F485173
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 901 | 548 | 758 | 246 |
Family's Representative Sequence
| Representative Sequence | 3300009545|Ga0105237_10014356|Ga0105237_100143562 |
| Length | 284 |
| Sequence | VPAKEALLIAPDNNEVSTMSDFDRNYASPFGRAIGRADAAAVDAGLRAYMLRIYNYMTIGLAITGFAALGVFMGATTNDPSLAAFPQKIGSFYLTGFGYAMFVSPLKWLFIFAPLAMVFVISFGIQRLAPATAQLLFWVFSALMGVSLSSIFLVYTHSSIVQVFFITAAAFGALSLYGYTTRRDMTGMGSFLIMGLFGIVIASIVNLFLASSALQFVVSVGGVLVFAGLTAWDTQRLKNEYIYGYAGAGEAVAERSAILGALSLYLNFINLFTLLLQLLGQRDN |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2507262055 | Bradyrhizobium sp. WSM1417 | Isolate | Nodule |
| 2 | 2508501009 | Bradyrhizobium sp. WSM471 | Isolate | Nodule |
| 3 | 2508501042 | Bradyrhizobium sp. WSM1253 | Isolate | Nodule |
| 4 | 2511231028 | Bradyrhizobium sp. YR681 | Isolate | Rhizosphere |
| 5 | 2513237092 | Bradyrhizobium sp. WSM1743 | Isolate | Nodule |
| 6 | 2513237094 | Bradyrhizobium sp. WSM3983 | Isolate | Nodule |
| 7 | 2513237096 | Bradyrhizobium pachyrhizi USDA 3259 | Isolate | Nodule |
| 8 | 2513237098 | Bradyrhizobium elkanii WSM2783 | Isolate | Nodule |
| 9 | 2513237101 | Bradyrhizobium murdochi WSM1741 | Isolate | Nodule |
| 10 | 2513237104 | Bradyrhizobium sp. EC3.3 | Isolate | Nodule |
| 11 | 2513237137 | Bradyrhizobium elkanii USDA 94 | Isolate | Nodule |
| 12 | 2513237139 | Bradyrhizobium ottawaense USDA 4 | Isolate | Nodule |
| 13 | 2513237141 | Bradyrhizobium sp. TV2a.2 | Isolate | Nodule |
| 14 | 2513237145 | Bradyrhizobium elkanii USDA 3254 | Isolate | Nodule |
| 15 | 2515154112 | Bradyrhizobium sp. WSM4349 | Isolate | Nodule |
| 16 | 2517093001 | Bradyrhizobium japonicum USDA 124 | Isolate | Nodule |
| 17 | 2517572143 | Bradyrhizobium elkanii USDA 76 | Isolate | Nodule |
| 18 | 2524023205 | Bradyrhizobium sp. Cp5.3 | Isolate | Nodule |
| 19 | 2524023210 | Bradyrhizobium sp. Ai1a-2 | Isolate | Nodule |
| 20 | 2524023228 | Bradyrhizobium sp. Th.b2 | Isolate | Nodule |
| 21 | 2602042107 | Bradyrhizobium sp. NFR13 | Isolate | Rhizoplane |
| 22 | 2617270735 | Bradyrhizobium shewense ERR11 | Isolate | Nodule |
| 23 | 2643221651 | Afipia sp. Root123D2 | Isolate | Unclassified |
| 24 | 2667528175 | Rhizobium tropici NFR14 | Isolate | Rhizoplane |
| 25 | 2721755755 | Bradyrhizobium icense LMTR 13 | Isolate | Nodule |
| 26 | 2728368998 | Bradyrhizobium macuxiense BR 10303 | Isolate | Nodule |
| 27 | 2744054633 | Bradyrhizobium neotropicale BR 10247 | Isolate | Unclassified |
| 28 | 2791355197 | Bradyrhizobium sp. C9 | Isolate | Nodule |
| 29 | 2791355199 | |||
| 30 | 2802429603 | Bradyrhizobium ottawaense L2 | Isolate | Nodule |
| 31 | 2824600985 | Bradyrhizobium sp.HAMBI 2135 | Isolate | Unclassified |
| 32 | 2824609381 | Bradyrhizobium sp. HAMBI 2134 | Isolate | Unclassified |
| 33 | 2824653114 | Bradyrhizobium sp. HAMBI 2142 | Isolate | Unclassified |
| 34 | 2824679649 | Bradyrhizobium sp.HAMBI 2116 | Isolate | Unclassified |
| 35 | 2824696289 | Bradyrhizobium sp. HAMBI 2127 | Isolate | Unclassified |
| 36 | 2824704595 | Bradyrhizobium sp. HAMBI 2150 | Isolate | Unclassified |
| 37 | 2824753945 | Bradyrhizobium sp. HAMBI 2128 | Isolate | Unclassified |
| 38 | 2824763712 | Bradyrhizobium sp. HAMBI 2129 | Isolate | Unclassified |
| 39 | 2824773399 | Bradyrhizobium sp. HAMBI 2130 | Isolate | Unclassified |
| 40 | 2841957949 | Bradyrhizobium sp. CIR1 | Isolate | Nodule |
| 41 | 2844315083 | Bradyrhizobium guangzhouense CCBAU 51670 | Isolate | Unclassified |
| 42 | 2847939898 | Bradyrhizobium ottawaense OO99 | Isolate | Unclassified |
| 43 | 2849076700 | Bradyrhizobium symbiodeficiens 85S1MB | Isolate | Nodule |
| 44 | 2857524615 | Tardiphaga sp. R-73074 | Isolate | Unclassified |
| 45 | 2874590934 | Bradyrhizobium canariense UBMA181 | Isolate | Nodule |
| 46 | 2874604998 | Bradyrhizobium sp. LMTR 3 | Isolate | Nodule |
| 47 | 2874612657 | Bradyrhizobium forestalis INPA54B | Isolate | Nodule |
| 48 | 2874645413 | Bradyrhizobium canariense UBMA122 | Isolate | Nodule |
| 49 | 2876771140 | Bradyrhizobium canariense UBMA192 | Isolate | Nodule |
| 50 | 2876808645 | Bradyrhizobium algeriense RST89 | Isolate | Unclassified |
| 51 | 2876818435 | Bradyrhizobium canariense UBMA195 | Isolate | Nodule |
| 52 | 2879074833 | Bradyrhizobium canariense UBMA171 | Isolate | Nodule |
| 53 | 2879110137 | Bradyrhizobium algeriense RST91 | Isolate | Nodule |
| 54 | 2879127579 | Bradyrhizobium canariense UBMA052 | Isolate | Nodule |
| 55 | 2879142872 | Bradyrhizobium canariense UBMA061 | Isolate | Nodule |
| 56 | 2884298095 | Microvirga thermotolerans HR1 | Isolate | Rhizosphere |
| 57 | 2885374607 | Bradyrhizobium sp. NAS96.2 | Isolate | Unclassified |
| 58 | 2885383462 | Bradyrhizobium sp. Leo170 | Isolate | Unclassified |
| 59 | 2885409591 | Bradyrhizobium sp. NAS80.1 | Isolate | Unclassified |
| 60 | 2888419890 | Bradyrhizobium sp. 1(2017) 63S1MB | Isolate | Unclassified |
| 61 | 2889033259 | Bradyrhizobium sp. CCBAU 051011 | Isolate | Unclassified |
| 62 | 2893066018 | Tardiphaga sp. P9-11 | Isolate | Unclassified |
| 63 | 2903727486 | Bradyrhizobium guangzhouense CCBAU 53424 | Isolate | Unclassified |
| 64 | 2903748898 | Bradyrhizobium uaiense UFLA 03-164 | Isolate | Nodule |
| 65 | 2903768456 | Bradyrhizobium sp. Leo121 | Isolate | Unclassified |
| 66 | 2904690495 | Bradyrhizobium ivorense CI-1B | Isolate | Nodule |
| 67 | 2904699407 | |||
| 68 | 2904711408 | Bradyrhizobium sp. USDA 3456 | Isolate | Unclassified |
| 69 | 2906602504 | Bradyrhizobium guangzhouense CCBAU 53426 | Isolate | Unclassified |
| 70 | 2906610324 | |||
| 71 | 2906635258 | Bradyrhizobium sp. USDA 3458 | Isolate | Unclassified |
| 72 | 2906660503 | Bradyrhizobium brasilense UFLA 03-321 | Isolate | Unclassified |
| 73 | 2908739725 | Bradyrhizobium sp. UFLA03-84 | Isolate | Nodule |
| 74 | 2908756301 | Bradyrhizobium ivorense CI-41S | Isolate | Nodule |
| 75 | 2919073203 | Tardiphaga robiniae 1155 | Isolate | Unclassified |
| 76 | 2922361189 | Bradyrhizobium australiense WSM 1791 | Isolate | Nodule |
| 77 | 2922386360 | Bradyrhizobium archetypum WSM 1744 | Isolate | Nodule |
| 78 | 2922393267 | Bradyrhizobium sp. WBAH10 | Isolate | Nodule |
| 79 | 2922425934 | |||
| 80 | 2935608549 | Bradyrhizobium sp. RT6a | Isolate | Nodule |
| 81 | 2935630451 | Bradyrhizobium sp. I1.14.4 | Isolate | Nodule |
| 82 | 2935648319 | Bradyrhizobium sp. JR4.3 | Isolate | Nodule |
| 83 | 2935656913 | Bradyrhizobium sp. JR5.3 | Isolate | Nodule |
| 84 | 2935769743 | Bradyrhizobium sp. LB12.1 | Isolate | Nodule |
| 85 | 2935777560 | Bradyrhizobium sp. LB14.3 | Isolate | Nodule |
| 86 | 2935785616 | Bradyrhizobium sp. LB5.2 | Isolate | Nodule |
| 87 | 2935793552 | Bradyrhizobium sp. LB8.2 | Isolate | Nodule |
| 88 | 2935819856 | Bradyrhizobium sp. RT3b | Isolate | Nodule |
| 89 | 2935847175 | Bradyrhizobium sp. RT5a | Isolate | Nodule |
| 90 | 2935908558 | Bradyrhizobium sp. F1.1.1 | Isolate | Nodule |
| 91 | 2935916978 | Bradyrhizobium sp. F1.13.3 | Isolate | Nodule |
| 92 | 2935926038 | Bradyrhizobium sp. F1.2.1 | Isolate | Nodule |
| 93 | 2935934488 | Bradyrhizobium sp. F1.2.2 | Isolate | Nodule |
| 94 | 2935942939 | Bradyrhizobium sp. F1.2.6 | Isolate | Nodule |
| 95 | 2935951376 | Bradyrhizobium sp. F1.2.8 | Isolate | Nodule |
| 96 | 2935959822 | Bradyrhizobium sp. F1.4.3 | Isolate | Nodule |
| 97 | 2935967501 | Bradyrhizobium sp. F1.6.2 | Isolate | Nodule |
| 98 | 2935975950 | Bradyrhizobium sp. GM2.2 | Isolate | Nodule |
| 99 | 2935984226 | Bradyrhizobium sp. i1.15.2 | Isolate | Nodule |
| 100 | 2936011229 | Bradyrhizobium sp. JR1.1 | Isolate | Nodule |
| 101 | 2936019824 | Bradyrhizobium sp. JR1.5 | Isolate | Nodule |
| 102 | 2936028420 | Bradyrhizobium sp. JR1.7 | Isolate | Nodule |
| 103 | 2936046547 | Bradyrhizobium sp. JR3.12 | Isolate | Nodule |
| 104 | 2936055302 | Bradyrhizobium sp. JR4.1 | Isolate | Nodule |
| 105 | 2941507105 | Bradyrhizobium sp. i1.12.3 | Isolate | Nodule |
| 106 | 2941515067 | Bradyrhizobium sp. i1.14.1 | Isolate | Nodule |
| 107 | 2941523033 | Bradyrhizobium sp. i1.8.4 | Isolate | Nodule |
| 108 | 3005474847 | Bradyrhizobium sp. CCBAU 53421 | Isolate | Nodule |
| 109 | 3005483717 | Bradyrhizobium agreste CNPSo 4010 | Isolate | Unclassified |
| 110 | 3005506211 | Bradyrhizobium diazoefficiens SZCCT0449 | Isolate | Unclassified |
| 111 | 3005587118 | Bradyrhizobium glycinis CNPSo 4016 | Isolate | Unclassified |
| 112 | 3005594810 | Bradyrhizobium sp. CCBAU 53340 | Isolate | Nodule |
| 113 | 3005710791 | Bradyrhizobium genosp. B BDV5040 | Isolate | Unclassified |
| 114 | 3005718088 | Bradyrhizobium sp. CCBAU 53338 | Isolate | Nodule |
| 115 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 116 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 117 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 118 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 119 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 120 | 3300003308 | Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_20 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 121 | 3300003575 | Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 122 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 123 | 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 124 | 3300004798 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 125 | 3300004801 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 126 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 127 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 128 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 129 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 130 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 131 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 132 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 133 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 134 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 135 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 136 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 137 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 138 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 139 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 140 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 141 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 142 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 143 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 144 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 145 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 146 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 147 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 148 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 149 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 150 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 151 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 152 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 153 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 154 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 155 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 156 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 157 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 158 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 159 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 160 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 161 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 162 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 163 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 164 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 165 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 166 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 167 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 168 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 169 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 170 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 171 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 172 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 173 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 174 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 175 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 176 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 177 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 178 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 179 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 180 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 181 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 182 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 183 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 184 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 185 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 186 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 187 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 188 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 189 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 190 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 191 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 193 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 194 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 195 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 197 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 198 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 199 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 200 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 201 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 202 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 203 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 204 | 3300012500 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 | Metagenome | Rhizosphere |
| 205 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 206 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 207 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 208 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 209 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 210 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 211 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 212 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 213 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 214 | 3300020075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 215 | 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) | Metatranscriptome | Rhizosphere |
| 216 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 217 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 218 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 219 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 220 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 221 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 222 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 223 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 224 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 225 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 226 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 227 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 228 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 229 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 230 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 231 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 232 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 234 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 235 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 236 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 237 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 238 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 239 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 240 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 241 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 242 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 243 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 244 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 245 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 246 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 247 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 248 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 249 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 250 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 251 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 252 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 253 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 254 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 255 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 256 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 257 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 258 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 259 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 260 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 261 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 262 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 263 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 264 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 265 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 266 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 267 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 268 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 269 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 270 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 271 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 272 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 273 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 274 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 275 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 276 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 277 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 278 | 3300029285 | Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B3.stno.R1 | Metatranscriptome | Rhizosphere |
| 279 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 280 | 3300030763 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 281 | 3300030882 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI6 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 282 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 283 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 284 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 285 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 286 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 287 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 288 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 289 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 290 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 291 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 292 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 293 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 294 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 295 | 3300033544 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 | Metagenome | Unclassified |
| 296 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 297 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 298 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 299 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 300 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 301 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 302 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 303 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 304 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 305 | 3300036458 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE2 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 306 | 3300036534 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRU5 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 307 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 308 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 309 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 310 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 311 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 312 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 313 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 314 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 315 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 316 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 317 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 318 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 319 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 320 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 321 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 322 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 323 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 324 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 325 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 326 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 327 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 328 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 329 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 330 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 331 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 332 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 333 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 377 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 378 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 379 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 380 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 381 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 382 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 383 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 384 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 385 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 386 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 387 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 388 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 389 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 390 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 391 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 392 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 393 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 394 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 395 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 396 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 397 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 398 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 399 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 400 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 401 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 402 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 403 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 404 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 405 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 406 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 407 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 408 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 409 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 410 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 411 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 412 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 413 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 414 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 415 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 416 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 417 | 3300049128 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 418 | 3300049133 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 419 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 420 | 3300049533 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 421 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 422 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 423 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 424 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 425 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 426 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 427 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 428 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 429 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 430 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 431 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 432 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 433 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 434 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 435 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 436 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 437 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 438 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 439 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 440 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 441 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 442 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 443 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 444 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 445 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 446 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 447 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 448 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 449 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 450 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 451 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 452 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 453 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 454 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 455 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 456 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 457 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 458 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 459 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 460 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 461 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 462 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 463 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 464 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 465 | 3300053089 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 endosphere | Metagenome | Endosphere |
| 466 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 467 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 468 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 469 | 3300053102 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere | Metagenome | Endosphere |
| 470 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 471 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 472 | 3300053115 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere | Metagenome | Endosphere |
| 473 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 474 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 475 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 476 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 477 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 478 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 479 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 480 | 3300053145 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere | Metagenome | Endosphere |
| 481 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 482 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 483 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 484 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 485 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 486 | 3300053159 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere | Metagenome | Endosphere |
| 487 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 488 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 489 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 490 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 491 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 492 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 493 | 3300053723 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 endosphere | Metagenome | Endosphere |
| 494 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 495 | 3300053733 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere | Metagenome | Endosphere |
| 496 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 497 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 498 | 3300059478 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 58R_AW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 499 | 3300059490 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 500 | 3300059493 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 501 | 3300059503 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 502 | 3300059504 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 503 | 3300059505 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 504 | 3300059506 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 505 | 3300059508 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 506 | 3300059511 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 507 | 3300059605 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 508 | 3300059607 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 163R_SW_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 509 | 3300059623 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 510 | 3300059625 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 151R_CD_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 511 | 3300059626 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 173R_CD_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 512 | 3300059627 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 154R_AW_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 513 | 3300059631 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 168R_SD_T3_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 514 | 3300059639 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 515 | 3300059642 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 516 | 3300059647 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 517 | 3300059653 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 145R_CW_T3_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 518 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 519 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 520 | 8006933436 | Bradyrhizobium septentrionale 7(2017) | Isolate | Unclassified |
| 521 | 8006964411 | Bradyrhizobium sp. sBnM-33 | Isolate | Nodule |
| 522 | 8006973647 | Bradyrhizobium septentrionale 162S2 | Isolate | Nodule |
| 523 | 8006984368 | Bradyrhizobium sp. SRL28 | Isolate | Unclassified |
| 524 | 8006994254 | Bradyrhizobium sp. sGM-13 | Isolate | Nodule |
| 525 | 8016522445 | Bradyrhizobium sp. LM6.9 | Isolate | Nodule |
| 526 | 8016530956 | Bradyrhizobium sp. LM6.11 | Isolate | Nodule |
| 527 | 8016539877 | Bradyrhizobium sp. LM6.10 | Isolate | Nodule |
| 528 | 8016548790 | Bradyrhizobium sp. LM3.6 | Isolate | Nodule |
| 529 | 8016557553 | Bradyrhizobium sp. LM3.4 | Isolate | Nodule |
| 530 | 8016566248 | Bradyrhizobium sp. LM3.2 | Isolate | Nodule |
| 531 | 8016583857 | Bradyrhizobium sp. LM2.7 | Isolate | Nodule |
| 532 | 8016595262 | Bradyrhizobium sp. LM2.3 | Isolate | Nodule |
| 533 | 8016603502 | Bradyrhizobium sp. LB7.2 | Isolate | Nodule |
| 534 | 8016613128 | Bradyrhizobium sp. LB7.1 | Isolate | Nodule |
| 535 | 8016622563 | Bradyrhizobium sp. LB13.1 | Isolate | Nodule |
| 536 | 8019530166 | Bradyrhizobium sp. LM4.3 | Isolate | Nodule |
| 537 | 8019538911 | Bradyrhizobium sp. LB9.1b | Isolate | Nodule |
| 538 | 8019547302 | Bradyrhizobium sp. LB1.3 | Isolate | Nodule |
| 539 | 8019555841 | Bradyrhizobium sp. JR6.1 | Isolate | Nodule |
| 540 | 8019565922 | Bradyrhizobium sp. JR3.5 | Isolate | Nodule |
| 541 | 8019619141 | Bradyrhizobium sp. GM7.3 | Isolate | Nodule |
| 542 | 8019629233 | Bradyrhizobium sp. GM6.1 | Isolate | Nodule |
| 543 | 8019638758 | Bradyrhizobium sp. GM5.1 | Isolate | Nodule |
| 544 | 8019668869 | Bradyrhizobium sp. GM2.4 | Isolate | Nodule |
| 545 | 8019687851 | Bradyrhizobium sp. F1.13.4 | Isolate | Nodule |
| 546 | 8056673599 | Bradyrhizobium hereditatis WSM 1738 | Isolate | Nodule |
| 547 | 8056681323 | Bradyrhizobium cenepequi CNPSo 4026 | Isolate | Nodule |
| 548 | 8056689827 | Bradyrhizobium semiaridum WSM 1704 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 76.48 |
| Metatranscriptomes | 8.03 |
| Isolates | 15.5 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 11.32 |
| Nodule | 11.32 |
| Rhizoplane | 4 |
| Rhizosphere | 59.38 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 13.98 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24740J21852_10019014 | 3300001979 | Bacteria | 2426 |
| 2 | JGI24737J22298_10000979 | 3300001990 | Bacteria | 10150 |
| 3 | JGI24738J21930_10031241 | 3300002075 | Bacteria | 1086 |
| 4 | JGI25406J46586_10045046 | 3300003203 | Bacteria | 1522 |
| 5 | JGI25165J46597_1009200 | 3300003214 | Bacteria | 1501 |
| 6 | Ga0006777J48905_1044268 | 3300003308 | Bacteria | 921 |
| 7 | Ga0007409J51694_1018315 | 3300003575 | Bacteria | 859 |
| 8 | Ga0055526_1019675 | 3300003771 | Bacteria | 2447 |
| 9 | JGI25405J52794_10031793 | 3300003911 | Bacteria | 1098 |
| 10 | Ga0058859_10002637 | 3300004798 | Bacteria | 1022 |
| 11 | Ga0058860_12101187 | 3300004801 | Bacteria | 1119 |
| 12 | Ga0058862_12634862 | 3300004803 | Bacteria | 989 |
| 13 | Ga0065165_1038109 | 3300005262 | Bacteria | 1452 |
| 14 | Ga0070658_10018416 | 3300005327 | Bacteria | 5590 |
| 15 | Ga0070683_100009865 | 3300005329 | Bacteria | 8181 |
| 16 | Ga0070670_100359760 | 3300005331 | Bacteria | 1280 |
| 17 | Ga0068869_100064257 | 3300005334 | Bacteria | 2699 |
| 18 | Ga0070666_10143604 | 3300005335 | Bacteria | 1663 |
| 19 | Ga0070680_100036908 | 3300005336 | Bacteria | 3948 |
| 20 | Ga0070680_100574888 | 3300005336 | Bacteria | 967 |
| 21 | Ga0070691_10048168 | 3300005341 | Bacteria | 2027 |
| 22 | Ga0070668_100084817 | 3300005347 | Bacteria | 2489 |
| 23 | Ga0070668_100260994 | 3300005347 | Bacteria | 1441 |
| 24 | Ga0070668_100342991 | 3300005347 | Bacteria | 1262 |
| 25 | Ga0070669_100023783 | 3300005353 | Bacteria | 4391 |
| 26 | Ga0070669_100523000 | 3300005353 | Bacteria | 986 |
| 27 | Ga0070675_100511647 | 3300005354 | Bacteria | 1083 |
| 28 | Ga0070671_100000542 | 3300005355 | Bacteria | 26647 |
| 29 | Ga0070673_100212996 | 3300005364 | Bacteria | 1669 |
| 30 | Ga0070688_100342197 | 3300005365 | Bacteria | 1092 |
| 31 | Ga0070659_100084996 | 3300005366 | Bacteria | 2530 |
| 32 | Ga0070667_100035887 | 3300005367 | Bacteria | 4155 |
| 33 | Ga0070667_100246357 | 3300005367 | Bacteria | 1597 |
| 34 | Ga0070709_10014869 | 3300005434 | Bacteria | 4414 |
| 35 | Ga0070709_10019171 | 3300005434 | Bacteria | 3950 |
| 36 | Ga0070709_10044929 | 3300005434 | Bacteria | 2738 |
| 37 | Ga0070714_100073568 | 3300005435 | Bacteria | 2961 |
| 38 | Ga0070714_100191652 | 3300005435 | Bacteria | 1866 |
| 39 | Ga0070713_100025592 | 3300005436 | Bacteria | 4617 |
| 40 | Ga0070713_100045297 | 3300005436 | Bacteria | 3604 |
| 41 | Ga0070713_100079741 | 3300005436 | Bacteria | 2790 |
| 42 | Ga0070713_100119688 | 3300005436 | Bacteria | 2307 |
| 43 | Ga0070713_100168405 | 3300005436 | Bacteria | 1961 |
| 44 | Ga0070713_100348883 | 3300005436 | Bacteria | 1373 |
| 45 | Ga0070710_10002858 | 3300005437 | Bacteria | 8225 |
| 46 | Ga0070710_10020812 | 3300005437 | Bacteria | 3409 |
| 47 | Ga0070710_10412975 | 3300005437 | Bacteria | 907 |
| 48 | Ga0070663_100001941 | 3300005455 | Bacteria | 11542 |
| 49 | Ga0070663_100060988 | 3300005455 | Bacteria | 2715 |
| 50 | Ga0070681_10001077 | 3300005458 | Bacteria | 23275 |
| 51 | Ga0070681_10132401 | 3300005458 | Bacteria | 2425 |
| 52 | Ga0068867_100176355 | 3300005459 | Bacteria | 1696 |
| 53 | Ga0070707_100142842 | 3300005468 | Bacteria | 2330 |
| 54 | Ga0070699_100168805 | 3300005518 | Bacteria | 1938 |
| 55 | Ga0070679_100005644 | 3300005530 | Bacteria | 11595 |
| 56 | Ga0070679_100028700 | 3300005530 | Bacteria | 5488 |
| 57 | Ga0070679_100097238 | 3300005530 | Bacteria | 2932 |
| 58 | Ga0070679_100103273 | 3300005530 | Bacteria | 2836 |
| 59 | Ga0070684_100008528 | 3300005535 | Bacteria | 8020 |
| 60 | Ga0070684_100133161 | 3300005535 | Bacteria | 2243 |
| 61 | Ga0068853_100015795 | 3300005539 | Bacteria | 6201 |
| 62 | Ga0068853_100280674 | 3300005539 | Bacteria | 1536 |
| 63 | Ga0070672_100256992 | 3300005543 | Bacteria | 1472 |
| 64 | Ga0070686_100303674 | 3300005544 | Bacteria | 1184 |
| 65 | Ga0070695_100045867 | 3300005545 | Bacteria | 2788 |
| 66 | Ga0070693_100059830 | 3300005547 | Bacteria | 2209 |
| 67 | Ga0070693_100089949 | 3300005547 | Bacteria | 1848 |
| 68 | Ga0070665_100001356 | 3300005548 | Bacteria | 28943 |
| 69 | Ga0070665_100182360 | 3300005548 | Bacteria | 2100 |
| 70 | Ga0070665_100331908 | 3300005548 | Bacteria | 1525 |
| 71 | Ga0068855_100024520 | 3300005563 | Bacteria | 7218 |
| 72 | Ga0068855_100046913 | 3300005563 | Bacteria | 5106 |
| 73 | Ga0068855_100188673 | 3300005563 | Bacteria | 2326 |
| 74 | Ga0068855_100240999 | 3300005563 | Bacteria | 2021 |
| 75 | Ga0068855_100415431 | 3300005563 | Bacteria | 1472 |
| 76 | Ga0070664_100431467 | 3300005564 | Bacteria | 1208 |
| 77 | Ga0068857_100005034 | 3300005577 | Bacteria | 11228 |
| 78 | Ga0068857_100166962 | 3300005577 | Bacteria | 1999 |
| 79 | Ga0068857_100223783 | 3300005577 | Bacteria | 1719 |
| 80 | Ga0068854_100003979 | 3300005578 | Bacteria | 9266 |
| 81 | Ga0068854_100342861 | 3300005578 | Bacteria | 1221 |
| 82 | Ga0068856_100000883 | 3300005614 | Bacteria | 32112 |
| 83 | Ga0068856_100004208 | 3300005614 | Bacteria | 14365 |
| 84 | Ga0068856_100152442 | 3300005614 | Bacteria | 2321 |
| 85 | Ga0068859_100093827 | 3300005617 | Bacteria | 3052 |
| 86 | Ga0068864_100085987 | 3300005618 | Bacteria | 2766 |
| 87 | Ga0068851_10006246 | 3300005834 | Bacteria | 5436 |
| 88 | Ga0068870_10164917 | 3300005840 | Bacteria | 1317 |
| 89 | Ga0068863_100074583 | 3300005841 | Bacteria | 3210 |
| 90 | Ga0068863_100150925 | 3300005841 | Bacteria | 2223 |
| 91 | Ga0068858_100039033 | 3300005842 | Bacteria | 4405 |
| 92 | Ga0068858_100478227 | 3300005842 | Bacteria | 1202 |
| 93 | Ga0068860_100261639 | 3300005843 | Bacteria | 1686 |
| 94 | Ga0068862_100034179 | 3300005844 | Bacteria | 4300 |
| 95 | Ga0068862_100238505 | 3300005844 | Bacteria | 1652 |
| 96 | Ga0081455_10000738 | 3300005937 | Bacteria | 42457 |
| 97 | Ga0081455_10011519 | 3300005937 | Bacteria | 8881 |
| 98 | Ga0081455_10025851 | 3300005937 | Bacteria | 5412 |
| 99 | Ga0081455_10029499 | 3300005937 | Bacteria | 5002 |
| 100 | Ga0081538_10007441 | 3300005981 | Bacteria | 9477 |
| 101 | Ga0081538_10032665 | 3300005981 | Bacteria | 3480 |
| 102 | Ga0081540_1005811 | 3300005983 | Bacteria | 9130 |
| 103 | Ga0081540_1007723 | 3300005983 | Bacteria | 7624 |
| 104 | Ga0081540_1040622 | 3300005983 | Bacteria | 2422 |
| 105 | Ga0081539_10000371 | 3300005985 | Bacteria | 98455 |
| 106 | Ga0081539_10025876 | 3300005985 | Bacteria | 3761 |
| 107 | Ga0081539_10075608 | 3300005985 | Bacteria | 1788 |
| 108 | Ga0070717_10003277 | 3300006028 | Bacteria | 11581 |
| 109 | Ga0070717_10018898 | 3300006028 | Bacteria | 5392 |
| 110 | Ga0070717_10053768 | 3300006028 | Bacteria | 3319 |
| 111 | Ga0070717_10208139 | 3300006028 | Bacteria | 1716 |
| 112 | Ga0075365_10006761 | 3300006038 | Bacteria | 6346 |
| 113 | Ga0075365_10087096 | 3300006038 | Bacteria | 2123 |
| 114 | Ga0075365_10145024 | 3300006038 | Bacteria | 1649 |
| 115 | Ga0075368_10028408 | 3300006042 | Bacteria | 2161 |
| 116 | Ga0075363_100052946 | 3300006048 | Bacteria | 2167 |
| 117 | Ga0075364_10110184 | 3300006051 | Bacteria | 1837 |
| 118 | Ga0075364_10165743 | 3300006051 | Bacteria | 1493 |
| 119 | Ga0075364_10289396 | 3300006051 | Bacteria | 1115 |
| 120 | Ga0070716_100005454 | 3300006173 | Bacteria | 6164 |
| 121 | Ga0070712_100051297 | 3300006175 | Bacteria | 2873 |
| 122 | Ga0075362_10028375 | 3300006177 | Bacteria | 2403 |
| 123 | Ga0075362_10068248 | 3300006177 | Bacteria | 1619 |
| 124 | Ga0075367_10013523 | 3300006178 | Bacteria | 4390 |
| 125 | Ga0075367_10022578 | 3300006178 | Bacteria | 3531 |
| 126 | Ga0075369_10009920 | 3300006186 | Bacteria | 3715 |
| 127 | Ga0075369_10049655 | 3300006186 | Bacteria | 1813 |
| 128 | Ga0075366_10118823 | 3300006195 | Bacteria | 1592 |
| 129 | Ga0075370_10031036 | 3300006353 | Bacteria | 2983 |
| 130 | Ga0075370_10107073 | 3300006353 | Bacteria | 1621 |
| 131 | Ga0075370_10136094 | 3300006353 | Bacteria | 1435 |
| 132 | Ga0075370_10184506 | 3300006353 | Bacteria | 1228 |
| 133 | Ga0075370_10212095 | 3300006353 | Bacteria | 1143 |
| 134 | Ga0068865_100140332 | 3300006881 | Bacteria | 1821 |
| 135 | Ga0075436_100045387 | 3300006914 | Bacteria | 3031 |
| 136 | Ga0097620_100093827 | 3300006931 | Bacteria | 3052 |
| 137 | Ga0079104_1041320 | 3300006946 | Bacteria | 1075 |
| 138 | Ga0105251_10001526 | 3300009011 | Bacteria | 19872 |
| 139 | Ga0105240_10002459 | 3300009093 | Bacteria | 29768 |
| 140 | Ga0105240_10007949 | 3300009093 | Bacteria | 15306 |
| 141 | Ga0105240_10056136 | 3300009093 | Bacteria | 4928 |
| 142 | Ga0105240_10061018 | 3300009093 | Bacteria | 4700 |
| 143 | Ga0105240_10093949 | 3300009093 | Bacteria | 3659 |
| 144 | Ga0105240_10470262 | 3300009093 | Bacteria | 1403 |
| 145 | Ga0111539_10089486 | 3300009094 | Bacteria | 3617 |
| 146 | Ga0105247_10237703 | 3300009101 | Bacteria | 1240 |
| 147 | Ga0105247_10362207 | 3300009101 | Bacteria | 1023 |
| 148 | Ga0105241_10020741 | 3300009174 | Bacteria | 4856 |
| 149 | Ga0105241_10223420 | 3300009174 | Bacteria | 1584 |
| 150 | Ga0105248_10013528 | 3300009177 | Bacteria | 8982 |
| 151 | Ga0105248_10089282 | 3300009177 | Bacteria | 3469 |
| 152 | Ga0105237_10014356 | 3300009545 | Bacteria | 8288 |
| 153 | Ga0105237_10014927 | 3300009545 | Bacteria | 8100 |
| 154 | Ga0105237_10151573 | 3300009545 | Bacteria | 2315 |
| 155 | Ga0105237_10194513 | 3300009545 | Bacteria | 2028 |
| 156 | Ga0105238_10001235 | 3300009551 | Bacteria | 25716 |
| 157 | Ga0105238_10018660 | 3300009551 | Bacteria | 7063 |
| 158 | Ga0105238_10021262 | 3300009551 | Bacteria | 6612 |
| 159 | Ga0105238_10116101 | 3300009551 | Bacteria | 2656 |
| 160 | Ga0105249_10379015 | 3300009553 | Bacteria | 1440 |
| 161 | Ga0105249_10386249 | 3300009553 | Bacteria | 1427 |
| 162 | Ga0099796_10016687 | 3300010159 | Bacteria | 2173 |
| 163 | Ga0105239_10018536 | 3300010375 | Bacteria | 7687 |
| 164 | Ga0105239_10053677 | 3300010375 | Bacteria | 4420 |
| 165 | Ga0105239_10456862 | 3300010375 | Bacteria | 1449 |
| 166 | Ga0105239_10710672 | 3300010375 | Bacteria | 1149 |
| 167 | Ga0157314_1005405 | 3300012500 | Bacteria | 969 |
| 168 | Ga0157369_10032756 | 3300013105 | Bacteria | 5711 |
| 169 | Ga0157369_10223644 | 3300013105 | Bacteria | 1969 |
| 170 | Ga0157374_10080278 | 3300013296 | Bacteria | 3093 |
| 171 | Ga0157374_10154653 | 3300013296 | Bacteria | 2231 |
| 172 | Ga0157374_10314643 | 3300013296 | Bacteria | 1551 |
| 173 | Ga0163162_10055722 | 3300013306 | Bacteria | 3981 |
| 174 | Ga0157375_10239363 | 3300013308 | Bacteria | 1974 |
| 175 | Ga0163163_10026240 | 3300014325 | Bacteria | 5566 |
| 176 | Ga0182008_10237463 | 3300014497 | Bacteria | 937 |
| 177 | Ga0157379_10530911 | 3300014968 | Bacteria | 1093 |
| 178 | Ga0197907_10122096 | 3300020069 | Bacteria | 1029 |
| 179 | Ga0197907_11428149 | 3300020069 | Bacteria | 1014 |
| 180 | Ga0206356_10841646 | 3300020070 | Bacteria | 915 |
| 181 | Ga0206356_11019694 | 3300020070 | Bacteria | 1083 |
| 182 | Ga0206356_11227967 | 3300020070 | Bacteria | 1316 |
| 183 | Ga0206349_1112773 | 3300020075 | Bacteria | 1263 |
| 184 | Ga0206349_1345775 | 3300020075 | Bacteria | 927 |
| 185 | Ga0206349_1694165 | 3300020075 | Bacteria | 1023 |
| 186 | Ga0206349_1878734 | 3300020075 | Bacteria | 1048 |
| 187 | Ga0206355_1022003 | 3300020076 | Bacteria | 829 |
| 188 | Ga0206355_1140956 | 3300020076 | Bacteria | 955 |
| 189 | Ga0206351_10137541 | 3300020077 | Bacteria | 936 |
| 190 | Ga0206351_10685837 | 3300020077 | Bacteria | 1022 |
| 191 | Ga0206351_10853499 | 3300020077 | Bacteria | 927 |
| 192 | Ga0206352_10853849 | 3300020078 | Bacteria | 943 |
| 193 | Ga0206352_11018583 | 3300020078 | Bacteria | 924 |
| 194 | Ga0206352_11297536 | 3300020078 | Bacteria | 969 |
| 195 | Ga0206350_10047531 | 3300020080 | Bacteria | 970 |
| 196 | Ga0206350_10124601 | 3300020080 | Bacteria | 947 |
| 197 | Ga0206350_10258629 | 3300020080 | Bacteria | 935 |
| 198 | Ga0206350_10783199 | 3300020080 | Bacteria | 917 |
| 199 | Ga0206350_11138243 | 3300020080 | Bacteria | 953 |
| 200 | Ga0206350_11301687 | 3300020080 | Bacteria | 925 |
| 201 | Ga0206354_10001066 | 3300020081 | Bacteria | 968 |
| 202 | Ga0206354_10892454 | 3300020081 | Bacteria | 919 |
| 203 | Ga0206354_11650149 | 3300020081 | Bacteria | 971 |
| 204 | Ga0206353_10006930 | 3300020082 | Bacteria | 923 |
| 205 | Ga0206353_11260487 | 3300020082 | Bacteria | 935 |
| 206 | Ga0206353_11903621 | 3300020082 | Bacteria | 2125 |
| 207 | Ga0154015_1265539 | 3300020610 | Bacteria | 956 |
| 208 | Ga0154015_1529450 | 3300020610 | Bacteria | 1040 |
| 209 | Ga0213873_10001008 | 3300021358 | Bacteria | 4576 |
| 210 | Ga0213876_10003470 | 3300021384 | Bacteria | 9015 |
| 211 | Ga0213876_10023883 | 3300021384 | Bacteria | 3227 |
| 212 | Ga0213876_10268756 | 3300021384 | Bacteria | 906 |
| 213 | Ga0213875_10027840 | 3300021388 | Bacteria | 2689 |
| 214 | Ga0224712_10119344 | 3300022467 | Bacteria | 1140 |
| 215 | Ga0224712_10139243 | 3300022467 | Bacteria | 1066 |
| 216 | Ga0224712_10186241 | 3300022467 | Bacteria | 938 |
| 217 | Ga0224712_10187736 | 3300022467 | Bacteria | 934 |
| 218 | Ga0224712_10190267 | 3300022467 | Bacteria | 928 |
| 219 | Ga0209677_100170 | 3300025253 | Bacteria | 55896 |
| 220 | Ga0209148_1006148 | 3300025254 | Bacteria | 2635 |
| 221 | Ga0209233_1012365 | 3300025261 | Bacteria | 2478 |
| 222 | Ga0209455_1002203 | 3300025272 | Bacteria | 7710 |
| 223 | Ga0209455_1007613 | 3300025272 | Bacteria | 3035 |
| 224 | Ga0209564_1000671 | 3300025295 | Bacteria | 50518 |
| 225 | Ga0209564_1010723 | 3300025295 | Bacteria | 4182 |
| 226 | Ga0209758_1001900 | 3300025297 | Bacteria | 22801 |
| 227 | Ga0207656_10011551 | 3300025321 | Bacteria | 3339 |
| 228 | Ga0207713_1002460 | 3300025735 | Bacteria | 13462 |
| 229 | Ga0207692_10006838 | 3300025898 | Bacteria | 4643 |
| 230 | Ga0207710_10105055 | 3300025900 | Bacteria | 1336 |
| 231 | Ga0207688_10086352 | 3300025901 | Bacteria | 1797 |
| 232 | Ga0207680_10126573 | 3300025903 | Bacteria | 1678 |
| 233 | Ga0207647_10022531 | 3300025904 | Bacteria | 4181 |
| 234 | Ga0207647_10027240 | 3300025904 | Bacteria | 3728 |
| 235 | Ga0207699_10169105 | 3300025906 | Bacteria | 1461 |
| 236 | Ga0207643_10070154 | 3300025908 | Bacteria | 2015 |
| 237 | Ga0207707_10001830 | 3300025912 | Bacteria | 19505 |
| 238 | Ga0207707_10028688 | 3300025912 | Bacteria | 4863 |
| 239 | Ga0207707_10299982 | 3300025912 | Bacteria | 1389 |
| 240 | Ga0207695_10051771 | 3300025913 | Bacteria | 4308 |
| 241 | Ga0207695_10139657 | 3300025913 | Bacteria | 2373 |
| 242 | Ga0207671_10062068 | 3300025914 | Bacteria | 2774 |
| 243 | Ga0207671_10099663 | 3300025914 | Bacteria | 2199 |
| 244 | Ga0207693_10003895 | 3300025915 | Bacteria | 12708 |
| 245 | Ga0207693_10004610 | 3300025915 | Bacteria | 11630 |
| 246 | Ga0207693_10107617 | 3300025915 | Bacteria | 2187 |
| 247 | Ga0207693_10304145 | 3300025915 | Bacteria | 1249 |
| 248 | Ga0207663_10054053 | 3300025916 | Bacteria | 2512 |
| 249 | Ga0207663_10098371 | 3300025916 | Bacteria | 1959 |
| 250 | Ga0207660_10413582 | 3300025917 | Bacteria | 1087 |
| 251 | Ga0207660_10488399 | 3300025917 | Bacteria | 998 |
| 252 | Ga0207657_10268499 | 3300025919 | Bacteria | 1356 |
| 253 | Ga0207652_10005820 | 3300025921 | Bacteria | 9998 |
| 254 | Ga0207652_10315488 | 3300025921 | Bacteria | 1411 |
| 255 | Ga0207652_10394162 | 3300025921 | Bacteria | 1249 |
| 256 | Ga0207681_10000503 | 3300025923 | Bacteria | 27243 |
| 257 | Ga0207694_10018629 | 3300025924 | Bacteria | 5249 |
| 258 | Ga0207694_10023665 | 3300025924 | Bacteria | 4664 |
| 259 | Ga0207694_10185041 | 3300025924 | Bacteria | 1690 |
| 260 | Ga0207687_10404930 | 3300025927 | Bacteria | 1123 |
| 261 | Ga0207700_10070457 | 3300025928 | Bacteria | 2688 |
| 262 | Ga0207700_10345410 | 3300025928 | Bacteria | 1295 |
| 263 | Ga0207664_10023800 | 3300025929 | Bacteria | 4595 |
| 264 | Ga0207664_10429104 | 3300025929 | Bacteria | 1178 |
| 265 | Ga0207664_10501200 | 3300025929 | Bacteria | 1087 |
| 266 | Ga0207644_10001520 | 3300025931 | Bacteria | 14966 |
| 267 | Ga0207704_10433479 | 3300025938 | Bacteria | 1045 |
| 268 | Ga0207665_10006607 | 3300025939 | Bacteria | 7691 |
| 269 | Ga0207665_10113232 | 3300025939 | Bacteria | 1908 |
| 270 | Ga0207711_10002363 | 3300025941 | Bacteria | 16902 |
| 271 | Ga0207711_10048929 | 3300025941 | Bacteria | 3618 |
| 272 | Ga0207711_10567891 | 3300025941 | Bacteria | 1058 |
| 273 | Ga0207661_10000878 | 3300025944 | Bacteria | 19794 |
| 274 | Ga0207661_10092182 | 3300025944 | Bacteria | 2525 |
| 275 | Ga0207679_10214993 | 3300025945 | Bacteria | 1614 |
| 276 | Ga0207679_10319399 | 3300025945 | Bacteria | 1344 |
| 277 | Ga0207667_10037414 | 3300025949 | Bacteria | 5187 |
| 278 | Ga0207667_10152080 | 3300025949 | Bacteria | 2381 |
| 279 | Ga0207667_10482417 | 3300025949 | Bacteria | 1258 |
| 280 | Ga0207668_10003815 | 3300025972 | Bacteria | 8882 |
| 281 | Ga0207668_10846220 | 3300025972 | Bacteria | 812 |
| 282 | Ga0207658_10197038 | 3300025986 | Bacteria | 1678 |
| 283 | Ga0207703_10302433 | 3300026035 | Bacteria | 1459 |
| 284 | Ga0207703_10339404 | 3300026035 | Bacteria | 1380 |
| 285 | Ga0207639_10213299 | 3300026041 | Bacteria | 1663 |
| 286 | Ga0207678_10043043 | 3300026067 | Bacteria | 3909 |
| 287 | Ga0207678_10149983 | 3300026067 | Bacteria | 1990 |
| 288 | Ga0207678_10237780 | 3300026067 | Bacteria | 1560 |
| 289 | Ga0207708_10280685 | 3300026075 | Bacteria | 1350 |
| 290 | Ga0207702_10000318 | 3300026078 | Bacteria | 55209 |
| 291 | Ga0207702_10232747 | 3300026078 | Bacteria | 1723 |
| 292 | Ga0207702_10567464 | 3300026078 | Bacteria | 1111 |
| 293 | Ga0207674_10014753 | 3300026116 | Bacteria | 8619 |
| 294 | Ga0207683_10088714 | 3300026121 | Bacteria | 2752 |
| 295 | Ga0207698_10089767 | 3300026142 | Bacteria | 2511 |
| 296 | Ga0207698_10627039 | 3300026142 | Bacteria | 1063 |
| 297 | Ga0209179_1015611 | 3300027512 | Bacteria | 1413 |
| 298 | Ga0268266_10000534 | 3300028379 | Bacteria | 53027 |
| 299 | Ga0268266_10001906 | 3300028379 | Bacteria | 23472 |
| 300 | Ga0268266_10009681 | 3300028379 | Bacteria | 8469 |
| 301 | Ga0268266_10394682 | 3300028379 | Bacteria | 1307 |
| 302 | Ga0268266_10465051 | 3300028379 | Bacteria | 1204 |
| 303 | Ga0268265_10065886 | 3300028380 | Bacteria | 2797 |
| 304 | Ga0268265_10125312 | 3300028380 | Bacteria | 2124 |
| 305 | Ga0268265_10211107 | 3300028380 | Bacteria | 1691 |
| 306 | Ga0268265_10853020 | 3300028380 | Bacteria | 891 |
| 307 | Ga0268264_10000062 | 3300028381 | Bacteria | 302110 |
| 308 | Ga0268264_10353623 | 3300028381 | Bacteria | 1399 |
| 309 | Ga0265334_10006202 | 3300028573 | Bacteria | 5171 |
| 310 | Ga0307517_10000232 | 3300028786 | Bacteria | 94332 |
| 311 | Ga0307515_10354065 | 3300028794 | Bacteria | 1113 |
| 312 | Ga0310981_1033463 | 3300029285 | Bacteria | 900 |
| 313 | Ga0307511_10085070 | 3300030521 | Bacteria | 2189 |
| 314 | Ga0307511_10114742 | 3300030521 | Bacteria | 1696 |
| 315 | Ga0265763_1004318 | 3300030763 | Bacteria | 1161 |
| 316 | Ga0265764_102331 | 3300030882 | Bacteria | 923 |
| 317 | Ga0265332_10063996 | 3300031238 | Bacteria | 1571 |
| 318 | Ga0265332_10079800 | 3300031238 | Bacteria | 1389 |
| 319 | Ga0265325_10032360 | 3300031241 | Bacteria | 2792 |
| 320 | Ga0265340_10012805 | 3300031247 | Bacteria | 4425 |
| 321 | Ga0265340_10097790 | 3300031247 | Bacteria | 1366 |
| 322 | Ga0265339_10001952 | 3300031249 | Bacteria | 15141 |
| 323 | Ga0307513_10083845 | 3300031456 | Bacteria | 3276 |
| 324 | Ga0307513_10299956 | 3300031456 | Bacteria | 1374 |
| 325 | Ga0307509_10207829 | 3300031507 | Bacteria | 1786 |
| 326 | Ga0307508_10105800 | 3300031616 | Bacteria | 2411 |
| 327 | Ga0307508_10147504 | 3300031616 | Bacteria | 1957 |
| 328 | Ga0265314_10087483 | 3300031711 | Bacteria | 2037 |
| 329 | Ga0265314_10188651 | 3300031711 | Bacteria | 1229 |
| 330 | Ga0307516_10029260 | 3300031730 | Bacteria | 5570 |
| 331 | Ga0307516_10132990 | 3300031730 | Bacteria | 2265 |
| 332 | Ga0307516_10181291 | 3300031730 | Bacteria | 1839 |
| 333 | Ga0307409_100077156 | 3300031995 | Bacteria | 2675 |
| 334 | Ga0307415_100039352 | 3300032126 | Bacteria | 3124 |
| 335 | Ga0307507_10061770 | 3300033179 | Bacteria | 3486 |
| 336 | Ga0307510_10024915 | 3300033180 | Bacteria | 6908 |
| 337 | Ga0316215_1000881 | 3300033544 | Bacteria | 2943 |
| 338 | Ga0373950_0017256 | 3300034818 | Bacteria | 1242 |
| 339 | Ga0373936_0009753 | 3300035113 | Bacteria | 3623 |
| 340 | Ga0373943_0035254 | 3300035170 | Bacteria | 2390 |
| 341 | Ga0373943_0045855 | 3300035170 | Bacteria | 2132 |
| 342 | Ga0373955_0148985 | 3300035172 | Bacteria | 1376 |
| 343 | Ga0373935_0001267 | 3300035692 | Bacteria | 13929 |
| 344 | Ga0373935_0036686 | 3300035692 | Bacteria | 3066 |
| 345 | Ga0373935_0398511 | 3300035692 | Bacteria | 988 |
| 346 | Ga0373927_0000766 | 3300035695 | Bacteria | 24573 |
| 347 | Ga0373927_0005757 | 3300035695 | Bacteria | 8509 |
| 348 | Ga0373927_0234532 | 3300035695 | Bacteria | 1206 |
| 349 | Ga0373933_0000218 | 3300035724 | Bacteria | 37928 |
| 350 | Ga0373933_0133166 | 3300035724 | Bacteria | 1564 |
| 351 | Ga0373947_0000310 | 3300035725 | Bacteria | 27577 |
| 352 | Ga0373937_0101471 | 3300036401 | Bacteria | 2671 |
| 353 | Ga0310112_018378 | 3300036458 | Bacteria | 985 |
| 354 | Ga0310109_018809 | 3300036534 | Bacteria | 934 |
| 355 | Ga0373925_0002455 | 3300037068 | Bacteria | 14850 |
| 356 | Ga0373925_0004991 | 3300037068 | Bacteria | 9964 |
| 357 | Ga0373925_0130723 | 3300037068 | Bacteria | 1957 |
| 358 | Ga0373925_0131430 | 3300037068 | Bacteria | 1952 |
| 359 | Ga0373925_0137215 | 3300037068 | Bacteria | 1912 |
| 360 | Ga0373925_0161821 | 3300037068 | Bacteria | 1763 |
| 361 | Ga0373925_0375173 | 3300037068 | Bacteria | 1158 |
| 362 | Ga0395899_0046650 | 3300037312 | Bacteria | 3227 |
| 363 | Ga0395900_0005138 | 3300037418 | Bacteria | 13747 |
| 364 | Ga0395900_0013190 | 3300037418 | Bacteria | 8447 |
| 365 | Ga0395900_0187341 | 3300037418 | Bacteria | 2100 |
| 366 | Ga0395900_0477755 | 3300037418 | Bacteria | 1199 |
| 367 | Ga0395900_0757346 | 3300037418 | Bacteria | 901 |
| 368 | Ga0395898_0033290 | 3300037466 | Bacteria | 5144 |
| 369 | Ga0395898_0035036 | 3300037466 | Bacteria | 4996 |
| 370 | Ga0395898_0041886 | 3300037466 | Bacteria | 4521 |
| 371 | Ga0395898_0070416 | 3300037466 | Bacteria | 3381 |
| 372 | Ga0395898_0105024 | 3300037466 | Bacteria | 2709 |
| 373 | Ga0395898_0148501 | 3300037466 | Bacteria | 2243 |
| 374 | Ga0395905_0259901 | 3300037471 | Bacteria | 1621 |
| 375 | Ga0436364_0281278 | 3300037853 | Bacteria | 34090 |
| 376 | Ga0436364_0904449 | 3300037853 | Bacteria | 2360 |
| 377 | Ga0436364_0984338 | 3300037853 | Bacteria | 2695 |
| 378 | Ga0436364_1231246 | 3300037853 | Bacteria | 4565 |
| 379 | Ga0436364_1337275 | 3300037853 | Bacteria | 3761 |
| 380 | Ga0395901_0154816 | 3300038443 | Bacteria | 2408 |
| 381 | Ga0395901_0240173 | 3300038443 | Bacteria | 1890 |
| 382 | Ga0395901_0810645 | 3300038443 | Bacteria | 924 |
| 383 | Ga0395901_1012062 | 3300038443 | Bacteria | 806 |
| 384 | Ga0400483_031226 | 3300039062 | Bacteria | 2670 |
| 385 | Ga0436365_0261699 | 3300039437 | Bacteria | 8326 |
| 386 | Ga0436365_0457696 | 3300039437 | Bacteria | 1037 |
| 387 | Ga0436365_0829696 | 3300039437 | Bacteria | 36403 |
| 388 | Ga0436365_1063208 | 3300039437 | Bacteria | 2154 |
| 389 | Ga0436365_1359706 | 3300039437 | Bacteria | 2246 |
| 390 | Ga0436365_1369925 | 3300039437 | Bacteria | 12666 |
| 391 | Ga0436365_1436379 | 3300039437 | Bacteria | 1766 |
| 392 | Ga0436365_1844499 | 3300039437 | Bacteria | 1279 |
| 393 | Ga0436360_0832565 | 3300039438 | Bacteria | 8060 |
| 394 | Ga0436360_0851954 | 3300039438 | Bacteria | 1380 |
| 395 | Ga0436361_0379028 | 3300039447 | Bacteria | 3805 |
| 396 | Ga0436361_0987636 | 3300039447 | Bacteria | 4376 |
| 397 | Ga0436363_0292864 | 3300039450 | Bacteria | 3200 |
| 398 | Ga0436363_0436908 | 3300039450 | Bacteria | 2420 |
| 399 | Ga0436363_0451258 | 3300039450 | Bacteria | 2197 |
| 400 | Ga0436363_0655475 | 3300039450 | Bacteria | 3427 |
| 401 | Ga0436363_0775146 | 3300039450 | Bacteria | 11928 |
| 402 | Ga0436363_0802555 | 3300039450 | Bacteria | 2593 |
| 403 | Ga0436363_1571051 | 3300039450 | Bacteria | 883 |
| 404 | Ga0436363_1571660 | 3300039450 | Bacteria | 2001 |
| 405 | Ga0436362_0963821 | 3300039453 | Bacteria | 1543 |
| 406 | Ga0436362_1185069 | 3300039453 | Bacteria | 11827 |
| 407 | Ga0451797_0777937 | 3300041453 | Bacteria | 1279 |
| 408 | Ga0466969_0044243 | 3300044656 | Bacteria | 2216 |
| 409 | Ga0466972_0000299 | 3300044658 | Bacteria | 30012 |
| 410 | Ga0466972_0052825 | 3300044658 | Bacteria | 1957 |
| 411 | Ga0466966_0002843 | 3300044684 | Bacteria | 11392 |
| 412 | Ga0466966_0081395 | 3300044684 | Bacteria | 2016 |
| 413 | Ga0466961_0002447 | 3300044693 | Bacteria | 11519 |
| 414 | Ga0466961_0141153 | 3300044693 | Bacteria | 1508 |
| 415 | Ga0466963_0095903 | 3300044694 | Bacteria | 2025 |
| 416 | Ga0466963_0237919 | 3300044694 | Bacteria | 1276 |
| 417 | Ga0466963_0361743 | 3300044694 | Bacteria | 1022 |
| 418 | Ga0466964_0092544 | 3300044706 | Bacteria | 1319 |
| 419 | Ga0466968_0002351 | 3300044735 | Bacteria | 6916 |
| 420 | Ga0466968_0081500 | 3300044735 | Bacteria | 1422 |
| 421 | Ga0466970_0171981 | 3300044765 | Bacteria | 1201 |
| 422 | Ga0466957_0059708 | 3300044842 | Bacteria | 2338 |
| 423 | Ga0466960_0097824 | 3300044901 | Bacteria | 1506 |
| 424 | Ga0466958_0145600 | 3300045836 | Bacteria | 1493 |
| 425 | Ga0466967_0070195 | 3300045976 | Bacteria | 3133 |
| 426 | Ga0466967_0115827 | 3300045976 | Bacteria | 2469 |
| 427 | Ga0495592_0026073 | 3300046454 | Bacteria | 4434 |
| 428 | Ga0495603_0000801 | 3300046455 | Bacteria | 18013 |
| 429 | Ga0495603_0007385 | 3300046455 | Bacteria | 6608 |
| 430 | Ga0495603_0298947 | 3300046455 | Bacteria | 924 |
| 431 | Ga0495590_0075863 | 3300046457 | Bacteria | 1183 |
| 432 | Ga0495629_0004806 | 3300046459 | Bacteria | 10133 |
| 433 | Ga0495629_0007739 | 3300046459 | Bacteria | 7906 |
| 434 | Ga0495638_0017844 | 3300046460 | Bacteria | 4723 |
| 435 | Ga0495638_0034495 | 3300046460 | Bacteria | 3230 |
| 436 | Ga0495638_0158860 | 3300046460 | Bacteria | 1306 |
| 437 | Ga0495638_0199003 | 3300046460 | Bacteria | 1132 |
| 438 | Ga0495641_0002198 | 3300046461 | Bacteria | 15577 |
| 439 | Ga0495651_0111889 | 3300046462 | Bacteria | 2018 |
| 440 | Ga0495651_0343390 | 3300046462 | Bacteria | 988 |
| 441 | Ga0495653_0215187 | 3300046463 | Bacteria | 1295 |
| 442 | Ga0495580_0038398 | 3300046472 | Bacteria | 3429 |
| 443 | Ga0495582_0000855 | 3300046473 | Bacteria | 16906 |
| 444 | Ga0495639_0000072 | 3300046475 | Bacteria | 46904 |
| 445 | Ga0495639_0020710 | 3300046475 | Bacteria | 2874 |
| 446 | Ga0495662_0000572 | 3300046476 | Bacteria | 16948 |
| 447 | Ga0495662_0197010 | 3300046476 | Bacteria | 993 |
| 448 | Ga0495664_0002994 | 3300046477 | Bacteria | 9132 |
| 449 | Ga0495664_0011398 | 3300046477 | Bacteria | 5012 |
| 450 | Ga0495584_0078381 | 3300046491 | Bacteria | 1662 |
| 451 | Ga0495584_0115366 | 3300046491 | Bacteria | 1359 |
| 452 | Ga0495594_0000046 | 3300046499 | Bacteria | 53822 |
| 453 | Ga0495583_0081903 | 3300046506 | Bacteria | 1401 |
| 454 | Ga0495606_0034430 | 3300046507 | Bacteria | 3477 |
| 455 | Ga0495610_0027759 | 3300046512 | Bacteria | 3003 |
| 456 | Ga0495616_0048814 | 3300046513 | Bacteria | 2124 |
| 457 | Ga0495616_0056120 | 3300046513 | Bacteria | 1946 |
| 458 | Ga0495620_0040172 | 3300046515 | Bacteria | 2061 |
| 459 | Ga0495630_0011525 | 3300046517 | Bacteria | 6402 |
| 460 | Ga0495643_0007651 | 3300046522 | Bacteria | 6931 |
| 461 | Ga0495648_0052615 | 3300046524 | Bacteria | 2472 |
| 462 | Ga0495663_0034611 | 3300046525 | Bacteria | 1513 |
| 463 | Ga0495666_0003632 | 3300046526 | Bacteria | 7798 |
| 464 | Ga0495666_0154266 | 3300046526 | Bacteria | 1067 |
| 465 | Ga0495652_0031563 | 3300046529 | Bacteria | 4638 |
| 466 | Ga0495665_0000128 | 3300046531 | Bacteria | 36043 |
| 467 | Ga0495640_0012908 | 3300046533 | Bacteria | 6370 |
| 468 | Ga0495621_0065406 | 3300046539 | Bacteria | 1328 |
| 469 | Ga0495597_0042608 | 3300046542 | Bacteria | 2024 |
| 470 | Ga0495597_0134503 | 3300046542 | Bacteria | 1023 |
| 471 | Ga0495645_0015358 | 3300046543 | Bacteria | 5445 |
| 472 | Ga0495645_0044984 | 3300046543 | Bacteria | 3220 |
| 473 | Ga0495645_0162030 | 3300046543 | Bacteria | 1546 |
| 474 | Ga0495622_0007496 | 3300046557 | Bacteria | 5062 |
| 475 | Ga0495622_0022209 | 3300046557 | Bacteria | 2956 |
| 476 | Ga0495667_0025221 | 3300046559 | Bacteria | 4008 |
| 477 | Ga0495656_0028598 | 3300046615 | Bacteria | 2237 |
| 478 | Ga0495656_0054370 | 3300046615 | Bacteria | 1722 |
| 479 | Ga0495634_0003037 | 3300046642 | Bacteria | 13668 |
| 480 | Ga0495634_0320167 | 3300046642 | Bacteria | 934 |
| 481 | Ga0495625_0218111 | 3300046660 | Bacteria | 1251 |
| 482 | Ga0495635_0002038 | 3300046663 | Bacteria | 13679 |
| 483 | Ga0495635_0003646 | 3300046663 | Bacteria | 10680 |
| 484 | Ga0495661_0033443 | 3300046665 | Bacteria | 3243 |
| 485 | Ga0495588_0010612 | 3300046674 | Bacteria | 4291 |
| 486 | Ga0495588_0044719 | 3300046674 | Bacteria | 2269 |
| 487 | Ga0495657_0002636 | 3300046675 | Bacteria | 15017 |
| 488 | Ga0495658_0004429 | 3300046683 | Bacteria | 6911 |
| 489 | Ga0495669_0131590 | 3300046684 | Bacteria | 1177 |
| 490 | Ga0495613_0003702 | 3300046689 | Bacteria | 11465 |
| 491 | Ga0495624_0000795 | 3300046690 | Bacteria | 24919 |
| 492 | Ga0495600_0126739 | 3300046809 | Bacteria | 1660 |
| 493 | Ga0495581_0000030 | 3300047315 | Bacteria | 53487 |
| 494 | Ga0495604_0020841 | 3300047317 | Bacteria | 5233 |
| 495 | Ga0495636_0068370 | 3300047318 | Bacteria | 1512 |
| 496 | Ga0495674_0001230 | 3300047319 | Bacteria | 24837 |
| 497 | Ga0495672_0028262 | 3300047320 | Bacteria | 3550 |
| 498 | Ga0495672_0219222 | 3300047320 | Bacteria | 940 |
| 499 | Ga0495676_0017129 | 3300047321 | Bacteria | 6412 |
| 500 | Ga0495676_0475670 | 3300047321 | Bacteria | 822 |
| 501 | Ga0495680_0000836 | 3300047322 | Bacteria | 34084 |
| 502 | Ga0495680_0094218 | 3300047322 | Bacteria | 2241 |
| 503 | Ga0495675_0036875 | 3300047444 | Bacteria | 3116 |
| 504 | Ga0495681_0038105 | 3300047470 | Bacteria | 2360 |
| 505 | Ga0495684_0018978 | 3300047471 | Bacteria | 5294 |
| 506 | Ga0495684_0089426 | 3300047471 | Bacteria | 2333 |
| 507 | Ga0495593_0000470 | 3300047673 | Bacteria | 22684 |
| 508 | Ga0495593_0013800 | 3300047673 | Bacteria | 4603 |
| 509 | Ga0495602_0360503 | 3300048088 | Bacteria | 1047 |
| 510 | Ga0495614_0022266 | 3300048089 | Bacteria | 2735 |
| 511 | Ga0495614_0038654 | 3300048089 | Bacteria | 2048 |
| 512 | Ga0495626_0013148 | 3300048091 | Bacteria | 4312 |
| 513 | Ga0496100_0045464 | 3300048903 | Bacteria | 2818 |
| 514 | Ga0496100_0427594 | 3300048903 | Bacteria | 1012 |
| 515 | Ga0496101_0272312 | 3300048904 | Bacteria | 1322 |
| 516 | Ga0496102_0457189 | 3300048905 | Bacteria | 1197 |
| 517 | Ga0496103_0016321 | 3300048906 | Bacteria | 4431 |
| 518 | Ga0496103_0387068 | 3300048906 | Bacteria | 898 |
| 519 | Ga0496104_0004634 | 3300048907 | Bacteria | 11973 |
| 520 | Ga0496104_0006887 | 3300048907 | Bacteria | 10025 |
| 521 | Ga0496104_0058668 | 3300048907 | Bacteria | 3643 |
| 522 | Ga0496105_0018687 | 3300048908 | Bacteria | 5579 |
| 523 | Ga0496105_0043484 | 3300048908 | Bacteria | 3705 |
| 524 | Ga0496105_0199333 | 3300048908 | Bacteria | 1634 |
| 525 | Ga0496106_0003643 | 3300048909 | Bacteria | 11488 |
| 526 | Ga0496107_0046717 | 3300048910 | Bacteria | 3116 |
| 527 | Ga0496107_0181458 | 3300048910 | Bacteria | 1563 |
| 528 | Ga0496108_0155438 | 3300048911 | Bacteria | 1975 |
| 529 | Ga0496108_0238859 | 3300048911 | Bacteria | 1580 |
| 530 | Ga0496108_0410894 | 3300048911 | Bacteria | 1182 |
| 531 | Ga0496109_0095265 | 3300048912 | Bacteria | 2756 |
| 532 | Ga0496109_0130510 | 3300048912 | Bacteria | 2345 |
| 533 | Ga0496109_0151503 | 3300048912 | Bacteria | 2171 |
| 534 | Ga0496110_0017143 | 3300048913 | Bacteria | 6055 |
| 535 | Ga0496110_0127423 | 3300048913 | Bacteria | 2297 |
| 536 | Ga0496110_0138630 | 3300048913 | Bacteria | 2199 |
| 537 | Ga0496110_0411456 | 3300048913 | Bacteria | 1233 |
| 538 | Ga0496111_0015674 | 3300048914 | Bacteria | 5209 |
| 539 | Ga0496112_0004525 | 3300048915 | Bacteria | 11810 |
| 540 | Ga0496112_0004583 | 3300048915 | Bacteria | 11751 |
| 541 | Ga0496112_0146271 | 3300048915 | Bacteria | 2332 |
| 542 | Ga0496112_0215534 | 3300048915 | Bacteria | 1876 |
| 543 | Ga0496114_0109828 | 3300048917 | Bacteria | 2362 |
| 544 | Ga0496115_0003360 | 3300048918 | Bacteria | 11473 |
| 545 | Ga0496115_0044258 | 3300048918 | Bacteria | 3550 |
| 546 | Ga0496116_0001930 | 3300048919 | Bacteria | 22336 |
| 547 | Ga0496117_0012405 | 3300048920 | Bacteria | 7516 |
| 548 | Ga0496117_0051814 | 3300048920 | Bacteria | 2897 |
| 549 | Ga0496117_0219744 | 3300048920 | Bacteria | 1058 |
| 550 | Ga0496118_0010865 | 3300048921 | Bacteria | 8960 |
| 551 | Ga0496118_0020331 | 3300048921 | Bacteria | 5889 |
| 552 | Ga0496118_0060316 | 3300048921 | Bacteria | 2817 |
| 553 | Ga0496118_0135418 | 3300048921 | Bacteria | 1573 |
| 554 | Ga0496118_0149541 | 3300048921 | Bacteria | 1464 |
| 555 | Ga0496119_0140410 | 3300048922 | Bacteria | 1305 |
| 556 | Ga0496120_0008022 | 3300048923 | Bacteria | 7770 |
| 557 | Ga0496120_0021337 | 3300048923 | Bacteria | 4095 |
| 558 | Ga0496121_0000811 | 3300048924 | Bacteria | 56962 |
| 559 | Ga0496121_0000870 | 3300048924 | Bacteria | 54546 |
| 560 | Ga0496121_0017520 | 3300048924 | Bacteria | 7309 |
| 561 | Ga0496121_0024640 | 3300048924 | Bacteria | 5745 |
| 562 | Ga0496121_0174913 | 3300048924 | Bacteria | 1555 |
| 563 | Ga0496121_0230428 | 3300048924 | Bacteria | 1298 |
| 564 | Ga0496123_0054650 | 3300048926 | Bacteria | 2627 |
| 565 | Ga0496124_0002001 | 3300048927 | Bacteria | 27769 |
| 566 | Ga0496124_0046080 | 3300048927 | Bacteria | 3736 |
| 567 | Ga0496124_0051368 | 3300048927 | Bacteria | 3508 |
| 568 | Ga0496124_0099848 | 3300048927 | Bacteria | 2353 |
| 569 | Ga0496124_0355129 | 3300048927 | Bacteria | 1035 |
| 570 | Ga0496125_0000869 | 3300048928 | Bacteria | 48286 |
| 571 | Ga0496125_0006645 | 3300048928 | Bacteria | 12446 |
| 572 | Ga0496125_0015348 | 3300048928 | Bacteria | 7416 |
| 573 | Ga0496125_0018462 | 3300048928 | Bacteria | 6623 |
| 574 | Ga0496125_0026599 | 3300048928 | Bacteria | 5267 |
| 575 | Ga0496125_0066354 | 3300048928 | Bacteria | 2852 |
| 576 | Ga0496125_0108616 | 3300048928 | Bacteria | 2017 |
| 577 | Ga0496125_0212982 | 3300048928 | Bacteria | 1253 |
| 578 | Ga0496125_0322812 | 3300048928 | Bacteria | 935 |
| 579 | Ga0496125_0326778 | 3300048928 | Bacteria | 927 |
| 580 | Ga0496126_0028135 | 3300048929 | Bacteria | 5360 |
| 581 | Ga0496126_0036323 | 3300048929 | Bacteria | 4607 |
| 582 | Ga0496126_0055197 | 3300048929 | Bacteria | 3595 |
| 583 | Ga0496126_0064657 | 3300048929 | Bacteria | 3276 |
| 584 | Ga0496126_0074215 | 3300048929 | Bacteria | 3021 |
| 585 | Ga0496126_0145097 | 3300048929 | Bacteria | 2039 |
| 586 | Ga0496126_0217168 | 3300048929 | Bacteria | 1608 |
| 587 | Ga0496126_0260193 | 3300048929 | Bacteria | 1443 |
| 588 | Ga0496126_0399814 | 3300048929 | Bacteria | 1114 |
| 589 | Ga0501308_015165 | 3300049128 | Bacteria | 911 |
| 590 | Ga0501344_01846 | 3300049133 | Bacteria | 1056 |
| 591 | Ga0495678_066654 | 3300049459 | Bacteria | 1332 |
| 592 | Ga0495678_080423 | 3300049459 | Bacteria | 1171 |
| 593 | Ga0501317_023690 | 3300049533 | Bacteria | 849 |
| 594 | Ga0501031_0002390 | 3300049568 | Bacteria | 11926 |
| 595 | Ga0501032_0001465 | 3300049569 | Bacteria | 18782 |
| 596 | Ga0501032_0009394 | 3300049569 | Bacteria | 7084 |
| 597 | Ga0501032_0111245 | 3300049569 | Bacteria | 1812 |
| 598 | Ga0501033_0000221 | 3300049570 | Bacteria | 54727 |
| 599 | Ga0501033_0014226 | 3300049570 | Bacteria | 6048 |
| 600 | Ga0501033_0161719 | 3300049570 | Bacteria | 1611 |
| 601 | Ga0501034_0063989 | 3300049571 | Bacteria | 3692 |
| 602 | Ga0501034_0387516 | 3300049571 | Bacteria | 1322 |
| 603 | Ga0501036_0112469 | 3300049572 | Bacteria | 2301 |
| 604 | Ga0501036_0116278 | 3300049572 | Bacteria | 2259 |
| 605 | Ga0501036_0149151 | 3300049572 | Bacteria | 1972 |
| 606 | Ga0501036_0185584 | 3300049572 | Bacteria | 1750 |
| 607 | Ga0501037_0000211 | 3300049573 | Bacteria | 51924 |
| 608 | Ga0501037_0199519 | 3300049573 | Bacteria | 1414 |
| 609 | Ga0501038_0117785 | 3300049574 | Bacteria | 2193 |
| 610 | Ga0501038_0214098 | 3300049574 | Bacteria | 1540 |
| 611 | Ga0501039_0004618 | 3300049575 | Bacteria | 10417 |
| 612 | Ga0501039_0073196 | 3300049575 | Bacteria | 2662 |
| 613 | Ga0501039_0078518 | 3300049575 | Bacteria | 2568 |
| 614 | Ga0501041_0022265 | 3300049577 | Bacteria | 3794 |
| 615 | Ga0501041_0168583 | 3300049577 | Bacteria | 1370 |
| 616 | Ga0501042_0102050 | 3300049578 | Bacteria | 2063 |
| 617 | Ga0501042_0417913 | 3300049578 | Bacteria | 972 |
| 618 | Ga0501043_0002234 | 3300049579 | Bacteria | 16494 |
| 619 | Ga0501043_0097788 | 3300049579 | Bacteria | 2307 |
| 620 | Ga0501043_0215386 | 3300049579 | Bacteria | 1487 |
| 621 | Ga0501046_0097963 | 3300049580 | Bacteria | 2252 |
| 622 | Ga0501046_0179534 | 3300049580 | Bacteria | 1584 |
| 623 | Ga0501047_0036900 | 3300049581 | Bacteria | 4724 |
| 624 | Ga0501047_0082949 | 3300049581 | Bacteria | 3081 |
| 625 | Ga0501047_0170043 | 3300049581 | Bacteria | 2048 |
| 626 | Ga0501048_0070529 | 3300049582 | Bacteria | 2468 |
| 627 | Ga0501068_0097814 | 3300049584 | Bacteria | 1816 |
| 628 | Ga0501070_0014987 | 3300049586 | Bacteria | 6522 |
| 629 | Ga0501070_0067905 | 3300049586 | Bacteria | 2952 |
| 630 | Ga0501070_0121560 | 3300049586 | Bacteria | 2158 |
| 631 | Ga0501071_0012141 | 3300049587 | Bacteria | 5829 |
| 632 | Ga0501071_0470326 | 3300049587 | Bacteria | 963 |
| 633 | Ga0501072_0004379 | 3300049588 | Bacteria | 10721 |
| 634 | Ga0501073_0024476 | 3300049589 | Bacteria | 4336 |
| 635 | Ga0501074_0012908 | 3300049590 | Bacteria | 6073 |
| 636 | Ga0501075_0027955 | 3300049591 | Bacteria | 4159 |
| 637 | Ga0501076_0134528 | 3300049592 | Bacteria | 2006 |
| 638 | Ga0501077_0037268 | 3300049593 | Bacteria | 3098 |
| 639 | Ga0501080_0009730 | 3300049742 | Bacteria | 8780 |
| 640 | Ga0501080_0113318 | 3300049742 | Bacteria | 2514 |
| 641 | Ga0501081_0324216 | 3300049743 | Bacteria | 1132 |
| 642 | Ga0501035_0003613 | 3300049822 | Bacteria | 14762 |
| 643 | Ga0501035_0040812 | 3300049822 | Bacteria | 4192 |
| 644 | Ga0501035_0144235 | 3300049822 | Bacteria | 2069 |
| 645 | Ga0501035_0160333 | 3300049822 | Bacteria | 1947 |
| 646 | Ga0501044_0006548 | 3300049823 | Bacteria | 12857 |
| 647 | Ga0501044_0030992 | 3300049823 | Bacteria | 5631 |
| 648 | Ga0501044_0038489 | 3300049823 | Bacteria | 4994 |
| 649 | Ga0501044_0101594 | 3300049823 | Bacteria | 2893 |
| 650 | Ga0501044_0119655 | 3300049823 | Bacteria | 2635 |
| 651 | Ga0501044_0266664 | 3300049823 | Bacteria | 1649 |
| 652 | Ga0501044_0504743 | 3300049823 | Bacteria | 1110 |
| 653 | Ga0501044_0973984 | 3300049823 | Bacteria | 721 |
| 654 | Ga0501045_0081117 | 3300049824 | Bacteria | 2392 |
| 655 | nmdc:mga03683_58931_c1 | 3300050489 | Bacteria | 1619 |
| 656 | nmdc:mga03n38_12117_c1 | 3300050490 | Bacteria | 3235 |
| 657 | nmdc:mga03n38_7962_c1 | 3300050490 | Bacteria | 3776 |
| 658 | nmdc:mga00v17_16675_c2 | 3300050491 | Bacteria | 1545 |
| 659 | nmdc:mga00v17_84585_c1 | 3300050491 | Bacteria | 1986 |
| 660 | nmdc:mga00v17_95829_c1 | 3300050491 | Bacteria | 1868 |
| 661 | nmdc:mga0yw44_13126_c1 | 3300050492 | Bacteria | 4349 |
| 662 | nmdc:mga0yw44_171654_c1 | 3300050492 | Bacteria | 1424 |
| 663 | nmdc:mga0yw44_63003_c1 | 3300050492 | Bacteria | 2279 |
| 664 | nmdc:mga0yw44_63079_c1 | 3300050492 | Bacteria | 2278 |
| 665 | nmdc:mga0k408_153467_c1 | 3300050493 | Bacteria | 1372 |
| 666 | nmdc:mga0k408_61581_c1 | 3300050493 | Bacteria | 935 |
| 667 | nmdc:mga06z11_58021_c1 | 3300050494 | Bacteria | 2007 |
| 668 | nmdc:mga06z11_85331_c1 | 3300050494 | Bacteria | 1703 |
| 669 | nmdc:mga06z11_92058_c1 | 3300050494 | Bacteria | 1648 |
| 670 | nmdc:mga07m45_135204_c1 | 3300050496 | Bacteria | 1427 |
| 671 | nmdc:mga07m45_316726_c1 | 3300050496 | Bacteria | 907 |
| 672 | nmdc:mga07m45_7843_c1 | 3300050496 | Bacteria | 5464 |
| 673 | nmdc:mga07m45_97861_c1 | 3300050496 | Bacteria | 1684 |
| 674 | nmdc:mga08y16_188038_c1 | 3300050511 | Bacteria | 2143 |
| 675 | nmdc:mga08x19_91753_c1 | 3300050514 | Bacteria | 2005 |
| 676 | nmdc:mga0a205_241895_c1 | 3300050515 | Bacteria | 1685 |
| 677 | nmdc:mga0sz30_47631_c1 | 3300050516 | Bacteria | 1812 |
| 678 | nmdc:mga0sz30_6347_c1 | 3300050516 | Bacteria | 4388 |
| 679 | nmdc:mga0sz30_7031_c1 | 3300050516 | Bacteria | 4207 |
| 680 | Ga0495612_0101059 | 3300053078 | Bacteria | 1228 |
| 681 | Ga0500635_0011112 | 3300053080 | Bacteria | 2551 |
| 682 | Ga0495595_0150542 | 3300053084 | Bacteria | 1145 |
| 683 | Ga0495619_0006419 | 3300053085 | Bacteria | 7451 |
| 684 | Ga0495619_0472753 | 3300053085 | Bacteria | 863 |
| 685 | Ga0500643_032856 | 3300053087 | Bacteria | 1572 |
| 686 | Ga0500581_049278 | 3300053089 | Bacteria | 2150 |
| 687 | Ga0500581_172258 | 3300053089 | Bacteria | 992 |
| 688 | Ga0500566_0000055 | 3300053094 | Bacteria | 54414 |
| 689 | Ga0500566_0003437 | 3300053094 | Bacteria | 9442 |
| 690 | Ga0500566_0038668 | 3300053094 | Bacteria | 2760 |
| 691 | Ga0500641_0001366 | 3300053096 | Bacteria | 8686 |
| 692 | Ga0500650_0000245 | 3300053098 | Bacteria | 13194 |
| 693 | Ga0500554_006966 | 3300053102 | Bacteria | 2573 |
| 694 | Ga0500556_0000006 | 3300053104 | Bacteria | 453982 |
| 695 | Ga0500569_002880 | 3300053109 | Bacteria | 3446 |
| 696 | Ga0500591_020057 | 3300053115 | Bacteria | 3241 |
| 697 | Ga0500595_001016 | 3300053119 | Bacteria | 15748 |
| 698 | Ga0500595_002547 | 3300053119 | Bacteria | 8931 |
| 699 | Ga0500595_077621 | 3300053119 | Bacteria | 976 |
| 700 | Ga0500608_000604 | 3300053122 | Bacteria | 13230 |
| 701 | Ga0500608_027696 | 3300053122 | Bacteria | 2672 |
| 702 | Ga0500642_0000004 | 3300053130 | Bacteria | 433122 |
| 703 | Ga0500652_000294 | 3300053131 | Bacteria | 18164 |
| 704 | Ga0500658_0028806 | 3300053134 | Bacteria | 2157 |
| 705 | Ga0500559_0000362 | 3300053136 | Bacteria | 33750 |
| 706 | Ga0500559_0019096 | 3300053136 | Bacteria | 2896 |
| 707 | Ga0500568_0001522 | 3300053139 | Bacteria | 14778 |
| 708 | Ga0500568_0050342 | 3300053139 | Bacteria | 1642 |
| 709 | Ga0500586_017738 | 3300053145 | Bacteria | 2184 |
| 710 | Ga0500590_025848 | 3300053148 | Bacteria | 3049 |
| 711 | Ga0500590_125280 | 3300053148 | Bacteria | 1197 |
| 712 | Ga0500603_000630 | 3300053150 | Bacteria | 8688 |
| 713 | Ga0500604_0002744 | 3300053151 | Bacteria | 4784 |
| 714 | Ga0500616_0000022 | 3300053153 | Bacteria | 460463 |
| 715 | Ga0500616_0000244 | 3300053153 | Bacteria | 85079 |
| 716 | Ga0500622_0000953 | 3300053156 | Bacteria | 24595 |
| 717 | Ga0500630_152704 | 3300053159 | Bacteria | 976 |
| 718 | Ga0500633_0061126 | 3300053160 | Bacteria | 1325 |
| 719 | Ga0500634_0011130 | 3300053161 | Bacteria | 4627 |
| 720 | Ga0500638_000160 | 3300053162 | Bacteria | 13163 |
| 721 | Ga0500638_025570 | 3300053162 | Bacteria | 2823 |
| 722 | Ga0500639_026342 | 3300053163 | Bacteria | 3072 |
| 723 | Ga0500639_184390 | 3300053163 | Bacteria | 918 |
| 724 | Ga0500636_0004749 | 3300053177 | Bacteria | 7704 |
| 725 | Ga0500637_0000180 | 3300053178 | Bacteria | 23612 |
| 726 | Ga0500637_0026584 | 3300053178 | Bacteria | 3189 |
| 727 | Ga0500637_0117530 | 3300053178 | Bacteria | 1542 |
| 728 | Ga0500637_0132267 | 3300053178 | Bacteria | 1446 |
| 729 | Ga0500567_062807 | 3300053723 | Bacteria | 1657 |
| 730 | Ga0500645_043501 | 3300053730 | Bacteria | 1323 |
| 731 | Ga0500552_018595 | 3300053733 | Bacteria | 965 |
| 732 | Ga0500596_001070 | 3300053735 | Bacteria | 5519 |
| 733 | Ga0501084_0132762 | 3300054114 | Bacteria | 2096 |
| 734 | Ga0587093_015825 | 3300059478 | Bacteria | 956 |
| 735 | Ga0587066_033408 | 3300059490 | Bacteria | 930 |
| 736 | Ga0587077_039774 | 3300059493 | Bacteria | 939 |
| 737 | Ga0587080_027782 | 3300059503 | Bacteria | 968 |
| 738 | Ga0587082_026592 | 3300059504 | Bacteria | 980 |
| 739 | Ga0587083_0049948 | 3300059505 | Bacteria | 908 |
| 740 | Ga0587083_0053841 | 3300059505 | Bacteria | 886 |
| 741 | Ga0587085_024953 | 3300059506 | Bacteria | 942 |
| 742 | Ga0587088_035480 | 3300059508 | Bacteria | 914 |
| 743 | Ga0587091_038584 | 3300059511 | Bacteria | 932 |
| 744 | Ga0587106_015136 | 3300059605 | Bacteria | 1073 |
| 745 | Ga0587125_010223 | 3300059607 | Bacteria | 965 |
| 746 | Ga0587101_022396 | 3300059623 | Bacteria | 921 |
| 747 | Ga0587113_008368 | 3300059625 | Bacteria | 918 |
| 748 | Ga0587115_019465 | 3300059626 | Bacteria | 934 |
| 749 | Ga0587117_019089 | 3300059627 | Bacteria | 939 |
| 750 | Ga0587130_008774 | 3300059631 | Bacteria | 964 |
| 751 | Ga0587062_019188 | 3300059639 | Bacteria | 952 |
| 752 | Ga0587062_020778 | 3300059639 | Bacteria | 929 |
| 753 | Ga0587069_016120 | 3300059642 | Bacteria | 1064 |
| 754 | Ga0587069_030050 | 3300059642 | Bacteria | 873 |
| 755 | Ga0587079_034016 | 3300059647 | Bacteria | 995 |
| 756 | Ga0587108_006445 | 3300059653 | Bacteria | 909 |
| 757 | Ga0501082_0553466 | 3300060353 | Bacteria | 1006 |
| 758 | Ga0530510_0031863 | 3300061734 | Bacteria | 3791 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300046642 | Ga0495634_0320167 | Ga0495634_0320167_10_741 | 176 |
| 2 | 3300049589 | Ga0501073_0024476 | Ga0501073_0024476_3426_4256 | 177 |
| 3 | 3300009093 | Ga0105240_10007949 | Ga0105240_1000794915 | 181 |
| 4 | 3300009545 | Ga0105237_10014927 | Ga0105237_100149272 | 181 |
| 5 | 3300035170 | Ga0373943_0035254 | Ga0373943_0035254_1597_2325 | 181 |
| 6 | 3300035692 | Ga0373935_0398511 | Ga0373935_0398511_88_924 | 181 |
| 7 | 3300046459 | Ga0495629_0004806 | Ga0495629_0004806_2591_3427 | 181 |
| 8 | 3300046462 | Ga0495651_0343390 | Ga0495651_0343390_62_898 | 181 |
| 9 | 3300046463 | Ga0495653_0215187 | Ga0495653_0215187_69_905 | 181 |
| 10 | 3300046557 | Ga0495622_0007496 | Ga0495622_0007496_1472_2308 | 181 |
| 11 | 3300046663 | Ga0495635_0003646 | Ga0495635_0003646_6734_7570 | 181 |
| 12 | 3300047317 | Ga0495604_0020841 | Ga0495604_0020841_1264_2100 | 181 |
| 13 | 3300047321 | Ga0495676_0475670 | Ga0495676_0475670_73_801 | 181 |
| 14 | 3300047673 | Ga0495593_0013800 | Ga0495593_0013800_2755_3591 | 181 |
| 15 | 3300048089 | Ga0495614_0038654 | Ga0495614_0038654_805_1641 | 181 |
| 16 | 3300048907 | Ga0496104_0006887 | Ga0496104_0006887_6772_7596 | 181 |
| 17 | 3300048908 | Ga0496105_0018687 | Ga0496105_0018687_1363_2187 | 181 |
| 18 | 3300048921 | Ga0496118_0149541 | Ga0496118_0149541_483_1319 | 181 |
| 19 | 3300048923 | Ga0496120_0008022 | Ga0496120_0008022_408_1232 | 181 |
| 20 | 3300048928 | Ga0496125_0006645 | Ga0496125_0006645_6459_7337 | 181 |
| 21 | 3300048928 | Ga0496125_0026599 | Ga0496125_0026599_544_1380 | 181 |
| 22 | 3300048929 | Ga0496126_0074215 | Ga0496126_0074215_1648_2484 | 181 |
| 23 | 3300049571 | Ga0501034_0063989 | Ga0501034_0063989_1968_2786 | 181 |
| 24 | 3300053119 | Ga0500595_077621 | Ga0500595_077621_99_935 | 181 |
| 25 | 3300053136 | Ga0500559_0019096 | Ga0500559_0019096_431_1267 | 181 |
| 26 | 3300046506 | Ga0495583_0081903 | Ga0495583_0081903_138_974 | 183 |
| 27 | 3300046507 | Ga0495606_0034430 | Ga0495606_0034430_808_1644 | 183 |
| 28 | 3300046524 | Ga0495648_0052615 | Ga0495648_0052615_1268_2104 | 183 |
| 29 | 3300046529 | Ga0495652_0031563 | Ga0495652_0031563_1539_2375 | 183 |
| 30 | 3300046660 | Ga0495625_0218111 | Ga0495625_0218111_280_1116 | 183 |
| 31 | 3300044765 | Ga0466970_0171981 | Ga0466970_0171981_111_881 | 185 |
| 32 | 3300005335 | Ga0070666_10143604 | Ga0070666_101436042 | 186 |
| 33 | 3300009177 | Ga0105248_10013528 | Ga0105248_100135282 | 186 |
| 34 | 3300025903 | Ga0207680_10126573 | Ga0207680_101265732 | 186 |
| 35 | 3300046454 | Ga0495592_0026073 | Ga0495592_0026073_2222_3058 | 186 |
| 36 | 3300046477 | Ga0495664_0002994 | Ga0495664_0002994_1646_2482 | 186 |
| 37 | 3300046543 | Ga0495645_0044984 | Ga0495645_0044984_178_1014 | 186 |
| 38 | 3300046559 | Ga0495667_0025221 | Ga0495667_0025221_1880_2716 | 186 |
| 39 | 3300046675 | Ga0495657_0002636 | Ga0495657_0002636_6675_7511 | 186 |
| 40 | 3300046809 | Ga0495600_0126739 | Ga0495600_0126739_530_1366 | 186 |
| 41 | 3300047322 | Ga0495680_0000836 | Ga0495680_0000836_11288_12124 | 186 |
| 42 | 3300047444 | Ga0495675_0036875 | Ga0495675_0036875_1811_2647 | 186 |
| 43 | 3300047471 | Ga0495684_0018978 | Ga0495684_0018978_1381_2217 | 186 |
| 44 | 3300049133 | Ga0501344_01846 | Ga0501344_01846_15_626 | 186 |
| 45 | 3300049823 | Ga0501044_0973984 | Ga0501044_0973984_14_646 | 186 |
| 46 | 3300050492 | nmdc:mga0yw44_13126_c1 | nmdc:mga0yw44_13126_c1_3631_4329 | 186 |
| 47 | 3300053153 | Ga0500616_0000244 | Ga0500616_0000244_59924_60739 | 186 |
| 48 | 3300053160 | Ga0500633_0061126 | Ga0500633_0061126_608_1306 | 186 |
| 49 | 3300049572 | Ga0501036_0112469 | Ga0501036_0112469_407_1297 | 188 |
| 50 | 3300005563 | Ga0068855_100240999 | Ga0068855_1002409992 | 190 |
| 51 | 3300009553 | Ga0105249_10386249 | Ga0105249_103862492 | 190 |
| 52 | 3300020081 | Ga0206354_10001066 | Ga0206354_100010661 | 190 |
| 53 | 3300046522 | Ga0495643_0007651 | Ga0495643_0007651_1465_2316 | 190 |
| 54 | 3300048905 | Ga0496102_0457189 | Ga0496102_0457189_218_1069 | 190 |
| 55 | 3300048906 | Ga0496103_0016321 | Ga0496103_0016321_318_1169 | 190 |
| 56 | 3300048922 | Ga0496119_0140410 | Ga0496119_0140410_18_695 | 190 |
| 57 | 3300048928 | Ga0496125_0000869 | Ga0496125_0000869_28201_29037 | 190 |
| 58 | 3300048929 | Ga0496126_0036323 | Ga0496126_0036323_3336_4172 | 190 |
| 59 | 3300005366 | Ga0070659_100084996 | Ga0070659_1000849964 | 191 |
| 60 | 3300005563 | Ga0068855_100046913 | Ga0068855_1000469134 | 191 |
| 61 | 3300005983 | Ga0081540_1040622 | Ga0081540_10406222 | 191 |
| 62 | 3300009093 | Ga0105240_10470262 | Ga0105240_104702622 | 191 |
| 63 | 3300013105 | Ga0157369_10223644 | Ga0157369_102236442 | 191 |
| 64 | 3300014497 | Ga0182008_10237463 | Ga0182008_102374631 | 191 |
| 65 | 3300025949 | Ga0207667_10482417 | Ga0207667_104824172 | 191 |
| 66 | 3300026142 | Ga0207698_10089767 | Ga0207698_100897674 | 191 |
| 67 | 3300048915 | Ga0496112_0146271 | Ga0496112_0146271_280_1071 | 191 |
| 68 | 3300003203 | JGI25406J46586_10045046 | JGI25406J46586_100450462 | 192 |
| 69 | 3300005981 | Ga0081538_10032665 | Ga0081538_100326652 | 192 |
| 70 | 3300005985 | Ga0081539_10000371 | Ga0081539_1000037129 | 192 |
| 71 | 3300046475 | Ga0495639_0020710 | Ga0495639_0020710_1994_2785 | 192 |
| 72 | 3300046533 | Ga0495640_0012908 | Ga0495640_0012908_1626_2453 | 192 |
| 73 | 3300005937 | Ga0081455_10029499 | Ga0081455_100294992 | 193 |
| 74 | 3300013296 | Ga0157374_10154653 | Ga0157374_101546532 | 193 |
| 75 | 3300046455 | Ga0495603_0007385 | Ga0495603_0007385_4854_5645 | 193 |
| 76 | 3300048903 | Ga0496100_0045464 | Ga0496100_0045464_670_1461 | 193 |
| 77 | 3300048913 | Ga0496110_0017143 | Ga0496110_0017143_4338_5129 | 193 |
| 78 | 3300048914 | Ga0496111_0015674 | Ga0496111_0015674_3780_4571 | 193 |
| 79 | 3300048915 | Ga0496112_0215534 | Ga0496112_0215534_465_1256 | 193 |
| 80 | 3300048918 | Ga0496115_0003360 | Ga0496115_0003360_1439_2230 | 193 |
| 81 | 3300059490 | Ga0587066_033408 | Ga0587066_033408_19_810 | 193 |
| 82 | 3300006051 | Ga0075364_10289396 | Ga0075364_102893961 | 195 |
| 83 | 3300039062 | Ga0400483_031226 | Ga0400483_031226_1264_1995 | 195 |
| 84 | 3300039453 | Ga0436362_0963821 | Ga0436362_0963821_869_1522 | 195 |
| 85 | 3300044735 | Ga0466968_0081500 | Ga0466968_0081500_152_922 | 195 |
| 86 | 3300025915 | Ga0207693_10107617 | Ga0207693_101076172 | 196 |
| 87 | 3300005434 | Ga0070709_10019171 | Ga0070709_100191712 | 197 |
| 88 | 3300005436 | Ga0070713_100079741 | Ga0070713_1000797413 | 197 |
| 89 | 3300005437 | Ga0070710_10020812 | Ga0070710_100208122 | 197 |
| 90 | 3300025913 | Ga0207695_10139657 | Ga0207695_101396572 | 197 |
| 91 | 3300025916 | Ga0207663_10098371 | Ga0207663_100983713 | 197 |
| 92 | 3300035724 | Ga0373933_0133166 | Ga0373933_0133166_255_1046 | 197 |
| 93 | 3300037068 | Ga0373925_0137215 | Ga0373925_0137215_148_984 | 197 |
| 94 | 3300039450 | Ga0436363_0292864 | Ga0436363_0292864_13_726 | 197 |
| 95 | 3300039450 | Ga0436363_1571051 | Ga0436363_1571051_32_745 | 197 |
| 96 | 3300059504 | Ga0587082_026592 | Ga0587082_026592_171_962 | 197 |
| 97 | 3300059639 | Ga0587062_019188 | Ga0587062_019188_11_802 | 197 |
| 98 | 3300006038 | Ga0075365_10145024 | Ga0075365_101450241 | 200 |
| 99 | 3300035692 | Ga0373935_0036686 | Ga0373935_0036686_2055_2882 | 200 |
| 100 | 3300049577 | Ga0501041_0022265 | Ga0501041_0022265_110_901 | 200 |
| 101 | 3300050492 | nmdc:mga0yw44_171654_c1 | nmdc:mga0yw44_171654_c1_231_1019 | 200 |
| 102 | 3300053139 | Ga0500568_0050342 | Ga0500568_0050342_600_1415 | 200 |
| 103 | 3300005347 | Ga0070668_100084817 | Ga0070668_1000848172 | 201 |
| 104 | 3300005353 | Ga0070669_100023783 | Ga0070669_1000237835 | 201 |
| 105 | 3300005355 | Ga0070671_100000542 | Ga0070671_1000005427 | 201 |
| 106 | 3300005367 | Ga0070667_100035887 | Ga0070667_1000358875 | 201 |
| 107 | 3300005548 | Ga0070665_100001356 | Ga0070665_10000135614 | 201 |
| 108 | 3300005841 | Ga0068863_100150925 | Ga0068863_1001509252 | 201 |
| 109 | 3300005842 | Ga0068858_100039033 | Ga0068858_1000390333 | 201 |
| 110 | 3300005844 | Ga0068862_100034179 | Ga0068862_1000341795 | 201 |
| 111 | 3300009011 | Ga0105251_10001526 | Ga0105251_100015264 | 201 |
| 112 | 3300009101 | Ga0105247_10237703 | Ga0105247_102377031 | 201 |
| 113 | 3300025735 | Ga0207713_1002460 | Ga0207713_10024609 | 201 |
| 114 | 3300025900 | Ga0207710_10105055 | Ga0207710_101050552 | 201 |
| 115 | 3300025923 | Ga0207681_10000503 | Ga0207681_100005038 | 201 |
| 116 | 3300025931 | Ga0207644_10001520 | Ga0207644_100015205 | 201 |
| 117 | 3300025941 | Ga0207711_10002363 | Ga0207711_1000236316 | 201 |
| 118 | 3300025972 | Ga0207668_10003815 | Ga0207668_100038152 | 201 |
| 119 | 3300025986 | Ga0207658_10197038 | Ga0207658_101970382 | 201 |
| 120 | 3300026035 | Ga0207703_10339404 | Ga0207703_103394042 | 201 |
| 121 | 3300028379 | Ga0268266_10000534 | Ga0268266_1000053414 | 201 |
| 122 | 3300028380 | Ga0268265_10125312 | Ga0268265_101253123 | 201 |
| 123 | 3300048906 | Ga0496103_0387068 | Ga0496103_0387068_85_825 | 201 |
| 124 | 3300048920 | Ga0496117_0051814 | Ga0496117_0051814_1985_2725 | 201 |
| 125 | 3300048921 | Ga0496118_0010865 | Ga0496118_0010865_5495_6235 | 201 |
| 126 | 3300048923 | Ga0496120_0021337 | Ga0496120_0021337_3252_3992 | 201 |
| 127 | 3300048924 | Ga0496121_0017520 | Ga0496121_0017520_6521_7261 | 201 |
| 128 | 3300048926 | Ga0496123_0054650 | Ga0496123_0054650_956_1696 | 201 |
| 129 | 3300048927 | Ga0496124_0051368 | Ga0496124_0051368_646_1386 | 201 |
| 130 | 3300048928 | Ga0496125_0066354 | Ga0496125_0066354_1984_2724 | 201 |
| 131 | 3300048929 | Ga0496126_0055197 | Ga0496126_0055197_754_1494 | 201 |
| 132 | 3300049568 | Ga0501031_0002390 | Ga0501031_0002390_4993_5784 | 201 |
| 133 | 3300049569 | Ga0501032_0001465 | Ga0501032_0001465_7296_8087 | 201 |
| 134 | 3300049570 | Ga0501033_0000221 | Ga0501033_0000221_50485_51276 | 201 |
| 135 | 3300049572 | Ga0501036_0149151 | Ga0501036_0149151_583_1374 | 201 |
| 136 | 3300049573 | Ga0501037_0000211 | Ga0501037_0000211_49522_50313 | 201 |
| 137 | 3300049574 | Ga0501038_0117785 | Ga0501038_0117785_956_1747 | 201 |
| 138 | 3300049575 | Ga0501039_0004618 | Ga0501039_0004618_4975_5766 | 201 |
| 139 | 3300049575 | Ga0501039_0073196 | Ga0501039_0073196_510_1301 | 201 |
| 140 | 3300049579 | Ga0501043_0002234 | Ga0501043_0002234_6213_7004 | 201 |
| 141 | 3300049580 | Ga0501046_0097963 | Ga0501046_0097963_351_1142 | 201 |
| 142 | 3300049584 | Ga0501068_0097814 | Ga0501068_0097814_883_1674 | 201 |
| 143 | 3300049822 | Ga0501035_0003613 | Ga0501035_0003613_10432_11223 | 201 |
| 144 | 3300049823 | Ga0501044_0030992 | Ga0501044_0030992_2008_2799 | 201 |
| 145 | 3300050493 | nmdc:mga0k408_61581_c1 | nmdc:mga0k408_61581_c1_171_911 | 201 |
| 146 | 3300005455 | Ga0070663_100001941 | Ga0070663_10000194110 | 202 |
| 147 | 3300005985 | Ga0081539_10075608 | Ga0081539_100756082 | 202 |
| 148 | 3300006038 | Ga0075365_10006761 | Ga0075365_100067615 | 202 |
| 149 | 3300006038 | Ga0075365_10087096 | Ga0075365_100870961 | 202 |
| 150 | 3300006051 | Ga0075364_10165743 | Ga0075364_101657431 | 202 |
| 151 | 3300006177 | Ga0075362_10068248 | Ga0075362_100682482 | 202 |
| 152 | 3300006186 | Ga0075369_10009920 | Ga0075369_100099202 | 202 |
| 153 | 3300006186 | Ga0075369_10049655 | Ga0075369_100496551 | 202 |
| 154 | 3300006353 | Ga0075370_10184506 | Ga0075370_101845062 | 202 |
| 155 | 3300006946 | Ga0079104_1041320 | Ga0079104_10413202 | 202 |
| 156 | 3300025295 | Ga0209564_1010723 | Ga0209564_10107233 | 202 |
| 157 | 3300026067 | Ga0207678_10237780 | Ga0207678_102377801 | 202 |
| 158 | 3300027512 | Ga0209179_1015611 | Ga0209179_10156112 | 202 |
| 159 | 3300028379 | Ga0268266_10465051 | Ga0268266_104650512 | 202 |
| 160 | 3300028380 | Ga0268265_10853020 | Ga0268265_108530201 | 202 |
| 161 | 3300031238 | Ga0265332_10079800 | Ga0265332_100798002 | 202 |
| 162 | 3300031711 | Ga0265314_10188651 | Ga0265314_101886511 | 202 |
| 163 | 3300046460 | Ga0495638_0017844 | Ga0495638_0017844_601_1389 | 202 |
| 164 | 3300046460 | Ga0495638_0034495 | Ga0495638_0034495_2369_3112 | 202 |
| 165 | 3300046512 | Ga0495610_0027759 | Ga0495610_0027759_1344_2132 | 202 |
| 166 | 3300046513 | Ga0495616_0056120 | Ga0495616_0056120_716_1504 | 202 |
| 167 | 3300046542 | Ga0495597_0042608 | Ga0495597_0042608_934_1722 | 202 |
| 168 | 3300046557 | Ga0495622_0022209 | Ga0495622_0022209_392_1180 | 202 |
| 169 | 3300046665 | Ga0495661_0033443 | Ga0495661_0033443_240_1028 | 202 |
| 170 | 3300046674 | Ga0495588_0044719 | Ga0495588_0044719_917_1705 | 202 |
| 171 | 3300047320 | Ga0495672_0219222 | Ga0495672_0219222_16_804 | 202 |
| 172 | 3300048088 | Ga0495602_0360503 | Ga0495602_0360503_90_878 | 202 |
| 173 | 3300048091 | Ga0495626_0013148 | Ga0495626_0013148_195_983 | 202 |
| 174 | 3300048903 | Ga0496100_0427594 | Ga0496100_0427594_81_869 | 202 |
| 175 | 3300048919 | Ga0496116_0001930 | Ga0496116_0001930_12814_13602 | 202 |
| 176 | 3300048921 | Ga0496118_0020331 | Ga0496118_0020331_3671_4459 | 202 |
| 177 | 3300048924 | Ga0496121_0024640 | Ga0496121_0024640_3127_3915 | 202 |
| 178 | 3300048927 | Ga0496124_0046080 | Ga0496124_0046080_1338_2126 | 202 |
| 179 | 3300048928 | Ga0496125_0018462 | Ga0496125_0018462_4646_5434 | 202 |
| 180 | 3300048928 | Ga0496125_0108616 | Ga0496125_0108616_1190_1978 | 202 |
| 181 | 3300049459 | Ga0495678_080423 | Ga0495678_080423_168_956 | 202 |
| 182 | 3300049823 | Ga0501044_0006548 | Ga0501044_0006548_6998_7741 | 202 |
| 183 | 3300049823 | Ga0501044_0101594 | Ga0501044_0101594_506_1291 | 202 |
| 184 | 3300050489 | nmdc:mga03683_58931_c1 | nmdc:mga03683_58931_c1_284_1027 | 202 |
| 185 | 3300050491 | nmdc:mga00v17_16675_c2 | nmdc:mga00v17_16675_c2_534_1277 | 202 |
| 186 | 3300050491 | nmdc:mga00v17_84585_c1 | nmdc:mga00v17_84585_c1_211_999 | 202 |
| 187 | 3300050492 | nmdc:mga0yw44_63079_c1 | nmdc:mga0yw44_63079_c1_958_1746 | 202 |
| 188 | 3300050494 | nmdc:mga06z11_58021_c1 | nmdc:mga06z11_58021_c1_408_1196 | 202 |
| 189 | 3300050496 | nmdc:mga07m45_316726_c1 | nmdc:mga07m45_316726_c1_129_872 | 202 |
| 190 | 3300050516 | nmdc:mga0sz30_47631_c1 | nmdc:mga0sz30_47631_c1_220_963 | 202 |
| 191 | 3300050516 | nmdc:mga0sz30_6347_c1 | nmdc:mga0sz30_6347_c1_2648_3436 | 202 |
| 192 | 3300053087 | Ga0500643_032856 | Ga0500643_032856_712_1530 | 202 |
| 193 | 3300053089 | Ga0500581_049278 | Ga0500581_049278_1082_1870 | 202 |
| 194 | 3300053094 | Ga0500566_0000055 | Ga0500566_0000055_45394_46182 | 202 |
| 195 | 3300053096 | Ga0500641_0001366 | Ga0500641_0001366_7653_8441 | 202 |
| 196 | 3300053098 | Ga0500650_0000245 | Ga0500650_0000245_213_1001 | 202 |
| 197 | 3300053104 | Ga0500556_0000006 | Ga0500556_0000006_224044_224832 | 202 |
| 198 | 3300053109 | Ga0500569_002880 | Ga0500569_002880_1588_2376 | 202 |
| 199 | 3300053122 | Ga0500608_000604 | Ga0500608_000604_5520_6308 | 202 |
| 200 | 3300053130 | Ga0500642_0000004 | Ga0500642_0000004_258437_259225 | 202 |
| 201 | 3300053131 | Ga0500652_000294 | Ga0500652_000294_10057_10845 | 202 |
| 202 | 3300053134 | Ga0500658_0028806 | Ga0500658_0028806_969_1757 | 202 |
| 203 | 3300053136 | Ga0500559_0000362 | Ga0500559_0000362_30573_31361 | 202 |
| 204 | 3300053139 | Ga0500568_0001522 | Ga0500568_0001522_5132_5920 | 202 |
| 205 | 3300053148 | Ga0500590_125280 | Ga0500590_125280_358_1146 | 202 |
| 206 | 3300053151 | Ga0500604_0002744 | Ga0500604_0002744_1012_1800 | 202 |
| 207 | 3300053153 | Ga0500616_0000022 | Ga0500616_0000022_222452_223240 | 202 |
| 208 | 3300053156 | Ga0500622_0000953 | Ga0500622_0000953_13715_14503 | 202 |
| 209 | 3300053177 | Ga0500636_0004749 | Ga0500636_0004749_5766_6554 | 202 |
| 210 | 3300053178 | Ga0500637_0026584 | Ga0500637_0026584_841_1629 | 202 |
| 211 | 3300060353 | Ga0501082_0553466 | Ga0501082_0553466_167_910 | 202 |
| 212 | 3300005530 | Ga0070679_100103273 | Ga0070679_1001032732 | 203 |
| 213 | 3300005544 | Ga0070686_100303674 | Ga0070686_1003036741 | 203 |
| 214 | 3300025912 | Ga0207707_10299982 | Ga0207707_102999821 | 203 |
| 215 | 3300025939 | Ga0207665_10113232 | Ga0207665_101132322 | 203 |
| 216 | 3300049571 | Ga0501034_0387516 | Ga0501034_0387516_316_1230 | 203 |
| 217 | 3300049573 | Ga0501037_0199519 | Ga0501037_0199519_32_856 | 203 |
| 218 | 3300049578 | Ga0501042_0102050 | Ga0501042_0102050_59_883 | 203 |
| 219 | 3300049587 | Ga0501071_0012141 | Ga0501071_0012141_2987_3811 | 203 |
| 220 | 3300049588 | Ga0501072_0004379 | Ga0501072_0004379_2890_3714 | 203 |
| 221 | 3300049591 | Ga0501075_0027955 | Ga0501075_0027955_790_1614 | 203 |
| 222 | 3300049593 | Ga0501077_0037268 | Ga0501077_0037268_1128_1952 | 203 |
| 223 | 3300049743 | Ga0501081_0324216 | Ga0501081_0324216_291_1115 | 203 |
| 224 | 3300049824 | Ga0501045_0081117 | Ga0501045_0081117_21_845 | 203 |
| 225 | 3300054114 | Ga0501084_0132762 | Ga0501084_0132762_975_1799 | 203 |
| 226 | 3300061734 | Ga0530510_0031863 | Ga0530510_0031863_1959_2783 | 203 |
| 227 | 3300037312 | Ga0395899_0046650 | Ga0395899_0046650_1213_2004 | 204 |
| 228 | 3300037466 | Ga0395898_0033290 | Ga0395898_0033290_3322_4113 | 204 |
| 229 | 3300037853 | Ga0436364_1337275 | Ga0436364_1337275_2611_3402 | 204 |
| 230 | 3300039437 | Ga0436365_1359706 | Ga0436365_1359706_764_1555 | 204 |
| 231 | 3300046455 | Ga0495603_0298947 | Ga0495603_0298947_24_815 | 204 |
| 232 | 3300005329 | Ga0070683_100009865 | Ga0070683_1000098653 | 205 |
| 233 | 3300005336 | Ga0070680_100036908 | Ga0070680_1000369082 | 205 |
| 234 | 3300005336 | Ga0070680_100574888 | Ga0070680_1005748881 | 205 |
| 235 | 3300005436 | Ga0070713_100025592 | Ga0070713_1000255925 | 205 |
| 236 | 3300005458 | Ga0070681_10001077 | Ga0070681_1000107720 | 205 |
| 237 | 3300005458 | Ga0070681_10132401 | Ga0070681_101324012 | 205 |
| 238 | 3300005530 | Ga0070679_100005644 | Ga0070679_1000056449 | 205 |
| 239 | 3300005530 | Ga0070679_100028700 | Ga0070679_1000287004 | 205 |
| 240 | 3300005530 | Ga0070679_100097238 | Ga0070679_1000972382 | 205 |
| 241 | 3300005535 | Ga0070684_100008528 | Ga0070684_1000085285 | 205 |
| 242 | 3300005535 | Ga0070684_100133161 | Ga0070684_1001331612 | 205 |
| 243 | 3300005547 | Ga0070693_100089949 | Ga0070693_1000899492 | 205 |
| 244 | 3300006028 | Ga0070717_10003277 | Ga0070717_100032776 | 205 |
| 245 | 3300009093 | Ga0105240_10093949 | Ga0105240_100939493 | 205 |
| 246 | 3300009551 | Ga0105238_10021262 | Ga0105238_100212624 | 205 |
| 247 | 3300010375 | Ga0105239_10053677 | Ga0105239_100536772 | 205 |
| 248 | 3300013296 | Ga0157374_10080278 | Ga0157374_100802783 | 205 |
| 249 | 3300020069 | Ga0197907_11428149 | Ga0197907_114281491 | 205 |
| 250 | 3300020076 | Ga0206355_1140956 | Ga0206355_11409561 | 205 |
| 251 | 3300020078 | Ga0206352_11297536 | Ga0206352_112975361 | 205 |
| 252 | 3300025297 | Ga0209758_1001900 | Ga0209758_10019005 | 205 |
| 253 | 3300025912 | Ga0207707_10001830 | Ga0207707_100018305 | 205 |
| 254 | 3300025912 | Ga0207707_10028688 | Ga0207707_100286885 | 205 |
| 255 | 3300025917 | Ga0207660_10413582 | Ga0207660_104135821 | 205 |
| 256 | 3300025917 | Ga0207660_10488399 | Ga0207660_104883991 | 205 |
| 257 | 3300025921 | Ga0207652_10005820 | Ga0207652_100058202 | 205 |
| 258 | 3300025921 | Ga0207652_10315488 | Ga0207652_103154882 | 205 |
| 259 | 3300025924 | Ga0207694_10023665 | Ga0207694_100236654 | 205 |
| 260 | 3300025944 | Ga0207661_10000878 | Ga0207661_100008783 | 205 |
| 261 | 3300025944 | Ga0207661_10092182 | Ga0207661_100921822 | 205 |
| 262 | 3300026078 | Ga0207702_10567464 | Ga0207702_105674641 | 205 |
| 263 | 3300037068 | Ga0373925_0161821 | Ga0373925_0161821_55_846 | 205 |
| 264 | 3300037418 | Ga0395900_0005138 | Ga0395900_0005138_12718_13605 | 205 |
| 265 | 3300037466 | Ga0395898_0035036 | Ga0395898_0035036_649_1440 | 205 |
| 266 | 3300037466 | Ga0395898_0041886 | Ga0395898_0041886_3676_4467 | 205 |
| 267 | 3300038443 | Ga0395901_0240173 | Ga0395901_0240173_1080_1871 | 205 |
| 268 | 3300044656 | Ga0466969_0044243 | Ga0466969_0044243_1197_1988 | 205 |
| 269 | 3300044658 | Ga0466972_0000299 | Ga0466972_0000299_21576_22367 | 205 |
| 270 | 3300044658 | Ga0466972_0052825 | Ga0466972_0052825_95_886 | 205 |
| 271 | 3300044684 | Ga0466966_0002843 | Ga0466966_0002843_6523_7314 | 205 |
| 272 | 3300044693 | Ga0466961_0002447 | Ga0466961_0002447_60_851 | 205 |
| 273 | 3300044693 | Ga0466961_0141153 | Ga0466961_0141153_585_1421 | 205 |
| 274 | 3300044694 | Ga0466963_0095903 | Ga0466963_0095903_754_1545 | 205 |
| 275 | 3300044735 | Ga0466968_0002351 | Ga0466968_0002351_1013_1804 | 205 |
| 276 | 3300044901 | Ga0466960_0097824 | Ga0466960_0097824_477_1268 | 205 |
| 277 | 3300045976 | Ga0466967_0070195 | Ga0466967_0070195_291_1082 | 205 |
| 278 | 3300046515 | Ga0495620_0040172 | Ga0495620_0040172_539_1330 | 205 |
| 279 | 3300046543 | Ga0495645_0015358 | Ga0495645_0015358_3985_4776 | 205 |
| 280 | 3300048913 | Ga0496110_0138630 | Ga0496110_0138630_128_919 | 205 |
| 281 | 3300048918 | Ga0496115_0044258 | Ga0496115_0044258_1241_2032 | 205 |
| 282 | 3300048929 | Ga0496126_0064657 | Ga0496126_0064657_1194_1985 | 205 |
| 283 | 3300049570 | Ga0501033_0014226 | Ga0501033_0014226_777_1598 | 205 |
| 284 | 3300049574 | Ga0501038_0214098 | Ga0501038_0214098_355_1176 | 205 |
| 285 | 3300049580 | Ga0501046_0179534 | Ga0501046_0179534_692_1513 | 205 |
| 286 | 3300049581 | Ga0501047_0036900 | Ga0501047_0036900_1878_2699 | 205 |
| 287 | 3300049582 | Ga0501048_0070529 | Ga0501048_0070529_1636_2457 | 205 |
| 288 | 3300049586 | Ga0501070_0067905 | Ga0501070_0067905_240_1061 | 205 |
| 289 | 3300049742 | Ga0501080_0113318 | Ga0501080_0113318_1394_2215 | 205 |
| 290 | 3300049822 | Ga0501035_0040812 | Ga0501035_0040812_1512_2333 | 205 |
| 291 | 3300049823 | Ga0501044_0504743 | Ga0501044_0504743_171_992 | 205 |
| 292 | 3300053094 | Ga0500566_0003437 | Ga0500566_0003437_2238_3029 | 205 |
| 293 | 3300053115 | Ga0500591_020057 | Ga0500591_020057_2057_2848 | 205 |
| 294 | 3300053122 | Ga0500608_027696 | Ga0500608_027696_1302_2093 | 205 |
| 295 | 3300053145 | Ga0500586_017738 | Ga0500586_017738_1240_2028 | 205 |
| 296 | 3300053148 | Ga0500590_025848 | Ga0500590_025848_1375_2166 | 205 |
| 297 | 3300053159 | Ga0500630_152704 | Ga0500630_152704_45_836 | 205 |
| 298 | 3300053163 | Ga0500639_026342 | Ga0500639_026342_2148_2939 | 205 |
| 299 | 3300053178 | Ga0500637_0132267 | Ga0500637_0132267_642_1433 | 205 |
| 300 | 3300053723 | Ga0500567_062807 | Ga0500567_062807_123_911 | 205 |
| 301 | 3300053735 | Ga0500596_001070 | Ga0500596_001070_2264_3055 | 205 |
| 302 | 3300059607 | Ga0587125_010223 | Ga0587125_010223_19_810 | 205 |
| 303 | 3300059626 | Ga0587115_019465 | Ga0587115_019465_16_807 | 205 |
| 304 | 3300059627 | Ga0587117_019089 | Ga0587117_019089_21_860 | 205 |
| 305 | 3300059639 | Ga0587062_020778 | Ga0587062_020778_20_856 | 205 |
| 306 | iso_pu_bacteria | 2884298095 | 2884298507 | 205 |
| 307 | 3300003214 | JGI25165J46597_1009200 | JGI25165J46597_10092002 | 206 |
| 308 | 3300005334 | Ga0068869_100064257 | Ga0068869_1000642572 | 206 |
| 309 | 3300005341 | Ga0070691_10048168 | Ga0070691_100481682 | 206 |
| 310 | 3300005365 | Ga0070688_100342197 | Ga0070688_1003421972 | 206 |
| 311 | 3300005434 | Ga0070709_10014869 | Ga0070709_100148692 | 206 |
| 312 | 3300005434 | Ga0070709_10044929 | Ga0070709_100449294 | 206 |
| 313 | 3300005435 | Ga0070714_100073568 | Ga0070714_1000735682 | 206 |
| 314 | 3300005436 | Ga0070713_100045297 | Ga0070713_1000452971 | 206 |
| 315 | 3300005436 | Ga0070713_100348883 | Ga0070713_1003488832 | 206 |
| 316 | 3300005437 | Ga0070710_10002858 | Ga0070710_100028582 | 206 |
| 317 | 3300005455 | Ga0070663_100060988 | Ga0070663_1000609882 | 206 |
| 318 | 3300005459 | Ga0068867_100176355 | Ga0068867_1001763552 | 206 |
| 319 | 3300005547 | Ga0070693_100059830 | Ga0070693_1000598302 | 206 |
| 320 | 3300005577 | Ga0068857_100166962 | Ga0068857_1001669622 | 206 |
| 321 | 3300005617 | Ga0068859_100093827 | Ga0068859_1000938272 | 206 |
| 322 | 3300005840 | Ga0068870_10164917 | Ga0068870_101649171 | 206 |
| 323 | 3300005841 | Ga0068863_100074583 | Ga0068863_1000745832 | 206 |
| 324 | 3300006028 | Ga0070717_10018898 | Ga0070717_100188982 | 206 |
| 325 | 3300006028 | Ga0070717_10053768 | Ga0070717_100537682 | 206 |
| 326 | 3300006042 | Ga0075368_10028408 | Ga0075368_100284082 | 206 |
| 327 | 3300006051 | Ga0075364_10110184 | Ga0075364_101101842 | 206 |
| 328 | 3300006173 | Ga0070716_100005454 | Ga0070716_1000054542 | 206 |
| 329 | 3300006175 | Ga0070712_100051297 | Ga0070712_1000512973 | 206 |
| 330 | 3300006177 | Ga0075362_10028375 | Ga0075362_100283752 | 206 |
| 331 | 3300006353 | Ga0075370_10136094 | Ga0075370_101360941 | 206 |
| 332 | 3300006931 | Ga0097620_100093827 | Ga0097620_1000938273 | 206 |
| 333 | 3300009101 | Ga0105247_10362207 | Ga0105247_103622071 | 206 |
| 334 | 3300020069 | Ga0197907_10122096 | Ga0197907_101220961 | 206 |
| 335 | 3300020070 | Ga0206356_11227967 | Ga0206356_112279672 | 206 |
| 336 | 3300020075 | Ga0206349_1112773 | Ga0206349_11127732 | 206 |
| 337 | 3300020077 | Ga0206351_10137541 | Ga0206351_101375411 | 206 |
| 338 | 3300020078 | Ga0206352_10853849 | Ga0206352_108538491 | 206 |
| 339 | 3300020078 | Ga0206352_11018583 | Ga0206352_110185831 | 206 |
| 340 | 3300020080 | Ga0206350_10047531 | Ga0206350_100475311 | 206 |
| 341 | 3300020081 | Ga0206354_10892454 | Ga0206354_108924541 | 206 |
| 342 | 3300020081 | Ga0206354_11650149 | Ga0206354_116501491 | 206 |
| 343 | 3300020082 | Ga0206353_11260487 | Ga0206353_112604871 | 206 |
| 344 | 3300022467 | Ga0224712_10139243 | Ga0224712_101392431 | 206 |
| 345 | 3300022467 | Ga0224712_10186241 | Ga0224712_101862411 | 206 |
| 346 | 3300025253 | Ga0209677_100170 | Ga0209677_1001705 | 206 |
| 347 | 3300025261 | Ga0209233_1012365 | Ga0209233_10123653 | 206 |
| 348 | 3300025272 | Ga0209455_1007613 | Ga0209455_10076132 | 206 |
| 349 | 3300025898 | Ga0207692_10006838 | Ga0207692_100068384 | 206 |
| 350 | 3300025906 | Ga0207699_10169105 | Ga0207699_101691052 | 206 |
| 351 | 3300025914 | Ga0207671_10099663 | Ga0207671_100996632 | 206 |
| 352 | 3300025915 | Ga0207693_10003895 | Ga0207693_100038959 | 206 |
| 353 | 3300025915 | Ga0207693_10004610 | Ga0207693_100046109 | 206 |
| 354 | 3300025916 | Ga0207663_10054053 | Ga0207663_100540532 | 206 |
| 355 | 3300025927 | Ga0207687_10404930 | Ga0207687_104049301 | 206 |
| 356 | 3300025929 | Ga0207664_10429104 | Ga0207664_104291041 | 206 |
| 357 | 3300025929 | Ga0207664_10501200 | Ga0207664_105012002 | 206 |
| 358 | 3300025939 | Ga0207665_10006607 | Ga0207665_100066076 | 206 |
| 359 | 3300025941 | Ga0207711_10567891 | Ga0207711_105678911 | 206 |
| 360 | 3300025949 | Ga0207667_10152080 | Ga0207667_101520802 | 206 |
| 361 | 3300026067 | Ga0207678_10149983 | Ga0207678_101499832 | 206 |
| 362 | 3300028379 | Ga0268266_10009681 | Ga0268266_100096815 | 206 |
| 363 | 3300028381 | Ga0268264_10000062 | Ga0268264_10000062254 | 206 |
| 364 | 3300030521 | Ga0307511_10085070 | Ga0307511_100850701 | 206 |
| 365 | 3300030521 | Ga0307511_10114742 | Ga0307511_101147422 | 206 |
| 366 | 3300030763 | Ga0265763_1004318 | Ga0265763_10043181 | 206 |
| 367 | 3300030882 | Ga0265764_102331 | Ga0265764_1023311 | 206 |
| 368 | 3300031247 | Ga0265340_10012805 | Ga0265340_100128054 | 206 |
| 369 | 3300031247 | Ga0265340_10097790 | Ga0265340_100977901 | 206 |
| 370 | 3300031249 | Ga0265339_10001952 | Ga0265339_100019524 | 206 |
| 371 | 3300031616 | Ga0307508_10105800 | Ga0307508_101058002 | 206 |
| 372 | 3300031711 | Ga0265314_10087483 | Ga0265314_100874832 | 206 |
| 373 | 3300031730 | Ga0307516_10181291 | Ga0307516_101812912 | 206 |
| 374 | 3300033179 | Ga0307507_10061770 | Ga0307507_100617702 | 206 |
| 375 | 3300033180 | Ga0307510_10024915 | Ga0307510_100249151 | 206 |
| 376 | 3300033544 | Ga0316215_1000881 | Ga0316215_10008812 | 206 |
| 377 | 3300035170 | Ga0373943_0045855 | Ga0373943_0045855_608_1399 | 206 |
| 378 | 3300035695 | Ga0373927_0005757 | Ga0373927_0005757_3795_4586 | 206 |
| 379 | 3300035724 | Ga0373933_0000218 | Ga0373933_0000218_2337_3128 | 206 |
| 380 | 3300036458 | Ga0310112_018378 | Ga0310112_018378_87_878 | 206 |
| 381 | 3300036534 | Ga0310109_018809 | Ga0310109_018809_113_904 | 206 |
| 382 | 3300037068 | Ga0373925_0004991 | Ga0373925_0004991_835_1626 | 206 |
| 383 | 3300037418 | Ga0395900_0013190 | Ga0395900_0013190_528_1319 | 206 |
| 384 | 3300037418 | Ga0395900_0757346 | Ga0395900_0757346_42_833 | 206 |
| 385 | 3300037853 | Ga0436364_0904449 | Ga0436364_0904449_81_779 | 206 |
| 386 | 3300038443 | Ga0395901_0810645 | Ga0395901_0810645_31_822 | 206 |
| 387 | 3300038443 | Ga0395901_1012062 | Ga0395901_1012062_12_746 | 206 |
| 388 | 3300039437 | Ga0436365_1063208 | Ga0436365_1063208_286_984 | 206 |
| 389 | 3300039437 | Ga0436365_1369925 | Ga0436365_1369925_4577_5368 | 206 |
| 390 | 3300039438 | Ga0436360_0832565 | Ga0436360_0832565_2747_3445 | 206 |
| 391 | 3300039447 | Ga0436361_0379028 | Ga0436361_0379028_1661_2455 | 206 |
| 392 | 3300039447 | Ga0436361_0987636 | Ga0436361_0987636_3419_4213 | 206 |
| 393 | 3300039450 | Ga0436363_0436908 | Ga0436363_0436908_292_1083 | 206 |
| 394 | 3300039450 | Ga0436363_0451258 | Ga0436363_0451258_75_773 | 206 |
| 395 | 3300044684 | Ga0466966_0081395 | Ga0466966_0081395_1177_1968 | 206 |
| 396 | 3300044694 | Ga0466963_0237919 | Ga0466963_0237919_229_1020 | 206 |
| 397 | 3300044706 | Ga0466964_0092544 | Ga0466964_0092544_268_1059 | 206 |
| 398 | 3300045836 | Ga0466958_0145600 | Ga0466958_0145600_407_1198 | 206 |
| 399 | 3300045976 | Ga0466967_0115827 | Ga0466967_0115827_1258_2049 | 206 |
| 400 | 3300046476 | Ga0495662_0197010 | Ga0495662_0197010_99_890 | 206 |
| 401 | 3300046491 | Ga0495584_0078381 | Ga0495584_0078381_664_1455 | 206 |
| 402 | 3300046491 | Ga0495584_0115366 | Ga0495584_0115366_463_1254 | 206 |
| 403 | 3300046542 | Ga0495597_0134503 | Ga0495597_0134503_60_851 | 206 |
| 404 | 3300046543 | Ga0495645_0162030 | Ga0495645_0162030_695_1486 | 206 |
| 405 | 3300048909 | Ga0496106_0003643 | Ga0496106_0003643_8305_9096 | 206 |
| 406 | 3300048910 | Ga0496107_0046717 | Ga0496107_0046717_2145_2936 | 206 |
| 407 | 3300048911 | Ga0496108_0238859 | Ga0496108_0238859_188_979 | 206 |
| 408 | 3300048920 | Ga0496117_0012405 | Ga0496117_0012405_4774_5565 | 206 |
| 409 | 3300048920 | Ga0496117_0219744 | Ga0496117_0219744_235_1026 | 206 |
| 410 | 3300048921 | Ga0496118_0060316 | Ga0496118_0060316_43_834 | 206 |
| 411 | 3300048924 | Ga0496121_0000811 | Ga0496121_0000811_5813_6604 | 206 |
| 412 | 3300048924 | Ga0496121_0000870 | Ga0496121_0000870_15797_16588 | 206 |
| 413 | 3300048927 | Ga0496124_0002001 | Ga0496124_0002001_11317_12108 | 206 |
| 414 | 3300048928 | Ga0496125_0015348 | Ga0496125_0015348_2089_2880 | 206 |
| 415 | 3300048928 | Ga0496125_0212982 | Ga0496125_0212982_449_1240 | 206 |
| 416 | 3300048928 | Ga0496125_0322812 | Ga0496125_0322812_103_894 | 206 |
| 417 | 3300048929 | Ga0496126_0028135 | Ga0496126_0028135_14_805 | 206 |
| 418 | 3300048929 | Ga0496126_0145097 | Ga0496126_0145097_157_948 | 206 |
| 419 | 3300048929 | Ga0496126_0260193 | Ga0496126_0260193_404_1195 | 206 |
| 420 | 3300048929 | Ga0496126_0399814 | Ga0496126_0399814_40_831 | 206 |
| 421 | 3300049459 | Ga0495678_066654 | Ga0495678_066654_184_975 | 206 |
| 422 | 3300050491 | nmdc:mga00v17_95829_c1 | nmdc:mga00v17_95829_c1_941_1732 | 206 |
| 423 | 3300050496 | nmdc:mga07m45_97861_c1 | nmdc:mga07m45_97861_c1_336_1127 | 206 |
| 424 | 3300050516 | nmdc:mga0sz30_7031_c1 | nmdc:mga0sz30_7031_c1_65_856 | 206 |
| 425 | 3300053078 | Ga0495612_0101059 | Ga0495612_0101059_163_954 | 206 |
| 426 | 3300053080 | Ga0500635_0011112 | Ga0500635_0011112_1382_2173 | 206 |
| 427 | 3300053084 | Ga0495595_0150542 | Ga0495595_0150542_49_747 | 206 |
| 428 | 3300053094 | Ga0500566_0038668 | Ga0500566_0038668_1359_2150 | 206 |
| 429 | 3300053150 | Ga0500603_000630 | Ga0500603_000630_6202_6993 | 206 |
| 430 | 3300053162 | Ga0500638_025570 | Ga0500638_025570_1393_2184 | 206 |
| 431 | 3300053178 | Ga0500637_0117530 | Ga0500637_0117530_408_1199 | 206 |
| 432 | 3300053733 | Ga0500552_018595 | Ga0500552_018595_55_846 | 206 |
| 433 | 3300059478 | Ga0587093_015825 | Ga0587093_015825_19_858 | 206 |
| 434 | 3300059493 | Ga0587077_039774 | Ga0587077_039774_126_917 | 206 |
| 435 | 3300059506 | Ga0587085_024953 | Ga0587085_024953_91_918 | 206 |
| 436 | 3300059605 | Ga0587106_015136 | Ga0587106_015136_191_988 | 206 |
| 437 | 3300059625 | Ga0587113_008368 | Ga0587113_008368_16_807 | 206 |
| 438 | 3300059642 | Ga0587069_016120 | Ga0587069_016120_37_831 | 206 |
| 439 | 3300005563 | Ga0068855_100024520 | Ga0068855_1000245202 | 207 |
| 440 | 3300005614 | Ga0068856_100000883 | Ga0068856_10000088325 | 207 |
| 441 | 3300006914 | Ga0075436_100045387 | Ga0075436_1000453872 | 207 |
| 442 | 3300009093 | Ga0105240_10061018 | Ga0105240_100610183 | 207 |
| 443 | 3300010159 | Ga0099796_10016687 | Ga0099796_100166872 | 207 |
| 444 | 3300013105 | Ga0157369_10032756 | Ga0157369_100327562 | 207 |
| 445 | 3300020070 | Ga0206356_11019694 | Ga0206356_110196941 | 207 |
| 446 | 3300020075 | Ga0206349_1694165 | Ga0206349_16941651 | 207 |
| 447 | 3300020075 | Ga0206349_1878734 | Ga0206349_18787342 | 207 |
| 448 | 3300020077 | Ga0206351_10685837 | Ga0206351_106858371 | 207 |
| 449 | 3300020077 | Ga0206351_10853499 | Ga0206351_108534992 | 207 |
| 450 | 3300020080 | Ga0206350_10124601 | Ga0206350_101246011 | 207 |
| 451 | 3300020080 | Ga0206350_11301687 | Ga0206350_113016871 | 207 |
| 452 | 3300020082 | Ga0206353_11903621 | Ga0206353_119036212 | 207 |
| 453 | 3300020610 | Ga0154015_1265539 | Ga0154015_12655391 | 207 |
| 454 | 3300020610 | Ga0154015_1529450 | Ga0154015_15294502 | 207 |
| 455 | 3300022467 | Ga0224712_10119344 | Ga0224712_101193442 | 207 |
| 456 | 3300022467 | Ga0224712_10187736 | Ga0224712_101877362 | 207 |
| 457 | 3300025921 | Ga0207652_10394162 | Ga0207652_103941621 | 207 |
| 458 | 3300026078 | Ga0207702_10000318 | Ga0207702_1000031824 | 207 |
| 459 | 3300026078 | Ga0207702_10232747 | Ga0207702_102327471 | 207 |
| 460 | 3300031616 | Ga0307508_10147504 | Ga0307508_101475041 | 207 |
| 461 | 3300037068 | Ga0373925_0130723 | Ga0373925_0130723_35_826 | 207 |
| 462 | 3300037418 | Ga0395900_0187341 | Ga0395900_0187341_1252_2043 | 207 |
| 463 | 3300037418 | Ga0395900_0477755 | Ga0395900_0477755_293_1087 | 207 |
| 464 | 3300037466 | Ga0395898_0070416 | Ga0395898_0070416_1906_2697 | 207 |
| 465 | 3300037466 | Ga0395898_0105024 | Ga0395898_0105024_697_1491 | 207 |
| 466 | 3300038443 | Ga0395901_0154816 | Ga0395901_0154816_263_1054 | 207 |
| 467 | 3300039437 | Ga0436365_0457696 | Ga0436365_0457696_112_903 | 207 |
| 468 | 3300039450 | Ga0436363_1571660 | Ga0436363_1571660_22_813 | 207 |
| 469 | 3300046457 | Ga0495590_0075863 | Ga0495590_0075863_61_852 | 207 |
| 470 | 3300046460 | Ga0495638_0158860 | Ga0495638_0158860_477_1268 | 207 |
| 471 | 3300046525 | Ga0495663_0034611 | Ga0495663_0034611_642_1433 | 207 |
| 472 | 3300046526 | Ga0495666_0154266 | Ga0495666_0154266_72_863 | 207 |
| 473 | 3300046539 | Ga0495621_0065406 | Ga0495621_0065406_452_1243 | 207 |
| 474 | 3300046615 | Ga0495656_0054370 | Ga0495656_0054370_729_1520 | 207 |
| 475 | 3300049569 | Ga0501032_0111245 | Ga0501032_0111245_41_832 | 207 |
| 476 | 3300049575 | Ga0501039_0078518 | Ga0501039_0078518_777_1568 | 207 |
| 477 | 3300049579 | Ga0501043_0097788 | Ga0501043_0097788_1095_1886 | 207 |
| 478 | 3300049581 | Ga0501047_0170043 | Ga0501047_0170043_385_1176 | 207 |
| 479 | 3300049822 | Ga0501035_0160333 | Ga0501035_0160333_189_980 | 207 |
| 480 | 3300049823 | Ga0501044_0266664 | Ga0501044_0266664_160_951 | 207 |
| 481 | 3300050514 | nmdc:mga08x19_91753_c1 | nmdc:mga08x19_91753_c1_619_1413 | 207 |
| 482 | 3300059503 | Ga0587080_027782 | Ga0587080_027782_145_936 | 207 |
| 483 | 3300059511 | Ga0587091_038584 | Ga0587091_038584_103_918 | 207 |
| 484 | 3300005331 | Ga0070670_100359760 | Ga0070670_1003597601 | 208 |
| 485 | 3300005437 | Ga0070710_10412975 | Ga0070710_104129751 | 208 |
| 486 | 3300005468 | Ga0070707_100142842 | Ga0070707_1001428423 | 208 |
| 487 | 3300005983 | Ga0081540_1005811 | Ga0081540_10058115 | 208 |
| 488 | 3300009553 | Ga0105249_10379015 | Ga0105249_103790152 | 208 |
| 489 | 3300013308 | Ga0157375_10239363 | Ga0157375_102393632 | 208 |
| 490 | 3300014968 | Ga0157379_10530911 | Ga0157379_105309112 | 208 |
| 491 | 3300021358 | Ga0213873_10001008 | Ga0213873_100010082 | 208 |
| 492 | 3300021384 | Ga0213876_10003470 | Ga0213876_100034702 | 208 |
| 493 | 3300021384 | Ga0213876_10023883 | Ga0213876_100238832 | 208 |
| 494 | 3300021388 | Ga0213875_10027840 | Ga0213875_100278402 | 208 |
| 495 | 3300025915 | Ga0207693_10304145 | Ga0207693_103041451 | 208 |
| 496 | 3300025972 | Ga0207668_10846220 | Ga0207668_108462201 | 208 |
| 497 | 3300031995 | Ga0307409_100077156 | Ga0307409_1000771564 | 208 |
| 498 | 3300035695 | Ga0373927_0234532 | Ga0373927_0234532_405_1151 | 208 |
| 499 | 3300037068 | Ga0373925_0375173 | Ga0373925_0375173_227_973 | 208 |
| 500 | 3300037471 | Ga0395905_0259901 | Ga0395905_0259901_301_1092 | 208 |
| 501 | 3300037853 | Ga0436364_0281278 | Ga0436364_0281278_30939_31685 | 208 |
| 502 | 3300037853 | Ga0436364_0984338 | Ga0436364_0984338_148_939 | 208 |
| 503 | 3300039437 | Ga0436365_0261699 | Ga0436365_0261699_1873_2619 | 208 |
| 504 | 3300039437 | Ga0436365_0829696 | Ga0436365_0829696_8867_9613 | 208 |
| 505 | 3300039437 | Ga0436365_1436379 | Ga0436365_1436379_112_858 | 208 |
| 506 | 3300039438 | Ga0436360_0851954 | Ga0436360_0851954_203_1033 | 208 |
| 507 | 3300039450 | Ga0436363_0775146 | Ga0436363_0775146_11135_11881 | 208 |
| 508 | 3300039450 | Ga0436363_0802555 | Ga0436363_0802555_1027_1821 | 208 |
| 509 | 3300039453 | Ga0436362_1185069 | Ga0436362_1185069_4541_5287 | 208 |
| 510 | 3300041453 | Ga0451797_0777937 | Ga0451797_0777937_60_851 | 208 |
| 511 | 3300044842 | Ga0466957_0059708 | Ga0466957_0059708_1328_2119 | 208 |
| 512 | 3300047470 | Ga0495681_0038105 | Ga0495681_0038105_965_1753 | 208 |
| 513 | 3300048907 | Ga0496104_0058668 | Ga0496104_0058668_33_764 | 208 |
| 514 | 3300048921 | Ga0496118_0135418 | Ga0496118_0135418_144_935 | 208 |
| 515 | 3300048929 | Ga0496126_0217168 | Ga0496126_0217168_563_1354 | 208 |
| 516 | 3300053161 | Ga0500634_0011130 | Ga0500634_0011130_2499_3287 | 208 |
| 517 | 3300059508 | Ga0587088_035480 | Ga0587088_035480_95_886 | 208 |
| 518 | 3300005353 | Ga0070669_100523000 | Ga0070669_1005230001 | 209 |
| 519 | 3300005548 | Ga0070665_100331908 | Ga0070665_1003319082 | 209 |
| 520 | 3300005843 | Ga0068860_100261639 | Ga0068860_1002616392 | 209 |
| 521 | 3300006881 | Ga0068865_100140332 | Ga0068865_1001403322 | 209 |
| 522 | 3300020080 | Ga0206350_11138243 | Ga0206350_111382431 | 209 |
| 523 | 3300025938 | Ga0207704_10433479 | Ga0207704_104334791 | 209 |
| 524 | 3300026035 | Ga0207703_10302433 | Ga0207703_103024332 | 209 |
| 525 | 3300026075 | Ga0207708_10280685 | Ga0207708_102806852 | 209 |
| 526 | 3300028380 | Ga0268265_10065886 | Ga0268265_100658861 | 209 |
| 527 | 3300028381 | Ga0268264_10353623 | Ga0268264_103536232 | 209 |
| 528 | 3300036401 | Ga0373937_0101471 | Ga0373937_0101471_362_1153 | 209 |
| 529 | 3300046615 | Ga0495656_0028598 | Ga0495656_0028598_140_931 | 209 |
| 530 | 3300048912 | Ga0496109_0130510 | Ga0496109_0130510_978_1781 | 209 |
| 531 | 3300048917 | Ga0496114_0109828 | Ga0496114_0109828_354_1157 | 209 |
| 532 | 3300048924 | Ga0496121_0174913 | Ga0496121_0174913_45_836 | 209 |
| 533 | 3300048927 | Ga0496124_0099848 | Ga0496124_0099848_403_1194 | 209 |
| 534 | 3300049822 | Ga0501035_0144235 | Ga0501035_0144235_440_1192 | 209 |
| 535 | 3300053102 | Ga0500554_006966 | Ga0500554_006966_1226_2017 | 210 |
| 536 | 3300053119 | Ga0500595_001016 | Ga0500595_001016_5185_5976 | 210 |
| 537 | 3300053162 | Ga0500638_000160 | Ga0500638_000160_7153_7944 | 210 |
| 538 | 3300053178 | Ga0500637_0000180 | Ga0500637_0000180_22042_22833 | 210 |
| 539 | 3300006195 | Ga0075366_10118823 | Ga0075366_101188232 | 211 |
| 540 | 3300006353 | Ga0075370_10212095 | Ga0075370_102120952 | 211 |
| 541 | 3300034818 | Ga0373950_0017256 | Ga0373950_0017256_15_713 | 211 |
| 542 | 3300050494 | nmdc:mga06z11_85331_c1 | nmdc:mga06z11_85331_c1_842_1633 | 211 |
| 543 | 3300050496 | nmdc:mga07m45_135204_c1 | nmdc:mga07m45_135204_c1_612_1403 | 211 |
| 544 | 3300053085 | Ga0495619_0472753 | Ga0495619_0472753_10_807 | 211 |
| 545 | 3300059631 | Ga0587130_008774 | Ga0587130_008774_16_870 | 211 |
| 546 | 3300059647 | Ga0587079_034016 | Ga0587079_034016_152_958 | 211 |
| 547 | iso_pu_bacteria | 8016583857 | 8016586158 | 211 |
| 548 | 3300003911 | JGI25405J52794_10031793 | JGI25405J52794_100317932 | 212 |
| 549 | 3300005364 | Ga0070673_100212996 | Ga0070673_1002129961 | 212 |
| 550 | 3300005518 | Ga0070699_100168805 | Ga0070699_1001688052 | 212 |
| 551 | 3300005543 | Ga0070672_100256992 | Ga0070672_1002569921 | 212 |
| 552 | 3300005545 | Ga0070695_100045867 | Ga0070695_1000458672 | 212 |
| 553 | 3300005548 | Ga0070665_100182360 | Ga0070665_1001823602 | 212 |
| 554 | 3300005618 | Ga0068864_100085987 | Ga0068864_1000859873 | 212 |
| 555 | 3300005842 | Ga0068858_100478227 | Ga0068858_1004782272 | 212 |
| 556 | 3300005844 | Ga0068862_100238505 | Ga0068862_1002385052 | 212 |
| 557 | 3300005937 | Ga0081455_10025851 | Ga0081455_100258515 | 212 |
| 558 | 3300005985 | Ga0081539_10025876 | Ga0081539_100258762 | 212 |
| 559 | 3300006353 | Ga0075370_10107073 | Ga0075370_101070732 | 212 |
| 560 | 3300010375 | Ga0105239_10710672 | Ga0105239_107106722 | 212 |
| 561 | 3300012500 | Ga0157314_1005405 | Ga0157314_10054051 | 212 |
| 562 | 3300013296 | Ga0157374_10314643 | Ga0157374_103146432 | 212 |
| 563 | 3300013306 | Ga0163162_10055722 | Ga0163162_100557223 | 212 |
| 564 | 3300014325 | Ga0163163_10026240 | Ga0163163_100262403 | 212 |
| 565 | 3300020070 | Ga0206356_10841646 | Ga0206356_108416462 | 212 |
| 566 | 3300020080 | Ga0206350_10258629 | Ga0206350_102586292 | 212 |
| 567 | 3300020082 | Ga0206353_10006930 | Ga0206353_100069302 | 212 |
| 568 | 3300022467 | Ga0224712_10190267 | Ga0224712_101902671 | 212 |
| 569 | 3300025901 | Ga0207688_10086352 | Ga0207688_100863521 | 212 |
| 570 | 3300025908 | Ga0207643_10070154 | Ga0207643_100701542 | 212 |
| 571 | 3300025919 | Ga0207657_10268499 | Ga0207657_102684992 | 212 |
| 572 | 3300025945 | Ga0207679_10214993 | Ga0207679_102149931 | 212 |
| 573 | 3300028379 | Ga0268266_10001906 | Ga0268266_1000190616 | 212 |
| 574 | 3300028379 | Ga0268266_10394682 | Ga0268266_103946822 | 212 |
| 575 | 3300028380 | Ga0268265_10211107 | Ga0268265_102111071 | 212 |
| 576 | 3300035172 | Ga0373955_0148985 | Ga0373955_0148985_102_896 | 212 |
| 577 | 3300035692 | Ga0373935_0001267 | Ga0373935_0001267_13026_13820 | 212 |
| 578 | 3300035695 | Ga0373927_0000766 | Ga0373927_0000766_22150_22944 | 212 |
| 579 | 3300035725 | Ga0373947_0000310 | Ga0373947_0000310_23710_24504 | 212 |
| 580 | 3300037068 | Ga0373925_0002455 | Ga0373925_0002455_5007_5801 | 212 |
| 581 | 3300046455 | Ga0495603_0000801 | Ga0495603_0000801_6047_6841 | 212 |
| 582 | 3300046459 | Ga0495629_0007739 | Ga0495629_0007739_4196_4990 | 212 |
| 583 | 3300046461 | Ga0495641_0002198 | Ga0495641_0002198_7488_8282 | 212 |
| 584 | 3300046472 | Ga0495580_0038398 | Ga0495580_0038398_2155_2949 | 212 |
| 585 | 3300046473 | Ga0495582_0000855 | Ga0495582_0000855_263_1057 | 212 |
| 586 | 3300046475 | Ga0495639_0000072 | Ga0495639_0000072_29175_29969 | 212 |
| 587 | 3300046476 | Ga0495662_0000572 | Ga0495662_0000572_4522_5316 | 212 |
| 588 | 3300046477 | Ga0495664_0011398 | Ga0495664_0011398_925_1719 | 212 |
| 589 | 3300046499 | Ga0495594_0000046 | Ga0495594_0000046_39985_40779 | 212 |
| 590 | 3300046517 | Ga0495630_0011525 | Ga0495630_0011525_1152_1946 | 212 |
| 591 | 3300046526 | Ga0495666_0003632 | Ga0495666_0003632_2752_3546 | 212 |
| 592 | 3300046531 | Ga0495665_0000128 | Ga0495665_0000128_7566_8360 | 212 |
| 593 | 3300046642 | Ga0495634_0003037 | Ga0495634_0003037_1392_2186 | 212 |
| 594 | 3300046663 | Ga0495635_0002038 | Ga0495635_0002038_2901_3695 | 212 |
| 595 | 3300046674 | Ga0495588_0010612 | Ga0495588_0010612_394_1188 | 212 |
| 596 | 3300046683 | Ga0495658_0004429 | Ga0495658_0004429_2659_3453 | 212 |
| 597 | 3300046689 | Ga0495613_0003702 | Ga0495613_0003702_2889_3683 | 212 |
| 598 | 3300046690 | Ga0495624_0000795 | Ga0495624_0000795_4543_5337 | 212 |
| 599 | 3300047315 | Ga0495581_0000030 | Ga0495581_0000030_31528_32322 | 212 |
| 600 | 3300047319 | Ga0495674_0001230 | Ga0495674_0001230_8601_9395 | 212 |
| 601 | 3300047321 | Ga0495676_0017129 | Ga0495676_0017129_3184_3978 | 212 |
| 602 | 3300047673 | Ga0495593_0000470 | Ga0495593_0000470_4955_5749 | 212 |
| 603 | 3300048089 | Ga0495614_0022266 | Ga0495614_0022266_1646_2440 | 212 |
| 604 | 3300048907 | Ga0496104_0004634 | Ga0496104_0004634_1744_2538 | 212 |
| 605 | 3300048908 | Ga0496105_0043484 | Ga0496105_0043484_2871_3665 | 212 |
| 606 | 3300048911 | Ga0496108_0155438 | Ga0496108_0155438_514_1308 | 212 |
| 607 | 3300048912 | Ga0496109_0151503 | Ga0496109_0151503_236_1030 | 212 |
| 608 | 3300048913 | Ga0496110_0127423 | Ga0496110_0127423_1007_1801 | 212 |
| 609 | 3300048915 | Ga0496112_0004525 | Ga0496112_0004525_3743_4537 | 212 |
| 610 | 3300050490 | nmdc:mga03n38_7962_c1 | nmdc:mga03n38_7962_c1_1966_2757 | 212 |
| 611 | 3300050493 | nmdc:mga0k408_153467_c1 | nmdc:mga0k408_153467_c1_322_1113 | 212 |
| 612 | 3300050494 | nmdc:mga06z11_92058_c1 | nmdc:mga06z11_92058_c1_462_1253 | 212 |
| 613 | 3300053119 | Ga0500595_002547 | Ga0500595_002547_4207_4998 | 212 |
| 614 | 3300053730 | Ga0500645_043501 | Ga0500645_043501_57_848 | 212 |
| 615 | 3300009545 | Ga0105237_10151573 | Ga0105237_101515732 | 213 |
| 616 | 3300010375 | Ga0105239_10456862 | Ga0105239_104568621 | 213 |
| 617 | 3300028573 | Ga0265334_10006202 | Ga0265334_100062024 | 213 |
| 618 | 3300047318 | Ga0495636_0068370 | Ga0495636_0068370_670_1461 | 213 |
| 619 | 3300005436 | Ga0070713_100168405 | Ga0070713_1001684052 | 214 |
| 620 | 3300003771 | Ga0055526_1019675 | Ga0055526_10196752 | 215 |
| 621 | 3300005262 | Ga0065165_1038109 | Ga0065165_10381091 | 215 |
| 622 | 3300025295 | Ga0209564_1000671 | Ga0209564_100067122 | 215 |
| 623 | 3300048928 | Ga0496125_0326778 | Ga0496125_0326778_82_867 | 215 |
| 624 | 3300003308 | Ga0006777J48905_1044268 | Ga0006777J48905_10442681 | 216 |
| 625 | 3300003575 | Ga0007409J51694_1018315 | Ga0007409J51694_10183151 | 216 |
| 626 | 3300005327 | Ga0070658_10018416 | Ga0070658_100184162 | 216 |
| 627 | 3300004798 | Ga0058859_10002637 | Ga0058859_100026371 | 217 |
| 628 | 3300004801 | Ga0058860_12101187 | Ga0058860_121011871 | 217 |
| 629 | 3300004803 | Ga0058862_12634862 | Ga0058862_126348621 | 217 |
| 630 | 3300048911 | Ga0496108_0410894 | Ga0496108_0410894_125_916 | 217 |
| 631 | 3300037068 | Ga0373925_0131430 | Ga0373925_0131430_1123_1926 | 219 |
| 632 | 3300005981 | Ga0081538_10007441 | Ga0081538_100074412 | 220 |
| 633 | 3300020076 | Ga0206355_1022003 | Ga0206355_10220031 | 220 |
| 634 | 3300005347 | Ga0070668_100342991 | Ga0070668_1003429911 | 221 |
| 635 | 3300006178 | Ga0075367_10022578 | Ga0075367_100225785 | 221 |
| 636 | 3300031456 | Ga0307513_10299956 | Ga0307513_102999562 | 221 |
| 637 | 3300031507 | Ga0307509_10207829 | Ga0307509_102078293 | 221 |
| 638 | 3300046513 | Ga0495616_0048814 | Ga0495616_0048814_608_1399 | 221 |
| 639 | 3300046684 | Ga0495669_0131590 | Ga0495669_0131590_349_1140 | 221 |
| 640 | 3300048927 | Ga0496124_0355129 | Ga0496124_0355129_60_845 | 221 |
| 641 | 3300050492 | nmdc:mga0yw44_63003_c1 | nmdc:mga0yw44_63003_c1_1026_1817 | 221 |
| 642 | 3300053089 | Ga0500581_172258 | Ga0500581_172258_22_813 | 221 |
| 643 | iso_pu_bacteria | 2643221651 | 2644291085 | 221 |
| 644 | 3300006028 | Ga0070717_10208139 | Ga0070717_102081392 | 222 |
| 645 | 3300025928 | Ga0207700_10345410 | Ga0207700_103454102 | 222 |
| 646 | 3300031730 | Ga0307516_10029260 | Ga0307516_100292602 | 222 |
| 647 | 3300035113 | Ga0373936_0009753 | Ga0373936_0009753_895_1845 | 222 |
| 648 | 3300046462 | Ga0495651_0111889 | Ga0495651_0111889_13_831 | 222 |
| 649 | 3300047322 | Ga0495680_0094218 | Ga0495680_0094218_1241_2059 | 222 |
| 650 | 3300047471 | Ga0495684_0089426 | Ga0495684_0089426_754_1572 | 222 |
| 651 | 3300053085 | Ga0495619_0006419 | Ga0495619_0006419_2681_3499 | 222 |
| 652 | 3300053163 | Ga0500639_184390 | Ga0500639_184390_48_881 | 222 |
| 653 | iso_pu_bacteria | 2903748898 | 2903758805 | 222 |
| 654 | iso_pu_bacteria | 2904690495 | 2904691013 | 222 |
| 655 | iso_pu_bacteria | 2908756301 | 2908757071 | 222 |
| 656 | iso_pu_bacteria | 8056689827 | 8056691136 | 222 |
| 657 | 3300029285 | Ga0310981_1033463 | Ga0310981_10334631 | 223 |
| 658 | iso_pu_bacteria | 2507262055 | 2507505442 | 223 |
| 659 | iso_pu_bacteria | 2508501009 | 2508539327 | 223 |
| 660 | iso_pu_bacteria | 2508501042 | 2508695654 | 223 |
| 661 | iso_pu_bacteria | 2511231028 | 2511400450 | 223 |
| 662 | iso_pu_bacteria | 2513237092 | 2513623934 | 223 |
| 663 | iso_pu_bacteria | 2513237096 | 2513659501 | 223 |
| 664 | iso_pu_bacteria | 2513237098 | 2513676307 | 223 |
| 665 | iso_pu_bacteria | 2513237101 | 2513695279 | 223 |
| 666 | iso_pu_bacteria | 2513237104 | 2513718232 | 223 |
| 667 | iso_pu_bacteria | 2513237137 | 2513859392 | 223 |
| 668 | iso_pu_bacteria | 2513237139 | 2513873358 | 223 |
| 669 | iso_pu_bacteria | 2513237141 | 2513888588 | 223 |
| 670 | iso_pu_bacteria | 2513237145 | 2513921566 | 223 |
| 671 | iso_pu_bacteria | 2515154112 | 2515627637 | 223 |
| 672 | iso_pu_bacteria | 2517093001 | 2517106288 | 223 |
| 673 | iso_pu_bacteria | 2517572143 | 2517889042 | 223 |
| 674 | iso_pu_bacteria | 2524023210 | 2524467235 | 223 |
| 675 | iso_pu_bacteria | 2524023228 | 2524537477 | 223 |
| 676 | iso_pu_bacteria | 2602042107 | 2603858633 | 223 |
| 677 | iso_pu_bacteria | 2617270735 | 2617352069 | 223 |
| 678 | iso_pu_bacteria | 2667528175 | 2671124031 | 223 |
| 679 | iso_pu_bacteria | 2721755755 | 2723841813 | 223 |
| 680 | iso_pu_bacteria | 2728368998 | 2728748440 | 223 |
| 681 | iso_pu_bacteria | 2791355197 | 2793072719 | 223 |
| 682 | iso_pu_bacteria | 2791355199 | 2793078313 | 223 |
| 683 | iso_pu_bacteria | 2802429603 | 2805920706 | 223 |
| 684 | iso_pu_bacteria | 2824600985 | 2824608728 | 223 |
| 685 | iso_pu_bacteria | 2824609381 | 2824617671 | 223 |
| 686 | iso_pu_bacteria | 2824653114 | 2824660134 | 223 |
| 687 | iso_pu_bacteria | 2824679649 | 2824687600 | 223 |
| 688 | iso_pu_bacteria | 2824696289 | 2824702614 | 223 |
| 689 | iso_pu_bacteria | 2824704595 | 2824710492 | 223 |
| 690 | iso_pu_bacteria | 2824753945 | 2824761763 | 223 |
| 691 | iso_pu_bacteria | 2824763712 | 2824772262 | 223 |
| 692 | iso_pu_bacteria | 2824773399 | 2824780852 | 223 |
| 693 | iso_pu_bacteria | 2841957949 | 2841965354 | 223 |
| 694 | iso_pu_bacteria | 2844315083 | 2844315535 | 223 |
| 695 | iso_pu_bacteria | 2847939898 | 2847942331 | 223 |
| 696 | iso_pu_bacteria | 2849076700 | 2849083204 | 223 |
| 697 | iso_pu_bacteria | 2857524615 | 2857526247 | 223 |
| 698 | iso_pu_bacteria | 2874590934 | 2874592557 | 223 |
| 699 | iso_pu_bacteria | 2874604998 | 2874607894 | 223 |
| 700 | iso_pu_bacteria | 2874612657 | 2874617988 | 223 |
| 701 | iso_pu_bacteria | 2874645413 | 2874647176 | 223 |
| 702 | iso_pu_bacteria | 2876771140 | 2876772560 | 223 |
| 703 | iso_pu_bacteria | 2876808645 | 2876814195 | 223 |
| 704 | iso_pu_bacteria | 2876818435 | 2876819821 | 223 |
| 705 | iso_pu_bacteria | 2879074833 | 2879076327 | 223 |
| 706 | iso_pu_bacteria | 2879110137 | 2879113321 | 223 |
| 707 | iso_pu_bacteria | 2879127579 | 2879128811 | 223 |
| 708 | iso_pu_bacteria | 2879142872 | 2879143632 | 223 |
| 709 | iso_pu_bacteria | 2885374607 | 2885377546 | 223 |
| 710 | iso_pu_bacteria | 2885383462 | 2885386910 | 223 |
| 711 | iso_pu_bacteria | 2885409591 | 2885415844 | 223 |
| 712 | iso_pu_bacteria | 2888419890 | 2888420130 | 223 |
| 713 | iso_pu_bacteria | 2889033259 | 2889035311 | 223 |
| 714 | iso_pu_bacteria | 2893066018 | 2893067481 | 223 |
| 715 | iso_pu_bacteria | 2903727486 | 2903733696 | 223 |
| 716 | iso_pu_bacteria | 2903768456 | 2903774497 | 223 |
| 717 | iso_pu_bacteria | 2904699407 | 2904708410 | 223 |
| 718 | iso_pu_bacteria | 2904711408 | 2904716338 | 223 |
| 719 | iso_pu_bacteria | 2906602504 | 2906609456 | 223 |
| 720 | iso_pu_bacteria | 2906610324 | 2906613582 | 223 |
| 721 | iso_pu_bacteria | 2906635258 | 2906635823 | 223 |
| 722 | iso_pu_bacteria | 2906660503 | 2906668116 | 223 |
| 723 | iso_pu_bacteria | 2908739725 | 2908747644 | 223 |
| 724 | iso_pu_bacteria | 2919073203 | 2919073901 | 223 |
| 725 | iso_pu_bacteria | 2922361189 | 2922363199 | 223 |
| 726 | iso_pu_bacteria | 2922386360 | 2922388496 | 223 |
| 727 | iso_pu_bacteria | 2922393267 | 2922396592 | 223 |
| 728 | iso_pu_bacteria | 2922425934 | 2922434019 | 223 |
| 729 | iso_pu_bacteria | 2935608549 | 2935615529 | 223 |
| 730 | iso_pu_bacteria | 2935630451 | 2935636046 | 223 |
| 731 | iso_pu_bacteria | 2935648319 | 2935654459 | 223 |
| 732 | iso_pu_bacteria | 2935656913 | 2935663339 | 223 |
| 733 | iso_pu_bacteria | 2935769743 | 2935774298 | 223 |
| 734 | iso_pu_bacteria | 2935777560 | 2935783337 | 223 |
| 735 | iso_pu_bacteria | 2935785616 | 2935788987 | 223 |
| 736 | iso_pu_bacteria | 2935793552 | 2935796737 | 223 |
| 737 | iso_pu_bacteria | 2935819856 | 2935825670 | 223 |
| 738 | iso_pu_bacteria | 2935847175 | 2935853434 | 223 |
| 739 | iso_pu_bacteria | 2935908558 | 2935915036 | 223 |
| 740 | iso_pu_bacteria | 2935916978 | 2935918884 | 223 |
| 741 | iso_pu_bacteria | 2935926038 | 2935931399 | 223 |
| 742 | iso_pu_bacteria | 2935934488 | 2935939996 | 223 |
| 743 | iso_pu_bacteria | 2935942939 | 2935947657 | 223 |
| 744 | iso_pu_bacteria | 2935951376 | 2935956428 | 223 |
| 745 | iso_pu_bacteria | 2935967501 | 2935973222 | 223 |
| 746 | iso_pu_bacteria | 2935975950 | 2935980534 | 223 |
| 747 | iso_pu_bacteria | 2935984226 | 2935990114 | 223 |
| 748 | iso_pu_bacteria | 2936011229 | 2936017502 | 223 |
| 749 | iso_pu_bacteria | 2936019824 | 2936025997 | 223 |
| 750 | iso_pu_bacteria | 2936028420 | 2936034839 | 223 |
| 751 | iso_pu_bacteria | 2936046547 | 2936052903 | 223 |
| 752 | iso_pu_bacteria | 2936055302 | 2936060238 | 223 |
| 753 | iso_pu_bacteria | 2941507105 | 2941512650 | 223 |
| 754 | iso_pu_bacteria | 2941515067 | 2941520512 | 223 |
| 755 | iso_pu_bacteria | 2941523033 | 2941528526 | 223 |
| 756 | iso_pu_bacteria | 3005474847 | 3005475266 | 223 |
| 757 | iso_pu_bacteria | 3005483717 | 3005486682 | 223 |
| 758 | iso_pu_bacteria | 3005506211 | 3005508988 | 223 |
| 759 | iso_pu_bacteria | 3005587118 | 3005594129 | 223 |
| 760 | iso_pu_bacteria | 3005594810 | 3005595227 | 223 |
| 761 | iso_pu_bacteria | 3005710791 | 3005711169 | 223 |
| 762 | iso_pu_bacteria | 3005718088 | 3005718465 | 223 |
| 763 | iso_pu_bacteria | 8006933436 | 8006936011 | 223 |
| 764 | iso_pu_bacteria | 8006964411 | 8006967628 | 223 |
| 765 | iso_pu_bacteria | 8006973647 | 8006975865 | 223 |
| 766 | iso_pu_bacteria | 8006984368 | 8006991098 | 223 |
| 767 | iso_pu_bacteria | 8006994254 | 8007000427 | 223 |
| 768 | iso_pu_bacteria | 8016522445 | 8016526319 | 223 |
| 769 | iso_pu_bacteria | 8016530956 | 8016531381 | 223 |
| 770 | iso_pu_bacteria | 8016539877 | 8016544595 | 223 |
| 771 | iso_pu_bacteria | 8016548790 | 8016557480 | 223 |
| 772 | iso_pu_bacteria | 8016557553 | 8016565838 | 223 |
| 773 | iso_pu_bacteria | 8016566248 | 8016569647 | 223 |
| 774 | iso_pu_bacteria | 8016595262 | 8016603437 | 223 |
| 775 | iso_pu_bacteria | 8016603502 | 8016606374 | 223 |
| 776 | iso_pu_bacteria | 8016613128 | 8016618282 | 223 |
| 777 | iso_pu_bacteria | 8016622563 | 8016622931 | 223 |
| 778 | iso_pu_bacteria | 8019530166 | 8019531215 | 223 |
| 779 | iso_pu_bacteria | 8019538911 | 8019540340 | 223 |
| 780 | iso_pu_bacteria | 8019547302 | 8019549931 | 223 |
| 781 | iso_pu_bacteria | 8019555841 | 8019562643 | 223 |
| 782 | iso_pu_bacteria | 8019565922 | 8019572722 | 223 |
| 783 | iso_pu_bacteria | 8019619141 | 8019623154 | 223 |
| 784 | iso_pu_bacteria | 8019629233 | 8019629944 | 223 |
| 785 | iso_pu_bacteria | 8019638758 | 8019640662 | 223 |
| 786 | iso_pu_bacteria | 8019668869 | 8019676542 | 223 |
| 787 | iso_pu_bacteria | 8019687851 | 8019696057 | 223 |
| 788 | iso_pu_bacteria | 8056673599 | 8056676132 | 223 |
| 789 | iso_pu_bacteria | 8056681323 | 8056682932 | 223 |
| 790 | 3300021384 | Ga0213876_10268756 | Ga0213876_102687561 | 224 |
| 791 | 3300037853 | Ga0436364_1231246 | Ga0436364_1231246_2978_3805 | 224 |
| 792 | 3300039437 | Ga0436365_1844499 | Ga0436365_1844499_221_1048 | 224 |
| 793 | 3300048904 | Ga0496101_0272312 | Ga0496101_0272312_314_1141 | 224 |
| 794 | 3300048908 | Ga0496105_0199333 | Ga0496105_0199333_418_1245 | 224 |
| 795 | 3300048910 | Ga0496107_0181458 | Ga0496107_0181458_358_1185 | 224 |
| 796 | 3300048913 | Ga0496110_0411456 | Ga0496110_0411456_140_967 | 224 |
| 797 | 3300059505 | Ga0587083_0053841 | Ga0587083_0053841_13_801 | 224 |
| 798 | 3300059642 | Ga0587069_030050 | Ga0587069_030050_72_860 | 224 |
| 799 | 3300059653 | Ga0587108_006445 | Ga0587108_006445_102_887 | 225 |
| 800 | 3300005436 | Ga0070713_100119688 | Ga0070713_1001196882 | 226 |
| 801 | 3300006178 | Ga0075367_10013523 | Ga0075367_100135231 | 226 |
| 802 | 3300006353 | Ga0075370_10031036 | Ga0075370_100310361 | 226 |
| 803 | 3300025928 | Ga0207700_10070457 | Ga0207700_100704572 | 226 |
| 804 | 3300025929 | Ga0207664_10023800 | Ga0207664_100238001 | 226 |
| 805 | 3300049581 | Ga0501047_0082949 | Ga0501047_0082949_231_1019 | 226 |
| 806 | 3300049586 | Ga0501070_0014987 | Ga0501070_0014987_1937_2725 | 226 |
| 807 | 3300049590 | Ga0501074_0012908 | Ga0501074_0012908_4682_5470 | 226 |
| 808 | 3300049742 | Ga0501080_0009730 | Ga0501080_0009730_2659_3447 | 226 |
| 809 | 3300049823 | Ga0501044_0038489 | Ga0501044_0038489_2060_2848 | 226 |
| 810 | 3300050490 | nmdc:mga03n38_12117_c1 | nmdc:mga03n38_12117_c1_1486_2274 | 226 |
| 811 | 3300050496 | nmdc:mga07m45_7843_c1 | nmdc:mga07m45_7843_c1_2180_2968 | 226 |
| 812 | 3300001979 | JGI24740J21852_10019014 | JGI24740J21852_100190142 | 227 |
| 813 | 3300001990 | JGI24737J22298_10000979 | JGI24737J22298_100009791 | 227 |
| 814 | 3300002075 | JGI24738J21930_10031241 | JGI24738J21930_100312412 | 227 |
| 815 | 3300005347 | Ga0070668_100260994 | Ga0070668_1002609942 | 227 |
| 816 | 3300005354 | Ga0070675_100511647 | Ga0070675_1005116471 | 227 |
| 817 | 3300005367 | Ga0070667_100246357 | Ga0070667_1002463571 | 227 |
| 818 | 3300005435 | Ga0070714_100191652 | Ga0070714_1001916523 | 227 |
| 819 | 3300005539 | Ga0068853_100015795 | Ga0068853_1000157954 | 227 |
| 820 | 3300005539 | Ga0068853_100280674 | Ga0068853_1002806742 | 227 |
| 821 | 3300005563 | Ga0068855_100188673 | Ga0068855_1001886733 | 227 |
| 822 | 3300005563 | Ga0068855_100415431 | Ga0068855_1004154312 | 227 |
| 823 | 3300005564 | Ga0070664_100431467 | Ga0070664_1004314672 | 227 |
| 824 | 3300005577 | Ga0068857_100005034 | Ga0068857_1000050345 | 227 |
| 825 | 3300005577 | Ga0068857_100223783 | Ga0068857_1002237831 | 227 |
| 826 | 3300005578 | Ga0068854_100003979 | Ga0068854_1000039794 | 227 |
| 827 | 3300005578 | Ga0068854_100342861 | Ga0068854_1003428611 | 227 |
| 828 | 3300005614 | Ga0068856_100004208 | Ga0068856_1000042087 | 227 |
| 829 | 3300005614 | Ga0068856_100152442 | Ga0068856_1001524423 | 227 |
| 830 | 3300005834 | Ga0068851_10006246 | Ga0068851_100062462 | 227 |
| 831 | 3300005937 | Ga0081455_10000738 | Ga0081455_1000073837 | 227 |
| 832 | 3300005937 | Ga0081455_10011519 | Ga0081455_100115195 | 227 |
| 833 | 3300005983 | Ga0081540_1007723 | Ga0081540_10077234 | 227 |
| 834 | 3300006048 | Ga0075363_100052946 | Ga0075363_1000529462 | 227 |
| 835 | 3300009093 | Ga0105240_10002459 | Ga0105240_100024592 | 227 |
| 836 | 3300009093 | Ga0105240_10056136 | Ga0105240_100561362 | 227 |
| 837 | 3300009094 | Ga0111539_10089486 | Ga0111539_100894864 | 227 |
| 838 | 3300009174 | Ga0105241_10020741 | Ga0105241_100207413 | 227 |
| 839 | 3300009174 | Ga0105241_10223420 | Ga0105241_102234202 | 227 |
| 840 | 3300009177 | Ga0105248_10089282 | Ga0105248_100892823 | 227 |
| 841 | 3300009545 | Ga0105237_10014356 | Ga0105237_100143562 | 227 |
| 842 | 3300009545 | Ga0105237_10194513 | Ga0105237_101945132 | 227 |
| 843 | 3300009551 | Ga0105238_10001235 | Ga0105238_1000123519 | 227 |
| 844 | 3300009551 | Ga0105238_10018660 | Ga0105238_100186601 | 227 |
| 845 | 3300009551 | Ga0105238_10116101 | Ga0105238_101161013 | 227 |
| 846 | 3300010375 | Ga0105239_10018536 | Ga0105239_100185362 | 227 |
| 847 | 3300020075 | Ga0206349_1345775 | Ga0206349_13457751 | 227 |
| 848 | 3300020080 | Ga0206350_10783199 | Ga0206350_107831991 | 227 |
| 849 | 3300025254 | Ga0209148_1006148 | Ga0209148_10061482 | 227 |
| 850 | 3300025272 | Ga0209455_1002203 | Ga0209455_10022035 | 227 |
| 851 | 3300025321 | Ga0207656_10011551 | Ga0207656_100115513 | 227 |
| 852 | 3300025904 | Ga0207647_10022531 | Ga0207647_100225316 | 227 |
| 853 | 3300025904 | Ga0207647_10027240 | Ga0207647_100272405 | 227 |
| 854 | 3300025913 | Ga0207695_10051771 | Ga0207695_100517712 | 227 |
| 855 | 3300025914 | Ga0207671_10062068 | Ga0207671_100620683 | 227 |
| 856 | 3300025924 | Ga0207694_10018629 | Ga0207694_100186293 | 227 |
| 857 | 3300025924 | Ga0207694_10185041 | Ga0207694_101850411 | 227 |
| 858 | 3300025941 | Ga0207711_10048929 | Ga0207711_100489293 | 227 |
| 859 | 3300025945 | Ga0207679_10319399 | Ga0207679_103193991 | 227 |
| 860 | 3300025949 | Ga0207667_10037414 | Ga0207667_100374144 | 227 |
| 861 | 3300026041 | Ga0207639_10213299 | Ga0207639_102132992 | 227 |
| 862 | 3300026067 | Ga0207678_10043043 | Ga0207678_100430432 | 227 |
| 863 | 3300026116 | Ga0207674_10014753 | Ga0207674_100147537 | 227 |
| 864 | 3300026121 | Ga0207683_10088714 | Ga0207683_100887144 | 227 |
| 865 | 3300026142 | Ga0207698_10627039 | Ga0207698_106270391 | 227 |
| 866 | 3300028786 | Ga0307517_10000232 | Ga0307517_1000023214 | 227 |
| 867 | 3300028794 | Ga0307515_10354065 | Ga0307515_103540652 | 227 |
| 868 | 3300031238 | Ga0265332_10063996 | Ga0265332_100639961 | 227 |
| 869 | 3300031241 | Ga0265325_10032360 | Ga0265325_100323602 | 227 |
| 870 | 3300031456 | Ga0307513_10083845 | Ga0307513_100838454 | 227 |
| 871 | 3300031730 | Ga0307516_10132990 | Ga0307516_101329902 | 227 |
| 872 | 3300032126 | Ga0307415_100039352 | Ga0307415_1000393522 | 227 |
| 873 | 3300037466 | Ga0395898_0148501 | Ga0395898_0148501_688_1479 | 227 |
| 874 | 3300039450 | Ga0436363_0655475 | Ga0436363_0655475_777_1577 | 227 |
| 875 | 3300044694 | Ga0466963_0361743 | Ga0466963_0361743_124_915 | 227 |
| 876 | 3300046460 | Ga0495638_0199003 | Ga0495638_0199003_295_1086 | 227 |
| 877 | 3300047320 | Ga0495672_0028262 | Ga0495672_0028262_577_1368 | 227 |
| 878 | 3300048912 | Ga0496109_0095265 | Ga0496109_0095265_1132_1923 | 227 |
| 879 | 3300048915 | Ga0496112_0004583 | Ga0496112_0004583_644_1435 | 227 |
| 880 | 3300048924 | Ga0496121_0230428 | Ga0496121_0230428_369_1160 | 227 |
| 881 | 3300049128 | Ga0501308_015165 | Ga0501308_015165_109_900 | 227 |
| 882 | 3300049533 | Ga0501317_023690 | Ga0501317_023690_45_836 | 227 |
| 883 | 3300049569 | Ga0501032_0009394 | Ga0501032_0009394_5305_6096 | 227 |
| 884 | 3300049570 | Ga0501033_0161719 | Ga0501033_0161719_755_1546 | 227 |
| 885 | 3300049572 | Ga0501036_0116278 | Ga0501036_0116278_1394_2185 | 227 |
| 886 | 3300049572 | Ga0501036_0185584 | Ga0501036_0185584_286_1077 | 227 |
| 887 | 3300049577 | Ga0501041_0168583 | Ga0501041_0168583_71_862 | 227 |
| 888 | 3300049578 | Ga0501042_0417913 | Ga0501042_0417913_106_897 | 227 |
| 889 | 3300049579 | Ga0501043_0215386 | Ga0501043_0215386_631_1422 | 227 |
| 890 | 3300049586 | Ga0501070_0121560 | Ga0501070_0121560_125_916 | 227 |
| 891 | 3300049587 | Ga0501071_0470326 | Ga0501071_0470326_98_889 | 227 |
| 892 | 3300049592 | Ga0501076_0134528 | Ga0501076_0134528_545_1336 | 227 |
| 893 | 3300049823 | Ga0501044_0119655 | Ga0501044_0119655_1143_1934 | 227 |
| 894 | 3300050511 | nmdc:mga08y16_188038_c1 | nmdc:mga08y16_188038_c1_550_1341 | 227 |
| 895 | 3300050515 | nmdc:mga0a205_241895_c1 | nmdc:mga0a205_241895_c1_833_1624 | 227 |
| 896 | 3300059505 | Ga0587083_0049948 | Ga0587083_0049948_18_809 | 227 |
| 897 | 3300059623 | Ga0587101_022396 | Ga0587101_022396_18_815 | 227 |
| 898 | iso_pu_bacteria | 2513237094 | 2513642181 | 227 |
| 899 | iso_pu_bacteria | 2524023205 | 2524441433 | 227 |
| 900 | iso_pu_bacteria | 2744054633 | 2745077567 | 227 |
| 901 | iso_pu_bacteria | 2935959822 | 2935966726 | 227 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3u3f-assembly2.cif.gz_B | structural basis for the interaction of pyk2 pat domain with paxillin ld motifs | 0.4837 | 49 | 221 |
| 1k40-assembly1.cif.gz_A | crystal structure of the fat domain of focal adhesion kinase | 0.4808 | 51 | 221 |
| 3u3f-assembly3.cif.gz_C | structural basis for the interaction of pyk2 pat domain with paxillin ld motifs | 0.4652 | 50 | 227 |
| 4xev-assembly1.cif.gz_A | fusion of pyk2-fat domain with leupaxin ld1 motif, complexed with leupaxin ld4 peptide | 0.4574 | 49 | 225 |
| 6fvq-assembly1.cif.gz_A | the active form of a pentameric ion channel (stelic) gated by alkaline ph - r86a | 0.4573 | 104 | 219 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P75769_17_224_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.5439 | 49 | 222 | 1.20.1250.20 |
| 3gm3A00 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Nucleotidyltransferases | 0.4925 | 49 | 221 | 1.20.120.330 |
| 4xefA00 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Nucleotidyltransferases | 0.486 | 50 | 221 | 1.20.120.330 |
| 3u3fB00 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Nucleotidyltransferases | 0.4837 | 49 | 221 | 1.20.120.330 |
| 1k40A00 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Nucleotidyltransferases | 0.4808 | 51 | 221 | 1.20.120.330 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2I8QUK8-F1-model_v4 | deleted | 0.7241 | 87 | 224 |
|
| AF-A0A2I8QUK8-F1-model_v4 | deleted | 0.6701 | 87 | 224 |
|
| AF-G0QXC9-F1-model_v4 | Uncharacterized protein | 0.6578 | 50 | 227 |
GO:0016020
|
| AF-A0A853I235-F1-model_v4 | deleted | 0.6566 | 41 | 226 |
|
| AF-A0A1R2AM22-F1-model_v4 | Uncharacterized protein | 0.648 | 50 | 227 |
GO:0016020
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar