga0070665_1003070552 | 308 |
| 191 | 3300005937 | Ga0081455_10087542 | Ga0081455_100875423 | 308 |
| 192 | 3300025303 | Ga0209051_1000620 | Ga0209051_10006202 | 308 |
| 193 | 3300047472 | Ga0495686_0000637 | Ga0495686_0000637_13782_14708 | 308 |
| 194 | iso_pu_bacteria | 2643221715 | 2644636222 | 308 |
| 195 | 3300041410 | Ga0439461_0000796 | Ga0439461_0000796_184_1179 | 309 |
| 196 | 3300041997 | Ga0439431_0013964 | Ga0439431_0013964_396_1391 | 309 |
| 197 | 3300042004 | Ga0439445_0006099 | Ga0439445_0006099_1737_2732 | 309 |
| 198 | 3300044658 | Ga0466972_0026711 | Ga0466972_0026711_526_1497 | 309 |
| 199 | 3300002077 | JGI24744J21845_10009503 | JGI24744J21845_100095032 | 310 |
| 200 | 3300005329 | Ga0070683_100096618 | Ga0070683_1000966182 | 310 |
| 201 | 3300005337 | Ga0070682_100005205 | Ga0070682_1000052055 | 310 |
| 202 | 3300005337 | Ga0070682_100082499 | Ga0070682_1000824991 | 310 |
| 203 | 3300005343 | Ga0070687_100099572 | Ga0070687_1000995722 | 310 |
| 204 | 3300005367 | Ga0070667_100000909 | Ga0070667_10000090921 | 310 |
| 205 | 3300005455 | Ga0070663_100134155 | Ga0070663_1001341552 | 310 |
| 206 | 3300005466 | Ga0070685_10063041 | Ga0070685_100630412 | 310 |
| 207 | 3300005539 | Ga0068853_100256334 | Ga0068853_1002563342 | 310 |
| 208 | 3300005615 | Ga0070702_100117127 | Ga0070702_1001171271 | 310 |
| 209 | 3300005618 | Ga0068864_100057810 | Ga0068864_1000578102 | 310 |
| 210 | 3300005834 | Ga0068851_10089836 | Ga0068851_100898362 | 310 |
| 211 | 3300006048 | Ga0075363_100001338 | Ga0075363_1000013384 | 310 |
| 212 | 3300006048 | Ga0075363_100018698 | Ga0075363_1000186984 | 310 |
| 213 | 3300006353 | Ga0075370_10022009 | Ga0075370_100220093 | 310 |
| 214 | 3300006353 | Ga0075370_10092048 | Ga0075370_100920482 | 310 |
| 215 | 3300009101 | Ga0105247_10000328 | Ga0105247_100003285 | 310 |
| 216 | 3300009101 | Ga0105247_10012064 | Ga0105247_100120643 | 310 |
| 217 | 3300009174 | Ga0105241_10074113 | Ga0105241_100741132 | 310 |
| 218 | 3300009177 | Ga0105248_10052591 | Ga0105248_100525913 | 310 |
| 219 | 3300025901 | Ga0207688_10062565 | Ga0207688_100625652 | 310 |
| 220 | 3300025903 | Ga0207680_10049816 | Ga0207680_100498162 | 310 |
| 221 | 3300025924 | Ga0207694_10070232 | Ga0207694_100702322 | 310 |
| 222 | 3300025928 | Ga0207700_10065821 | Ga0207700_100658213 | 310 |
| 223 | 3300025986 | Ga0207658_10008227 | Ga0207658_100082275 | 310 |
| 224 | 3300034819 | Ga0373958_0012687 | Ga0373958_0012687_36_998 | 310 |
| 225 | 3300045976 | Ga0466967_0012158 | Ga0466967_0012158_874_1848 | 310 |
| 226 | 3300045976 | Ga0466967_0628222 | Ga0466967_0628222_40_1023 | 310 |
| 227 | 3300046507 | Ga0495606_0181315 | Ga0495606_0181315_146_1111 | 310 |
| 228 | 3300048903 | Ga0496100_0000077 | Ga0496100_0000077_45540_46502 | 310 |
| 229 | 3300048904 | Ga0496101_0000042 | Ga0496101_0000042_154776_155738 | 310 |
| 230 | 3300048904 | Ga0496101_0006100 | Ga0496101_0006100_2697_3659 | 310 |
| 231 | 3300048905 | Ga0496102_0026118 | Ga0496102_0026118_3570_4532 | 310 |
| 232 | 3300048906 | Ga0496103_0004276 | Ga0496103_0004276_5155_6117 | 310 |
| 233 | 3300048909 | Ga0496106_0005705 | Ga0496106_0005705_4738_5700 | 310 |
| 234 | 3300048910 | Ga0496107_0000718 | Ga0496107_0000718_4659_5621 | 310 |
| 235 | 3300048910 | Ga0496107_0098611 | Ga0496107_0098611_447_1409 | 310 |
| 236 | 3300048911 | Ga0496108_0034491 | Ga0496108_0034491_29_991 | 310 |
| 237 | 3300048912 | Ga0496109_0000452 | Ga0496109_0000452_26799_27761 | 310 |
| 238 | 3300048912 | Ga0496109_0037368 | Ga0496109_0037368_260_1225 | 310 |
| 239 | 3300048913 | Ga0496110_0054179 | Ga0496110_0054179_411_1373 | 310 |
| 240 | 3300048914 | Ga0496111_0027696 | Ga0496111_0027696_2345_3307 | 310 |
| 241 | 3300048915 | Ga0496112_0000750 | Ga0496112_0000750_3029_4006 | 310 |
| 242 | 3300048915 | Ga0496112_0014213 | Ga0496112_0014213_5349_6314 | 310 |
| 243 | 3300048915 | Ga0496112_0026123 | Ga0496112_0026123_1698_2669 | 310 |
| 244 | 3300048916 | Ga0496113_0003095 | Ga0496113_0003095_8323_9294 | 310 |
| 245 | 3300048917 | Ga0496114_0000319 | Ga0496114_0000319_3641_4603 | 310 |
| 246 | 3300048918 | Ga0496115_0000807 | Ga0496115_0000807_16980_17942 | 310 |
| 247 | 3300048918 | Ga0496115_0244881 | Ga0496115_0244881_167_1129 | 310 |
| 248 | 3300048919 | Ga0496116_0004012 | Ga0496116_0004012_5812_6774 | 310 |
| 249 | 3300048921 | Ga0496118_0087035 | Ga0496118_0087035_1070_2032 | 310 |
| 250 | 3300048922 | Ga0496119_0011044 | Ga0496119_0011044_5654_6616 | 310 |
| 251 | 3300048924 | Ga0496121_0000139 | Ga0496121_0000139_154776_155738 | 310 |
| 252 | 3300048925 | Ga0496122_0000149 | Ga0496122_0000149_155004_155966 | 310 |
| 253 | 3300048925 | Ga0496122_0090279 | Ga0496122_0090279_816_1787 | 310 |
| 254 | 3300048927 | Ga0496124_0000114 | Ga0496124_0000114_156815_157777 | 310 |
| 255 | 3300048928 | Ga0496125_0000130 | Ga0496125_0000130_154776_155738 | 310 |
| 256 | 3300048929 | Ga0496126_0000149 | Ga0496126_0000149_7439_8401 | 310 |
| 257 | 3300048929 | Ga0496126_0005371 | Ga0496126_0005371_8640_9611 | 310 |
| 258 | 3300049742 | Ga0501080_0396950 | Ga0501080_0396950_35_997 | 310 |
| 259 | 3300050489 | nmdc:mga03683_69585_c1 | nmdc:mga03683_69585_c1_320_1282 | 310 |
| 260 | 3300050490 | nmdc:mga03n38_2563_c1 | nmdc:mga03n38_2563_c1_813_1778 | 310 |
| 261 | 3300050490 | nmdc:mga03n38_57403_c1 | nmdc:mga03n38_57403_c1_71_1033 | 310 |
| 262 | 3300050490 | nmdc:mga03n38_64893_c1 | nmdc:mga03n38_64893_c1_474_1436 | 310 |
| 263 | 3300050496 | nmdc:mga07m45_26614_c1 | nmdc:mga07m45_26614_c1_399_1361 | 310 |
| 264 | 3300050511 | nmdc:mga08y16_366072_c1 | nmdc:mga08y16_366072_c1_354_1316 | 310 |
| 265 | 3300050516 | nmdc:mga0sz30_6497_c1 | nmdc:mga0sz30_6497_c1_1739_2731 | 310 |
| 266 | 3300003792 | Ga0055540_1000913 | Ga0055540_10009138 | 311 |
| 267 | 3300005843 | Ga0068860_100000021 | Ga0068860_1000000216 | 311 |
| 268 | 3300005844 | Ga0068862_100000015 | Ga0068862_1000000157 | 311 |
| 269 | 3300006186 | Ga0075369_10010217 | Ga0075369_100102171 | 311 |
| 270 | 3300025273 | Ga0209673_1029218 | Ga0209673_10292182 | 311 |
| 271 | 3300025303 | Ga0209051_1003712 | Ga0209051_10037129 | 311 |
| 272 | 3300025900 | Ga0207710_10000078 | Ga0207710_100000786 | 311 |
| 273 | 3300025945 | Ga0207679_10092910 | Ga0207679_100929102 | 311 |
| 274 | 3300025961 | Ga0207712_10000028 | Ga0207712_10000028209 | 311 |
| 275 | 3300025986 | Ga0207658_10000679 | Ga0207658_100006792 | 311 |
| 276 | 3300026121 | Ga0207683_10209660 | Ga0207683_102096602 | 311 |
| 277 | 3300028380 | Ga0268265_10000023 | Ga0268265_100000237 | 311 |
| 278 | 3300028381 | Ga0268264_10000099 | Ga0268264_100000996 | 311 |
| 279 | 3300039437 | Ga0436365_0410802 | Ga0436365_0410802_35157_36158 | 311 |
| 280 | 3300048903 | Ga0496100_0002024 | Ga0496100_0002024_4023_5006 | 311 |
| 281 | 3300048904 | Ga0496101_0004118 | Ga0496101_0004118_5322_6305 | 311 |
| 282 | 3300048907 | Ga0496104_0001295 | Ga0496104_0001295_12907_13890 | 311 |
| 283 | 3300048909 | Ga0496106_0002680 | Ga0496106_0002680_7110_8093 | 311 |
| 284 | 3300048917 | Ga0496114_0000848 | Ga0496114_0000848_9474_10457 | 311 |
| 285 | 3300048918 | Ga0496115_0001191 | Ga0496115_0001191_6454_7437 | 311 |
| 286 | 3300048921 | Ga0496118_0000029 | Ga0496118_0000029_77716_78738 | 311 |
| 287 | iso_pu_bacteria | 2738541274 | 2738703914 | 311 |
| 288 | iso_pu_bacteria | 2738543028 | 2739330788 | 311 |
| 289 | 3300006178 | Ga0075367_10106939 | Ga0075367_101069392 | 312 |
| 290 | 3300009101 | Ga0105247_10034300 | Ga0105247_100343003 | 312 |
| 291 | 3300009176 | Ga0105242_10128879 | Ga0105242_101288792 | 312 |
| 292 | 3300013105 | Ga0157369_10067305 | Ga0157369_100673052 | 312 |
| 293 | 3300013308 | Ga0157375_10103882 | Ga0157375_101038822 | 312 |
| 294 | 3300025899 | Ga0207642_10025868 | Ga0207642_100258682 | 312 |
| 295 | 3300025934 | Ga0207686_10129084 | Ga0207686_101290842 | 312 |
| 296 | 3300025941 | Ga0207711_10062968 | Ga0207711_100629682 | 312 |
| 297 | 3300026088 | Ga0207641_10198814 | Ga0207641_101988142 | 312 |
| 298 | 3300041410 | Ga0439461_0003852 | Ga0439461_0003852_1213_2184 | 312 |
| 299 | 3300042002 | Ga0439442_006960 | Ga0439442_006960_10_981 | 312 |
| 300 | 3300042004 | Ga0439445_0034103 | Ga0439445_0034103_94_1065 | 312 |
| 301 | 3300044658 | Ga0466972_0012965 | Ga0466972_0012965_2744_3688 | 312 |
| 302 | 3300044683 | Ga0466965_0015378 | Ga0466965_0015378_2297_3241 | 312 |
| 303 | 3300044735 | Ga0466968_0001353 | Ga0466968_0001353_3881_4825 | 312 |
| 304 | 3300044765 | Ga0466970_0013275 | Ga0466970_0013275_2004_2948 | 312 |
| 305 | 3300044842 | Ga0466957_0009809 | Ga0466957_0009809_1623_2567 | 312 |
| 306 | 3300044901 | Ga0466960_0000346 | Ga0466960_0000346_12295_13239 | 312 |
| 307 | 3300045049 | Ga0466959_0016474 | Ga0466959_0016474_568_1512 | 312 |
| 308 | 3300045836 | Ga0466958_0051534 | Ga0466958_0051534_1257_2201 | 312 |
| 309 | 3300045976 | Ga0466967_0106649 | Ga0466967_0106649_365_1309 | 312 |
| 310 | 3300048915 | Ga0496112_0242577 | Ga0496112_0242577_477_1421 | 312 |
| 311 | 3300048916 | Ga0496113_0059404 | Ga0496113_0059404_466_1410 | 312 |
| 312 | 3300048925 | Ga0496122_0080832 | Ga0496122_0080832_213_1157 | 312 |
| 313 | 3300048926 | Ga0496123_0057749 | Ga0496123_0057749_1367_2311 | 312 |
| 314 | 3300048929 | Ga0496126_0005992 | Ga0496126_0005992_10385_11329 | 312 |
| 315 | 3300049571 | Ga0501034_0014466 | Ga0501034_0014466_6708_7712 | 312 |
| 316 | 3300049581 | Ga0501047_0007602 | Ga0501047_0007602_6469_7473 | 312 |
| 317 | 3300049582 | Ga0501048_0122628 | Ga0501048_0122628_21_1025 | 312 |
| 318 | 3300049822 | Ga0501035_0000818 | Ga0501035_0000818_28435_29439 | 312 |
| 319 | 3300049823 | Ga0501044_0000373 | Ga0501044_0000373_51300_52304 | 312 |
| 320 | 3300050490 | nmdc:mga03n38_7409_c1 | nmdc:mga03n38_7409_c1_2311_3285 | 312 |
| 321 | 3300050492 | nmdc:mga0yw44_58321_c1 | nmdc:mga0yw44_58321_c1_620_1594 | 312 |
| 322 | 3300005353 | Ga0070669_100002332 | Ga0070669_1000023326 | 313 |
| 323 | 3300005367 | Ga0070667_100000782 | Ga0070667_10000078229 | 313 |
| 324 | 3300005548 | Ga0070665_100086922 | Ga0070665_1000869223 | 313 |
| 325 | 3300005617 | Ga0068859_100002413 | Ga0068859_1000024136 | 313 |
| 326 | 3300005841 | Ga0068863_100012525 | Ga0068863_1000125256 | 313 |
| 327 | 3300006931 | Ga0097620_100002413 | Ga0097620_1000024136 | 313 |
| 328 | 3300009101 | Ga0105247_10000053 | Ga0105247_100000536 | 313 |
| 329 | 3300009177 | Ga0105248_10016483 | Ga0105248_100164836 | 313 |
| 330 | 3300009545 | Ga0105237_10010933 | Ga0105237_100109335 | 313 |
| 331 | 3300009553 | Ga0105249_10000125 | Ga0105249_1000012573 | 313 |
| 332 | 3300010375 | Ga0105239_10136140 | Ga0105239_101361403 | 313 |
| 333 | 3300025923 | Ga0207681_10001300 | Ga0207681_1000130011 | 313 |
| 334 | 3300025941 | Ga0207711_10010206 | Ga0207711_100102062 | 313 |
| 335 | 3300026088 | Ga0207641_10003363 | Ga0207641_100033639 | 313 |
| 336 | 3300028379 | Ga0268266_10173470 | Ga0268266_101734702 | 313 |
| 337 | 3300039437 | Ga0436365_1023426 | Ga0436365_1023426_1126_2157 | 313 |
| 338 | 3300046460 | Ga0495638_0004222 | Ga0495638_0004222_8771_9763 | 313 |
| 339 | 3300048903 | Ga0496100_0000412 | Ga0496100_0000412_5927_6937 | 313 |
| 340 | 3300048904 | Ga0496101_0004253 | Ga0496101_0004253_3635_4600 | 313 |
| 341 | 3300048905 | Ga0496102_0004377 | Ga0496102_0004377_4244_5209 | 313 |
| 342 | 3300048906 | Ga0496103_0000341 | Ga0496103_0000341_7039_8004 | 313 |
| 343 | 3300048910 | Ga0496107_0012252 | Ga0496107_0012252_2914_3879 | 313 |
| 344 | 3300048919 | Ga0496116_0009583 | Ga0496116_0009583_2340_3305 | 313 |
| 345 | 3300048920 | Ga0496117_0006001 | Ga0496117_0006001_6557_7522 | 313 |
| 346 | 3300048921 | Ga0496118_0001467 | Ga0496118_0001467_26906_27871 | 313 |
| 347 | 3300048922 | Ga0496119_0009760 | Ga0496119_0009760_6464_7429 | 313 |
| 348 | 3300048924 | Ga0496121_0013545 | Ga0496121_0013545_532_1497 | 313 |
| 349 | 3300048927 | Ga0496124_0074199 | Ga0496124_0074199_649_1614 | 313 |
| 350 | 3300048928 | Ga0496125_0012786 | Ga0496125_0012786_5973_6938 | 313 |
| 351 | 3300048929 | Ga0496126_0007273 | Ga0496126_0007273_11140_12105 | 313 |
| 352 | 3300053096 | Ga0500641_0041678 | Ga0500641_0041678_624_1616 | 313 |
| 353 | 3300005937 | Ga0081455_10162312 | Ga0081455_101623122 | 314 |
| 354 | 3300006178 | Ga0075367_10188789 | Ga0075367_101887891 | 314 |
| 355 | 3300009174 | Ga0105241_10382170 | Ga0105241_103821701 | 314 |
| 356 | 3300031251 | Ga0265327_10012693 | Ga0265327_100126935 | 314 |
| 357 | 3300048905 | Ga0496102_0065820 | Ga0496102_0065820_165_1169 | 314 |
| 358 | 3300006038 | Ga0075365_10072393 | Ga0075365_100723931 | 315 |
| 359 | 3300006051 | Ga0075364_10150714 | Ga0075364_101507141 | 315 |
| 360 | 3300006186 | Ga0075369_10037908 | Ga0075369_100379082 | 315 |
| 361 | 3300006353 | Ga0075370_10074386 | Ga0075370_100743862 | 315 |
| 362 | 3300039437 | Ga0436365_1353958 | Ga0436365_1353958_697_1668 | 315 |
| 363 | 3300041460 | Ga0451802_0840566 | Ga0451802_0840566_1375_2355 | 315 |
| 364 | 3300050490 | nmdc:mga03n38_20064_c1 | nmdc:mga03n38_20064_c1_827_1858 | 315 |
| 365 | 3300050496 | nmdc:mga07m45_34805_c1 | nmdc:mga07m45_34805_c1_712_1689 | 315 |
| 366 | 3300050496 | nmdc:mga07m45_93155_c1 | nmdc:mga07m45_93155_c1_295_1326 | 315 |
| 367 | 3300050516 | nmdc:mga0sz30_52440_c1 | nmdc:mga0sz30_52440_c1_400_1431 | 315 |
| 368 | iso_pu_bacteria | 2902792274 | 2902795254 | 315 |
| 369 | iso_pu_bacteria | 2902810491 | 2902815740 | 315 |
| 370 | 3300039447 | Ga0436361_0850467 | Ga0436361_0850467_500_1477 | 316 |
| 371 | iso_pu_bacteria | 2643221687 | 2644485478 | 316 |
| 372 | iso_pu_bacteria | 2643221687 | 2644488338 | 316 |
| 373 | iso_pu_bacteria | 2643221715 | 2644634156 | 316 |
| 374 | iso_pu_bacteria | 2643221715 | 2644639981 | 316 |
| 375 | iso_pu_bacteria | 2738541274 | 2738704322 | 316 |
| 376 | iso_pu_bacteria | 2738543028 | 2739331195 | 316 |
| 377 | iso_pu_bacteria | 2902792274 | 2902798144 | 316 |
| 378 | iso_pu_bacteria | 2902799365 | 2902804466 | 316 |
| 379 | iso_pu_bacteria | 2902810491 | 2902811314 | 316 |
| 380 | iso_pu_bacteria | 2902810491 | 2902811810 | 316 |
| 381 | iso_pu_bacteria | 2902837492 | 2902841431 | 316 |
| 382 | 3300005844 | Ga0068862_100436535 | Ga0068862_1004365351 | 317 |
| 383 | 3300006186 | Ga0075369_10001676 | Ga0075369_100016762 | 317 |
| 384 | 3300009147 | Ga0114129_10027500 | Ga0114129_100275003 | 317 |
| 385 | 3300021384 | Ga0213876_10027794 | Ga0213876_100277942 | 317 |
| 386 | 3300021388 | Ga0213875_10011913 | Ga0213875_100119131 | 317 |
| 387 | 3300037853 | Ga0436364_0327816 | Ga0436364_0327816_2953_3942 | 317 |
| 388 | 3300039437 | Ga0436365_1305825 | Ga0436365_1305825_1516_2505 | 317 |
| 389 | 3300039437 | Ga0436365_1920643 | Ga0436365_1920643_2507_3493 | 317 |
| 390 | 3300041413 | Ga0439465_0002323 | Ga0439465_0002323_1724_2758 | 317 |
| 391 | 3300041413 | Ga0439465_0016749 | Ga0439465_0016749_549_1598 | 317 |
| 392 | 3300041997 | Ga0439431_0004428 | Ga0439431_0004428_1516_2565 | 317 |
| 393 | 3300042002 | Ga0439442_011406 | Ga0439442_011406_13_1062 | 317 |
| 394 | 3300044658 | Ga0466972_0007610 | Ga0466972_0007610_3978_4967 | 317 |
| 395 | 3300044683 | Ga0466965_0001452 | Ga0466965_0001452_8036_9025 | 317 |
| 396 | 3300044901 | Ga0466960_0000084 | Ga0466960_0000084_21379_22368 | 317 |
| 397 | 3300048905 | Ga0496102_0166789 | Ga0496102_0166789_852_1886 | 317 |
| 398 | 3300049581 | Ga0501047_0004729 | Ga0501047_0004729_2755_3753 | 317 |
| 399 | 3300049585 | Ga0501069_0085788 | Ga0501069_0085788_505_1494 | 317 |
| 400 | 3300050490 | nmdc:mga03n38_7217_c1 | nmdc:mga03n38_7217_c1_2043_3029 | 317 |
| 401 | 3300050491 | nmdc:mga00v17_29528_c1 | nmdc:mga00v17_29528_c1_1474_2460 | 317 |
| 402 | 3300050492 | nmdc:mga0yw44_67315_c1 | nmdc:mga0yw44_67315_c1_255_1241 | 317 |
| 403 | 3300050507 | nmdc:mga05p37_26956_c1 | nmdc:mga05p37_26956_c1_1893_2930 | 317 |
| 404 | 3300050509 | nmdc:mga0qj67_74038_c1 | nmdc:mga0qj67_74038_c1_535_1572 | 317 |
| 405 | 3300050510 | nmdc:mga06r32_148327_c1 | nmdc:mga06r32_148327_c1_1266_2303 | 317 |
| 406 | 3300050516 | nmdc:mga0sz30_3473_c1 | nmdc:mga0sz30_3473_c1_1184_2173 | 317 |
| 407 | 3300005435 | Ga0070714_100022804 | Ga0070714_1000228043 | 318 |
| 408 | 3300006038 | Ga0075365_10216916 | Ga0075365_102169161 | 318 |
| 409 | 3300006048 | Ga0075363_100002533 | Ga0075363_1000025339 | 318 |
| 410 | 3300025929 | Ga0207664_10150395 | Ga0207664_101503952 | 318 |
| 411 | 3300031852 | Ga0307410_10259290 | Ga0307410_102592902 | 318 |
| 412 | 3300050490 | nmdc:mga03n38_611_c1 | nmdc:mga03n38_611_c1_1954_2925 | 318 |
| 413 | 3300050491 | nmdc:mga00v17_5821_c1 | nmdc:mga00v17_5821_c1_5238_6209 | 318 |
| 414 | 3300050496 | nmdc:mga07m45_23230_c1 | nmdc:mga07m45_23230_c1_2059_3030 | 318 |
| 415 | 3300050516 | nmdc:mga0sz30_43725_c1 | nmdc:mga0sz30_43725_c1_489_1460 | 318 |
| 416 | iso_pu_bacteria | 2738541264 | 2738663837 | 318 |
| 417 | iso_pu_bacteria | 2738541274 | 2738708649 | 318 |
| 418 | iso_pu_bacteria | 2738543028 | 2739335169 | 318 |
| 419 | iso_pu_bacteria | 2842134933 | 2842136167 | 318 |
| 420 | iso_pu_bacteria | 2842134933 | 2842138769 | 318 |
| 421 | iso_pu_bacteria | 2902792274 | 2902799068 | 318 |
| 422 | iso_pu_bacteria | 2902799365 | 2902804368 | 318 |
| 423 | iso_pu_bacteria | 2929212328 | 2929214406 | 318 |
| 424 | iso_pu_bacteria | 2929212328 | 2929218437 | 318 |
| 425 | iso_pu_bacteria | 2939582691 | 2939583638 | 318 |
| 426 | iso_pu_bacteria | 2939582691 | 2939586296 | 318 |
| 427 | 3300002073 | JGI24745J21846_1007035 | JGI24745J21846_10070351 | 319 |
| 428 | 3300003792 | Ga0055540_1003066 | Ga0055540_10030665 | 319 |
| 429 | 3300003792 | Ga0055540_1006127 | Ga0055540_10061276 | 319 |
| 430 | 3300003792 | Ga0055540_1022773 | Ga0055540_10227732 | 319 |
| 431 | 3300005328 | Ga0070676_10017923 | Ga0070676_100179234 | 319 |
| 432 | 3300005334 | Ga0068869_100110989 | Ga0068869_1001109891 | 319 |
| 433 | 3300005337 | Ga0070682_100143506 | Ga0070682_1001435061 | 319 |
| 434 | 3300005338 | Ga0068868_100000582 | Ga0068868_1000005822 | 319 |
| 435 | 3300005347 | Ga0070668_100001337 | Ga0070668_1000013374 | 319 |
| 436 | 3300005353 | Ga0070669_100001646 | Ga0070669_1000016464 | 319 |
| 437 | 3300005354 | Ga0070675_100059332 | Ga0070675_1000593322 | 319 |
| 438 | 3300005355 | Ga0070671_100002936 | Ga0070671_1000029369 | 319 |
| 439 | 3300005356 | Ga0070674_100050740 | Ga0070674_1000507402 | 319 |
| 440 | 3300005364 | Ga0070673_100045830 | Ga0070673_1000458303 | 319 |
| 441 | 3300005367 | Ga0070667_100000075 | Ga0070667_10000007517 | 319 |
| 442 | 3300005434 | Ga0070709_10088948 | Ga0070709_100889482 | 319 |
| 443 | 3300005437 | Ga0070710_10000230 | Ga0070710_1000023012 | 319 |
| 444 | 3300005438 | Ga0070701_10002623 | Ga0070701_100026232 | 319 |
| 445 | 3300005439 | Ga0070711_100002822 | Ga0070711_1000028224 | 319 |
| 446 | 3300005455 | Ga0070663_100025982 | Ga0070663_1000259822 | 319 |
| 447 | 3300005456 | Ga0070678_100111460 | Ga0070678_1001114602 | 319 |
| 448 | 3300005457 | Ga0070662_100005597 | Ga0070662_1000055973 | 319 |
| 449 | 3300005459 | Ga0068867_100002882 | Ga0068867_10000288212 | 319 |
| 450 | 3300005543 | Ga0070672_100061252 | Ga0070672_1000612522 | 319 |
| 451 | 3300005545 | Ga0070695_100060503 | Ga0070695_1000605032 | 319 |
| 452 | 3300005548 | Ga0070665_100005421 | Ga0070665_10000542110 | 319 |
| 453 | 3300005548 | Ga0070665_100005636 | Ga0070665_10000563611 | 319 |
| 454 | 3300005563 | Ga0068855_100429238 | Ga0068855_1004292382 | 319 |
| 455 | 3300005616 | Ga0068852_100079232 | Ga0068852_1000792322 | 319 |
| 456 | 3300005841 | Ga0068863_100003502 | Ga0068863_1000035023 | 319 |
| 457 | 3300005842 | Ga0068858_100287015 | Ga0068858_1002870151 | 319 |
| 458 | 3300005843 | Ga0068860_100000025 | Ga0068860_100000025132 | 319 |
| 459 | 3300005844 | Ga0068862_100000045 | Ga0068862_100000045132 | 319 |
| 460 | 3300005937 | Ga0081455_10009898 | Ga0081455_100098988 | 319 |
| 461 | 3300005937 | Ga0081455_10021426 | Ga0081455_100214262 | 319 |
| 462 | 3300006038 | Ga0075365_10026563 | Ga0075365_100265632 | 319 |
| 463 | 3300006038 | Ga0075365_10041785 | Ga0075365_100417851 | 319 |
| 464 | 3300006038 | Ga0075365_10069646 | Ga0075365_100696462 | 319 |
| 465 | 3300006038 | Ga0075365_10253145 | Ga0075365_102531451 | 319 |
| 466 | 3300006042 | Ga0075368_10001464 | Ga0075368_100014644 | 319 |
| 467 | 3300006048 | Ga0075363_100002179 | Ga0075363_1000021792 | 319 |
| 468 | 3300006048 | Ga0075363_100018054 | Ga0075363_1000180543 | 319 |
| 469 | 3300006048 | Ga0075363_100061281 | Ga0075363_1000612812 | 319 |
| 470 | 3300006051 | Ga0075364_10002509 | Ga0075364_1000250910 | 319 |
| 471 | 3300006051 | Ga0075364_10007223 | Ga0075364_100072235 | 319 |
| 472 | 3300006051 | Ga0075364_10016845 | Ga0075364_100168452 | 319 |
| 473 | 3300006051 | Ga0075364_10064383 | Ga0075364_100643832 | 319 |
| 474 | 3300006051 | Ga0075364_10183705 | Ga0075364_101837051 | 319 |
| 475 | 3300006163 | Ga0070715_10001069 | Ga0070715_100010694 | 319 |
| 476 | 3300006177 | Ga0075362_10006752 | Ga0075362_100067523 | 319 |
| 477 | 3300006177 | Ga0075362_10063740 | Ga0075362_100637402 | 319 |
| 478 | 3300006178 | Ga0075367_10011089 | Ga0075367_100110893 | 319 |
| 479 | 3300006186 | Ga0075369_10008161 | Ga0075369_100081612 | 319 |
| 480 | 3300006186 | Ga0075369_10018238 | Ga0075369_100182382 | 319 |
| 481 | 3300006186 | Ga0075369_10033391 | Ga0075369_100333912 | 319 |
| 482 | 3300006186 | Ga0075369_10038102 | Ga0075369_100381022 | 319 |
| 483 | 3300006186 | Ga0075369_10086335 | Ga0075369_100863352 | 319 |
| 484 | 3300006195 | Ga0075366_10072830 | Ga0075366_100728302 | 319 |
| 485 | 3300006881 | Ga0068865_100006687 | Ga0068865_1000066875 | 319 |
| 486 | 3300009094 | Ga0111539_10365206 | Ga0111539_103652062 | 319 |
| 487 | 3300009101 | Ga0105247_10000010 | Ga0105247_10000010202 | 319 |
| 488 | 3300009101 | Ga0105247_10146870 | Ga0105247_101468701 | 319 |
| 489 | 3300009148 | Ga0105243_10145836 | Ga0105243_101458362 | 319 |
| 490 | 3300009177 | Ga0105248_10000145 | Ga0105248_1000014529 | 319 |
| 491 | 3300009177 | Ga0105248_10023837 | Ga0105248_100238374 | 319 |
| 492 | 3300009545 | Ga0105237_10002857 | Ga0105237_1000285712 | 319 |
| 493 | 3300009553 | Ga0105249_10000010 | Ga0105249_10000010197 | 319 |
| 494 | 3300010375 | Ga0105239_10006382 | Ga0105239_100063828 | 319 |
| 495 | 3300010375 | Ga0105239_10160449 | Ga0105239_101604492 | 319 |
| 496 | 3300011119 | Ga0105246_10078303 | Ga0105246_100783032 | 319 |
| 497 | 3300013105 | Ga0157369_10329888 | Ga0157369_103298881 | 319 |
| 498 | 3300013296 | Ga0157374_10065452 | Ga0157374_100654523 | 319 |
| 499 | 3300013306 | Ga0163162_10104020 | Ga0163162_101040202 | 319 |
| 500 | 3300014325 | Ga0163163_10048829 | Ga0163163_100488291 | 319 |
| 501 | 3300014325 | Ga0163163_10073653 | Ga0163163_100736533 | 319 |
| 502 | 3300014968 | Ga0157379_10012726 | Ga0157379_100127264 | 319 |
| 503 | 3300014968 | Ga0157379_10087121 | Ga0157379_100871213 | 319 |
| 504 | 3300017792 | Ga0163161_10010688 | Ga0163161_100106883 | 319 |
| 505 | 3300021377 | Ga0213874_10072497 | Ga0213874_100724971 | 319 |
| 506 | 3300021384 | Ga0213876_10007576 | Ga0213876_100075763 | 319 |
| 507 | 3300025303 | Ga0209051_1002038 | Ga0209051_10020386 | 319 |
| 508 | 3300025303 | Ga0209051_1008620 | Ga0209051_10086204 | 319 |
| 509 | 3300025885 | Ga0207653_10024221 | Ga0207653_100242212 | 319 |
| 510 | 3300025898 | Ga0207692_10073846 | Ga0207692_100738462 | 319 |
| 511 | 3300025900 | Ga0207710_10000028 | Ga0207710_10000028204 | 319 |
| 512 | 3300025900 | Ga0207710_10005233 | Ga0207710_100052332 | 319 |
| 513 | 3300025904 | Ga0207647_10024420 | Ga0207647_100244203 | 319 |
| 514 | 3300025905 | Ga0207685_10061835 | Ga0207685_100618351 | 319 |
| 515 | 3300025906 | Ga0207699_10030110 | Ga0207699_100301102 | 319 |
| 516 | 3300025907 | Ga0207645_10120764 | Ga0207645_101207642 | 319 |
| 517 | 3300025914 | Ga0207671_10018297 | Ga0207671_100182974 | 319 |
| 518 | 3300025916 | Ga0207663_10079423 | Ga0207663_100794232 | 319 |
| 519 | 3300025919 | Ga0207657_10191122 | Ga0207657_101911222 | 319 |
| 520 | 3300025923 | Ga0207681_10006641 | Ga0207681_100066415 | 319 |
| 521 | 3300025926 | Ga0207659_10023921 | Ga0207659_100239213 | 319 |
| 522 | 3300025927 | Ga0207687_10001412 | Ga0207687_100014124 | 319 |
| 523 | 3300025928 | Ga0207700_10204086 | Ga0207700_102040862 | 319 |
| 524 | 3300025931 | Ga0207644_10012729 | Ga0207644_100127294 | 319 |
| 525 | 3300025935 | Ga0207709_10007965 | Ga0207709_100079654 | 319 |
| 526 | 3300025935 | Ga0207709_10317721 | Ga0207709_103177211 | 319 |
| 527 | 3300025937 | Ga0207669_10000309 | Ga0207669_1000030916 | 319 |
| 528 | 3300025938 | Ga0207704_10001181 | Ga0207704_1000118114 | 319 |
| 529 | 3300025940 | Ga0207691_10093429 | Ga0207691_100934291 | 319 |
| 530 | 3300025941 | Ga0207711_10000069 | Ga0207711_100000692 | 319 |
| 531 | 3300025941 | Ga0207711_10064247 | Ga0207711_100642473 | 319 |
| 532 | 3300025942 | Ga0207689_10018308 | Ga0207689_100183083 | 319 |
| 533 | 3300025949 | Ga0207667_10154898 | Ga0207667_101548984 | 319 |
| 534 | 3300025961 | Ga0207712_10000016 | Ga0207712_10000016198 | 319 |
| 535 | 3300025961 | Ga0207712_10016281 | Ga0207712_100162813 | 319 |
| 536 | 3300025972 | Ga0207668_10000577 | Ga0207668_1000057716 | 319 |
| 537 | 3300025972 | Ga0207668_10003056 | Ga0207668_100030562 | 319 |
| 538 | 3300025986 | Ga0207658_10000237 | Ga0207658_1000023739 | 319 |
| 539 | 3300025986 | Ga0207658_10048169 | Ga0207658_100481693 | 319 |
| 540 | 3300026035 | Ga0207703_10214004 | Ga0207703_102140042 | 319 |
| 541 | 3300026041 | Ga0207639_10021526 | Ga0207639_100215263 | 319 |
| 542 | 3300026041 | Ga0207639_10224048 | Ga0207639_102240481 | 319 |
| 543 | 3300026067 | Ga0207678_10037542 | Ga0207678_100375422 | 319 |
| 544 | 3300026088 | Ga0207641_10001106 | Ga0207641_1000110622 | 319 |
| 545 | 3300026088 | Ga0207641_10096267 | Ga0207641_100962672 | 319 |
| 546 | 3300026089 | Ga0207648_10002032 | Ga0207648_100020323 | 319 |
| 547 | 3300026121 | Ga0207683_10000040 | Ga0207683_1000004086 | 319 |
| 548 | 3300028379 | Ga0268266_10003565 | Ga0268266_100035658 | 319 |
| 549 | 3300028379 | Ga0268266_10042527 | Ga0268266_100425274 | 319 |
| 550 | 3300028379 | Ga0268266_10146845 | Ga0268266_101468452 | 319 |
| 551 | 3300028380 | Ga0268265_10000056 | Ga0268265_10000056126 | 319 |
| 552 | 3300028381 | Ga0268264_10000053 | Ga0268264_10000053156 | 319 |
| 553 | 3300028381 | Ga0268264_10020195 | Ga0268264_100201954 | 319 |
| 554 | 3300031852 | Ga0307410_10018047 | Ga0307410_100180472 | 319 |
| 555 | 3300031852 | Ga0307410_10167929 | Ga0307410_101679292 | 319 |
| 556 | 3300031901 | Ga0307406_10007792 | Ga0307406_100077924 | 319 |
| 557 | 3300031995 | Ga0307409_100180745 | Ga0307409_1001807451 | 319 |
| 558 | 3300035691 | Ga0373931_0010168 | Ga0373931_0010168_3091_4086 | 319 |
| 559 | 3300036712 | Ga0316584_0015591 | Ga0316584_0015591_837_1835 | 319 |
| 560 | 3300039437 | Ga0436365_0217155 | Ga0436365_0217155_39454_40476 | 319 |
| 561 | 3300039450 | Ga0436363_1133793 | Ga0436363_1133793_3614_4612 | 319 |
| 562 | 3300041410 | Ga0439461_0000868 | Ga0439461_0000868_2564_3598 | 319 |
| 563 | 3300041411 | Ga0439466_0062648 | Ga0439466_0062648_180_1175 | 319 |
| 564 | 3300041413 | Ga0439465_0004304 | Ga0439465_0004304_2341_3336 | 319 |
| 565 | 3300042004 | Ga0439445_0056945 | Ga0439445_0056945_29_1033 | 319 |
| 566 | 3300044656 | Ga0466969_0136614 | Ga0466969_0136614_134_1123 | 319 |
| 567 | 3300044683 | Ga0466965_0000246 | Ga0466965_0000246_7033_8028 | 319 |
| 568 | 3300044684 | Ga0466966_0028129 | Ga0466966_0028129_1529_2518 | 319 |
| 569 | 3300044693 | Ga0466961_0080801 | Ga0466961_0080801_139_1128 | 319 |
| 570 | 3300044735 | Ga0466968_0000471 | Ga0466968_0000471_9188_10177 | 319 |
| 571 | 3300044735 | Ga0466968_0001160 | Ga0466968_0001160_4393_5388 | 319 |
| 572 | 3300044765 | Ga0466970_0036457 | Ga0466970_0036457_1146_2141 | 319 |
| 573 | 3300044765 | Ga0466970_0144904 | Ga0466970_0144904_306_1295 | 319 |
| 574 | 3300044842 | Ga0466957_0022462 | Ga0466957_0022462_2524_3519 | 319 |
| 575 | 3300044901 | Ga0466960_0001105 | Ga0466960_0001105_4565_5560 | 319 |
| 576 | 3300045049 | Ga0466959_0008207 | Ga0466959_0008207_3274_4263 | 319 |
| 577 | 3300045049 | Ga0466959_0009475 | Ga0466959_0009475_4946_5941 | 319 |
| 578 | 3300045836 | Ga0466958_0031320 | Ga0466958_0031320_1892_2881 | 319 |
| 579 | 3300045976 | Ga0466967_0026345 | Ga0466967_0026345_2962_3957 | 319 |
| 580 | 3300045976 | Ga0466967_0047539 | Ga0466967_0047539_238_1233 | 319 |
| 581 | 3300045976 | Ga0466967_0146524 | Ga0466967_0146524_958_1953 | 319 |
| 582 | 3300046455 | Ga0495603_0027201 | Ga0495603_0027201_1806_2804 | 319 |
| 583 | 3300046459 | Ga0495629_0024776 | Ga0495629_0024776_1434_2432 | 319 |
| 584 | 3300046476 | Ga0495662_0023707 | Ga0495662_0023707_547_1545 | 319 |
| 585 | 3300046520 | Ga0495637_0084401 | Ga0495637_0084401_53_1132 | 319 |
| 586 | 3300046530 | Ga0495654_0016783 | Ga0495654_0016783_1190_2185 | 319 |
| 587 | 3300046616 | Ga0495668_0013112 | Ga0495668_0013112_1612_2607 | 319 |
| 588 | 3300046692 | Ga0495671_0110471 | Ga0495671_0110471_187_1182 | 319 |
| 589 | 3300047315 | Ga0495581_0045508 | Ga0495581_0045508_800_1798 | 319 |
| 590 | 3300047319 | Ga0495674_0058368 | Ga0495674_0058368_255_1253 | 319 |
| 591 | 3300047320 | Ga0495672_0024419 | Ga0495672_0024419_2729_3724 | 319 |
| 592 | 3300047320 | Ga0495672_0044909 | Ga0495672_0044909_684_1694 | 319 |
| 593 | 3300047469 | Ga0495673_0003409 | Ga0495673_0003409_8684_9679 | 319 |
| 594 | 3300047472 | Ga0495686_0079346 | Ga0495686_0079346_137_1132 | 319 |
| 595 | 3300047673 | Ga0495593_0004862 | Ga0495593_0004862_285_1283 | 319 |
| 596 | 3300048903 | Ga0496100_0014104 | Ga0496100_0014104_3309_4304 | 319 |
| 597 | 3300048903 | Ga0496100_0016807 | Ga0496100_0016807_81_1076 | 319 |
| 598 | 3300048903 | Ga0496100_0154576 | Ga0496100_0154576_177_1172 | 319 |
| 599 | 3300048904 | Ga0496101_0000162 | Ga0496101_0000162_52447_53442 | 319 |
| 600 | 3300048904 | Ga0496101_0013316 | Ga0496101_0013316_1448_2443 | 319 |
| 601 | 3300048904 | Ga0496101_0085900 | Ga0496101_0085900_333_1310 | 319 |
| 602 | 3300048905 | Ga0496102_0000035 | Ga0496102_0000035_77682_78677 | 319 |
| 603 | 3300048905 | Ga0496102_0004887 | Ga0496102_0004887_360_1355 | 319 |
| 604 | 3300048906 | Ga0496103_0000028 | Ga0496103_0000028_134984_135979 | 319 |
| 605 | 3300048906 | Ga0496103_0020644 | Ga0496103_0020644_2721_3716 | 319 |
| 606 | 3300048907 | Ga0496104_0008051 | Ga0496104_0008051_5192_6187 | 319 |
| 607 | 3300048907 | Ga0496104_0088673 | Ga0496104_0088673_1516_2511 | 319 |
| 608 | 3300048908 | Ga0496105_0012167 | Ga0496105_0012167_5614_6609 | 319 |
| 609 | 3300048908 | Ga0496105_0019044 | Ga0496105_0019044_3822_4817 | 319 |
| 610 | 3300048909 | Ga0496106_0030736 | Ga0496106_0030736_2533_3528 | 319 |
| 611 | 3300048909 | Ga0496106_0140052 | Ga0496106_0140052_360_1337 | 319 |
| 612 | 3300048910 | Ga0496107_0055590 | Ga0496107_0055590_532_1527 | 319 |
| 613 | 3300048910 | Ga0496107_0072617 | Ga0496107_0072617_1261_2256 | 319 |
| 614 | 3300048910 | Ga0496107_0075435 | Ga0496107_0075435_878_1873 | 319 |
| 615 | 3300048911 | Ga0496108_0141767 | Ga0496108_0141767_977_1954 | 319 |
| 616 | 3300048912 | Ga0496109_0011184 | Ga0496109_0011184_2207_3202 | 319 |
| 617 | 3300048912 | Ga0496109_0378912 | Ga0496109_0378912_26_1045 | 319 |
| 618 | 3300048913 | Ga0496110_0112174 | Ga0496110_0112174_659_1654 | 319 |
| 619 | 3300048914 | Ga0496111_0088265 | Ga0496111_0088265_932_1951 | 319 |
| 620 | 3300048915 | Ga0496112_0010839 | Ga0496112_0010839_3831_4826 | 319 |
| 621 | 3300048915 | Ga0496112_0012968 | Ga0496112_0012968_6541_7560 | 319 |
| 622 | 3300048915 | Ga0496112_0050194 | Ga0496112_0050194_953_1948 | 319 |
| 623 | 3300048915 | Ga0496112_0133231 | Ga0496112_0133231_50_1048 | 319 |
| 624 | 3300048916 | Ga0496113_0157802 | Ga0496113_0157802_574_1569 | 319 |
| 625 | 3300048917 | Ga0496114_0007296 | Ga0496114_0007296_3788_4783 | 319 |
| 626 | 3300048917 | Ga0496114_0066904 | Ga0496114_0066904_1725_2744 | 319 |
| 627 | 3300048918 | Ga0496115_0025602 | Ga0496115_0025602_2928_3923 | 319 |
| 628 | 3300048919 | Ga0496116_0000090 | Ga0496116_0000090_77682_78677 | 319 |
| 629 | 3300048920 | Ga0496117_0000051 | Ga0496117_0000051_77682_78677 | 319 |
| 630 | 3300048921 | Ga0496118_0000043 | Ga0496118_0000043_77682_78677 | 319 |
| 631 | 3300048922 | Ga0496119_0000318 | Ga0496119_0000318_59785_60780 | 319 |
| 632 | 3300048923 | Ga0496120_0000274 | Ga0496120_0000274_16402_17397 | 319 |
| 633 | 3300048923 | Ga0496120_0148608 | Ga0496120_0148608_43_1038 | 319 |
| 634 | 3300048924 | Ga0496121_0000080 | Ga0496121_0000080_117230_118225 | 319 |
| 635 | 3300048925 | Ga0496122_0089014 | Ga0496122_0089014_183_1178 | 319 |
| 636 | 3300048926 | Ga0496123_0006983 | Ga0496123_0006983_9364_10359 | 319 |
| 637 | 3300048928 | Ga0496125_0133662 | Ga0496125_0133662_258_1268 | 319 |
| 638 | 3300048929 | Ga0496126_0015987 | Ga0496126_0015987_3105_4100 | 319 |
| 639 | 3300050489 | nmdc:mga03683_26274_c1 | nmdc:mga03683_26274_c1_962_1957 | 319 |
| 640 | 3300050489 | nmdc:mga03683_28487_c1 | nmdc:mga03683_28487_c1_554_1597 | 319 |
| 641 | 3300050489 | nmdc:mga03683_52334_c1 | nmdc:mga03683_52334_c1_682_1677 | 319 |
| 642 | 3300050490 | nmdc:mga03n38_59192_c1 | nmdc:mga03n38_59192_c1_405_1400 | 319 |
| 643 | 3300050491 | nmdc:mga00v17_10441_c1 | nmdc:mga00v17_10441_c1_1683_2813 | 319 |
| 644 | 3300050491 | nmdc:mga00v17_65935_c1 | nmdc:mga00v17_65935_c1_174_1169 | 319 |
| 645 | 3300050492 | nmdc:mga0yw44_104752_c1 | nmdc:mga0yw44_104752_c1_483_1490 | 319 |
| 646 | 3300050492 | nmdc:mga0yw44_149080_c1 | nmdc:mga0yw44_149080_c1_290_1285 | 319 |
| 647 | 3300050492 | nmdc:mga0yw44_25526_c1 | nmdc:mga0yw44_25526_c1_2073_3083 | 319 |
| 648 | 3300050492 | nmdc:mga0yw44_7942_c1 | nmdc:mga0yw44_7942_c1_1854_2849 | 319 |
| 649 | 3300050493 | nmdc:mga0k408_25200_c1 | nmdc:mga0k408_25200_c1_413_1408 | 319 |
| 650 | 3300050494 | nmdc:mga06z11_20181_c1 | nmdc:mga06z11_20181_c1_2003_3046 | 319 |
| 651 | 3300050495 | nmdc:mga04h51_3469_c1 | nmdc:mga04h51_3469_c1_1416_2411 | 319 |
| 652 | 3300050496 | nmdc:mga07m45_14446_c1 | nmdc:mga07m45_14446_c1_1132_2175 | 319 |
| 653 | 3300050507 | nmdc:mga05p37_6127_c1 | nmdc:mga05p37_6127_c1_1487_2482 | 319 |
| 654 | 3300050509 | nmdc:mga0qj67_13608_c1 | nmdc:mga0qj67_13608_c1_5072_6067 | 319 |
| 655 | 3300050511 | nmdc:mga08y16_107492_c1 | nmdc:mga08y16_107492_c1_1665_2660 | 319 |
| 656 | 3300050516 | nmdc:mga0sz30_38546_c1 | nmdc:mga0sz30_38546_c1_997_1992 | 319 |
| 657 | 3300050516 | nmdc:mga0sz30_52133_c1 | nmdc:mga0sz30_52133_c1_115_1110 | 319 |
| 658 | 3300053087 | Ga0500643_056975 | Ga0500643_056975_25_1020 | 319 |
| 659 | 3300053092 | Ga0500583_0176602 | Ga0500583_0176602_22_1032 | 319 |
| 660 | 3300053104 | Ga0500556_0007416 | Ga0500556_0007416_1851_2846 | 319 |
| 661 | 3300053105 | Ga0500557_042863 | Ga0500557_042863_103_1113 | 319 |
| 662 | 3300053153 | Ga0500616_0034800 | Ga0500616_0034800_1238_2233 | 319 |
| 663 | 3300053730 | Ga0500645_000006 | Ga0500645_000006_78777_79787 | 319 |
| 664 | iso_pu_bacteria | 2929212328 | 2929215882 | 319 |
| 665 | iso_pu_bacteria | 2939582691 | 2939585482 | 319 |
| 666 | 3300003792 | Ga0055540_1000003 | Ga0055540_100000328 | 320 |
| 667 | 3300005329 | Ga0070683_100041275 | Ga0070683_1000412752 | 320 |
| 668 | 3300005367 | Ga0070667_100006345 | Ga0070667_1000063457 | 320 |
| 669 | 3300006038 | Ga0075365_10003210 | Ga0075365_100032104 | 320 |
| 670 | 3300006038 | Ga0075365_10004632 | Ga0075365_100046322 | 320 |
| 671 | 3300006051 | Ga0075364_10007628 | Ga0075364_100076282 | 320 |
| 672 | 3300006186 | Ga0075369_10045390 | Ga0075369_100453902 | 320 |
| 673 | 3300021384 | Ga0213876_10081371 | Ga0213876_100813712 | 320 |
| 674 | 3300021388 | Ga0213875_10015274 | Ga0213875_100152742 | 320 |
| 675 | 3300021388 | Ga0213875_10039674 | Ga0213875_100396743 | 320 |
| 676 | 3300021388 | Ga0213875_10040014 | Ga0213875_100400142 | 320 |
| 677 | 3300025294 | Ga0209025_1041088 | Ga0209025_10410882 | 320 |
| 678 | 3300025303 | Ga0209051_1000011 | Ga0209051_1000011568 | 320 |
| 679 | 3300025903 | Ga0207680_10006569 | Ga0207680_100065695 | 320 |
| 680 | 3300025921 | Ga0207652_10390088 | Ga0207652_103900881 | 320 |
| 681 | 3300025929 | Ga0207664_10124226 | Ga0207664_101242261 | 320 |
| 682 | 3300025986 | Ga0207658_10000449 | Ga0207658_100004498 | 320 |
| 683 | 3300031251 | Ga0265327_10000630 | Ga0265327_1000063042 | 320 |
| 684 | 3300036647 | Ga0316582_0320732 | Ga0316582_0320732_16_1011 | 320 |
| 685 | 3300036712 | Ga0316584_0148448 | Ga0316584_0148448_255_1250 | 320 |
| 686 | 3300037853 | Ga0436364_0839430 | Ga0436364_0839430_1241_2245 | 320 |
| 687 | 3300037853 | Ga0436364_1162640 | Ga0436364_1162640_92_1072 | 320 |
| 688 | 3300037853 | Ga0436364_1328828 | Ga0436364_1328828_550_1542 | 320 |
| 689 | 3300039437 | Ga0436365_0869447 | Ga0436365_0869447_13575_14579 | 320 |
| 690 | 3300044656 | Ga0466969_0084041 | Ga0466969_0084041_394_1437 | 320 |
| 691 | 3300044683 | Ga0466965_0005097 | Ga0466965_0005097_2849_3856 | 320 |
| 692 | 3300044684 | Ga0466966_0000302 | Ga0466966_0000302_16730_17773 | 320 |
| 693 | 3300044684 | Ga0466966_0010324 | Ga0466966_0010324_4551_5588 | 320 |
| 694 | 3300044693 | Ga0466961_0027756 | Ga0466961_0027756_2106_3098 | 320 |
| 695 | 3300044694 | Ga0466963_0083271 | Ga0466963_0083271_1119_2132 | 320 |
| 696 | 3300044735 | Ga0466968_0006237 | Ga0466968_0006237_648_1685 | 320 |
| 697 | 3300044842 | Ga0466957_0002467 | Ga0466957_0002467_3930_4973 | 320 |
| 698 | 3300044842 | Ga0466957_0002759 | Ga0466957_0002759_5459_6451 | 320 |
| 699 | 3300044842 | Ga0466957_0040777 | Ga0466957_0040777_726_1751 | 320 |
| 700 | 3300044842 | Ga0466957_0072143 | Ga0466957_0072143_721_1713 | 320 |
| 701 | 3300044901 | Ga0466960_0000196 | Ga0466960_0000196_2116_3123 | 320 |
| 702 | 3300044901 | Ga0466960_0001609 | Ga0466960_0001609_5901_6944 | 320 |
| 703 | 3300044901 | Ga0466960_0059086 | Ga0466960_0059086_333_1376 | 320 |
| 704 | 3300045049 | Ga0466959_0010988 | Ga0466959_0010988_59_1051 | 320 |
| 705 | 3300045049 | Ga0466959_0017121 | Ga0466959_0017121_3808_4845 | 320 |
| 706 | 3300045049 | Ga0466959_0043353 | Ga0466959_0043353_296_1339 | 320 |
| 707 | 3300045836 | Ga0466958_0000426 | Ga0466958_0000426_8930_9922 | 320 |
| 708 | 3300045836 | Ga0466958_0003206 | Ga0466958_0003206_5049_6092 | 320 |
| 709 | 3300045836 | Ga0466958_0011212 | Ga0466958_0011212_2520_3557 | 320 |
| 710 | 3300045976 | Ga0466967_0000693 | Ga0466967_0000693_517_1560 | 320 |
| 711 | 3300045976 | Ga0466967_0022841 | Ga0466967_0022841_662_1687 | 320 |
| 712 | 3300045976 | Ga0466967_0144643 | Ga0466967_0144643_260_1249 | 320 |
| 713 | 3300048903 | Ga0496100_0000067 | Ga0496100_0000067_18114_19103 | 320 |
| 714 | 3300048904 | Ga0496101_0000099 | Ga0496101_0000099_50684_51673 | 320 |
| 715 | 3300048905 | Ga0496102_0062880 | Ga0496102_0062880_1754_2743 | 320 |
| 716 | 3300048906 | Ga0496103_0010678 | Ga0496103_0010678_4292_5281 | 320 |
| 717 | 3300048909 | Ga0496106_0004631 | Ga0496106_0004631_6694_7683 | 320 |
| 718 | 3300048910 | Ga0496107_0028979 | Ga0496107_0028979_1239_2228 | 320 |
| 719 | 3300048911 | Ga0496108_0006748 | Ga0496108_0006748_2204_3193 | 320 |
| 720 | 3300048912 | Ga0496109_0000159 | Ga0496109_0000159_39999_40988 | 320 |
| 721 | 3300048913 | Ga0496110_0004131 | Ga0496110_0004131_3706_4695 | 320 |
| 722 | 3300048917 | Ga0496114_0000116 | Ga0496114_0000116_50673_51662 | 320 |
| 723 | 3300048918 | Ga0496115_0030309 | Ga0496115_0030309_3250_4239 | 320 |
| 724 | 3300048919 | Ga0496116_0001408 | Ga0496116_0001408_528_1517 | 320 |
| 725 | 3300048921 | Ga0496118_0027781 | Ga0496118_0027781_769_1758 | 320 |
| 726 | 3300048922 | Ga0496119_0008747 | Ga0496119_0008747_1974_2963 | 320 |
| 727 | 3300048924 | Ga0496121_0000016 | Ga0496121_0000016_326707_327696 | 320 |
| 728 | 3300048925 | Ga0496122_0000284 | Ga0496122_0000284_40626_41615 | 320 |
| 729 | 3300048926 | Ga0496123_0006672 | Ga0496123_0006672_7055_8044 | 320 |
| 730 | 3300048927 | Ga0496124_0000015 | Ga0496124_0000015_50694_51683 | 320 |
| 731 | 3300048928 | Ga0496125_0000021 | Ga0496125_0000021_409018_410007 | 320 |
| 732 | 3300048929 | Ga0496126_0000015 | Ga0496126_0000015_409018_410007 | 320 |
| 733 | 3300048929 | Ga0496126_0022736 | Ga0496126_0022736_2483_3511 | 320 |
| 734 | 3300049569 | Ga0501032_0001911 | Ga0501032_0001911_12040_13047 | 320 |
| 735 | 3300049570 | Ga0501033_0065605 | Ga0501033_0065605_1482_2504 | 320 |
| 736 | 3300049571 | Ga0501034_0001916 | Ga0501034_0001916_17289_18311 | 320 |
| 737 | 3300049571 | Ga0501034_0005958 | Ga0501034_0005958_608_1615 | 320 |
| 738 | 3300049572 | Ga0501036_0024018 | Ga0501036_0024018_175_1167 | 320 |
| 739 | 3300049573 | Ga0501037_0000434 | Ga0501037_0000434_32796_33803 | 320 |
| 740 | 3300049573 | Ga0501037_0049529 | Ga0501037_0049529_1361_2383 | 320 |
| 741 | 3300049579 | Ga0501043_0002476 | Ga0501043_0002476_2770_3777 | 320 |
| 742 | 3300049580 | Ga0501046_0001059 | Ga0501046_0001059_19238_20260 | 320 |
| 743 | 3300049581 | Ga0501047_0051467 | Ga0501047_0051467_595_1587 | 320 |
| 744 | 3300049582 | Ga0501048_0001266 | Ga0501048_0001266_6018_7040 | 320 |
| 745 | 3300049586 | Ga0501070_0006251 | Ga0501070_0006251_608_1615 | 320 |
| 746 | 3300049589 | Ga0501073_0215868 | Ga0501073_0215868_69_1076 | 320 |
| 747 | 3300049742 | Ga0501080_0142952 | Ga0501080_0142952_1090_2112 | 320 |
| 748 | 3300049822 | Ga0501035_0000542 | Ga0501035_0000542_8924_9916 | 320 |
| 749 | 3300049822 | Ga0501035_0018298 | Ga0501035_0018298_206_1228 | 320 |
| 750 | 3300049823 | Ga0501044_0000153 | Ga0501044_0000153_54015_55007 | 320 |
| 751 | 3300049823 | Ga0501044_0003155 | Ga0501044_0003155_6967_7989 | 320 |
| 752 | 3300049823 | Ga0501044_0029694 | Ga0501044_0029694_4615_5622 | 320 |
| 753 | 3300050492 | nmdc:mga0yw44_973_c1 | nmdc:mga0yw44_973_c1_5702_6742 | 320 |
| 754 | 3300050496 | nmdc:mga07m45_13146_c1 | nmdc:mga07m45_13146_c1_1372_2385 | 320 |
| 755 | 3300050516 | nmdc:mga0sz30_2095_c1 | nmdc:mga0sz30_2095_c1_5993_7114 | 320 |
| 756 | 3300050516 | nmdc:mga0sz30_48159_c1 | nmdc:mga0sz30_48159_c1_278_1261 | 320 |
| 757 | 3300050516 | nmdc:mga0sz30_8592_c1 | nmdc:mga0sz30_8592_c1_957_1970 | 320 |
| 758 | 3300053130 | Ga0500642_0073937 | Ga0500642_0073937_514_1497 | 320 |
| 759 | 3300053146 | Ga0500588_0012261 | Ga0500588_0012261_206_1198 | 320 |
| 760 | 3300053730 | Ga0500645_000032 | Ga0500645_000032_95075_96103 | 320 |
| 761 | 3300005337 | Ga0070682_100005205 | Ga0070682_1000052054 | 321 |
| 762 | 3300005366 | Ga0070659_100259142 | Ga0070659_1002591421 | 321 |
| 763 | 3300005455 | Ga0070663_100017490 | Ga0070663_1000174902 | 321 |
| 764 | 3300005578 | Ga0068854_100253224 | Ga0068854_1002532242 | 321 |
| 765 | 3300005841 | Ga0068863_100061465 | Ga0068863_1000614651 | 321 |
| 766 | 3300006048 | Ga0075363_100003311 | Ga0075363_1000033114 | 321 |
| 767 | 3300006048 | Ga0075363_100010144 | Ga0075363_1000101444 | 321 |
| 768 | 3300006048 | Ga0075363_100080094 | Ga0075363_1000800942 | 321 |
| 769 | 3300006051 | Ga0075364_10018315 | Ga0075364_100183153 | 321 |
| 770 | 3300006051 | Ga0075364_10039274 | Ga0075364_100392741 | 321 |
| 771 | 3300006177 | Ga0075362_10033425 | Ga0075362_100334251 | 321 |
| 772 | 3300006177 | Ga0075362_10035769 | Ga0075362_100357692 | 321 |
| 773 | 3300006178 | Ga0075367_10017826 | Ga0075367_100178262 | 321 |
| 774 | 3300006353 | Ga0075370_10062688 | Ga0075370_100626882 | 321 |
| 775 | 3300009094 | Ga0111539_10603888 | Ga0111539_106038882 | 321 |
| 776 | 3300009098 | Ga0105245_10194810 | Ga0105245_101948101 | 321 |
| 777 | 3300025944 | Ga0207661_10219687 | Ga0207661_102196872 | 321 |
| 778 | 3300025981 | Ga0207640_10179100 | Ga0207640_101791002 | 321 |
| 779 | 3300026067 | Ga0207678_10021313 | Ga0207678_100213133 | 321 |
| 780 | 3300031824 | Ga0307413_10031846 | Ga0307413_100318461 | 321 |
| 781 | 3300031852 | Ga0307410_10032993 | Ga0307410_100329933 | 321 |
| 782 | 3300031903 | Ga0307407_10046930 | Ga0307407_100469303 | 321 |
| 783 | 3300031995 | Ga0307409_100100343 | Ga0307409_1001003432 | 321 |
| 784 | 3300032002 | Ga0307416_100031989 | Ga0307416_1000319893 | 321 |
| 785 | 3300032004 | Ga0307414_10357049 | Ga0307414_103570492 | 321 |
| 786 | 3300032005 | Ga0307411_10018444 | Ga0307411_100184443 | 321 |
| 787 | 3300032126 | Ga0307415_100032524 | Ga0307415_1000325243 | 321 |
| 788 | 3300037853 | Ga0436364_0776939 | Ga0436364_0776939_5412_6413 | 321 |
| 789 | 3300041413 | Ga0439465_0058489 | Ga0439465_0058489_56_1135 | 321 |
| 790 | 3300045976 | Ga0466967_0023010 | Ga0466967_0023010_2149_3186 | 321 |
| 791 | 3300046473 | Ga0495582_0020061 | Ga0495582_0020061_2040_3104 | 321 |
| 792 | 3300048904 | Ga0496101_0041362 | Ga0496101_0041362_2047_3090 | 321 |
| 793 | 3300048905 | Ga0496102_0092751 | Ga0496102_0092751_881_1924 | 321 |
| 794 | 3300048909 | Ga0496106_0020609 | Ga0496106_0020609_270_1268 | 321 |
| 795 | 3300048909 | Ga0496106_0021068 | Ga0496106_0021068_2452_3495 | 321 |
| 796 | 3300048910 | Ga0496107_0030647 | Ga0496107_0030647_1692_2735 | 321 |
| 797 | 3300048915 | Ga0496112_0000750 | Ga0496112_0000750_1829_2899 | 321 |
| 798 | 3300048916 | Ga0496113_0060286 | Ga0496113_0060286_1234_2304 | 321 |
| 799 | 3300048917 | Ga0496114_0076627 | Ga0496114_0076627_1265_2308 | 321 |
| 800 | 3300048923 | Ga0496120_0034069 | Ga0496120_0034069_809_1885 | 321 |
| 801 | 3300049586 | Ga0501070_0076680 | Ga0501070_0076680_305_1351 | 321 |
| 802 | 3300049823 | Ga0501044_0010960 | Ga0501044_0010960_8563_9612 | 321 |
| 803 | 3300050489 | nmdc:mga03683_24850_c1 | nmdc:mga03683_24850_c1_483_1565 | 321 |
| 804 | 3300050489 | nmdc:mga03683_56181_c1 | nmdc:mga03683_56181_c1_355_1440 | 321 |
| 805 | 3300050490 | nmdc:mga03n38_14961_c1 | nmdc:mga03n38_14961_c1_157_1245 | 321 |
| 806 | 3300050490 | nmdc:mga03n38_30600_c1 | nmdc:mga03n38_30600_c1_747_1832 | 321 |
| 807 | 3300050490 | nmdc:mga03n38_34659_c1 | nmdc:mga03n38_34659_c1_513_1595 | 321 |
| 808 | 3300050490 | nmdc:mga03n38_36112_c1 | nmdc:mga03n38_36112_c1_279_1367 | 321 |
| 809 | 3300050490 | nmdc:mga03n38_57355_c1 | nmdc:mga03n38_57355_c1_357_1439 | 321 |
| 810 | 3300050491 | nmdc:mga00v17_13704_c1 | nmdc:mga00v17_13704_c1_1324_2406 | 321 |
| 811 | 3300050491 | nmdc:mga00v17_193254_c1 | nmdc:mga00v17_193254_c1_110_1198 | 321 |
| 812 | 3300050491 | nmdc:mga00v17_29653_c2 | nmdc:mga00v17_29653_c2_1017_2078 | 321 |
| 813 | 3300050492 | nmdc:mga0yw44_24933_c1 | nmdc:mga0yw44_24933_c1_218_1303 | 321 |
| 814 | 3300050492 | nmdc:mga0yw44_79245_c1 | nmdc:mga0yw44_79245_c1_202_1284 | 321 |
| 815 | 3300050494 | nmdc:mga06z11_30343_c1 | nmdc:mga06z11_30343_c1_617_1699 | 321 |
| 816 | 3300050495 | nmdc:mga04h51_8193_c1 | nmdc:mga04h51_8193_c1_514_1596 | 321 |
| 817 | 3300050496 | nmdc:mga07m45_2381_c2 | nmdc:mga07m45_2381_c2_39_1124 | 321 |
| 818 | 3300050496 | nmdc:mga07m45_3674_c1 | nmdc:mga07m45_3674_c1_6106_7188 | 321 |
| 819 | 3300050516 | nmdc:mga0sz30_39244_c1 | nmdc:mga0sz30_39244_c1_827_1909 | 321 |
| 820 | 3300050516 | nmdc:mga0sz30_4841_c1 | nmdc:mga0sz30_4841_c1_481_1488 | 321 |
| 821 | 3300060353 | Ga0501082_0322120 | Ga0501082_0322120_216_1262 | 321 |
| 822 | 3300005367 | Ga0070667_100018573 | Ga0070667_1000185734 | 322 |
| 823 | 3300005466 | Ga0070685_10176080 | Ga0070685_101760801 | 322 |
| 824 | 3300005548 | Ga0070665_100040639 | Ga0070665_1000406393 | 322 |
| 825 | 3300005841 | Ga0068863_100005817 | Ga0068863_1000058171 | 322 |
| 826 | 3300005937 | Ga0081455_10014180 | Ga0081455_100141806 | 322 |
| 827 | 3300006048 | Ga0075363_100029014 | Ga0075363_1000290144 | 322 |
| 828 | 3300006051 | Ga0075364_10014429 | Ga0075364_100144292 | 322 |
| 829 | 3300006186 | Ga0075369_10011905 | Ga0075369_100119052 | 322 |
| 830 | 3300006844 | Ga0075428_100008341 | Ga0075428_1000083416 | 322 |
| 831 | 3300006846 | Ga0075430_100023419 | Ga0075430_1000234195 | 322 |
| 832 | 3300009177 | Ga0105248_10150478 | Ga0105248_101504782 | 322 |
| 833 | 3300025914 | Ga0207671_10024065 | Ga0207671_100240656 | 322 |
| 834 | 3300026095 | Ga0207676_10092629 | Ga0207676_100926292 | 322 |
| 835 | 3300026118 | Ga0207675_100112485 | Ga0207675_1001124852 | 322 |
| 836 | 3300031852 | Ga0307410_10045074 | Ga0307410_100450743 | 322 |
| 837 | 3300046460 | Ga0495638_0002356 | Ga0495638_0002356_7428_8408 | 322 |
| 838 | 3300046506 | Ga0495583_0038040 | Ga0495583_0038040_209_1186 | 322 |
| 839 | 3300046507 | Ga0495606_0136554 | Ga0495606_0136554_283_1260 | 322 |
| 840 | 3300046524 | Ga0495648_0004819 | Ga0495648_0004819_9744_10721 | 322 |
| 841 | 3300047320 | Ga0495672_0004096 | Ga0495672_0004096_11000_11977 | 322 |
| 842 | 3300047469 | Ga0495673_0001764 | Ga0495673_0001764_13109_14086 | 322 |
| 843 | 3300048911 | Ga0496108_0112979 | Ga0496108_0112979_984_2036 | 322 |
| 844 | 3300048913 | Ga0496110_0106236 | Ga0496110_0106236_776_1828 | 322 |
| 845 | 3300048914 | Ga0496111_0125000 | Ga0496111_0125000_153_1205 | 322 |
| 846 | 3300048915 | Ga0496112_0020666 | Ga0496112_0020666_647_1699 | 322 |
| 847 | 3300049569 | Ga0501032_0006353 | Ga0501032_0006353_7423_8430 | 322 |
| 848 | 3300049571 | Ga0501034_0001919 | Ga0501034_0001919_11852_12859 | 322 |
| 849 | 3300049573 | Ga0501037_0000167 | Ga0501037_0000167_35038_36045 | 322 |
| 850 | 3300049574 | Ga0501038_0002867 | Ga0501038_0002867_13885_14892 | 322 |
| 851 | 3300049575 | Ga0501039_0000583 | Ga0501039_0000583_6175_7182 | 322 |
| 852 | 3300049579 | Ga0501043_0003282 | Ga0501043_0003282_4914_5921 | 322 |
| 853 | 3300049586 | Ga0501070_0001462 | Ga0501070_0001462_7577_8584 | 322 |
| 854 | 3300049593 | Ga0501077_0076711 | Ga0501077_0076711_932_1939 | 322 |
| 855 | 3300049823 | Ga0501044_0085386 | Ga0501044_0085386_1896_2903 | 322 |
| 856 | 3300050490 | nmdc:mga03n38_38264_c1 | nmdc:mga03n38_38264_c1_165_1214 | 322 |
| 857 | 3300050491 | nmdc:mga00v17_147916_c1 | nmdc:mga00v17_147916_c1_417_1487 | 322 |
| 858 | 3300050491 | nmdc:mga00v17_92137_c1 | nmdc:mga00v17_92137_c1_154_1203 | 322 |
| 859 | 3300050516 | nmdc:mga0sz30_19876_c1 | nmdc:mga0sz30_19876_c1_1178_2227 | 322 |
| 860 | 3300050516 | nmdc:mga0sz30_2257_c2 | nmdc:mga0sz30_2257_c2_1750_2724 | 322 |
| 861 | 3300053130 | Ga0500642_0080805 | Ga0500642_0080805_204_1184 | 322 |
| 862 | 3300059504 | Ga0587082_021006 | Ga0587082_021006_12_1025 | 322 |
| 863 | 3300000546 | LJNas_1006653 | LJNas_10066531 | 323 |
| 864 | 3300005353 | Ga0070669_100002998 | Ga0070669_10000299812 | 323 |
| 865 | 3300005367 | Ga0070667_100000056 | Ga0070667_10000005685 | 323 |
| 866 | 3300005548 | Ga0070665_100003729 | Ga0070665_10000372914 | 323 |
| 867 | 3300005617 | Ga0068859_100002568 | Ga0068859_10000256813 | 323 |
| 868 | 3300005841 | Ga0068863_100000200 | Ga0068863_10000020067 | 323 |
| 869 | 3300005842 | Ga0068858_100065696 | Ga0068858_1000656962 | 323 |
| 870 | 3300005843 | Ga0068860_100000092 | Ga0068860_10000009271 | 323 |
| 871 | 3300005844 | Ga0068862_100000035 | Ga0068862_10000003574 | 323 |
| 872 | 3300006931 | Ga0097620_100002568 | Ga0097620_10000256813 | 323 |
| 873 | 3300009177 | Ga0105248_10000036 | Ga0105248_1000003684 | 323 |
| 874 | 3300009553 | Ga0105249_10000046 | Ga0105249_10000046106 | 323 |
| 875 | 3300014325 | Ga0163163_10125004 | Ga0163163_101250044 | 323 |
| 876 | 3300014968 | Ga0157379_10059390 | Ga0157379_100593904 | 323 |
| 877 | 3300025900 | Ga0207710_10000060 | Ga0207710_10000060122 | 323 |
| 878 | 3300025923 | Ga0207681_10002363 | Ga0207681_1000236312 | 323 |
| 879 | 3300025941 | Ga0207711_10000073 | Ga0207711_1000007367 | 323 |
| 880 | 3300025961 | Ga0207712_10000042 | Ga0207712_1000004275 | 323 |
| 881 | 3300025986 | Ga0207658_10000595 | Ga0207658_1000059523 | 323 |
| 882 | 3300026035 | Ga0207703_10579400 | Ga0207703_105794001 | 323 |
| 883 | 3300026041 | Ga0207639_10030885 | Ga0207639_100308852 | 323 |
| 884 | 3300026088 | Ga0207641_10000278 | Ga0207641_100002784 | 323 |
| 885 | 3300028379 | Ga0268266_10014025 | Ga0268266_100140256 | 323 |
| 886 | 3300028380 | Ga0268265_10000051 | Ga0268265_10000051106 | 323 |
| 887 | 3300028381 | Ga0268264_10000108 | Ga0268264_10000108100 | 323 |
| 888 | 3300048903 | Ga0496100_0019462 | Ga0496100_0019462_2401_3372 | 323 |
| 889 | 3300048904 | Ga0496101_0012156 | Ga0496101_0012156_464_1435 | 323 |
| 890 | 3300048905 | Ga0496102_0000131 | Ga0496102_0000131_102597_103568 | 323 |
| 891 | 3300048906 | Ga0496103_0000779 | Ga0496103_0000779_13377_14348 | 323 |
| 892 | 3300048919 | Ga0496116_0010238 | Ga0496116_0010238_210_1181 | 323 |
| 893 | 3300048920 | Ga0496117_0001155 | Ga0496117_0001155_25443_26414 | 323 |
| 894 | 3300048921 | Ga0496118_0000165 | Ga0496118_0000165_13211_14182 | 323 |
| 895 | 3300048922 | Ga0496119_0005099 | Ga0496119_0005099_6969_7940 | 323 |
| 896 | 3300048923 | Ga0496120_0032214 | Ga0496120_0032214_55_1026 | 323 |
| 897 | 3300048924 | Ga0496121_0028180 | Ga0496121_0028180_1618_2589 | 323 |
| 898 | 3300048927 | Ga0496124_0050318 | Ga0496124_0050318_980_1951 | 323 |
| 899 | 3300048928 | Ga0496125_0018213 | Ga0496125_0018213_3188_4159 | 323 |
| 900 | 3300048929 | Ga0496126_0000807 | Ga0496126_0000807_9406_10377 | 323 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4qdz-assembly1.cif.gz_A | crystal structure of antigen 85c-e228q mutant | 0.9804 | 45 | 322 |
| 7myg-assembly2.cif.gz_B | m. tb ag85c modified by thl-10d | 0.974 | 46 | 322 |
| 5vns-assembly1.cif.gz_A | m.tb antigen 85c acyl-enzyme intermediate with tetrahydrolipstatin | 0.9736 | 40 | 322 |
| 4qe3-assembly1.cif.gz_A | crystal structure of antigen 85c-h260q mutant | 0.9699 | 45 | 322 |
| 4qdz-assembly1.cif.gz_A | crystal structure of antigen 85c-e228q mutant | 0.9696 | 45 | 322 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1va5A00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain | 0.9424 | 40 | 322 | 3.40.50.1820 |
| 1va5A00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain | 0.9294 | 40 | 322 | 3.40.50.1820 |
| 1r88A00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain | 0.9273 | 46 | 323 | 3.40.50.1820 |
| 1r88A00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain | 0.9172 | 46 | 323 | 3.40.50.1820 |
| 4h18C00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain | 0.8978 | 47 | 322 | 3.40.50.1820 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-P71519-F1-model_v4 | 32-kDa protein | 0.9932 | 118 | 254 |
GO:0005576
GO:0016747 |
| AF-A0A1C9H8U3-F1-model_v4 | Mycolyl transferase 85B (EC 2.3.1.122) | 0.986 | 50 | 243 |
GO:0005576
GO:0050348 |
| AF-P71519-F1-model_v4 | 32-kDa protein | 0.9859 | 118 | 254 |
GO:0005576
GO:0016747 |
| AF-A0A2S9FLT1-F1-model_v4 | Diacylglycerol acyltransferase/mycolyltransferase Ag85A | 0.9821 | 96 | 246 |
GO:0005576
GO:0016747 |
| AF-A0A2S8MRB0-F1-model_v4 | deleted | 0.9807 | 71 | 194 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar