F485173

General Info

Members Datasets Scaffolds Average Seq Length
901 548 758 246

Family's Representative Sequence

Representative Sequence 3300009545|Ga0105237_10014356|Ga0105237_100143562
Length 284
Sequence VPAKEALLIAPDNNEVSTMSDFDRNYASPFGRAIGRADAAAVDAGLRAYMLRIYNYMTIGLAITGFAALGVFMGATTNDPSLAAFPQKIGSFYLTGFGYAMFVSPLKWLFIFAPLAMVFVISFGIQRLAPATAQLLFWVFSALMGVSLSSIFLVYTHSSIVQVFFITAAAFGALSLYGYTTRRDMTGMGSFLIMGLFGIVIASIVNLFLASSALQFVVSVGGVLVFAGLTAWDTQRLKNEYIYGYAGAGEAVAERSAILGALSLYLNFINLFTLLLQLLGQRDN

Samples

Sample ID Description Type Environment
1 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
2 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
3 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
4 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
5 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
6 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
7 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
8 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
9 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
10 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
11 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
12 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
13 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
14 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
15 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
16 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
17 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
18 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
19 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
20 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
21 2602042107 Bradyrhizobium sp. NFR13 Isolate Rhizoplane
22 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
23 2643221651 Afipia sp. Root123D2 Isolate Unclassified
24 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
25 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
26 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
27 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
28 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
29 2791355199
30 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
31 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
32 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
33 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
34 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
35 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
36 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
37 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
38 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
39 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
40 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
41 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
42 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
43 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
44 2857524615 Tardiphaga sp. R-73074 Isolate Unclassified
45 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
46 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
47 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
48 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
49 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
50 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
51 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
52 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
53 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
54 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
55 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
56 2884298095 Microvirga thermotolerans HR1 Isolate Rhizosphere
57 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
58 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
59 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
60 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
61 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
62 2893066018 Tardiphaga sp. P9-11 Isolate Unclassified
63 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
64 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
65 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
66 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
67 2904699407
68 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
69 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
70 2906610324
71 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
72 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
73 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
74 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
75 2919073203 Tardiphaga robiniae 1155 Isolate Unclassified
76 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
77 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
78 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
79 2922425934
80 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
81 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
82 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
83 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
84 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
85 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
86 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
87 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
88 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
89 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
90 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
91 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
92 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
93 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
94 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
95 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
96 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
97 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
98 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
99 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
100 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
101 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
102 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
103 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
104 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
105 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
106 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
107 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
108 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
109 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
110 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
111 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified
112 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
113 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
114 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
115 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
116 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
117 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
118 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
119 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
120 3300003308 Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_20 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
121 3300003575 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
122 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
123 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
124 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
125 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
126 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
127 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
128 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
129 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
130 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
131 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
132 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
133 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
134 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
135 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
136 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
137 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
138 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
139 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
140 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
141 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
142 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
143 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
144 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
145 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
146 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
147 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
148 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
149 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
150 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
151 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
152 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
153 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
154 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
155 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
156 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
157 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
158 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
159 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
160 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
161 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
162 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
163 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
164 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
165 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
166 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
167 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
168 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
169 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
170 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
171 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
172 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
173 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
174 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
175 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
176 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
177 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
178 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
179 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
180 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
181 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
182 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
183 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
184 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
185 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
186 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
187 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
188 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
189 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
190 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
191 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
192 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
193 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
194 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
195 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
196 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
197 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
198 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
199 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
200 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
201 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
202 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
203 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
204 3300012500 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 Metagenome Rhizosphere
205 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
206 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
207 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
208 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
209 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
210 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
211 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
212 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
213 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
214 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
215 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
216 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
217 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
218 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
219 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
220 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
221 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
222 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
223 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
224 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
225 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
226 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
227 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
228 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
229 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
230 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
231 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
232 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
233 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
234 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
235 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
236 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
237 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
238 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
239 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
240 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
241 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
242 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
243 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
244 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
245 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
246 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
247 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
248 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
249 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
250 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
251 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
252 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
253 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
254 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
255 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
256 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
257 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
258 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
259 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
260 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
261 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
262 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
263 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
264 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
265 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
266 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
267 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
268 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
269 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
270 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
271 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
272 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
273 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
274 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
275 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
276 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
277 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
278 3300029285 Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B3.stno.R1 Metatranscriptome Rhizosphere
279 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
280 3300030763 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
281 3300030882 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI6 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
282 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
283 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
284 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
285 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
286 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
287 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
288 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
289 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
290 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
291 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
292 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
293 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
294 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
295 3300033544 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 Metagenome Unclassified
296 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
297 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
298 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
299 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
300 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
301 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
302 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
303 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
304 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
305 3300036458 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
306 3300036534 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRU5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
307 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
308 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
309 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
310 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
311 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
312 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
313 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
314 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
315 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
316 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
317 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
318 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
319 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
320 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
321 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
322 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
323 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
324 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
325 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
326 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
327 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
328 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
329 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
330 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
331 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
332 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
333 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
334 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
335 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
336 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
337 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
338 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
339 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
340 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
341 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
342 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
343 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
344 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
345 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
346 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
347 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
348 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
349 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
350 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
351 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
352 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
353 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
354 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
355 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
356 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
357 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
358 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
359 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
360 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
361 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
362 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
363 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
364 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
365 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
366 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
367 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
368 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
369 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
370 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
371 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
372 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
373 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
374 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
375 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
376 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
377 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
378 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
379 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
380 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
381 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
382 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
383 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
384 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
385 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
386 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
387 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
388 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
389 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
390 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
391 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
392 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
393 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
394 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
395 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
396 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
397 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
398 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
399 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
400 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
401 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
402 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
403 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
404 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
405 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
406 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
407 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
408 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
409 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
410 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
411 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
412 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
413 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
414 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
415 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
416 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
417 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
418 3300049133 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
419 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
420 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
421 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
422 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
423 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
424 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
425 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
426 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
427 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
428 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
429 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
430 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
431 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
432 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
433 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
434 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
435 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
436 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
437 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
438 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
439 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
440 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
441 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
442 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
443 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
444 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
445 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
446 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
447 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
448 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
449 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
450 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
451 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
452 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
453 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
454 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
455 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
456 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
457 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
458 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
459 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
460 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
461 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
462 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
463 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
464 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
465 3300053089 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 endosphere Metagenome Endosphere
466 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
467 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
468 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
469 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
470 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
471 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
472 3300053115 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere Metagenome Endosphere
473 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
474 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
475 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
476 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
477 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
478 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
479 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
480 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
481 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
482 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
483 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
484 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
485 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
486 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
487 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
488 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
489 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
490 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
491 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
492 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
493 3300053723 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 endosphere Metagenome Endosphere
494 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
495 3300053733 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere Metagenome Endosphere
496 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
497 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
498 3300059478 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 58R_AW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
499 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
500 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
501 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
502 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
503 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
504 3300059506 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
505 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
506 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
507 3300059605 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
508 3300059607 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 163R_SW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
509 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
510 3300059625 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 151R_CD_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
511 3300059626 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 173R_CD_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
512 3300059627 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 154R_AW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
513 3300059631 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 168R_SD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
514 3300059639 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
515 3300059642 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
516 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
517 3300059653 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 145R_CW_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
518 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
519 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
520 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
521 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
522 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
523 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
524 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
525 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
526 8016530956 Bradyrhizobium sp. LM6.11 Isolate Nodule
527 8016539877 Bradyrhizobium sp. LM6.10 Isolate Nodule
528 8016548790 Bradyrhizobium sp. LM3.6 Isolate Nodule
529 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
530 8016566248 Bradyrhizobium sp. LM3.2 Isolate Nodule
531 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
532 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
533 8016603502 Bradyrhizobium sp. LB7.2 Isolate Nodule
534 8016613128 Bradyrhizobium sp. LB7.1 Isolate Nodule
535 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
536 8019530166 Bradyrhizobium sp. LM4.3 Isolate Nodule
537 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
538 8019547302 Bradyrhizobium sp. LB1.3 Isolate Nodule
539 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
540 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
541 8019619141 Bradyrhizobium sp. GM7.3 Isolate Nodule
542 8019629233 Bradyrhizobium sp. GM6.1 Isolate Nodule
543 8019638758 Bradyrhizobium sp. GM5.1 Isolate Nodule
544 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
545 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
546 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule
547 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule
548 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 76.48
Metatranscriptomes 8.03
Isolates 15.5

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.32
Nodule 11.32
Rhizoplane 4
Rhizosphere 59.38
Stem 0
Stem Tuber 0
Unclassified 13.98

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10019014 3300001979 Bacteria 2426
2 JGI24737J22298_10000979 3300001990 Bacteria 10150
3 JGI24738J21930_10031241 3300002075 Bacteria 1086
4 JGI25406J46586_10045046 3300003203 Bacteria 1522
5 JGI25165J46597_1009200 3300003214 Bacteria 1501
6 Ga0006777J48905_1044268 3300003308 Bacteria 921
7 Ga0007409J51694_1018315 3300003575 Bacteria 859
8 Ga0055526_1019675 3300003771 Bacteria 2447
9 JGI25405J52794_10031793 3300003911 Bacteria 1098
10 Ga0058859_10002637 3300004798 Bacteria 1022
11 Ga0058860_12101187 3300004801 Bacteria 1119
12 Ga0058862_12634862 3300004803 Bacteria 989
13 Ga0065165_1038109 3300005262 Bacteria 1452
14 Ga0070658_10018416 3300005327 Bacteria 5590
15 Ga0070683_100009865 3300005329 Bacteria 8181
16 Ga0070670_100359760 3300005331 Bacteria 1280
17 Ga0068869_100064257 3300005334 Bacteria 2699
18 Ga0070666_10143604 3300005335 Bacteria 1663
19 Ga0070680_100036908 3300005336 Bacteria 3948
20 Ga0070680_100574888 3300005336 Bacteria 967
21 Ga0070691_10048168 3300005341 Bacteria 2027
22 Ga0070668_100084817 3300005347 Bacteria 2489
23 Ga0070668_100260994 3300005347 Bacteria 1441
24 Ga0070668_100342991 3300005347 Bacteria 1262
25 Ga0070669_100023783 3300005353 Bacteria 4391
26 Ga0070669_100523000 3300005353 Bacteria 986
27 Ga0070675_100511647 3300005354 Bacteria 1083
28 Ga0070671_100000542 3300005355 Bacteria 26647
29 Ga0070673_100212996 3300005364 Bacteria 1669
30 Ga0070688_100342197 3300005365 Bacteria 1092
31 Ga0070659_100084996 3300005366 Bacteria 2530
32 Ga0070667_100035887 3300005367 Bacteria 4155
33 Ga0070667_100246357 3300005367 Bacteria 1597
34 Ga0070709_10014869 3300005434 Bacteria 4414
35 Ga0070709_10019171 3300005434 Bacteria 3950
36 Ga0070709_10044929 3300005434 Bacteria 2738
37 Ga0070714_100073568 3300005435 Bacteria 2961
38 Ga0070714_100191652 3300005435 Bacteria 1866
39 Ga0070713_100025592 3300005436 Bacteria 4617
40 Ga0070713_100045297 3300005436 Bacteria 3604
41 Ga0070713_100079741 3300005436 Bacteria 2790
42 Ga0070713_100119688 3300005436 Bacteria 2307
43 Ga0070713_100168405 3300005436 Bacteria 1961
44 Ga0070713_100348883 3300005436 Bacteria 1373
45 Ga0070710_10002858 3300005437 Bacteria 8225
46 Ga0070710_10020812 3300005437 Bacteria 3409
47 Ga0070710_10412975 3300005437 Bacteria 907
48 Ga0070663_100001941 3300005455 Bacteria 11542
49 Ga0070663_100060988 3300005455 Bacteria 2715
50 Ga0070681_10001077 3300005458 Bacteria 23275
51 Ga0070681_10132401 3300005458 Bacteria 2425
52 Ga0068867_100176355 3300005459 Bacteria 1696
53 Ga0070707_100142842 3300005468 Bacteria 2330
54 Ga0070699_100168805 3300005518 Bacteria 1938
55 Ga0070679_100005644 3300005530 Bacteria 11595
56 Ga0070679_100028700 3300005530 Bacteria 5488
57 Ga0070679_100097238 3300005530 Bacteria 2932
58 Ga0070679_100103273 3300005530 Bacteria 2836
59 Ga0070684_100008528 3300005535 Bacteria 8020
60 Ga0070684_100133161 3300005535 Bacteria 2243
61 Ga0068853_100015795 3300005539 Bacteria 6201
62 Ga0068853_100280674 3300005539 Bacteria 1536
63 Ga0070672_100256992 3300005543 Bacteria 1472
64 Ga0070686_100303674 3300005544 Bacteria 1184
65 Ga0070695_100045867 3300005545 Bacteria 2788
66 Ga0070693_100059830 3300005547 Bacteria 2209
67 Ga0070693_100089949 3300005547 Bacteria 1848
68 Ga0070665_100001356 3300005548 Bacteria 28943
69 Ga0070665_100182360 3300005548 Bacteria 2100
70 Ga0070665_100331908 3300005548 Bacteria 1525
71 Ga0068855_100024520 3300005563 Bacteria 7218
72 Ga0068855_100046913 3300005563 Bacteria 5106
73 Ga0068855_100188673 3300005563 Bacteria 2326
74 Ga0068855_100240999 3300005563 Bacteria 2021
75 Ga0068855_100415431 3300005563 Bacteria 1472
76 Ga0070664_100431467 3300005564 Bacteria 1208
77 Ga0068857_100005034 3300005577 Bacteria 11228
78 Ga0068857_100166962 3300005577 Bacteria 1999
79 Ga0068857_100223783 3300005577 Bacteria 1719
80 Ga0068854_100003979 3300005578 Bacteria 9266
81 Ga0068854_100342861 3300005578 Bacteria 1221
82 Ga0068856_100000883 3300005614 Bacteria 32112
83 Ga0068856_100004208 3300005614 Bacteria 14365
84 Ga0068856_100152442 3300005614 Bacteria 2321
85 Ga0068859_100093827 3300005617 Bacteria 3052
86 Ga0068864_100085987 3300005618 Bacteria 2766
87 Ga0068851_10006246 3300005834 Bacteria 5436
88 Ga0068870_10164917 3300005840 Bacteria 1317
89 Ga0068863_100074583 3300005841 Bacteria 3210
90 Ga0068863_100150925 3300005841 Bacteria 2223
91 Ga0068858_100039033 3300005842 Bacteria 4405
92 Ga0068858_100478227 3300005842 Bacteria 1202
93 Ga0068860_100261639 3300005843 Bacteria 1686
94 Ga0068862_100034179 3300005844 Bacteria 4300
95 Ga0068862_100238505 3300005844 Bacteria 1652
96 Ga0081455_10000738 3300005937 Bacteria 42457
97 Ga0081455_10011519 3300005937 Bacteria 8881
98 Ga0081455_10025851 3300005937 Bacteria 5412
99 Ga0081455_10029499 3300005937 Bacteria 5002
100 Ga0081538_10007441 3300005981 Bacteria 9477
101 Ga0081538_10032665 3300005981 Bacteria 3480
102 Ga0081540_1005811 3300005983 Bacteria 9130
103 Ga0081540_1007723 3300005983 Bacteria 7624
104 Ga0081540_1040622 3300005983 Bacteria 2422
105 Ga0081539_10000371 3300005985 Bacteria 98455
106 Ga0081539_10025876 3300005985 Bacteria 3761
107 Ga0081539_10075608 3300005985 Bacteria 1788
108 Ga0070717_10003277 3300006028 Bacteria 11581
109 Ga0070717_10018898 3300006028 Bacteria 5392
110 Ga0070717_10053768 3300006028 Bacteria 3319
111 Ga0070717_10208139 3300006028 Bacteria 1716
112 Ga0075365_10006761 3300006038 Bacteria 6346
113 Ga0075365_10087096 3300006038 Bacteria 2123
114 Ga0075365_10145024 3300006038 Bacteria 1649
115 Ga0075368_10028408 3300006042 Bacteria 2161
116 Ga0075363_100052946 3300006048 Bacteria 2167
117 Ga0075364_10110184 3300006051 Bacteria 1837
118 Ga0075364_10165743 3300006051 Bacteria 1493
119 Ga0075364_10289396 3300006051 Bacteria 1115
120 Ga0070716_100005454 3300006173 Bacteria 6164
121 Ga0070712_100051297 3300006175 Bacteria 2873
122 Ga0075362_10028375 3300006177 Bacteria 2403
123 Ga0075362_10068248 3300006177 Bacteria 1619
124 Ga0075367_10013523 3300006178 Bacteria 4390
125 Ga0075367_10022578 3300006178 Bacteria 3531
126 Ga0075369_10009920 3300006186 Bacteria 3715
127 Ga0075369_10049655 3300006186 Bacteria 1813
128 Ga0075366_10118823 3300006195 Bacteria 1592
129 Ga0075370_10031036 3300006353 Bacteria 2983
130 Ga0075370_10107073 3300006353 Bacteria 1621
131 Ga0075370_10136094 3300006353 Bacteria 1435
132 Ga0075370_10184506 3300006353 Bacteria 1228
133 Ga0075370_10212095 3300006353 Bacteria 1143
134 Ga0068865_100140332 3300006881 Bacteria 1821
135 Ga0075436_100045387 3300006914 Bacteria 3031
136 Ga0097620_100093827 3300006931 Bacteria 3052
137 Ga0079104_1041320 3300006946 Bacteria 1075
138 Ga0105251_10001526 3300009011 Bacteria 19872
139 Ga0105240_10002459 3300009093 Bacteria 29768
140 Ga0105240_10007949 3300009093 Bacteria 15306
141 Ga0105240_10056136 3300009093 Bacteria 4928
142 Ga0105240_10061018 3300009093 Bacteria 4700
143 Ga0105240_10093949 3300009093 Bacteria 3659
144 Ga0105240_10470262 3300009093 Bacteria 1403
145 Ga0111539_10089486 3300009094 Bacteria 3617
146 Ga0105247_10237703 3300009101 Bacteria 1240
147 Ga0105247_10362207 3300009101 Bacteria 1023
148 Ga0105241_10020741 3300009174 Bacteria 4856
149 Ga0105241_10223420 3300009174 Bacteria 1584
150 Ga0105248_10013528 3300009177 Bacteria 8982
151 Ga0105248_10089282 3300009177 Bacteria 3469
152 Ga0105237_10014356 3300009545 Bacteria 8288
153 Ga0105237_10014927 3300009545 Bacteria 8100
154 Ga0105237_10151573 3300009545 Bacteria 2315
155 Ga0105237_10194513 3300009545 Bacteria 2028
156 Ga0105238_10001235 3300009551 Bacteria 25716
157 Ga0105238_10018660 3300009551 Bacteria 7063
158 Ga0105238_10021262 3300009551 Bacteria 6612
159 Ga0105238_10116101 3300009551 Bacteria 2656
160 Ga0105249_10379015 3300009553 Bacteria 1440
161 Ga0105249_10386249 3300009553 Bacteria 1427
162 Ga0099796_10016687 3300010159 Bacteria 2173
163 Ga0105239_10018536 3300010375 Bacteria 7687
164 Ga0105239_10053677 3300010375 Bacteria 4420
165 Ga0105239_10456862 3300010375 Bacteria 1449
166 Ga0105239_10710672 3300010375 Bacteria 1149
167 Ga0157314_1005405 3300012500 Bacteria 969
168 Ga0157369_10032756 3300013105 Bacteria 5711
169 Ga0157369_10223644 3300013105 Bacteria 1969
170 Ga0157374_10080278 3300013296 Bacteria 3093
171 Ga0157374_10154653 3300013296 Bacteria 2231
172 Ga0157374_10314643 3300013296 Bacteria 1551
173 Ga0163162_10055722 3300013306 Bacteria 3981
174 Ga0157375_10239363 3300013308 Bacteria 1974
175 Ga0163163_10026240 3300014325 Bacteria 5566
176 Ga0182008_10237463 3300014497 Bacteria 937
177 Ga0157379_10530911 3300014968 Bacteria 1093
178 Ga0197907_10122096 3300020069 Bacteria 1029
179 Ga0197907_11428149 3300020069 Bacteria 1014
180 Ga0206356_10841646 3300020070 Bacteria 915
181 Ga0206356_11019694 3300020070 Bacteria 1083
182 Ga0206356_11227967 3300020070 Bacteria 1316
183 Ga0206349_1112773 3300020075 Bacteria 1263
184 Ga0206349_1345775 3300020075 Bacteria 927
185 Ga0206349_1694165 3300020075 Bacteria 1023
186 Ga0206349_1878734 3300020075 Bacteria 1048
187 Ga0206355_1022003 3300020076 Bacteria 829
188 Ga0206355_1140956 3300020076 Bacteria 955
189 Ga0206351_10137541 3300020077 Bacteria 936
190 Ga0206351_10685837 3300020077 Bacteria 1022
191 Ga0206351_10853499 3300020077 Bacteria 927
192 Ga0206352_10853849 3300020078 Bacteria 943
193 Ga0206352_11018583 3300020078 Bacteria 924
194 Ga0206352_11297536 3300020078 Bacteria 969
195 Ga0206350_10047531 3300020080 Bacteria 970
196 Ga0206350_10124601 3300020080 Bacteria 947
197 Ga0206350_10258629 3300020080 Bacteria 935
198 Ga0206350_10783199 3300020080 Bacteria 917
199 Ga0206350_11138243 3300020080 Bacteria 953
200 Ga0206350_11301687 3300020080 Bacteria 925
201 Ga0206354_10001066 3300020081 Bacteria 968
202 Ga0206354_10892454 3300020081 Bacteria 919
203 Ga0206354_11650149 3300020081 Bacteria 971
204 Ga0206353_10006930 3300020082 Bacteria 923
205 Ga0206353_11260487 3300020082 Bacteria 935
206 Ga0206353_11903621 3300020082 Bacteria 2125
207 Ga0154015_1265539 3300020610 Bacteria 956
208 Ga0154015_1529450 3300020610 Bacteria 1040
209 Ga0213873_10001008 3300021358 Bacteria 4576
210 Ga0213876_10003470 3300021384 Bacteria 9015
211 Ga0213876_10023883 3300021384 Bacteria 3227
212 Ga0213876_10268756 3300021384 Bacteria 906
213 Ga0213875_10027840 3300021388 Bacteria 2689
214 Ga0224712_10119344 3300022467 Bacteria 1140
215 Ga0224712_10139243 3300022467 Bacteria 1066
216 Ga0224712_10186241 3300022467 Bacteria 938
217 Ga0224712_10187736 3300022467 Bacteria 934
218 Ga0224712_10190267 3300022467 Bacteria 928
219 Ga0209677_100170 3300025253 Bacteria 55896
220 Ga0209148_1006148 3300025254 Bacteria 2635
221 Ga0209233_1012365 3300025261 Bacteria 2478
222 Ga0209455_1002203 3300025272 Bacteria 7710
223 Ga0209455_1007613 3300025272 Bacteria 3035
224 Ga0209564_1000671 3300025295 Bacteria 50518
225 Ga0209564_1010723 3300025295 Bacteria 4182
226 Ga0209758_1001900 3300025297 Bacteria 22801
227 Ga0207656_10011551 3300025321 Bacteria 3339
228 Ga0207713_1002460 3300025735 Bacteria 13462
229 Ga0207692_10006838 3300025898 Bacteria 4643
230 Ga0207710_10105055 3300025900 Bacteria 1336
231 Ga0207688_10086352 3300025901 Bacteria 1797
232 Ga0207680_10126573 3300025903 Bacteria 1678
233 Ga0207647_10022531 3300025904 Bacteria 4181
234 Ga0207647_10027240 3300025904 Bacteria 3728
235 Ga0207699_10169105 3300025906 Bacteria 1461
236 Ga0207643_10070154 3300025908 Bacteria 2015
237 Ga0207707_10001830 3300025912 Bacteria 19505
238 Ga0207707_10028688 3300025912 Bacteria 4863
239 Ga0207707_10299982 3300025912 Bacteria 1389
240 Ga0207695_10051771 3300025913 Bacteria 4308
241 Ga0207695_10139657 3300025913 Bacteria 2373
242 Ga0207671_10062068 3300025914 Bacteria 2774
243 Ga0207671_10099663 3300025914 Bacteria 2199
244 Ga0207693_10003895 3300025915 Bacteria 12708
245 Ga0207693_10004610 3300025915 Bacteria 11630
246 Ga0207693_10107617 3300025915 Bacteria 2187
247 Ga0207693_10304145 3300025915 Bacteria 1249
248 Ga0207663_10054053 3300025916 Bacteria 2512
249 Ga0207663_10098371 3300025916 Bacteria 1959
250 Ga0207660_10413582 3300025917 Bacteria 1087
251 Ga0207660_10488399 3300025917 Bacteria 998
252 Ga0207657_10268499 3300025919 Bacteria 1356
253 Ga0207652_10005820 3300025921 Bacteria 9998
254 Ga0207652_10315488 3300025921 Bacteria 1411
255 Ga0207652_10394162 3300025921 Bacteria 1249
256 Ga0207681_10000503 3300025923 Bacteria 27243
257 Ga0207694_10018629 3300025924 Bacteria 5249
258 Ga0207694_10023665 3300025924 Bacteria 4664
259 Ga0207694_10185041 3300025924 Bacteria 1690
260 Ga0207687_10404930 3300025927 Bacteria 1123
261 Ga0207700_10070457 3300025928 Bacteria 2688
262 Ga0207700_10345410 3300025928 Bacteria 1295
263 Ga0207664_10023800 3300025929 Bacteria 4595
264 Ga0207664_10429104 3300025929 Bacteria 1178
265 Ga0207664_10501200 3300025929 Bacteria 1087
266 Ga0207644_10001520 3300025931 Bacteria 14966
267 Ga0207704_10433479 3300025938 Bacteria 1045
268 Ga0207665_10006607 3300025939 Bacteria 7691
269 Ga0207665_10113232 3300025939 Bacteria 1908
270 Ga0207711_10002363 3300025941 Bacteria 16902
271 Ga0207711_10048929 3300025941 Bacteria 3618
272 Ga0207711_10567891 3300025941 Bacteria 1058
273 Ga0207661_10000878 3300025944 Bacteria 19794
274 Ga0207661_10092182 3300025944 Bacteria 2525
275 Ga0207679_10214993 3300025945 Bacteria 1614
276 Ga0207679_10319399 3300025945 Bacteria 1344
277 Ga0207667_10037414 3300025949 Bacteria 5187
278 Ga0207667_10152080 3300025949 Bacteria 2381
279 Ga0207667_10482417 3300025949 Bacteria 1258
280 Ga0207668_10003815 3300025972 Bacteria 8882
281 Ga0207668_10846220 3300025972 Bacteria 812
282 Ga0207658_10197038 3300025986 Bacteria 1678
283 Ga0207703_10302433 3300026035 Bacteria 1459
284 Ga0207703_10339404 3300026035 Bacteria 1380
285 Ga0207639_10213299 3300026041 Bacteria 1663
286 Ga0207678_10043043 3300026067 Bacteria 3909
287 Ga0207678_10149983 3300026067 Bacteria 1990
288 Ga0207678_10237780 3300026067 Bacteria 1560
289 Ga0207708_10280685 3300026075 Bacteria 1350
290 Ga0207702_10000318 3300026078 Bacteria 55209
291 Ga0207702_10232747 3300026078 Bacteria 1723
292 Ga0207702_10567464 3300026078 Bacteria 1111
293 Ga0207674_10014753 3300026116 Bacteria 8619
294 Ga0207683_10088714 3300026121 Bacteria 2752
295 Ga0207698_10089767 3300026142 Bacteria 2511
296 Ga0207698_10627039 3300026142 Bacteria 1063
297 Ga0209179_1015611 3300027512 Bacteria 1413
298 Ga0268266_10000534 3300028379 Bacteria 53027
299 Ga0268266_10001906 3300028379 Bacteria 23472
300 Ga0268266_10009681 3300028379 Bacteria 8469
301 Ga0268266_10394682 3300028379 Bacteria 1307
302 Ga0268266_10465051 3300028379 Bacteria 1204
303 Ga0268265_10065886 3300028380 Bacteria 2797
304 Ga0268265_10125312 3300028380 Bacteria 2124
305 Ga0268265_10211107 3300028380 Bacteria 1691
306 Ga0268265_10853020 3300028380 Bacteria 891
307 Ga0268264_10000062 3300028381 Bacteria 302110
308 Ga0268264_10353623 3300028381 Bacteria 1399
309 Ga0265334_10006202 3300028573 Bacteria 5171
310 Ga0307517_10000232 3300028786 Bacteria 94332
311 Ga0307515_10354065 3300028794 Bacteria 1113
312 Ga0310981_1033463 3300029285 Bacteria 900
313 Ga0307511_10085070 3300030521 Bacteria 2189
314 Ga0307511_10114742 3300030521 Bacteria 1696
315 Ga0265763_1004318 3300030763 Bacteria 1161
316 Ga0265764_102331 3300030882 Bacteria 923
317 Ga0265332_10063996 3300031238 Bacteria 1571
318 Ga0265332_10079800 3300031238 Bacteria 1389
319 Ga0265325_10032360 3300031241 Bacteria 2792
320 Ga0265340_10012805 3300031247 Bacteria 4425
321 Ga0265340_10097790 3300031247 Bacteria 1366
322 Ga0265339_10001952 3300031249 Bacteria 15141
323 Ga0307513_10083845 3300031456 Bacteria 3276
324 Ga0307513_10299956 3300031456 Bacteria 1374
325 Ga0307509_10207829 3300031507 Bacteria 1786
326 Ga0307508_10105800 3300031616 Bacteria 2411
327 Ga0307508_10147504 3300031616 Bacteria 1957
328 Ga0265314_10087483 3300031711 Bacteria 2037
329 Ga0265314_10188651 3300031711 Bacteria 1229
330 Ga0307516_10029260 3300031730 Bacteria 5570
331 Ga0307516_10132990 3300031730 Bacteria 2265
332 Ga0307516_10181291 3300031730 Bacteria 1839
333 Ga0307409_100077156 3300031995 Bacteria 2675
334 Ga0307415_100039352 3300032126 Bacteria 3124
335 Ga0307507_10061770 3300033179 Bacteria 3486
336 Ga0307510_10024915 3300033180 Bacteria 6908
337 Ga0316215_1000881 3300033544 Bacteria 2943
338 Ga0373950_0017256 3300034818 Bacteria 1242
339 Ga0373936_0009753 3300035113 Bacteria 3623
340 Ga0373943_0035254 3300035170 Bacteria 2390
341 Ga0373943_0045855 3300035170 Bacteria 2132
342 Ga0373955_0148985 3300035172 Bacteria 1376
343 Ga0373935_0001267 3300035692 Bacteria 13929
344 Ga0373935_0036686 3300035692 Bacteria 3066
345 Ga0373935_0398511 3300035692 Bacteria 988
346 Ga0373927_0000766 3300035695 Bacteria 24573
347 Ga0373927_0005757 3300035695 Bacteria 8509
348 Ga0373927_0234532 3300035695 Bacteria 1206
349 Ga0373933_0000218 3300035724 Bacteria 37928
350 Ga0373933_0133166 3300035724 Bacteria 1564
351 Ga0373947_0000310 3300035725 Bacteria 27577
352 Ga0373937_0101471 3300036401 Bacteria 2671
353 Ga0310112_018378 3300036458 Bacteria 985
354 Ga0310109_018809 3300036534 Bacteria 934
355 Ga0373925_0002455 3300037068 Bacteria 14850
356 Ga0373925_0004991 3300037068 Bacteria 9964
357 Ga0373925_0130723 3300037068 Bacteria 1957
358 Ga0373925_0131430 3300037068 Bacteria 1952
359 Ga0373925_0137215 3300037068 Bacteria 1912
360 Ga0373925_0161821 3300037068 Bacteria 1763
361 Ga0373925_0375173 3300037068 Bacteria 1158
362 Ga0395899_0046650 3300037312 Bacteria 3227
363 Ga0395900_0005138 3300037418 Bacteria 13747
364 Ga0395900_0013190 3300037418 Bacteria 8447
365 Ga0395900_0187341 3300037418 Bacteria 2100
366 Ga0395900_0477755 3300037418 Bacteria 1199
367 Ga0395900_0757346 3300037418 Bacteria 901
368 Ga0395898_0033290 3300037466 Bacteria 5144
369 Ga0395898_0035036 3300037466 Bacteria 4996
370 Ga0395898_0041886 3300037466 Bacteria 4521
371 Ga0395898_0070416 3300037466 Bacteria 3381
372 Ga0395898_0105024 3300037466 Bacteria 2709
373 Ga0395898_0148501 3300037466 Bacteria 2243
374 Ga0395905_0259901 3300037471 Bacteria 1621
375 Ga0436364_0281278 3300037853 Bacteria 34090
376 Ga0436364_0904449 3300037853 Bacteria 2360
377 Ga0436364_0984338 3300037853 Bacteria 2695
378 Ga0436364_1231246 3300037853 Bacteria 4565
379 Ga0436364_1337275 3300037853 Bacteria 3761
380 Ga0395901_0154816 3300038443 Bacteria 2408
381 Ga0395901_0240173 3300038443 Bacteria 1890
382 Ga0395901_0810645 3300038443 Bacteria 924
383 Ga0395901_1012062 3300038443 Bacteria 806
384 Ga0400483_031226 3300039062 Bacteria 2670
385 Ga0436365_0261699 3300039437 Bacteria 8326
386 Ga0436365_0457696 3300039437 Bacteria 1037
387 Ga0436365_0829696 3300039437 Bacteria 36403
388 Ga0436365_1063208 3300039437 Bacteria 2154
389 Ga0436365_1359706 3300039437 Bacteria 2246
390 Ga0436365_1369925 3300039437 Bacteria 12666
391 Ga0436365_1436379 3300039437 Bacteria 1766
392 Ga0436365_1844499 3300039437 Bacteria 1279
393 Ga0436360_0832565 3300039438 Bacteria 8060
394 Ga0436360_0851954 3300039438 Bacteria 1380
395 Ga0436361_0379028 3300039447 Bacteria 3805
396 Ga0436361_0987636 3300039447 Bacteria 4376
397 Ga0436363_0292864 3300039450 Bacteria 3200
398 Ga0436363_0436908 3300039450 Bacteria 2420
399 Ga0436363_0451258 3300039450 Bacteria 2197
400 Ga0436363_0655475 3300039450 Bacteria 3427
401 Ga0436363_0775146 3300039450 Bacteria 11928
402 Ga0436363_0802555 3300039450 Bacteria 2593
403 Ga0436363_1571051 3300039450 Bacteria 883
404 Ga0436363_1571660 3300039450 Bacteria 2001
405 Ga0436362_0963821 3300039453 Bacteria 1543
406 Ga0436362_1185069 3300039453 Bacteria 11827
407 Ga0451797_0777937 3300041453 Bacteria 1279
408 Ga0466969_0044243 3300044656 Bacteria 2216
409 Ga0466972_0000299 3300044658 Bacteria 30012
410 Ga0466972_0052825 3300044658 Bacteria 1957
411 Ga0466966_0002843 3300044684 Bacteria 11392
412 Ga0466966_0081395 3300044684 Bacteria 2016
413 Ga0466961_0002447 3300044693 Bacteria 11519
414 Ga0466961_0141153 3300044693 Bacteria 1508
415 Ga0466963_0095903 3300044694 Bacteria 2025
416 Ga0466963_0237919 3300044694 Bacteria 1276
417 Ga0466963_0361743 3300044694 Bacteria 1022
418 Ga0466964_0092544 3300044706 Bacteria 1319
419 Ga0466968_0002351 3300044735 Bacteria 6916
420 Ga0466968_0081500 3300044735 Bacteria 1422
421 Ga0466970_0171981 3300044765 Bacteria 1201
422 Ga0466957_0059708 3300044842 Bacteria 2338
423 Ga0466960_0097824 3300044901 Bacteria 1506
424 Ga0466958_0145600 3300045836 Bacteria 1493
425 Ga0466967_0070195 3300045976 Bacteria 3133
426 Ga0466967_0115827 3300045976 Bacteria 2469
427 Ga0495592_0026073 3300046454 Bacteria 4434
428 Ga0495603_0000801 3300046455 Bacteria 18013
429 Ga0495603_0007385 3300046455 Bacteria 6608
430 Ga0495603_0298947 3300046455 Bacteria 924
431 Ga0495590_0075863 3300046457 Bacteria 1183
432 Ga0495629_0004806 3300046459 Bacteria 10133
433 Ga0495629_0007739 3300046459 Bacteria 7906
434 Ga0495638_0017844 3300046460 Bacteria 4723
435 Ga0495638_0034495 3300046460 Bacteria 3230
436 Ga0495638_0158860 3300046460 Bacteria 1306
437 Ga0495638_0199003 3300046460 Bacteria 1132
438 Ga0495641_0002198 3300046461 Bacteria 15577
439 Ga0495651_0111889 3300046462 Bacteria 2018
440 Ga0495651_0343390 3300046462 Bacteria 988
441 Ga0495653_0215187 3300046463 Bacteria 1295
442 Ga0495580_0038398 3300046472 Bacteria 3429
443 Ga0495582_0000855 3300046473 Bacteria 16906
444 Ga0495639_0000072 3300046475 Bacteria 46904
445 Ga0495639_0020710 3300046475 Bacteria 2874
446 Ga0495662_0000572 3300046476 Bacteria 16948
447 Ga0495662_0197010 3300046476 Bacteria 993
448 Ga0495664_0002994 3300046477 Bacteria 9132
449 Ga0495664_0011398 3300046477 Bacteria 5012
450 Ga0495584_0078381 3300046491 Bacteria 1662
451 Ga0495584_0115366 3300046491 Bacteria 1359
452 Ga0495594_0000046 3300046499 Bacteria 53822
453 Ga0495583_0081903 3300046506 Bacteria 1401
454 Ga0495606_0034430 3300046507 Bacteria 3477
455 Ga0495610_0027759 3300046512 Bacteria 3003
456 Ga0495616_0048814 3300046513 Bacteria 2124
457 Ga0495616_0056120 3300046513 Bacteria 1946
458 Ga0495620_0040172 3300046515 Bacteria 2061
459 Ga0495630_0011525 3300046517 Bacteria 6402
460 Ga0495643_0007651 3300046522 Bacteria 6931
461 Ga0495648_0052615 3300046524 Bacteria 2472
462 Ga0495663_0034611 3300046525 Bacteria 1513
463 Ga0495666_0003632 3300046526 Bacteria 7798
464 Ga0495666_0154266 3300046526 Bacteria 1067
465 Ga0495652_0031563 3300046529 Bacteria 4638
466 Ga0495665_0000128 3300046531 Bacteria 36043
467 Ga0495640_0012908 3300046533 Bacteria 6370
468 Ga0495621_0065406 3300046539 Bacteria 1328
469 Ga0495597_0042608 3300046542 Bacteria 2024
470 Ga0495597_0134503 3300046542 Bacteria 1023
471 Ga0495645_0015358 3300046543 Bacteria 5445
472 Ga0495645_0044984 3300046543 Bacteria 3220
473 Ga0495645_0162030 3300046543 Bacteria 1546
474 Ga0495622_0007496 3300046557 Bacteria 5062
475 Ga0495622_0022209 3300046557 Bacteria 2956
476 Ga0495667_0025221 3300046559 Bacteria 4008
477 Ga0495656_0028598 3300046615 Bacteria 2237
478 Ga0495656_0054370 3300046615 Bacteria 1722
479 Ga0495634_0003037 3300046642 Bacteria 13668
480 Ga0495634_0320167 3300046642 Bacteria 934
481 Ga0495625_0218111 3300046660 Bacteria 1251
482 Ga0495635_0002038 3300046663 Bacteria 13679
483 Ga0495635_0003646 3300046663 Bacteria 10680
484 Ga0495661_0033443 3300046665 Bacteria 3243
485 Ga0495588_0010612 3300046674 Bacteria 4291
486 Ga0495588_0044719 3300046674 Bacteria 2269
487 Ga0495657_0002636 3300046675 Bacteria 15017
488 Ga0495658_0004429 3300046683 Bacteria 6911
489 Ga0495669_0131590 3300046684 Bacteria 1177
490 Ga0495613_0003702 3300046689 Bacteria 11465
491 Ga0495624_0000795 3300046690 Bacteria 24919
492 Ga0495600_0126739 3300046809 Bacteria 1660
493 Ga0495581_0000030 3300047315 Bacteria 53487
494 Ga0495604_0020841 3300047317 Bacteria 5233
495 Ga0495636_0068370 3300047318 Bacteria 1512
496 Ga0495674_0001230 3300047319 Bacteria 24837
497 Ga0495672_0028262 3300047320 Bacteria 3550
498 Ga0495672_0219222 3300047320 Bacteria 940
499 Ga0495676_0017129 3300047321 Bacteria 6412
500 Ga0495676_0475670 3300047321 Bacteria 822
501 Ga0495680_0000836 3300047322 Bacteria 34084
502 Ga0495680_0094218 3300047322 Bacteria 2241
503 Ga0495675_0036875 3300047444 Bacteria 3116
504 Ga0495681_0038105 3300047470 Bacteria 2360
505 Ga0495684_0018978 3300047471 Bacteria 5294
506 Ga0495684_0089426 3300047471 Bacteria 2333
507 Ga0495593_0000470 3300047673 Bacteria 22684
508 Ga0495593_0013800 3300047673 Bacteria 4603
509 Ga0495602_0360503 3300048088 Bacteria 1047
510 Ga0495614_0022266 3300048089 Bacteria 2735
511 Ga0495614_0038654 3300048089 Bacteria 2048
512 Ga0495626_0013148 3300048091 Bacteria 4312
513 Ga0496100_0045464 3300048903 Bacteria 2818
514 Ga0496100_0427594 3300048903 Bacteria 1012
515 Ga0496101_0272312 3300048904 Bacteria 1322
516 Ga0496102_0457189 3300048905 Bacteria 1197
517 Ga0496103_0016321 3300048906 Bacteria 4431
518 Ga0496103_0387068 3300048906 Bacteria 898
519 Ga0496104_0004634 3300048907 Bacteria 11973
520 Ga0496104_0006887 3300048907 Bacteria 10025
521 Ga0496104_0058668 3300048907 Bacteria 3643
522 Ga0496105_0018687 3300048908 Bacteria 5579
523 Ga0496105_0043484 3300048908 Bacteria 3705
524 Ga0496105_0199333 3300048908 Bacteria 1634
525 Ga0496106_0003643 3300048909 Bacteria 11488
526 Ga0496107_0046717 3300048910 Bacteria 3116
527 Ga0496107_0181458 3300048910 Bacteria 1563
528 Ga0496108_0155438 3300048911 Bacteria 1975
529 Ga0496108_0238859 3300048911 Bacteria 1580
530 Ga0496108_0410894 3300048911 Bacteria 1182
531 Ga0496109_0095265 3300048912 Bacteria 2756
532 Ga0496109_0130510 3300048912 Bacteria 2345
533 Ga0496109_0151503 3300048912 Bacteria 2171
534 Ga0496110_0017143 3300048913 Bacteria 6055
535 Ga0496110_0127423 3300048913 Bacteria 2297
536 Ga0496110_0138630 3300048913 Bacteria 2199
537 Ga0496110_0411456 3300048913 Bacteria 1233
538 Ga0496111_0015674 3300048914 Bacteria 5209
539 Ga0496112_0004525 3300048915 Bacteria 11810
540 Ga0496112_0004583 3300048915 Bacteria 11751
541 Ga0496112_0146271 3300048915 Bacteria 2332
542 Ga0496112_0215534 3300048915 Bacteria 1876
543 Ga0496114_0109828 3300048917 Bacteria 2362
544 Ga0496115_0003360 3300048918 Bacteria 11473
545 Ga0496115_0044258 3300048918 Bacteria 3550
546 Ga0496116_0001930 3300048919 Bacteria 22336
547 Ga0496117_0012405 3300048920 Bacteria 7516
548 Ga0496117_0051814 3300048920 Bacteria 2897
549 Ga0496117_0219744 3300048920 Bacteria 1058
550 Ga0496118_0010865 3300048921 Bacteria 8960
551 Ga0496118_0020331 3300048921 Bacteria 5889
552 Ga0496118_0060316 3300048921 Bacteria 2817
553 Ga0496118_0135418 3300048921 Bacteria 1573
554 Ga0496118_0149541 3300048921 Bacteria 1464
555 Ga0496119_0140410 3300048922 Bacteria 1305
556 Ga0496120_0008022 3300048923 Bacteria 7770
557 Ga0496120_0021337 3300048923 Bacteria 4095
558 Ga0496121_0000811 3300048924 Bacteria 56962
559 Ga0496121_0000870 3300048924 Bacteria 54546
560 Ga0496121_0017520 3300048924 Bacteria 7309
561 Ga0496121_0024640 3300048924 Bacteria 5745
562 Ga0496121_0174913 3300048924 Bacteria 1555
563 Ga0496121_0230428 3300048924 Bacteria 1298
564 Ga0496123_0054650 3300048926 Bacteria 2627
565 Ga0496124_0002001 3300048927 Bacteria 27769
566 Ga0496124_0046080 3300048927 Bacteria 3736
567 Ga0496124_0051368 3300048927 Bacteria 3508
568 Ga0496124_0099848 3300048927 Bacteria 2353
569 Ga0496124_0355129 3300048927 Bacteria 1035
570 Ga0496125_0000869 3300048928 Bacteria 48286
571 Ga0496125_0006645 3300048928 Bacteria 12446
572 Ga0496125_0015348 3300048928 Bacteria 7416
573 Ga0496125_0018462 3300048928 Bacteria 6623
574 Ga0496125_0026599 3300048928 Bacteria 5267
575 Ga0496125_0066354 3300048928 Bacteria 2852
576 Ga0496125_0108616 3300048928 Bacteria 2017
577 Ga0496125_0212982 3300048928 Bacteria 1253
578 Ga0496125_0322812 3300048928 Bacteria 935
579 Ga0496125_0326778 3300048928 Bacteria 927
580 Ga0496126_0028135 3300048929 Bacteria 5360
581 Ga0496126_0036323 3300048929 Bacteria 4607
582 Ga0496126_0055197 3300048929 Bacteria 3595
583 Ga0496126_0064657 3300048929 Bacteria 3276
584 Ga0496126_0074215 3300048929 Bacteria 3021
585 Ga0496126_0145097 3300048929 Bacteria 2039
586 Ga0496126_0217168 3300048929 Bacteria 1608
587 Ga0496126_0260193 3300048929 Bacteria 1443
588 Ga0496126_0399814 3300048929 Bacteria 1114
589 Ga0501308_015165 3300049128 Bacteria 911
590 Ga0501344_01846 3300049133 Bacteria 1056
591 Ga0495678_066654 3300049459 Bacteria 1332
592 Ga0495678_080423 3300049459 Bacteria 1171
593 Ga0501317_023690 3300049533 Bacteria 849
594 Ga0501031_0002390 3300049568 Bacteria 11926
595 Ga0501032_0001465 3300049569 Bacteria 18782
596 Ga0501032_0009394 3300049569 Bacteria 7084
597 Ga0501032_0111245 3300049569 Bacteria 1812
598 Ga0501033_0000221 3300049570 Bacteria 54727
599 Ga0501033_0014226 3300049570 Bacteria 6048
600 Ga0501033_0161719 3300049570 Bacteria 1611
601 Ga0501034_0063989 3300049571 Bacteria 3692
602 Ga0501034_0387516 3300049571 Bacteria 1322
603 Ga0501036_0112469 3300049572 Bacteria 2301
604 Ga0501036_0116278 3300049572 Bacteria 2259
605 Ga0501036_0149151 3300049572 Bacteria 1972
606 Ga0501036_0185584 3300049572 Bacteria 1750
607 Ga0501037_0000211 3300049573 Bacteria 51924
608 Ga0501037_0199519 3300049573 Bacteria 1414
609 Ga0501038_0117785 3300049574 Bacteria 2193
610 Ga0501038_0214098 3300049574 Bacteria 1540
611 Ga0501039_0004618 3300049575 Bacteria 10417
612 Ga0501039_0073196 3300049575 Bacteria 2662
613 Ga0501039_0078518 3300049575 Bacteria 2568
614 Ga0501041_0022265 3300049577 Bacteria 3794
615 Ga0501041_0168583 3300049577 Bacteria 1370
616 Ga0501042_0102050 3300049578 Bacteria 2063
617 Ga0501042_0417913 3300049578 Bacteria 972
618 Ga0501043_0002234 3300049579 Bacteria 16494
619 Ga0501043_0097788 3300049579 Bacteria 2307
620 Ga0501043_0215386 3300049579 Bacteria 1487
621 Ga0501046_0097963 3300049580 Bacteria 2252
622 Ga0501046_0179534 3300049580 Bacteria 1584
623 Ga0501047_0036900 3300049581 Bacteria 4724
624 Ga0501047_0082949 3300049581 Bacteria 3081
625 Ga0501047_0170043 3300049581 Bacteria 2048
626 Ga0501048_0070529 3300049582 Bacteria 2468
627 Ga0501068_0097814 3300049584 Bacteria 1816
628 Ga0501070_0014987 3300049586 Bacteria 6522
629 Ga0501070_0067905 3300049586 Bacteria 2952
630 Ga0501070_0121560 3300049586 Bacteria 2158
631 Ga0501071_0012141 3300049587 Bacteria 5829
632 Ga0501071_0470326 3300049587 Bacteria 963
633 Ga0501072_0004379 3300049588 Bacteria 10721
634 Ga0501073_0024476 3300049589 Bacteria 4336
635 Ga0501074_0012908 3300049590 Bacteria 6073
636 Ga0501075_0027955 3300049591 Bacteria 4159
637 Ga0501076_0134528 3300049592 Bacteria 2006
638 Ga0501077_0037268 3300049593 Bacteria 3098
639 Ga0501080_0009730 3300049742 Bacteria 8780
640 Ga0501080_0113318 3300049742 Bacteria 2514
641 Ga0501081_0324216 3300049743 Bacteria 1132
642 Ga0501035_0003613 3300049822 Bacteria 14762
643 Ga0501035_0040812 3300049822 Bacteria 4192
644 Ga0501035_0144235 3300049822 Bacteria 2069
645 Ga0501035_0160333 3300049822 Bacteria 1947
646 Ga0501044_0006548 3300049823 Bacteria 12857
647 Ga0501044_0030992 3300049823 Bacteria 5631
648 Ga0501044_0038489 3300049823 Bacteria 4994
649 Ga0501044_0101594 3300049823 Bacteria 2893
650 Ga0501044_0119655 3300049823 Bacteria 2635
651 Ga0501044_0266664 3300049823 Bacteria 1649
652 Ga0501044_0504743 3300049823 Bacteria 1110
653 Ga0501044_0973984 3300049823 Bacteria 721
654 Ga0501045_0081117 3300049824 Bacteria 2392
655 nmdc:mga03683_58931_c1 3300050489 Bacteria 1619
656 nmdc:mga03n38_12117_c1 3300050490 Bacteria 3235
657 nmdc:mga03n38_7962_c1 3300050490 Bacteria 3776
658 nmdc:mga00v17_16675_c2 3300050491 Bacteria 1545
659 nmdc:mga00v17_84585_c1 3300050491 Bacteria 1986
660 nmdc:mga00v17_95829_c1 3300050491 Bacteria 1868
661 nmdc:mga0yw44_13126_c1 3300050492 Bacteria 4349
662 nmdc:mga0yw44_171654_c1 3300050492 Bacteria 1424
663 nmdc:mga0yw44_63003_c1 3300050492 Bacteria 2279
664 nmdc:mga0yw44_63079_c1 3300050492 Bacteria 2278
665 nmdc:mga0k408_153467_c1 3300050493 Bacteria 1372
666 nmdc:mga0k408_61581_c1 3300050493 Bacteria 935
667 nmdc:mga06z11_58021_c1 3300050494 Bacteria 2007
668 nmdc:mga06z11_85331_c1 3300050494 Bacteria 1703
669 nmdc:mga06z11_92058_c1 3300050494 Bacteria 1648
670 nmdc:mga07m45_135204_c1 3300050496 Bacteria 1427
671 nmdc:mga07m45_316726_c1 3300050496 Bacteria 907
672 nmdc:mga07m45_7843_c1 3300050496 Bacteria 5464
673 nmdc:mga07m45_97861_c1 3300050496 Bacteria 1684
674 nmdc:mga08y16_188038_c1 3300050511 Bacteria 2143
675 nmdc:mga08x19_91753_c1 3300050514 Bacteria 2005
676 nmdc:mga0a205_241895_c1 3300050515 Bacteria 1685
677 nmdc:mga0sz30_47631_c1 3300050516 Bacteria 1812
678 nmdc:mga0sz30_6347_c1 3300050516 Bacteria 4388
679 nmdc:mga0sz30_7031_c1 3300050516 Bacteria 4207
680 Ga0495612_0101059 3300053078 Bacteria 1228
681 Ga0500635_0011112 3300053080 Bacteria 2551
682 Ga0495595_0150542 3300053084 Bacteria 1145
683 Ga0495619_0006419 3300053085 Bacteria 7451
684 Ga0495619_0472753 3300053085 Bacteria 863
685 Ga0500643_032856 3300053087 Bacteria 1572
686 Ga0500581_049278 3300053089 Bacteria 2150
687 Ga0500581_172258 3300053089 Bacteria 992
688 Ga0500566_0000055 3300053094 Bacteria 54414
689 Ga0500566_0003437 3300053094 Bacteria 9442
690 Ga0500566_0038668 3300053094 Bacteria 2760
691 Ga0500641_0001366 3300053096 Bacteria 8686
692 Ga0500650_0000245 3300053098 Bacteria 13194
693 Ga0500554_006966 3300053102 Bacteria 2573
694 Ga0500556_0000006 3300053104 Bacteria 453982
695 Ga0500569_002880 3300053109 Bacteria 3446
696 Ga0500591_020057 3300053115 Bacteria 3241
697 Ga0500595_001016 3300053119 Bacteria 15748
698 Ga0500595_002547 3300053119 Bacteria 8931
699 Ga0500595_077621 3300053119 Bacteria 976
700 Ga0500608_000604 3300053122 Bacteria 13230
701 Ga0500608_027696 3300053122 Bacteria 2672
702 Ga0500642_0000004 3300053130 Bacteria 433122
703 Ga0500652_000294 3300053131 Bacteria 18164
704 Ga0500658_0028806 3300053134 Bacteria 2157
705 Ga0500559_0000362 3300053136 Bacteria 33750
706 Ga0500559_0019096 3300053136 Bacteria 2896
707 Ga0500568_0001522 3300053139 Bacteria 14778
708 Ga0500568_0050342 3300053139 Bacteria 1642
709 Ga0500586_017738 3300053145 Bacteria 2184
710 Ga0500590_025848 3300053148 Bacteria 3049
711 Ga0500590_125280 3300053148 Bacteria 1197
712 Ga0500603_000630 3300053150 Bacteria 8688
713 Ga0500604_0002744 3300053151 Bacteria 4784
714 Ga0500616_0000022 3300053153 Bacteria 460463
715 Ga0500616_0000244 3300053153 Bacteria 85079
716 Ga0500622_0000953 3300053156 Bacteria 24595
717 Ga0500630_152704 3300053159 Bacteria 976
718 Ga0500633_0061126 3300053160 Bacteria 1325
719 Ga0500634_0011130 3300053161 Bacteria 4627
720 Ga0500638_000160 3300053162 Bacteria 13163
721 Ga0500638_025570 3300053162 Bacteria 2823
722 Ga0500639_026342 3300053163 Bacteria 3072
723 Ga0500639_184390 3300053163 Bacteria 918
724 Ga0500636_0004749 3300053177 Bacteria 7704
725 Ga0500637_0000180 3300053178 Bacteria 23612
726 Ga0500637_0026584 3300053178 Bacteria 3189
727 Ga0500637_0117530 3300053178 Bacteria 1542
728 Ga0500637_0132267 3300053178 Bacteria 1446
729 Ga0500567_062807 3300053723 Bacteria 1657
730 Ga0500645_043501 3300053730 Bacteria 1323
731 Ga0500552_018595 3300053733 Bacteria 965
732 Ga0500596_001070 3300053735 Bacteria 5519
733 Ga0501084_0132762 3300054114 Bacteria 2096
734 Ga0587093_015825 3300059478 Bacteria 956
735 Ga0587066_033408 3300059490 Bacteria 930
736 Ga0587077_039774 3300059493 Bacteria 939
737 Ga0587080_027782 3300059503 Bacteria 968
738 Ga0587082_026592 3300059504 Bacteria 980
739 Ga0587083_0049948 3300059505 Bacteria 908
740 Ga0587083_0053841 3300059505 Bacteria 886
741 Ga0587085_024953 3300059506 Bacteria 942
742 Ga0587088_035480 3300059508 Bacteria 914
743 Ga0587091_038584 3300059511 Bacteria 932
744 Ga0587106_015136 3300059605 Bacteria 1073
745 Ga0587125_010223 3300059607 Bacteria 965
746 Ga0587101_022396 3300059623 Bacteria 921
747 Ga0587113_008368 3300059625 Bacteria 918
748 Ga0587115_019465 3300059626 Bacteria 934
749 Ga0587117_019089 3300059627 Bacteria 939
750 Ga0587130_008774 3300059631 Bacteria 964
751 Ga0587062_019188 3300059639 Bacteria 952
752 Ga0587062_020778 3300059639 Bacteria 929
753 Ga0587069_016120 3300059642 Bacteria 1064
754 Ga0587069_030050 3300059642 Bacteria 873
755 Ga0587079_034016 3300059647 Bacteria 995
756 Ga0587108_006445 3300059653 Bacteria 909
757 Ga0501082_0553466 3300060353 Bacteria 1006
758 Ga0530510_0031863 3300061734 Bacteria 3791

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046642 Ga0495634_0320167 Ga0495634_0320167_10_741 176
2 3300049589 Ga0501073_0024476 Ga0501073_0024476_3426_4256 177
3 3300009093 Ga0105240_10007949 Ga0105240_1000794915 181
4 3300009545 Ga0105237_10014927 Ga0105237_100149272 181
5 3300035170 Ga0373943_0035254 Ga0373943_0035254_1597_2325 181
6 3300035692 Ga0373935_0398511 Ga0373935_0398511_88_924 181
7 3300046459 Ga0495629_0004806 Ga0495629_0004806_2591_3427 181
8 3300046462 Ga0495651_0343390 Ga0495651_0343390_62_898 181
9 3300046463 Ga0495653_0215187 Ga0495653_0215187_69_905 181
10 3300046557 Ga0495622_0007496 Ga0495622_0007496_1472_2308 181
11 3300046663 Ga0495635_0003646 Ga0495635_0003646_6734_7570 181
12 3300047317 Ga0495604_0020841 Ga0495604_0020841_1264_2100 181
13 3300047321 Ga0495676_0475670 Ga0495676_0475670_73_801 181
14 3300047673 Ga0495593_0013800 Ga0495593_0013800_2755_3591 181
15 3300048089 Ga0495614_0038654 Ga0495614_0038654_805_1641 181
16 3300048907 Ga0496104_0006887 Ga0496104_0006887_6772_7596 181
17 3300048908 Ga0496105_0018687 Ga0496105_0018687_1363_2187 181
18 3300048921 Ga0496118_0149541 Ga0496118_0149541_483_1319 181
19 3300048923 Ga0496120_0008022 Ga0496120_0008022_408_1232 181
20 3300048928 Ga0496125_0006645 Ga0496125_0006645_6459_7337 181
21 3300048928 Ga0496125_0026599 Ga0496125_0026599_544_1380 181
22 3300048929 Ga0496126_0074215 Ga0496126_0074215_1648_2484 181
23 3300049571 Ga0501034_0063989 Ga0501034_0063989_1968_2786 181
24 3300053119 Ga0500595_077621 Ga0500595_077621_99_935 181
25 3300053136 Ga0500559_0019096 Ga0500559_0019096_431_1267 181
26 3300046506 Ga0495583_0081903 Ga0495583_0081903_138_974 183
27 3300046507 Ga0495606_0034430 Ga0495606_0034430_808_1644 183
28 3300046524 Ga0495648_0052615 Ga0495648_0052615_1268_2104 183
29 3300046529 Ga0495652_0031563 Ga0495652_0031563_1539_2375 183
30 3300046660 Ga0495625_0218111 Ga0495625_0218111_280_1116 183
31 3300044765 Ga0466970_0171981 Ga0466970_0171981_111_881 185
32 3300005335 Ga0070666_10143604 Ga0070666_101436042 186
33 3300009177 Ga0105248_10013528 Ga0105248_100135282 186
34 3300025903 Ga0207680_10126573 Ga0207680_101265732 186
35 3300046454 Ga0495592_0026073 Ga0495592_0026073_2222_3058 186
36 3300046477 Ga0495664_0002994 Ga0495664_0002994_1646_2482 186
37 3300046543 Ga0495645_0044984 Ga0495645_0044984_178_1014 186
38 3300046559 Ga0495667_0025221 Ga0495667_0025221_1880_2716 186
39 3300046675 Ga0495657_0002636 Ga0495657_0002636_6675_7511 186
40 3300046809 Ga0495600_0126739 Ga0495600_0126739_530_1366 186
41 3300047322 Ga0495680_0000836 Ga0495680_0000836_11288_12124 186
42 3300047444 Ga0495675_0036875 Ga0495675_0036875_1811_2647 186
43 3300047471 Ga0495684_0018978 Ga0495684_0018978_1381_2217 186
44 3300049133 Ga0501344_01846 Ga0501344_01846_15_626 186
45 3300049823 Ga0501044_0973984 Ga0501044_0973984_14_646 186
46 3300050492 nmdc:mga0yw44_13126_c1 nmdc:mga0yw44_13126_c1_3631_4329 186
47 3300053153 Ga0500616_0000244 Ga0500616_0000244_59924_60739 186
48 3300053160 Ga0500633_0061126 Ga0500633_0061126_608_1306 186
49 3300049572 Ga0501036_0112469 Ga0501036_0112469_407_1297 188
50 3300005563 Ga0068855_100240999 Ga0068855_1002409992 190
51 3300009553 Ga0105249_10386249 Ga0105249_103862492 190
52 3300020081 Ga0206354_10001066 Ga0206354_100010661 190
53 3300046522 Ga0495643_0007651 Ga0495643_0007651_1465_2316 190
54 3300048905 Ga0496102_0457189 Ga0496102_0457189_218_1069 190
55 3300048906 Ga0496103_0016321 Ga0496103_0016321_318_1169 190
56 3300048922 Ga0496119_0140410 Ga0496119_0140410_18_695 190
57 3300048928 Ga0496125_0000869 Ga0496125_0000869_28201_29037 190
58 3300048929 Ga0496126_0036323 Ga0496126_0036323_3336_4172 190
59 3300005366 Ga0070659_100084996 Ga0070659_1000849964 191
60 3300005563 Ga0068855_100046913 Ga0068855_1000469134 191
61 3300005983 Ga0081540_1040622 Ga0081540_10406222 191
62 3300009093 Ga0105240_10470262 Ga0105240_104702622 191
63 3300013105 Ga0157369_10223644 Ga0157369_102236442 191
64 3300014497 Ga0182008_10237463 Ga0182008_102374631 191
65 3300025949 Ga0207667_10482417 Ga0207667_104824172 191
66 3300026142 Ga0207698_10089767 Ga0207698_100897674 191
67 3300048915 Ga0496112_0146271 Ga0496112_0146271_280_1071 191
68 3300003203 JGI25406J46586_10045046 JGI25406J46586_100450462 192
69 3300005981 Ga0081538_10032665 Ga0081538_100326652 192
70 3300005985 Ga0081539_10000371 Ga0081539_1000037129 192
71 3300046475 Ga0495639_0020710 Ga0495639_0020710_1994_2785 192
72 3300046533 Ga0495640_0012908 Ga0495640_0012908_1626_2453 192
73 3300005937 Ga0081455_10029499 Ga0081455_100294992 193
74 3300013296 Ga0157374_10154653 Ga0157374_101546532 193
75 3300046455 Ga0495603_0007385 Ga0495603_0007385_4854_5645 193
76 3300048903 Ga0496100_0045464 Ga0496100_0045464_670_1461 193
77 3300048913 Ga0496110_0017143 Ga0496110_0017143_4338_5129 193
78 3300048914 Ga0496111_0015674 Ga0496111_0015674_3780_4571 193
79 3300048915 Ga0496112_0215534 Ga0496112_0215534_465_1256 193
80 3300048918 Ga0496115_0003360 Ga0496115_0003360_1439_2230 193
81 3300059490 Ga0587066_033408 Ga0587066_033408_19_810 193
82 3300006051 Ga0075364_10289396 Ga0075364_102893961 195
83 3300039062 Ga0400483_031226 Ga0400483_031226_1264_1995 195
84 3300039453 Ga0436362_0963821 Ga0436362_0963821_869_1522 195
85 3300044735 Ga0466968_0081500 Ga0466968_0081500_152_922 195
86 3300025915 Ga0207693_10107617 Ga0207693_101076172 196
87 3300005434 Ga0070709_10019171 Ga0070709_100191712 197
88 3300005436 Ga0070713_100079741 Ga0070713_1000797413 197
89 3300005437 Ga0070710_10020812 Ga0070710_100208122 197
90 3300025913 Ga0207695_10139657 Ga0207695_101396572 197
91 3300025916 Ga0207663_10098371 Ga0207663_100983713 197
92 3300035724 Ga0373933_0133166 Ga0373933_0133166_255_1046 197
93 3300037068 Ga0373925_0137215 Ga0373925_0137215_148_984 197
94 3300039450 Ga0436363_0292864 Ga0436363_0292864_13_726 197
95 3300039450 Ga0436363_1571051 Ga0436363_1571051_32_745 197
96 3300059504 Ga0587082_026592 Ga0587082_026592_171_962 197
97 3300059639 Ga0587062_019188 Ga0587062_019188_11_802 197
98 3300006038 Ga0075365_10145024 Ga0075365_101450241 200
99 3300035692 Ga0373935_0036686 Ga0373935_0036686_2055_2882 200
100 3300049577 Ga0501041_0022265 Ga0501041_0022265_110_901 200
101 3300050492 nmdc:mga0yw44_171654_c1 nmdc:mga0yw44_171654_c1_231_1019 200
102 3300053139 Ga0500568_0050342 Ga0500568_0050342_600_1415 200
103 3300005347 Ga0070668_100084817 Ga0070668_1000848172 201
104 3300005353 Ga0070669_100023783 Ga0070669_1000237835 201
105 3300005355 Ga0070671_100000542 Ga0070671_1000005427 201
106 3300005367 Ga0070667_100035887 Ga0070667_1000358875 201
107 3300005548 Ga0070665_100001356 Ga0070665_10000135614 201
108 3300005841 Ga0068863_100150925 Ga0068863_1001509252 201
109 3300005842 Ga0068858_100039033 Ga0068858_1000390333 201
110 3300005844 Ga0068862_100034179 Ga0068862_1000341795 201
111 3300009011 Ga0105251_10001526 Ga0105251_100015264 201
112 3300009101 Ga0105247_10237703 Ga0105247_102377031 201
113 3300025735 Ga0207713_1002460 Ga0207713_10024609 201
114 3300025900 Ga0207710_10105055 Ga0207710_101050552 201
115 3300025923 Ga0207681_10000503 Ga0207681_100005038 201
116 3300025931 Ga0207644_10001520 Ga0207644_100015205 201
117 3300025941 Ga0207711_10002363 Ga0207711_1000236316 201
118 3300025972 Ga0207668_10003815 Ga0207668_100038152 201
119 3300025986 Ga0207658_10197038 Ga0207658_101970382 201
120 3300026035 Ga0207703_10339404 Ga0207703_103394042 201
121 3300028379 Ga0268266_10000534 Ga0268266_1000053414 201
122 3300028380 Ga0268265_10125312 Ga0268265_101253123 201
123 3300048906 Ga0496103_0387068 Ga0496103_0387068_85_825 201
124 3300048920 Ga0496117_0051814 Ga0496117_0051814_1985_2725 201
125 3300048921 Ga0496118_0010865 Ga0496118_0010865_5495_6235 201
126 3300048923 Ga0496120_0021337 Ga0496120_0021337_3252_3992 201
127 3300048924 Ga0496121_0017520 Ga0496121_0017520_6521_7261 201
128 3300048926 Ga0496123_0054650 Ga0496123_0054650_956_1696 201
129 3300048927 Ga0496124_0051368 Ga0496124_0051368_646_1386 201
130 3300048928 Ga0496125_0066354 Ga0496125_0066354_1984_2724 201
131 3300048929 Ga0496126_0055197 Ga0496126_0055197_754_1494 201
132 3300049568 Ga0501031_0002390 Ga0501031_0002390_4993_5784 201
133 3300049569 Ga0501032_0001465 Ga0501032_0001465_7296_8087 201
134 3300049570 Ga0501033_0000221 Ga0501033_0000221_50485_51276 201
135 3300049572 Ga0501036_0149151 Ga0501036_0149151_583_1374 201
136 3300049573 Ga0501037_0000211 Ga0501037_0000211_49522_50313 201
137 3300049574 Ga0501038_0117785 Ga0501038_0117785_956_1747 201
138 3300049575 Ga0501039_0004618 Ga0501039_0004618_4975_5766 201
139 3300049575 Ga0501039_0073196 Ga0501039_0073196_510_1301 201
140 3300049579 Ga0501043_0002234 Ga0501043_0002234_6213_7004 201
141 3300049580 Ga0501046_0097963 Ga0501046_0097963_351_1142 201
142 3300049584 Ga0501068_0097814 Ga0501068_0097814_883_1674 201
143 3300049822 Ga0501035_0003613 Ga0501035_0003613_10432_11223 201
144 3300049823 Ga0501044_0030992 Ga0501044_0030992_2008_2799 201
145 3300050493 nmdc:mga0k408_61581_c1 nmdc:mga0k408_61581_c1_171_911 201
146 3300005455 Ga0070663_100001941 Ga0070663_10000194110 202
147 3300005985 Ga0081539_10075608 Ga0081539_100756082 202
148 3300006038 Ga0075365_10006761 Ga0075365_100067615 202
149 3300006038 Ga0075365_10087096 Ga0075365_100870961 202
150 3300006051 Ga0075364_10165743 Ga0075364_101657431 202
151 3300006177 Ga0075362_10068248 Ga0075362_100682482 202
152 3300006186 Ga0075369_10009920 Ga0075369_100099202 202
153 3300006186 Ga0075369_10049655 Ga0075369_100496551 202
154 3300006353 Ga0075370_10184506 Ga0075370_101845062 202
155 3300006946 Ga0079104_1041320 Ga0079104_10413202 202
156 3300025295 Ga0209564_1010723 Ga0209564_10107233 202
157 3300026067 Ga0207678_10237780 Ga0207678_102377801 202
158 3300027512 Ga0209179_1015611 Ga0209179_10156112 202
159 3300028379 Ga0268266_10465051 Ga0268266_104650512 202
160 3300028380 Ga0268265_10853020 Ga0268265_108530201 202
161 3300031238 Ga0265332_10079800 Ga0265332_100798002 202
162 3300031711 Ga0265314_10188651 Ga0265314_101886511 202
163 3300046460 Ga0495638_0017844 Ga0495638_0017844_601_1389 202
164 3300046460 Ga0495638_0034495 Ga0495638_0034495_2369_3112 202
165 3300046512 Ga0495610_0027759 Ga0495610_0027759_1344_2132 202
166 3300046513 Ga0495616_0056120 Ga0495616_0056120_716_1504 202
167 3300046542 Ga0495597_0042608 Ga0495597_0042608_934_1722 202
168 3300046557 Ga0495622_0022209 Ga0495622_0022209_392_1180 202
169 3300046665 Ga0495661_0033443 Ga0495661_0033443_240_1028 202
170 3300046674 Ga0495588_0044719 Ga0495588_0044719_917_1705 202
171 3300047320 Ga0495672_0219222 Ga0495672_0219222_16_804 202
172 3300048088 Ga0495602_0360503 Ga0495602_0360503_90_878 202
173 3300048091 Ga0495626_0013148 Ga0495626_0013148_195_983 202
174 3300048903 Ga0496100_0427594 Ga0496100_0427594_81_869 202
175 3300048919 Ga0496116_0001930 Ga0496116_0001930_12814_13602 202
176 3300048921 Ga0496118_0020331 Ga0496118_0020331_3671_4459 202
177 3300048924 Ga0496121_0024640 Ga0496121_0024640_3127_3915 202
178 3300048927 Ga0496124_0046080 Ga0496124_0046080_1338_2126 202
179 3300048928 Ga0496125_0018462 Ga0496125_0018462_4646_5434 202
180 3300048928 Ga0496125_0108616 Ga0496125_0108616_1190_1978 202
181 3300049459 Ga0495678_080423 Ga0495678_080423_168_956 202
182 3300049823 Ga0501044_0006548 Ga0501044_0006548_6998_7741 202
183 3300049823 Ga0501044_0101594 Ga0501044_0101594_506_1291 202
184 3300050489 nmdc:mga03683_58931_c1 nmdc:mga03683_58931_c1_284_1027 202
185 3300050491 nmdc:mga00v17_16675_c2 nmdc:mga00v17_16675_c2_534_1277 202
186 3300050491 nmdc:mga00v17_84585_c1 nmdc:mga00v17_84585_c1_211_999 202
187 3300050492 nmdc:mga0yw44_63079_c1 nmdc:mga0yw44_63079_c1_958_1746 202
188 3300050494 nmdc:mga06z11_58021_c1 nmdc:mga06z11_58021_c1_408_1196 202
189 3300050496 nmdc:mga07m45_316726_c1 nmdc:mga07m45_316726_c1_129_872 202
190 3300050516 nmdc:mga0sz30_47631_c1 nmdc:mga0sz30_47631_c1_220_963 202
191 3300050516 nmdc:mga0sz30_6347_c1 nmdc:mga0sz30_6347_c1_2648_3436 202
192 3300053087 Ga0500643_032856 Ga0500643_032856_712_1530 202
193 3300053089 Ga0500581_049278 Ga0500581_049278_1082_1870 202
194 3300053094 Ga0500566_0000055 Ga0500566_0000055_45394_46182 202
195 3300053096 Ga0500641_0001366 Ga0500641_0001366_7653_8441 202
196 3300053098 Ga0500650_0000245 Ga0500650_0000245_213_1001 202
197 3300053104 Ga0500556_0000006 Ga0500556_0000006_224044_224832 202
198 3300053109 Ga0500569_002880 Ga0500569_002880_1588_2376 202
199 3300053122 Ga0500608_000604 Ga0500608_000604_5520_6308 202
200 3300053130 Ga0500642_0000004 Ga0500642_0000004_258437_259225 202
201 3300053131 Ga0500652_000294 Ga0500652_000294_10057_10845 202
202 3300053134 Ga0500658_0028806 Ga0500658_0028806_969_1757 202
203 3300053136 Ga0500559_0000362 Ga0500559_0000362_30573_31361 202
204 3300053139 Ga0500568_0001522 Ga0500568_0001522_5132_5920 202
205 3300053148 Ga0500590_125280 Ga0500590_125280_358_1146 202
206 3300053151 Ga0500604_0002744 Ga0500604_0002744_1012_1800 202
207 3300053153 Ga0500616_0000022 Ga0500616_0000022_222452_223240 202
208 3300053156 Ga0500622_0000953 Ga0500622_0000953_13715_14503 202
209 3300053177 Ga0500636_0004749 Ga0500636_0004749_5766_6554 202
210 3300053178 Ga0500637_0026584 Ga0500637_0026584_841_1629 202
211 3300060353 Ga0501082_0553466 Ga0501082_0553466_167_910 202
212 3300005530 Ga0070679_100103273 Ga0070679_1001032732 203
213 3300005544 Ga0070686_100303674 Ga0070686_1003036741 203
214 3300025912 Ga0207707_10299982 Ga0207707_102999821 203
215 3300025939 Ga0207665_10113232 Ga0207665_101132322 203
216 3300049571 Ga0501034_0387516 Ga0501034_0387516_316_1230 203
217 3300049573 Ga0501037_0199519 Ga0501037_0199519_32_856 203
218 3300049578 Ga0501042_0102050 Ga0501042_0102050_59_883 203
219 3300049587 Ga0501071_0012141 Ga0501071_0012141_2987_3811 203
220 3300049588 Ga0501072_0004379 Ga0501072_0004379_2890_3714 203
221 3300049591 Ga0501075_0027955 Ga0501075_0027955_790_1614 203
222 3300049593 Ga0501077_0037268 Ga0501077_0037268_1128_1952 203
223 3300049743 Ga0501081_0324216 Ga0501081_0324216_291_1115 203
224 3300049824 Ga0501045_0081117 Ga0501045_0081117_21_845 203
225 3300054114 Ga0501084_0132762 Ga0501084_0132762_975_1799 203
226 3300061734 Ga0530510_0031863 Ga0530510_0031863_1959_2783 203
227 3300037312 Ga0395899_0046650 Ga0395899_0046650_1213_2004 204
228 3300037466 Ga0395898_0033290 Ga0395898_0033290_3322_4113 204
229 3300037853 Ga0436364_1337275 Ga0436364_1337275_2611_3402 204
230 3300039437 Ga0436365_1359706 Ga0436365_1359706_764_1555 204
231 3300046455 Ga0495603_0298947 Ga0495603_0298947_24_815 204
232 3300005329 Ga0070683_100009865 Ga0070683_1000098653 205
233 3300005336 Ga0070680_100036908 Ga0070680_1000369082 205
234 3300005336 Ga0070680_100574888 Ga0070680_1005748881 205
235 3300005436 Ga0070713_100025592 Ga0070713_1000255925 205
236 3300005458 Ga0070681_10001077 Ga0070681_1000107720 205
237 3300005458 Ga0070681_10132401 Ga0070681_101324012 205
238 3300005530 Ga0070679_100005644 Ga0070679_1000056449 205
239 3300005530 Ga0070679_100028700 Ga0070679_1000287004 205
240 3300005530 Ga0070679_100097238 Ga0070679_1000972382 205
241 3300005535 Ga0070684_100008528 Ga0070684_1000085285 205
242 3300005535 Ga0070684_100133161 Ga0070684_1001331612 205
243 3300005547 Ga0070693_100089949 Ga0070693_1000899492 205
244 3300006028 Ga0070717_10003277 Ga0070717_100032776 205
245 3300009093 Ga0105240_10093949 Ga0105240_100939493 205
246 3300009551 Ga0105238_10021262 Ga0105238_100212624 205
247 3300010375 Ga0105239_10053677 Ga0105239_100536772 205
248 3300013296 Ga0157374_10080278 Ga0157374_100802783 205
249 3300020069 Ga0197907_11428149 Ga0197907_114281491 205
250 3300020076 Ga0206355_1140956 Ga0206355_11409561 205
251 3300020078 Ga0206352_11297536 Ga0206352_112975361 205
252 3300025297 Ga0209758_1001900 Ga0209758_10019005 205
253 3300025912 Ga0207707_10001830 Ga0207707_100018305 205
254 3300025912 Ga0207707_10028688 Ga0207707_100286885 205
255 3300025917 Ga0207660_10413582 Ga0207660_104135821 205
256 3300025917 Ga0207660_10488399 Ga0207660_104883991 205
257 3300025921 Ga0207652_10005820 Ga0207652_100058202 205
258 3300025921 Ga0207652_10315488 Ga0207652_103154882 205
259 3300025924 Ga0207694_10023665 Ga0207694_100236654 205
260 3300025944 Ga0207661_10000878 Ga0207661_100008783 205
261 3300025944 Ga0207661_10092182 Ga0207661_100921822 205
262 3300026078 Ga0207702_10567464 Ga0207702_105674641 205
263 3300037068 Ga0373925_0161821 Ga0373925_0161821_55_846 205
264 3300037418 Ga0395900_0005138 Ga0395900_0005138_12718_13605 205
265 3300037466 Ga0395898_0035036 Ga0395898_0035036_649_1440 205
266 3300037466 Ga0395898_0041886 Ga0395898_0041886_3676_4467 205
267 3300038443 Ga0395901_0240173 Ga0395901_0240173_1080_1871 205
268 3300044656 Ga0466969_0044243 Ga0466969_0044243_1197_1988 205
269 3300044658 Ga0466972_0000299 Ga0466972_0000299_21576_22367 205
270 3300044658 Ga0466972_0052825 Ga0466972_0052825_95_886 205
271 3300044684 Ga0466966_0002843 Ga0466966_0002843_6523_7314 205
272 3300044693 Ga0466961_0002447 Ga0466961_0002447_60_851 205
273 3300044693 Ga0466961_0141153 Ga0466961_0141153_585_1421 205
274 3300044694 Ga0466963_0095903 Ga0466963_0095903_754_1545 205
275 3300044735 Ga0466968_0002351 Ga0466968_0002351_1013_1804 205
276 3300044901 Ga0466960_0097824 Ga0466960_0097824_477_1268 205
277 3300045976 Ga0466967_0070195 Ga0466967_0070195_291_1082 205
278 3300046515 Ga0495620_0040172 Ga0495620_0040172_539_1330 205
279 3300046543 Ga0495645_0015358 Ga0495645_0015358_3985_4776 205
280 3300048913 Ga0496110_0138630 Ga0496110_0138630_128_919 205
281 3300048918 Ga0496115_0044258 Ga0496115_0044258_1241_2032 205
282 3300048929 Ga0496126_0064657 Ga0496126_0064657_1194_1985 205
283 3300049570 Ga0501033_0014226 Ga0501033_0014226_777_1598 205
284 3300049574 Ga0501038_0214098 Ga0501038_0214098_355_1176 205
285 3300049580 Ga0501046_0179534 Ga0501046_0179534_692_1513 205
286 3300049581 Ga0501047_0036900 Ga0501047_0036900_1878_2699 205
287 3300049582 Ga0501048_0070529 Ga0501048_0070529_1636_2457 205
288 3300049586 Ga0501070_0067905 Ga0501070_0067905_240_1061 205
289 3300049742 Ga0501080_0113318 Ga0501080_0113318_1394_2215 205
290 3300049822 Ga0501035_0040812 Ga0501035_0040812_1512_2333 205
291 3300049823 Ga0501044_0504743 Ga0501044_0504743_171_992 205
292 3300053094 Ga0500566_0003437 Ga0500566_0003437_2238_3029 205
293 3300053115 Ga0500591_020057 Ga0500591_020057_2057_2848 205
294 3300053122 Ga0500608_027696 Ga0500608_027696_1302_2093 205
295 3300053145 Ga0500586_017738 Ga0500586_017738_1240_2028 205
296 3300053148 Ga0500590_025848 Ga0500590_025848_1375_2166 205
297 3300053159 Ga0500630_152704 Ga0500630_152704_45_836 205
298 3300053163 Ga0500639_026342 Ga0500639_026342_2148_2939 205
299 3300053178 Ga0500637_0132267 Ga0500637_0132267_642_1433 205
300 3300053723 Ga0500567_062807 Ga0500567_062807_123_911 205
301 3300053735 Ga0500596_001070 Ga0500596_001070_2264_3055 205
302 3300059607 Ga0587125_010223 Ga0587125_010223_19_810 205
303 3300059626 Ga0587115_019465 Ga0587115_019465_16_807 205
304 3300059627 Ga0587117_019089 Ga0587117_019089_21_860 205
305 3300059639 Ga0587062_020778 Ga0587062_020778_20_856 205
306 iso_pu_bacteria 2884298095 2884298507 205
307 3300003214 JGI25165J46597_1009200 JGI25165J46597_10092002 206
308 3300005334 Ga0068869_100064257 Ga0068869_1000642572 206
309 3300005341 Ga0070691_10048168 Ga0070691_100481682 206
310 3300005365 Ga0070688_100342197 Ga0070688_1003421972 206
311 3300005434 Ga0070709_10014869 Ga0070709_100148692 206
312 3300005434 Ga0070709_10044929 Ga0070709_100449294 206
313 3300005435 Ga0070714_100073568 Ga0070714_1000735682 206
314 3300005436 Ga0070713_100045297 Ga0070713_1000452971 206
315 3300005436 Ga0070713_100348883 Ga0070713_1003488832 206
316 3300005437 Ga0070710_10002858 Ga0070710_100028582 206
317 3300005455 Ga0070663_100060988 Ga0070663_1000609882 206
318 3300005459 Ga0068867_100176355 Ga0068867_1001763552 206
319 3300005547 Ga0070693_100059830 Ga0070693_1000598302 206
320 3300005577 Ga0068857_100166962 Ga0068857_1001669622 206
321 3300005617 Ga0068859_100093827 Ga0068859_1000938272 206
322 3300005840 Ga0068870_10164917 Ga0068870_101649171 206
323 3300005841 Ga0068863_100074583 Ga0068863_1000745832 206
324 3300006028 Ga0070717_10018898 Ga0070717_100188982 206
325 3300006028 Ga0070717_10053768 Ga0070717_100537682 206
326 3300006042 Ga0075368_10028408 Ga0075368_100284082 206
327 3300006051 Ga0075364_10110184 Ga0075364_101101842 206
328 3300006173 Ga0070716_100005454 Ga0070716_1000054542 206
329 3300006175 Ga0070712_100051297 Ga0070712_1000512973 206
330 3300006177 Ga0075362_10028375 Ga0075362_100283752 206
331 3300006353 Ga0075370_10136094 Ga0075370_101360941 206
332 3300006931 Ga0097620_100093827 Ga0097620_1000938273 206
333 3300009101 Ga0105247_10362207 Ga0105247_103622071 206
334 3300020069 Ga0197907_10122096 Ga0197907_101220961 206
335 3300020070 Ga0206356_11227967 Ga0206356_112279672 206
336 3300020075 Ga0206349_1112773 Ga0206349_11127732 206
337 3300020077 Ga0206351_10137541 Ga0206351_101375411 206
338 3300020078 Ga0206352_10853849 Ga0206352_108538491 206
339 3300020078 Ga0206352_11018583 Ga0206352_110185831 206
340 3300020080 Ga0206350_10047531 Ga0206350_100475311 206
341 3300020081 Ga0206354_10892454 Ga0206354_108924541 206
342 3300020081 Ga0206354_11650149 Ga0206354_116501491 206
343 3300020082 Ga0206353_11260487 Ga0206353_112604871 206
344 3300022467 Ga0224712_10139243 Ga0224712_101392431 206
345 3300022467 Ga0224712_10186241 Ga0224712_101862411 206
346 3300025253 Ga0209677_100170 Ga0209677_1001705 206
347 3300025261 Ga0209233_1012365 Ga0209233_10123653 206
348 3300025272 Ga0209455_1007613 Ga0209455_10076132 206
349 3300025898 Ga0207692_10006838 Ga0207692_100068384 206
350 3300025906 Ga0207699_10169105 Ga0207699_101691052 206
351 3300025914 Ga0207671_10099663 Ga0207671_100996632 206
352 3300025915 Ga0207693_10003895 Ga0207693_100038959 206
353 3300025915 Ga0207693_10004610 Ga0207693_100046109 206
354 3300025916 Ga0207663_10054053 Ga0207663_100540532 206
355 3300025927 Ga0207687_10404930 Ga0207687_104049301 206
356 3300025929 Ga0207664_10429104 Ga0207664_104291041 206
357 3300025929 Ga0207664_10501200 Ga0207664_105012002 206
358 3300025939 Ga0207665_10006607 Ga0207665_100066076 206
359 3300025941 Ga0207711_10567891 Ga0207711_105678911 206
360 3300025949 Ga0207667_10152080 Ga0207667_101520802 206
361 3300026067 Ga0207678_10149983 Ga0207678_101499832 206
362 3300028379 Ga0268266_10009681 Ga0268266_100096815 206
363 3300028381 Ga0268264_10000062 Ga0268264_10000062254 206
364 3300030521 Ga0307511_10085070 Ga0307511_100850701 206
365 3300030521 Ga0307511_10114742 Ga0307511_101147422 206
366 3300030763 Ga0265763_1004318 Ga0265763_10043181 206
367 3300030882 Ga0265764_102331 Ga0265764_1023311 206
368 3300031247 Ga0265340_10012805 Ga0265340_100128054 206
369 3300031247 Ga0265340_10097790 Ga0265340_100977901 206
370 3300031249 Ga0265339_10001952 Ga0265339_100019524 206
371 3300031616 Ga0307508_10105800 Ga0307508_101058002 206
372 3300031711 Ga0265314_10087483 Ga0265314_100874832 206
373 3300031730 Ga0307516_10181291 Ga0307516_101812912 206
374 3300033179 Ga0307507_10061770 Ga0307507_100617702 206
375 3300033180 Ga0307510_10024915 Ga0307510_100249151 206
376 3300033544 Ga0316215_1000881 Ga0316215_10008812 206
377 3300035170 Ga0373943_0045855 Ga0373943_0045855_608_1399 206
378 3300035695 Ga0373927_0005757 Ga0373927_0005757_3795_4586 206
379 3300035724 Ga0373933_0000218 Ga0373933_0000218_2337_3128 206
380 3300036458 Ga0310112_018378 Ga0310112_018378_87_878 206
381 3300036534 Ga0310109_018809 Ga0310109_018809_113_904 206
382 3300037068 Ga0373925_0004991 Ga0373925_0004991_835_1626 206
383 3300037418 Ga0395900_0013190 Ga0395900_0013190_528_1319 206
384 3300037418 Ga0395900_0757346 Ga0395900_0757346_42_833 206
385 3300037853 Ga0436364_0904449 Ga0436364_0904449_81_779 206
386 3300038443 Ga0395901_0810645 Ga0395901_0810645_31_822 206
387 3300038443 Ga0395901_1012062 Ga0395901_1012062_12_746 206
388 3300039437 Ga0436365_1063208 Ga0436365_1063208_286_984 206
389 3300039437 Ga0436365_1369925 Ga0436365_1369925_4577_5368 206
390 3300039438 Ga0436360_0832565 Ga0436360_0832565_2747_3445 206
391 3300039447 Ga0436361_0379028 Ga0436361_0379028_1661_2455 206
392 3300039447 Ga0436361_0987636 Ga0436361_0987636_3419_4213 206
393 3300039450 Ga0436363_0436908 Ga0436363_0436908_292_1083 206
394 3300039450 Ga0436363_0451258 Ga0436363_0451258_75_773 206
395 3300044684 Ga0466966_0081395 Ga0466966_0081395_1177_1968 206
396 3300044694 Ga0466963_0237919 Ga0466963_0237919_229_1020 206
397 3300044706 Ga0466964_0092544 Ga0466964_0092544_268_1059 206
398 3300045836 Ga0466958_0145600 Ga0466958_0145600_407_1198 206
399 3300045976 Ga0466967_0115827 Ga0466967_0115827_1258_2049 206
400 3300046476 Ga0495662_0197010 Ga0495662_0197010_99_890 206
401 3300046491 Ga0495584_0078381 Ga0495584_0078381_664_1455 206
402 3300046491 Ga0495584_0115366 Ga0495584_0115366_463_1254 206
403 3300046542 Ga0495597_0134503 Ga0495597_0134503_60_851 206
404 3300046543 Ga0495645_0162030 Ga0495645_0162030_695_1486 206
405 3300048909 Ga0496106_0003643 Ga0496106_0003643_8305_9096 206
406 3300048910 Ga0496107_0046717 Ga0496107_0046717_2145_2936 206
407 3300048911 Ga0496108_0238859 Ga0496108_0238859_188_979 206
408 3300048920 Ga0496117_0012405 Ga0496117_0012405_4774_5565 206
409 3300048920 Ga0496117_0219744 Ga0496117_0219744_235_1026 206
410 3300048921 Ga0496118_0060316 Ga0496118_0060316_43_834 206
411 3300048924 Ga0496121_0000811 Ga0496121_0000811_5813_6604 206
412 3300048924 Ga0496121_0000870 Ga0496121_0000870_15797_16588 206
413 3300048927 Ga0496124_0002001 Ga0496124_0002001_11317_12108 206
414 3300048928 Ga0496125_0015348 Ga0496125_0015348_2089_2880 206
415 3300048928 Ga0496125_0212982 Ga0496125_0212982_449_1240 206
416 3300048928 Ga0496125_0322812 Ga0496125_0322812_103_894 206
417 3300048929 Ga0496126_0028135 Ga0496126_0028135_14_805 206
418 3300048929 Ga0496126_0145097 Ga0496126_0145097_157_948 206
419 3300048929 Ga0496126_0260193 Ga0496126_0260193_404_1195 206
420 3300048929 Ga0496126_0399814 Ga0496126_0399814_40_831 206
421 3300049459 Ga0495678_066654 Ga0495678_066654_184_975 206
422 3300050491 nmdc:mga00v17_95829_c1 nmdc:mga00v17_95829_c1_941_1732 206
423 3300050496 nmdc:mga07m45_97861_c1 nmdc:mga07m45_97861_c1_336_1127 206
424 3300050516 nmdc:mga0sz30_7031_c1 nmdc:mga0sz30_7031_c1_65_856 206
425 3300053078 Ga0495612_0101059 Ga0495612_0101059_163_954 206
426 3300053080 Ga0500635_0011112 Ga0500635_0011112_1382_2173 206
427 3300053084 Ga0495595_0150542 Ga0495595_0150542_49_747 206
428 3300053094 Ga0500566_0038668 Ga0500566_0038668_1359_2150 206
429 3300053150 Ga0500603_000630 Ga0500603_000630_6202_6993 206
430 3300053162 Ga0500638_025570 Ga0500638_025570_1393_2184 206
431 3300053178 Ga0500637_0117530 Ga0500637_0117530_408_1199 206
432 3300053733 Ga0500552_018595 Ga0500552_018595_55_846 206
433 3300059478 Ga0587093_015825 Ga0587093_015825_19_858 206
434 3300059493 Ga0587077_039774 Ga0587077_039774_126_917 206
435 3300059506 Ga0587085_024953 Ga0587085_024953_91_918 206
436 3300059605 Ga0587106_015136 Ga0587106_015136_191_988 206
437 3300059625 Ga0587113_008368 Ga0587113_008368_16_807 206
438 3300059642 Ga0587069_016120 Ga0587069_016120_37_831 206
439 3300005563 Ga0068855_100024520 Ga0068855_1000245202 207
440 3300005614 Ga0068856_100000883 Ga0068856_10000088325 207
441 3300006914 Ga0075436_100045387 Ga0075436_1000453872 207
442 3300009093 Ga0105240_10061018 Ga0105240_100610183 207
443 3300010159 Ga0099796_10016687 Ga0099796_100166872 207
444 3300013105 Ga0157369_10032756 Ga0157369_100327562 207
445 3300020070 Ga0206356_11019694 Ga0206356_110196941 207
446 3300020075 Ga0206349_1694165 Ga0206349_16941651 207
447 3300020075 Ga0206349_1878734 Ga0206349_18787342 207
448 3300020077 Ga0206351_10685837 Ga0206351_106858371 207
449 3300020077 Ga0206351_10853499 Ga0206351_108534992 207
450 3300020080 Ga0206350_10124601 Ga0206350_101246011 207
451 3300020080 Ga0206350_11301687 Ga0206350_113016871 207
452 3300020082 Ga0206353_11903621 Ga0206353_119036212 207
453 3300020610 Ga0154015_1265539 Ga0154015_12655391 207
454 3300020610 Ga0154015_1529450 Ga0154015_15294502 207
455 3300022467 Ga0224712_10119344 Ga0224712_101193442 207
456 3300022467 Ga0224712_10187736 Ga0224712_101877362 207
457 3300025921 Ga0207652_10394162 Ga0207652_103941621 207
458 3300026078 Ga0207702_10000318 Ga0207702_1000031824 207
459 3300026078 Ga0207702_10232747 Ga0207702_102327471 207
460 3300031616 Ga0307508_10147504 Ga0307508_101475041 207
461 3300037068 Ga0373925_0130723 Ga0373925_0130723_35_826 207
462 3300037418 Ga0395900_0187341 Ga0395900_0187341_1252_2043 207
463 3300037418 Ga0395900_0477755 Ga0395900_0477755_293_1087 207
464 3300037466 Ga0395898_0070416 Ga0395898_0070416_1906_2697 207
465 3300037466 Ga0395898_0105024 Ga0395898_0105024_697_1491 207
466 3300038443 Ga0395901_0154816 Ga0395901_0154816_263_1054 207
467 3300039437 Ga0436365_0457696 Ga0436365_0457696_112_903 207
468 3300039450 Ga0436363_1571660 Ga0436363_1571660_22_813 207
469 3300046457 Ga0495590_0075863 Ga0495590_0075863_61_852 207
470 3300046460 Ga0495638_0158860 Ga0495638_0158860_477_1268 207
471 3300046525 Ga0495663_0034611 Ga0495663_0034611_642_1433 207
472 3300046526 Ga0495666_0154266 Ga0495666_0154266_72_863 207
473 3300046539 Ga0495621_0065406 Ga0495621_0065406_452_1243 207
474 3300046615 Ga0495656_0054370 Ga0495656_0054370_729_1520 207
475 3300049569 Ga0501032_0111245 Ga0501032_0111245_41_832 207
476 3300049575 Ga0501039_0078518 Ga0501039_0078518_777_1568 207
477 3300049579 Ga0501043_0097788 Ga0501043_0097788_1095_1886 207
478 3300049581 Ga0501047_0170043 Ga0501047_0170043_385_1176 207
479 3300049822 Ga0501035_0160333 Ga0501035_0160333_189_980 207
480 3300049823 Ga0501044_0266664 Ga0501044_0266664_160_951 207
481 3300050514 nmdc:mga08x19_91753_c1 nmdc:mga08x19_91753_c1_619_1413 207
482 3300059503 Ga0587080_027782 Ga0587080_027782_145_936 207
483 3300059511 Ga0587091_038584 Ga0587091_038584_103_918 207
484 3300005331 Ga0070670_100359760 Ga0070670_1003597601 208
485 3300005437 Ga0070710_10412975 Ga0070710_104129751 208
486 3300005468 Ga0070707_100142842 Ga0070707_1001428423 208
487 3300005983 Ga0081540_1005811 Ga0081540_10058115 208
488 3300009553 Ga0105249_10379015 Ga0105249_103790152 208
489 3300013308 Ga0157375_10239363 Ga0157375_102393632 208
490 3300014968 Ga0157379_10530911 Ga0157379_105309112 208
491 3300021358 Ga0213873_10001008 Ga0213873_100010082 208
492 3300021384 Ga0213876_10003470 Ga0213876_100034702 208
493 3300021384 Ga0213876_10023883 Ga0213876_100238832 208
494 3300021388 Ga0213875_10027840 Ga0213875_100278402 208
495 3300025915 Ga0207693_10304145 Ga0207693_103041451 208
496 3300025972 Ga0207668_10846220 Ga0207668_108462201 208
497 3300031995 Ga0307409_100077156 Ga0307409_1000771564 208
498 3300035695 Ga0373927_0234532 Ga0373927_0234532_405_1151 208
499 3300037068 Ga0373925_0375173 Ga0373925_0375173_227_973 208
500 3300037471 Ga0395905_0259901 Ga0395905_0259901_301_1092 208
501 3300037853 Ga0436364_0281278 Ga0436364_0281278_30939_31685 208
502 3300037853 Ga0436364_0984338 Ga0436364_0984338_148_939 208
503 3300039437 Ga0436365_0261699 Ga0436365_0261699_1873_2619 208
504 3300039437 Ga0436365_0829696 Ga0436365_0829696_8867_9613 208
505 3300039437 Ga0436365_1436379 Ga0436365_1436379_112_858 208
506 3300039438 Ga0436360_0851954 Ga0436360_0851954_203_1033 208
507 3300039450 Ga0436363_0775146 Ga0436363_0775146_11135_11881 208
508 3300039450 Ga0436363_0802555 Ga0436363_0802555_1027_1821 208
509 3300039453 Ga0436362_1185069 Ga0436362_1185069_4541_5287 208
510 3300041453 Ga0451797_0777937 Ga0451797_0777937_60_851 208
511 3300044842 Ga0466957_0059708 Ga0466957_0059708_1328_2119 208
512 3300047470 Ga0495681_0038105 Ga0495681_0038105_965_1753 208
513 3300048907 Ga0496104_0058668 Ga0496104_0058668_33_764 208
514 3300048921 Ga0496118_0135418 Ga0496118_0135418_144_935 208
515 3300048929 Ga0496126_0217168 Ga0496126_0217168_563_1354 208
516 3300053161 Ga0500634_0011130 Ga0500634_0011130_2499_3287 208
517 3300059508 Ga0587088_035480 Ga0587088_035480_95_886 208
518 3300005353 Ga0070669_100523000 Ga0070669_1005230001 209
519 3300005548 Ga0070665_100331908 Ga0070665_1003319082 209
520 3300005843 Ga0068860_100261639 Ga0068860_1002616392 209
521 3300006881 Ga0068865_100140332 Ga0068865_1001403322 209
522 3300020080 Ga0206350_11138243 Ga0206350_111382431 209
523 3300025938 Ga0207704_10433479 Ga0207704_104334791 209
524 3300026035 Ga0207703_10302433 Ga0207703_103024332 209
525 3300026075 Ga0207708_10280685 Ga0207708_102806852 209
526 3300028380 Ga0268265_10065886 Ga0268265_100658861 209
527 3300028381 Ga0268264_10353623 Ga0268264_103536232 209
528 3300036401 Ga0373937_0101471 Ga0373937_0101471_362_1153 209
529 3300046615 Ga0495656_0028598 Ga0495656_0028598_140_931 209
530 3300048912 Ga0496109_0130510 Ga0496109_0130510_978_1781 209
531 3300048917 Ga0496114_0109828 Ga0496114_0109828_354_1157 209
532 3300048924 Ga0496121_0174913 Ga0496121_0174913_45_836 209
533 3300048927 Ga0496124_0099848 Ga0496124_0099848_403_1194 209
534 3300049822 Ga0501035_0144235 Ga0501035_0144235_440_1192 209
535 3300053102 Ga0500554_006966 Ga0500554_006966_1226_2017 210
536 3300053119 Ga0500595_001016 Ga0500595_001016_5185_5976 210
537 3300053162 Ga0500638_000160 Ga0500638_000160_7153_7944 210
538 3300053178 Ga0500637_0000180 Ga0500637_0000180_22042_22833 210
539 3300006195 Ga0075366_10118823 Ga0075366_101188232 211
540 3300006353 Ga0075370_10212095 Ga0075370_102120952 211
541 3300034818 Ga0373950_0017256 Ga0373950_0017256_15_713 211
542 3300050494 nmdc:mga06z11_85331_c1 nmdc:mga06z11_85331_c1_842_1633 211
543 3300050496 nmdc:mga07m45_135204_c1 nmdc:mga07m45_135204_c1_612_1403 211
544 3300053085 Ga0495619_0472753 Ga0495619_0472753_10_807 211
545 3300059631 Ga0587130_008774 Ga0587130_008774_16_870 211
546 3300059647 Ga0587079_034016 Ga0587079_034016_152_958 211
547 iso_pu_bacteria 8016583857 8016586158 211
548 3300003911 JGI25405J52794_10031793 JGI25405J52794_100317932 212
549 3300005364 Ga0070673_100212996 Ga0070673_1002129961 212
550 3300005518 Ga0070699_100168805 Ga0070699_1001688052 212
551 3300005543 Ga0070672_100256992 Ga0070672_1002569921 212
552 3300005545 Ga0070695_100045867 Ga0070695_1000458672 212
553 3300005548 Ga0070665_100182360 Ga0070665_1001823602 212
554 3300005618 Ga0068864_100085987 Ga0068864_1000859873 212
555 3300005842 Ga0068858_100478227 Ga0068858_1004782272 212
556 3300005844 Ga0068862_100238505 Ga0068862_1002385052 212
557 3300005937 Ga0081455_10025851 Ga0081455_100258515 212
558 3300005985 Ga0081539_10025876 Ga0081539_100258762 212
559 3300006353 Ga0075370_10107073 Ga0075370_101070732 212
560 3300010375 Ga0105239_10710672 Ga0105239_107106722 212
561 3300012500 Ga0157314_1005405 Ga0157314_10054051 212
562 3300013296 Ga0157374_10314643 Ga0157374_103146432 212
563 3300013306 Ga0163162_10055722 Ga0163162_100557223 212
564 3300014325 Ga0163163_10026240 Ga0163163_100262403 212
565 3300020070 Ga0206356_10841646 Ga0206356_108416462 212
566 3300020080 Ga0206350_10258629 Ga0206350_102586292 212
567 3300020082 Ga0206353_10006930 Ga0206353_100069302 212
568 3300022467 Ga0224712_10190267 Ga0224712_101902671 212
569 3300025901 Ga0207688_10086352 Ga0207688_100863521 212
570 3300025908 Ga0207643_10070154 Ga0207643_100701542 212
571 3300025919 Ga0207657_10268499 Ga0207657_102684992 212
572 3300025945 Ga0207679_10214993 Ga0207679_102149931 212
573 3300028379 Ga0268266_10001906 Ga0268266_1000190616 212
574 3300028379 Ga0268266_10394682 Ga0268266_103946822 212
575 3300028380 Ga0268265_10211107 Ga0268265_102111071 212
576 3300035172 Ga0373955_0148985 Ga0373955_0148985_102_896 212
577 3300035692 Ga0373935_0001267 Ga0373935_0001267_13026_13820 212
578 3300035695 Ga0373927_0000766 Ga0373927_0000766_22150_22944 212
579 3300035725 Ga0373947_0000310 Ga0373947_0000310_23710_24504 212
580 3300037068 Ga0373925_0002455 Ga0373925_0002455_5007_5801 212
581 3300046455 Ga0495603_0000801 Ga0495603_0000801_6047_6841 212
582 3300046459 Ga0495629_0007739 Ga0495629_0007739_4196_4990 212
583 3300046461 Ga0495641_0002198 Ga0495641_0002198_7488_8282 212
584 3300046472 Ga0495580_0038398 Ga0495580_0038398_2155_2949 212
585 3300046473 Ga0495582_0000855 Ga0495582_0000855_263_1057 212
586 3300046475 Ga0495639_0000072 Ga0495639_0000072_29175_29969 212
587 3300046476 Ga0495662_0000572 Ga0495662_0000572_4522_5316 212
588 3300046477 Ga0495664_0011398 Ga0495664_0011398_925_1719 212
589 3300046499 Ga0495594_0000046 Ga0495594_0000046_39985_40779 212
590 3300046517 Ga0495630_0011525 Ga0495630_0011525_1152_1946 212
591 3300046526 Ga0495666_0003632 Ga0495666_0003632_2752_3546 212
592 3300046531 Ga0495665_0000128 Ga0495665_0000128_7566_8360 212
593 3300046642 Ga0495634_0003037 Ga0495634_0003037_1392_2186 212
594 3300046663 Ga0495635_0002038 Ga0495635_0002038_2901_3695 212
595 3300046674 Ga0495588_0010612 Ga0495588_0010612_394_1188 212
596 3300046683 Ga0495658_0004429 Ga0495658_0004429_2659_3453 212
597 3300046689 Ga0495613_0003702 Ga0495613_0003702_2889_3683 212
598 3300046690 Ga0495624_0000795 Ga0495624_0000795_4543_5337 212
599 3300047315 Ga0495581_0000030 Ga0495581_0000030_31528_32322 212
600 3300047319 Ga0495674_0001230 Ga0495674_0001230_8601_9395 212
601 3300047321 Ga0495676_0017129 Ga0495676_0017129_3184_3978 212
602 3300047673 Ga0495593_0000470 Ga0495593_0000470_4955_5749 212
603 3300048089 Ga0495614_0022266 Ga0495614_0022266_1646_2440 212
604 3300048907 Ga0496104_0004634 Ga0496104_0004634_1744_2538 212
605 3300048908 Ga0496105_0043484 Ga0496105_0043484_2871_3665 212
606 3300048911 Ga0496108_0155438 Ga0496108_0155438_514_1308 212
607 3300048912 Ga0496109_0151503 Ga0496109_0151503_236_1030 212
608 3300048913 Ga0496110_0127423 Ga0496110_0127423_1007_1801 212
609 3300048915 Ga0496112_0004525 Ga0496112_0004525_3743_4537 212
610 3300050490 nmdc:mga03n38_7962_c1 nmdc:mga03n38_7962_c1_1966_2757 212
611 3300050493 nmdc:mga0k408_153467_c1 nmdc:mga0k408_153467_c1_322_1113 212
612 3300050494 nmdc:mga06z11_92058_c1 nmdc:mga06z11_92058_c1_462_1253 212
613 3300053119 Ga0500595_002547 Ga0500595_002547_4207_4998 212
614 3300053730 Ga0500645_043501 Ga0500645_043501_57_848 212
615 3300009545 Ga0105237_10151573 Ga0105237_101515732 213
616 3300010375 Ga0105239_10456862 Ga0105239_104568621 213
617 3300028573 Ga0265334_10006202 Ga0265334_100062024 213
618 3300047318 Ga0495636_0068370 Ga0495636_0068370_670_1461 213
619 3300005436 Ga0070713_100168405 Ga0070713_1001684052 214
620 3300003771 Ga0055526_1019675 Ga0055526_10196752 215
621 3300005262 Ga0065165_1038109 Ga0065165_10381091 215
622 3300025295 Ga0209564_1000671 Ga0209564_100067122 215
623 3300048928 Ga0496125_0326778 Ga0496125_0326778_82_867 215
624 3300003308 Ga0006777J48905_1044268 Ga0006777J48905_10442681 216
625 3300003575 Ga0007409J51694_1018315 Ga0007409J51694_10183151 216
626 3300005327 Ga0070658_10018416 Ga0070658_100184162 216
627 3300004798 Ga0058859_10002637 Ga0058859_100026371 217
628 3300004801 Ga0058860_12101187 Ga0058860_121011871 217
629 3300004803 Ga0058862_12634862 Ga0058862_126348621 217
630 3300048911 Ga0496108_0410894 Ga0496108_0410894_125_916 217
631 3300037068 Ga0373925_0131430 Ga0373925_0131430_1123_1926 219
632 3300005981 Ga0081538_10007441 Ga0081538_100074412 220
633 3300020076 Ga0206355_1022003 Ga0206355_10220031 220
634 3300005347 Ga0070668_100342991 Ga0070668_1003429911 221
635 3300006178 Ga0075367_10022578 Ga0075367_100225785 221
636 3300031456 Ga0307513_10299956 Ga0307513_102999562 221
637 3300031507 Ga0307509_10207829 Ga0307509_102078293 221
638 3300046513 Ga0495616_0048814 Ga0495616_0048814_608_1399 221
639 3300046684 Ga0495669_0131590 Ga0495669_0131590_349_1140 221
640 3300048927 Ga0496124_0355129 Ga0496124_0355129_60_845 221
641 3300050492 nmdc:mga0yw44_63003_c1 nmdc:mga0yw44_63003_c1_1026_1817 221
642 3300053089 Ga0500581_172258 Ga0500581_172258_22_813 221
643 iso_pu_bacteria 2643221651 2644291085 221
644 3300006028 Ga0070717_10208139 Ga0070717_102081392 222
645 3300025928 Ga0207700_10345410 Ga0207700_103454102 222
646 3300031730 Ga0307516_10029260 Ga0307516_100292602 222
647 3300035113 Ga0373936_0009753 Ga0373936_0009753_895_1845 222
648 3300046462 Ga0495651_0111889 Ga0495651_0111889_13_831 222
649 3300047322 Ga0495680_0094218 Ga0495680_0094218_1241_2059 222
650 3300047471 Ga0495684_0089426 Ga0495684_0089426_754_1572 222
651 3300053085 Ga0495619_0006419 Ga0495619_0006419_2681_3499 222
652 3300053163 Ga0500639_184390 Ga0500639_184390_48_881 222
653 iso_pu_bacteria 2903748898 2903758805 222
654 iso_pu_bacteria 2904690495 2904691013 222
655 iso_pu_bacteria 2908756301 2908757071 222
656 iso_pu_bacteria 8056689827 8056691136 222
657 3300029285 Ga0310981_1033463 Ga0310981_10334631 223
658 iso_pu_bacteria 2507262055 2507505442 223
659 iso_pu_bacteria 2508501009 2508539327 223
660 iso_pu_bacteria 2508501042 2508695654 223
661 iso_pu_bacteria 2511231028 2511400450 223
662 iso_pu_bacteria 2513237092 2513623934 223
663 iso_pu_bacteria 2513237096 2513659501 223
664 iso_pu_bacteria 2513237098 2513676307 223
665 iso_pu_bacteria 2513237101 2513695279 223
666 iso_pu_bacteria 2513237104 2513718232 223
667 iso_pu_bacteria 2513237137 2513859392 223
668 iso_pu_bacteria 2513237139 2513873358 223
669 iso_pu_bacteria 2513237141 2513888588 223
670 iso_pu_bacteria 2513237145 2513921566 223
671 iso_pu_bacteria 2515154112 2515627637 223
672 iso_pu_bacteria 2517093001 2517106288 223
673 iso_pu_bacteria 2517572143 2517889042 223
674 iso_pu_bacteria 2524023210 2524467235 223
675 iso_pu_bacteria 2524023228 2524537477 223
676 iso_pu_bacteria 2602042107 2603858633 223
677 iso_pu_bacteria 2617270735 2617352069 223
678 iso_pu_bacteria 2667528175 2671124031 223
679 iso_pu_bacteria 2721755755 2723841813 223
680 iso_pu_bacteria 2728368998 2728748440 223
681 iso_pu_bacteria 2791355197 2793072719 223
682 iso_pu_bacteria 2791355199 2793078313 223
683 iso_pu_bacteria 2802429603 2805920706 223
684 iso_pu_bacteria 2824600985 2824608728 223
685 iso_pu_bacteria 2824609381 2824617671 223
686 iso_pu_bacteria 2824653114 2824660134 223
687 iso_pu_bacteria 2824679649 2824687600 223
688 iso_pu_bacteria 2824696289 2824702614 223
689 iso_pu_bacteria 2824704595 2824710492 223
690 iso_pu_bacteria 2824753945 2824761763 223
691 iso_pu_bacteria 2824763712 2824772262 223
692 iso_pu_bacteria 2824773399 2824780852 223
693 iso_pu_bacteria 2841957949 2841965354 223
694 iso_pu_bacteria 2844315083 2844315535 223
695 iso_pu_bacteria 2847939898 2847942331 223
696 iso_pu_bacteria 2849076700 2849083204 223
697 iso_pu_bacteria 2857524615 2857526247 223
698 iso_pu_bacteria 2874590934 2874592557 223
699 iso_pu_bacteria 2874604998 2874607894 223
700 iso_pu_bacteria 2874612657 2874617988 223
701 iso_pu_bacteria 2874645413 2874647176 223
702 iso_pu_bacteria 2876771140 2876772560 223
703 iso_pu_bacteria 2876808645 2876814195 223
704 iso_pu_bacteria 2876818435 2876819821 223
705 iso_pu_bacteria 2879074833 2879076327 223
706 iso_pu_bacteria 2879110137 2879113321 223
707 iso_pu_bacteria 2879127579 2879128811 223
708 iso_pu_bacteria 2879142872 2879143632 223
709 iso_pu_bacteria 2885374607 2885377546 223
710 iso_pu_bacteria 2885383462 2885386910 223
711 iso_pu_bacteria 2885409591 2885415844 223
712 iso_pu_bacteria 2888419890 2888420130 223
713 iso_pu_bacteria 2889033259 2889035311 223
714 iso_pu_bacteria 2893066018 2893067481 223
715 iso_pu_bacteria 2903727486 2903733696 223
716 iso_pu_bacteria 2903768456 2903774497 223
717 iso_pu_bacteria 2904699407 2904708410 223
718 iso_pu_bacteria 2904711408 2904716338 223
719 iso_pu_bacteria 2906602504 2906609456 223
720 iso_pu_bacteria 2906610324 2906613582 223
721 iso_pu_bacteria 2906635258 2906635823 223
722 iso_pu_bacteria 2906660503 2906668116 223
723 iso_pu_bacteria 2908739725 2908747644 223
724 iso_pu_bacteria 2919073203 2919073901 223
725 iso_pu_bacteria 2922361189 2922363199 223
726 iso_pu_bacteria 2922386360 2922388496 223
727 iso_pu_bacteria 2922393267 2922396592 223
728 iso_pu_bacteria 2922425934 2922434019 223
729 iso_pu_bacteria 2935608549 2935615529 223
730 iso_pu_bacteria 2935630451 2935636046 223
731 iso_pu_bacteria 2935648319 2935654459 223
732 iso_pu_bacteria 2935656913 2935663339 223
733 iso_pu_bacteria 2935769743 2935774298 223
734 iso_pu_bacteria 2935777560 2935783337 223
735 iso_pu_bacteria 2935785616 2935788987 223
736 iso_pu_bacteria 2935793552 2935796737 223
737 iso_pu_bacteria 2935819856 2935825670 223
738 iso_pu_bacteria 2935847175 2935853434 223
739 iso_pu_bacteria 2935908558 2935915036 223
740 iso_pu_bacteria 2935916978 2935918884 223
741 iso_pu_bacteria 2935926038 2935931399 223
742 iso_pu_bacteria 2935934488 2935939996 223
743 iso_pu_bacteria 2935942939 2935947657 223
744 iso_pu_bacteria 2935951376 2935956428 223
745 iso_pu_bacteria 2935967501 2935973222 223
746 iso_pu_bacteria 2935975950 2935980534 223
747 iso_pu_bacteria 2935984226 2935990114 223
748 iso_pu_bacteria 2936011229 2936017502 223
749 iso_pu_bacteria 2936019824 2936025997 223
750 iso_pu_bacteria 2936028420 2936034839 223
751 iso_pu_bacteria 2936046547 2936052903 223
752 iso_pu_bacteria 2936055302 2936060238 223
753 iso_pu_bacteria 2941507105 2941512650 223
754 iso_pu_bacteria 2941515067 2941520512 223
755 iso_pu_bacteria 2941523033 2941528526 223
756 iso_pu_bacteria 3005474847 3005475266 223
757 iso_pu_bacteria 3005483717 3005486682 223
758 iso_pu_bacteria 3005506211 3005508988 223
759 iso_pu_bacteria 3005587118 3005594129 223
760 iso_pu_bacteria 3005594810 3005595227 223
761 iso_pu_bacteria 3005710791 3005711169 223
762 iso_pu_bacteria 3005718088 3005718465 223
763 iso_pu_bacteria 8006933436 8006936011 223
764 iso_pu_bacteria 8006964411 8006967628 223
765 iso_pu_bacteria 8006973647 8006975865 223
766 iso_pu_bacteria 8006984368 8006991098 223
767 iso_pu_bacteria 8006994254 8007000427 223
768 iso_pu_bacteria 8016522445 8016526319 223
769 iso_pu_bacteria 8016530956 8016531381 223
770 iso_pu_bacteria 8016539877 8016544595 223
771 iso_pu_bacteria 8016548790 8016557480 223
772 iso_pu_bacteria 8016557553 8016565838 223
773 iso_pu_bacteria 8016566248 8016569647 223
774 iso_pu_bacteria 8016595262 8016603437 223
775 iso_pu_bacteria 8016603502 8016606374 223
776 iso_pu_bacteria 8016613128 8016618282 223
777 iso_pu_bacteria 8016622563 8016622931 223
778 iso_pu_bacteria 8019530166 8019531215 223
779 iso_pu_bacteria 8019538911 8019540340 223
780 iso_pu_bacteria 8019547302 8019549931 223
781 iso_pu_bacteria 8019555841 8019562643 223
782 iso_pu_bacteria 8019565922 8019572722 223
783 iso_pu_bacteria 8019619141 8019623154 223
784 iso_pu_bacteria 8019629233 8019629944 223
785 iso_pu_bacteria 8019638758 8019640662 223
786 iso_pu_bacteria 8019668869 8019676542 223
787 iso_pu_bacteria 8019687851 8019696057 223
788 iso_pu_bacteria 8056673599 8056676132 223
789 iso_pu_bacteria 8056681323 8056682932 223
790 3300021384 Ga0213876_10268756 Ga0213876_102687561 224
791 3300037853 Ga0436364_1231246 Ga0436364_1231246_2978_3805 224
792 3300039437 Ga0436365_1844499 Ga0436365_1844499_221_1048 224
793 3300048904 Ga0496101_0272312 Ga0496101_0272312_314_1141 224
794 3300048908 Ga0496105_0199333 Ga0496105_0199333_418_1245 224
795 3300048910 Ga0496107_0181458 Ga0496107_0181458_358_1185 224
796 3300048913 Ga0496110_0411456 Ga0496110_0411456_140_967 224
797 3300059505 Ga0587083_0053841 Ga0587083_0053841_13_801 224
798 3300059642 Ga0587069_030050 Ga0587069_030050_72_860 224
799 3300059653 Ga0587108_006445 Ga0587108_006445_102_887 225
800 3300005436 Ga0070713_100119688 Ga0070713_1001196882 226
801 3300006178 Ga0075367_10013523 Ga0075367_100135231 226
802 3300006353 Ga0075370_10031036 Ga0075370_100310361 226
803 3300025928 Ga0207700_10070457 Ga0207700_100704572 226
804 3300025929 Ga0207664_10023800 Ga0207664_100238001 226
805 3300049581 Ga0501047_0082949 Ga0501047_0082949_231_1019 226
806 3300049586 Ga0501070_0014987 Ga0501070_0014987_1937_2725 226
807 3300049590 Ga0501074_0012908 Ga0501074_0012908_4682_5470 226
808 3300049742 Ga0501080_0009730 Ga0501080_0009730_2659_3447 226
809 3300049823 Ga0501044_0038489 Ga0501044_0038489_2060_2848 226
810 3300050490 nmdc:mga03n38_12117_c1 nmdc:mga03n38_12117_c1_1486_2274 226
811 3300050496 nmdc:mga07m45_7843_c1 nmdc:mga07m45_7843_c1_2180_2968 226
812 3300001979 JGI24740J21852_10019014 JGI24740J21852_100190142 227
813 3300001990 JGI24737J22298_10000979 JGI24737J22298_100009791 227
814 3300002075 JGI24738J21930_10031241 JGI24738J21930_100312412 227
815 3300005347 Ga0070668_100260994 Ga0070668_1002609942 227
816 3300005354 Ga0070675_100511647 Ga0070675_1005116471 227
817 3300005367 Ga0070667_100246357 Ga0070667_1002463571 227
818 3300005435 Ga0070714_100191652 Ga0070714_1001916523 227
819 3300005539 Ga0068853_100015795 Ga0068853_1000157954 227
820 3300005539 Ga0068853_100280674 Ga0068853_1002806742 227
821 3300005563 Ga0068855_100188673 Ga0068855_1001886733 227
822 3300005563 Ga0068855_100415431 Ga0068855_1004154312 227
823 3300005564 Ga0070664_100431467 Ga0070664_1004314672 227
824 3300005577 Ga0068857_100005034 Ga0068857_1000050345 227
825 3300005577 Ga0068857_100223783 Ga0068857_1002237831 227
826 3300005578 Ga0068854_100003979 Ga0068854_1000039794 227
827 3300005578 Ga0068854_100342861 Ga0068854_1003428611 227
828 3300005614 Ga0068856_100004208 Ga0068856_1000042087 227
829 3300005614 Ga0068856_100152442 Ga0068856_1001524423 227
830 3300005834 Ga0068851_10006246 Ga0068851_100062462 227
831 3300005937 Ga0081455_10000738 Ga0081455_1000073837 227
832 3300005937 Ga0081455_10011519 Ga0081455_100115195 227
833 3300005983 Ga0081540_1007723 Ga0081540_10077234 227
834 3300006048 Ga0075363_100052946 Ga0075363_1000529462 227
835 3300009093 Ga0105240_10002459 Ga0105240_100024592 227
836 3300009093 Ga0105240_10056136 Ga0105240_100561362 227
837 3300009094 Ga0111539_10089486 Ga0111539_100894864 227
838 3300009174 Ga0105241_10020741 Ga0105241_100207413 227
839 3300009174 Ga0105241_10223420 Ga0105241_102234202 227
840 3300009177 Ga0105248_10089282 Ga0105248_100892823 227
841 3300009545 Ga0105237_10014356 Ga0105237_100143562 227
842 3300009545 Ga0105237_10194513 Ga0105237_101945132 227
843 3300009551 Ga0105238_10001235 Ga0105238_1000123519 227
844 3300009551 Ga0105238_10018660 Ga0105238_100186601 227
845 3300009551 Ga0105238_10116101 Ga0105238_101161013 227
846 3300010375 Ga0105239_10018536 Ga0105239_100185362 227
847 3300020075 Ga0206349_1345775 Ga0206349_13457751 227
848 3300020080 Ga0206350_10783199 Ga0206350_107831991 227
849 3300025254 Ga0209148_1006148 Ga0209148_10061482 227
850 3300025272 Ga0209455_1002203 Ga0209455_10022035 227
851 3300025321 Ga0207656_10011551 Ga0207656_100115513 227
852 3300025904 Ga0207647_10022531 Ga0207647_100225316 227
853 3300025904 Ga0207647_10027240 Ga0207647_100272405 227
854 3300025913 Ga0207695_10051771 Ga0207695_100517712 227
855 3300025914 Ga0207671_10062068 Ga0207671_100620683 227
856 3300025924 Ga0207694_10018629 Ga0207694_100186293 227
857 3300025924 Ga0207694_10185041 Ga0207694_101850411 227
858 3300025941 Ga0207711_10048929 Ga0207711_100489293 227
859 3300025945 Ga0207679_10319399 Ga0207679_103193991 227
860 3300025949 Ga0207667_10037414 Ga0207667_100374144 227
861 3300026041 Ga0207639_10213299 Ga0207639_102132992 227
862 3300026067 Ga0207678_10043043 Ga0207678_100430432 227
863 3300026116 Ga0207674_10014753 Ga0207674_100147537 227
864 3300026121 Ga0207683_10088714 Ga0207683_100887144 227
865 3300026142 Ga0207698_10627039 Ga0207698_106270391 227
866 3300028786 Ga0307517_10000232 Ga0307517_1000023214 227
867 3300028794 Ga0307515_10354065 Ga0307515_103540652 227
868 3300031238 Ga0265332_10063996 Ga0265332_100639961 227
869 3300031241 Ga0265325_10032360 Ga0265325_100323602 227
870 3300031456 Ga0307513_10083845 Ga0307513_100838454 227
871 3300031730 Ga0307516_10132990 Ga0307516_101329902 227
872 3300032126 Ga0307415_100039352 Ga0307415_1000393522 227
873 3300037466 Ga0395898_0148501 Ga0395898_0148501_688_1479 227
874 3300039450 Ga0436363_0655475 Ga0436363_0655475_777_1577 227
875 3300044694 Ga0466963_0361743 Ga0466963_0361743_124_915 227
876 3300046460 Ga0495638_0199003 Ga0495638_0199003_295_1086 227
877 3300047320 Ga0495672_0028262 Ga0495672_0028262_577_1368 227
878 3300048912 Ga0496109_0095265 Ga0496109_0095265_1132_1923 227
879 3300048915 Ga0496112_0004583 Ga0496112_0004583_644_1435 227
880 3300048924 Ga0496121_0230428 Ga0496121_0230428_369_1160 227
881 3300049128 Ga0501308_015165 Ga0501308_015165_109_900 227
882 3300049533 Ga0501317_023690 Ga0501317_023690_45_836 227
883 3300049569 Ga0501032_0009394 Ga0501032_0009394_5305_6096 227
884 3300049570 Ga0501033_0161719 Ga0501033_0161719_755_1546 227
885 3300049572 Ga0501036_0116278 Ga0501036_0116278_1394_2185 227
886 3300049572 Ga0501036_0185584 Ga0501036_0185584_286_1077 227
887 3300049577 Ga0501041_0168583 Ga0501041_0168583_71_862 227
888 3300049578 Ga0501042_0417913 Ga0501042_0417913_106_897 227
889 3300049579 Ga0501043_0215386 Ga0501043_0215386_631_1422 227
890 3300049586 Ga0501070_0121560 Ga0501070_0121560_125_916 227
891 3300049587 Ga0501071_0470326 Ga0501071_0470326_98_889 227
892 3300049592 Ga0501076_0134528 Ga0501076_0134528_545_1336 227
893 3300049823 Ga0501044_0119655 Ga0501044_0119655_1143_1934 227
894 3300050511 nmdc:mga08y16_188038_c1 nmdc:mga08y16_188038_c1_550_1341 227
895 3300050515 nmdc:mga0a205_241895_c1 nmdc:mga0a205_241895_c1_833_1624 227
896 3300059505 Ga0587083_0049948 Ga0587083_0049948_18_809 227
897 3300059623 Ga0587101_022396 Ga0587101_022396_18_815 227
898 iso_pu_bacteria 2513237094 2513642181 227
899 iso_pu_bacteria 2524023205 2524441433 227
900 iso_pu_bacteria 2744054633 2745077567 227
901 iso_pu_bacteria 2935959822 2935966726 227

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01027

Bax1-I

Inhibitor of apoptosis-promoting Bax1

47

279

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
3u3f-assembly2.cif.gz_B structural basis for the interaction of pyk2 pat domain with paxillin ld motifs 0.4837 49 221
1k40-assembly1.cif.gz_A crystal structure of the fat domain of focal adhesion kinase 0.4808 51 221
3u3f-assembly3.cif.gz_C structural basis for the interaction of pyk2 pat domain with paxillin ld motifs 0.4652 50 227
4xev-assembly1.cif.gz_A fusion of pyk2-fat domain with leupaxin ld1 motif, complexed with leupaxin ld4 peptide 0.4574 49 225
6fvq-assembly1.cif.gz_A the active form of a pentameric ion channel (stelic) gated by alkaline ph - r86a 0.4573 104 219
ID Description Score Start End Superfamily
af_P75769_17_224_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.5439 49 222 1.20.1250.20
3gm3A00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Nucleotidyltransferases 0.4925 49 221 1.20.120.330
4xefA00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Nucleotidyltransferases 0.486 50 221 1.20.120.330
3u3fB00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Nucleotidyltransferases 0.4837 49 221 1.20.120.330
1k40A00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Nucleotidyltransferases 0.4808 51 221 1.20.120.330
ID Description Score Start End GO Terms
AF-A0A2I8QUK8-F1-model_v4 deleted 0.7241 87 224
AF-A0A2I8QUK8-F1-model_v4 deleted 0.6701 87 224
AF-G0QXC9-F1-model_v4 Uncharacterized protein 0.6578 50 227 GO:0016020
AF-A0A853I235-F1-model_v4 deleted 0.6566 41 226
AF-A0A1R2AM22-F1-model_v4 Uncharacterized protein 0.648 50 227 GO:0016020

Feature Viewer

pLDDT pTM Quality
66.71 0.51 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map