F485182
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 901 | 653 | 1802 | 331 |
Family's Representative Sequence
| Representative Sequence | 3300041413|Ga0439465_0034236|Ga0439465_0034236_457_1446 |
| Length | 329 |
| Sequence | MNTAVLFDNVSRHFGAVRAVDRVTLQVAEGEFFAMLGPSGSGKTTCLRLMAGFEQPTTGHIEIFGETAEGVPPYRRSVFQDYALFPHLSILDNVAYGLMVKGIGREERRKAAEDALAMVKLPGYGARRPGQLSGGQRQRVALARALVNKPKVLLLDEPLGALDLKLREQMQEELKSLQKSLGITFVFVTHDQGEALSMADRIAVFNEGRIQQLGRPEDVYNQPKTRFVADFVGSSNVLSAKLCQSLGLNASFASLRPEAVAIAPAANGALSLSGTVAGRSFLGATNRIVVDVDGNRIAVASPAAQAVPAVGSPVTLSFAARDLHPMEDA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 2 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 3 | 3300002704 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB | Metagenome | Unclassified |
| 4 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 5 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 6 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 7 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 8 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 9 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 10 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 11 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 12 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 13 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 14 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 15 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 16 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 17 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 18 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 19 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 20 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 21 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 22 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 23 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 24 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 25 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 26 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 28 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 29 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 31 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 32 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 34 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 35 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 36 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 43 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 46 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 48 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 49 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 50 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 53 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 57 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 58 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 59 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 60 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 61 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 62 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 64 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 67 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 68 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 70 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 71 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 72 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 74 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 75 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 76 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 77 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 78 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 79 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 80 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 81 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 82 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 83 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 84 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 85 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 86 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 87 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 88 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 89 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 90 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 92 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 93 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 94 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 95 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 96 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 97 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 98 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 100 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300009765 | Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule | Metagenome | Nodule |
| 113 | 3300009766 | Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule | Metagenome | Nodule |
| 114 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 128 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 132 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 133 | 3300021321 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 | Metagenome | Nodule |
| 134 | 3300021327 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 | Metagenome | Nodule |
| 135 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 136 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 137 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 138 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 139 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 140 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 141 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 142 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 143 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 144 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 145 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 146 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 147 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 148 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 149 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 150 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 151 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 152 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 153 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 154 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 155 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 156 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 214 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 217 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 218 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 219 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 220 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 221 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 222 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 223 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 224 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 225 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 226 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 227 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 228 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 229 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 230 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 231 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 232 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 233 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 234 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 235 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 236 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 237 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 238 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 239 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 240 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 241 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 242 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 243 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 244 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 245 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 246 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 247 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 248 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 249 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 250 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 251 | 3300041503 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG | Metagenome | Unclassified |
| 252 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 253 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 254 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 255 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 256 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 291 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 292 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 293 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 294 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 295 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 296 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 297 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 298 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 299 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 300 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 301 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 302 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 303 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 304 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 305 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 306 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 307 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 308 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 309 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 310 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 311 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 312 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 313 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 314 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 315 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 316 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 317 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 318 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 319 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 320 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 321 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 322 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 323 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 324 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 325 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 326 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 327 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 328 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 329 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 330 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 331 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 332 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 333 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 334 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 335 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 336 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 337 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 338 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 339 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 340 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 341 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 342 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 343 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 344 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 345 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 346 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 347 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 348 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 350 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 353 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 354 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 355 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 356 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 357 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 358 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 359 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 360 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 361 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 362 | 3300059508 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 363 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 364 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 365 | 2509276021 | Rhizobium leguminosarum bv. trifolii WSM597 | Isolate | Nodule |
| 366 | 2509276033 | Rhizobium leguminosarum bv. trifolii WSM2012 | Isolate | Nodule |
| 367 | 2510065019 | Rhizobium leguminosarum bv. trifolii WSM1689 | Isolate | Nodule |
| 368 | 2510461069 | Rhizobium sp. PDO1-076 | Isolate | Rhizosphere |
| 369 | 2510461076 | Rhizobium leguminosarum bv. trifolii TA1 | Isolate | Nodule |
| 370 | 2510917022 | Rhizobium sp. AP16 | Isolate | Rhizosphere |
| 371 | 2510917028 | Rhizobium sp. CF122 | Isolate | Rhizosphere |
| 372 | 2510917030 | Rhizobium sp. CF142 | Isolate | Rhizosphere |
| 373 | 2513237084 | Rhizobium leguminosarum bv. viciae UPM1131 | Isolate | Nodule |
| 374 | 2513237085 | Rhizobium leguminosarum bv. viciae UPM1137 | Isolate | Nodule |
| 375 | 2513237088 | Rhizobium mesoamericanum STM6155 | Isolate | Nodule |
| 376 | 2513237093 | Rhizobium leguminosarum bv. phaseoli FA23 | Isolate | Nodule |
| 377 | 2513237103 | Rhizobium leguminosarum bv. viciae VF39 | Isolate | Nodule |
| 378 | 2513237138 | Rhizobium favelukesii OR191 | Isolate | Nodule |
| 379 | 2513237146 | Rhizobium mongolense USDA 1844 (Illumina) | Isolate | Nodule |
| 380 | 2513237159 | Rhizobium giardinii bv. giardinii H152 | Isolate | Nodule |
| 381 | 2513237162 | Rhizobium ruizarguesonis GB30 | Isolate | Nodule |
| 382 | 2515075009 | Rhizobium leguminosarum bv. viciae 248 | Isolate | Nodule |
| 383 | 2515154113 | Rhizobium ruizarguesonis Vc2 | Isolate | Nodule |
| 384 | 2515154114 | Rhizobium ruizarguesonis Vh3 | Isolate | Nodule |
| 385 | 2515154116 | Rhizobium ruizarguesonis Ps8 | Isolate | Nodule |
| 386 | 2515154134 | Rhizobium gallicum bv. gallicum R602sp | Isolate | Nodule |
| 387 | 2516143018 | Ensifer sp. BR816 | Isolate | Nodule |
| 388 | 2516653077 | Rhizobium acaciae WSM1481 | Isolate | Nodule |
| 389 | 2516653085 | Rhizobium leguminosarum bv. phaseoli 4292 | Isolate | Nodule |
| 390 | 2517093000 | Rhizobium leguminosarum bv. trifolii SRDI943 | Isolate | Nodule |
| 391 | 2517287029 | Rhizobium leguminosarum bv. trifolii SRDI565 | Isolate | Nodule |
| 392 | 2523231067 | Pleomorphomonas oryzae DSM 16300 | Isolate | Unclassified |
| 393 | 2524023209 | Rhizobium leucaenae USDA 9039 | Isolate | Nodule |
| 394 | 2529292951 | Rhizobium sp. CCGE 510 | Isolate | Nodule |
| 395 | 2534681796 | Rhizobium grahamii CCGE 502 | Isolate | Nodule |
| 396 | 2582581283 | Rhizobium sp. OK665 | Isolate | Rhizosphere |
| 397 | 2582581294 | Rhizobium sp. CF394 | Isolate | Rhizosphere |
| 398 | 2582581298 | Rhizobium alamii YR540 | Isolate | Rhizosphere |
| 399 | 2582581299 | Rhizobium leguminosarum OV483 | Isolate | Rhizosphere |
| 400 | 2582581304 | Rhizobium sp. YR519 | Isolate | Rhizosphere |
| 401 | 2582581306 | Rhizobium sp. YR295 | Isolate | Rhizosphere |
| 402 | 2582581307 | Rhizobium sp. YR060 | Isolate | Rhizosphere |
| 403 | 2582581308 | Rhizobium sp. OK494 | Isolate | Rhizosphere |
| 404 | 2582581315 | Agrobacterium rhizogenes YR147 | Isolate | Rhizosphere |
| 405 | 2582581316 | Agrobacterium rhizogenes OK036 | Isolate | Rhizosphere |
| 406 | 2582581865 | Rhizobium sp. CF258 | Isolate | Rhizosphere |
| 407 | 2582581866 | Rhizobium sp. CF097 | Isolate | Rhizosphere |
| 408 | 2582581867 | Rhizobium sp. OV201 | Isolate | Rhizosphere |
| 409 | 2585427526 | Rhizobium leguminosarum OV152 | Isolate | Rhizosphere |
| 410 | 2585427527 | Rhizobium lusitanum YR374 | Isolate | Rhizosphere |
| 411 | 2585427528 | Rhizobium leguminosarum CF307 | Isolate | Rhizosphere |
| 412 | 2585427529 | Rhizobium alamii YR584 | Isolate | Rhizosphere |
| 413 | 2585427530 | Rhizobium tropici YR635 | Isolate | Rhizosphere |
| 414 | 2585427531 | Agrobacterium rhizogenes YR530 | Isolate | Rhizosphere |
| 415 | 2585427590 | Rhizobium sp. CF048 | Isolate | Rhizosphere |
| 416 | 2585427593 | Rhizobium tropici CF286 | Isolate | Rhizosphere |
| 417 | 2585427594 | Rhizobium sp. YR528 | Isolate | Rhizosphere |
| 418 | 2585427608 | Agrobacterium rhizogenes OV677 | Isolate | Rhizosphere |
| 419 | 2585427609 | Agrobacterium rhizogenes CF263 | Isolate | Rhizosphere |
| 420 | 2585428125 | Agrobacterium rhizogenes CF262 | Isolate | Rhizosphere |
| 421 | 2599185156 | Rhizobium sp. NFR03 | Isolate | Rhizoplane |
| 422 | 2599185170 | Rhizobium mongolense USDA 1844 (PacBio) | Isolate | Nodule |
| 423 | 2615840624 | Rhizobium aethiopicum HBR26 | Isolate | Nodule |
| 424 | 2615840626 | Rhizobium lusitanum P1-7 | Isolate | Nodule |
| 425 | 2615840698 | Rhizobium multihospitium HAMBI 2975 | Isolate | Nodule |
| 426 | 2643221599 | Rhizobium sp. Root708 | Isolate | Unclassified |
| 427 | 2643221607 | Rhizobium sp. Root73 | Isolate | Unclassified |
| 428 | 2643221634 | Rhizobium sp. Root1203 | Isolate | Unclassified |
| 429 | 2643221636 | Rhizobium sp. Root1204 | Isolate | Unclassified |
| 430 | 2643221637 | Rhizobium sp. Root1212 | Isolate | Unclassified |
| 431 | 2643221643 | Rhizobium sp. Root1220 | Isolate | Unclassified |
| 432 | 2643221653 | Rhizobium sp. Root1240 | Isolate | Unclassified |
| 433 | 2643221686 | Rhizobium sp. Root1334 | Isolate | Unclassified |
| 434 | 2643221688 | Rhizobium sp. Root482 | Isolate | Unclassified |
| 435 | 2643221689 | Rhizobium sp. Root483D2 | Isolate | Unclassified |
| 436 | 2643221718 | Rhizobium sp. Root268 | Isolate | Unclassified |
| 437 | 2643221719 | Rhizobium sp. Root274 | Isolate | Unclassified |
| 438 | 2643221723 | Ensifer sp. Root278 | Isolate | Unclassified |
| 439 | 2667528174 | Rhizobium sp. NFR17 | Isolate | Rhizoplane |
| 440 | 2690316117 | Sinorhizobium fredii CCBAU 45436 | Isolate | Unclassified |
| 441 | 2718217882 | Rhizobium sp. N741 | Isolate | Nodule |
| 442 | 2718217927 | Rhizobium sp. N324 | Isolate | Nodule |
| 443 | 2718217997 | Rhizobium phaseoli sv. phaseoli R723 | Isolate | Nodule |
| 444 | 2718218009 | Rhizobium sp. N561 | Isolate | Nodule |
| 445 | 2718218199 | Rhizobium phaseoli sv. phaseoli N261 | Isolate | Nodule |
| 446 | 2718218232 | Rhizobium phaseoli sv. phaseoli N161 | Isolate | Nodule |
| 447 | 2718218233 | Rhizobium phaseoli sv. phaseoli R744 | Isolate | Nodule |
| 448 | 2718218235 | Rhizobium phaseoli sv. phaseoli R620 | Isolate | Nodule |
| 449 | 2718218269 | Rhizobium phaseoli sv. phaseoli N671 | Isolate | Nodule |
| 450 | 2718218363 | Rhizobium sp. N113 | Isolate | Nodule |
| 451 | 2718218365 | Rhizobium sp. N731 | Isolate | Nodule |
| 452 | 2718218366 | Rhizobium sp. N621 | Isolate | Nodule |
| 453 | 2718218423 | Rhizobium sp. N941 | Isolate | Nodule |
| 454 | 2721755514 | Rhizobium sp. N6212 | Isolate | Nodule |
| 455 | 2721755556 | Rhizobium phaseoli sv. phaseoli N931 | Isolate | Nodule |
| 456 | 2721755684 | Rhizobium phaseoli sv. phaseoli N841 | Isolate | Nodule |
| 457 | 2721755685 | Rhizobium phaseoli sv. phaseoli R611 | Isolate | Nodule |
| 458 | 2721755809 | Rhizobium sp. N541 | Isolate | Nodule |
| 459 | 2721755810 | Rhizobium sp. N871 | Isolate | Nodule |
| 460 | 2721755819 | Rhizobium phaseoli sv. phaseoli N771 | Isolate | Nodule |
| 461 | 2721755822 | Rhizobium phaseoli sv. phaseoli R650 | Isolate | Nodule |
| 462 | 2721755823 | Rhizobium phaseoli sv. phaseoli R630 | Isolate | Nodule |
| 463 | 2724679232 | Rhizobium leguminosarum Vaf12 | Isolate | Unclassified |
| 464 | 2728369352 | Rhizobium phaseoli sv. phaseoli N831 | Isolate | Nodule |
| 465 | 2728369365 | Rhizobium sp. N1341 | Isolate | Nodule |
| 466 | 2728369397 | Rhizobium sp. N1314 | Isolate | Nodule |
| 467 | 2738541293 | Rhizobium sp. GV031 | Isolate | Unclassified |
| 468 | 2738541333 | Rhizobium sophoriradicis CCBAU 03470 | Isolate | Unclassified |
| 469 | 2738543031 | Pleomorphomonas sp. CF100 | Isolate | Unclassified |
| 470 | 2751185821 | Ensifer shofinae CCBAU 251167 | Isolate | Unclassified |
| 471 | 2765235802 | Phyllobacterium bourgognense 31-25a | Isolate | Rhizoplane |
| 472 | 2765235942 | Rhizobium sp. WYCCWR10014 | Isolate | Nodule |
| 473 | 2767802442 | Phyllobacterium brassicacearum 29-15 | Isolate | Rhizoplane |
| 474 | 2775506902 | Phyllobacterium zundukense Tri-48 | Isolate | Unclassified |
| 475 | 2775506904 | Phyllobacterium zundukense Tri-38 | Isolate | Unclassified |
| 476 | 2775507266 | Rhizobium tropici PRF 81 | Isolate | Nodule |
| 477 | 2791355082 | Ensifer alkalisoli YIC4027 | Isolate | Nodule |
| 478 | 2791355091 | Sinorhizobium sp. FG01 | Isolate | Nodule |
| 479 | 2791355092 | Sinorhizobium sp. NG07B | Isolate | Nodule |
| 480 | 2791355094 | Sinorhizobium sp. BJ1 | Isolate | Nodule |
| 481 | 2791355256 | Rhizobium sp. M10 | Isolate | Nodule |
| 482 | 2791355259 | Rhizobium hidalgonense FH14 | Isolate | Nodule |
| 483 | 2791355260 | Rhizobium sp. L9 | Isolate | Nodule |
| 484 | 2791355261 | Rhizobium sp. J15 | Isolate | Nodule |
| 485 | 2791355262 | Rhizobium sp. M1 | Isolate | Nodule |
| 486 | 2791355263 | Rhizobium chutanense C5 | Isolate | Nodule |
| 487 | 2791355264 | Rhizobium sp. S9 | Isolate | Nodule |
| 488 | 2791355265 | Rhizobium sp. H4 | Isolate | Nodule |
| 489 | 2791355266 | Rhizobium sp. L43 | Isolate | Nodule |
| 490 | 2791355267 | Rhizobium sp. L18 | Isolate | Nodule |
| 491 | 2802429605 | Rhizobium sophoriradicis L101 | Isolate | Nodule |
| 492 | 2802429606 | Rhizobium sophoriradicis JJW1 | Isolate | Nodule |
| 493 | 2802429633 | Rhizobium anhuiense J3 | Isolate | Nodule |
| 494 | 2802429634 | Rhizobium anhuiense S10 | Isolate | Nodule |
| 495 | 2802429635 | Rhizobium anhuiense Y27 | Isolate | Nodule |
| 496 | 2802429636 | Rhizobium anhuiense JX3 | Isolate | Nodule |
| 497 | 2802429637 | Rhizobium anhuiense C15 | Isolate | Nodule |
| 498 | 2818991272 | Rhizobium sp. SLBN-4 | Isolate | Unclassified |
| 499 | 2818991448 | Rhizobium miluonense 1234 | Isolate | Unclassified |
| 500 | 2818991453 | Rhizobium lusitanum 1158 | Isolate | Unclassified |
| 501 | 2838016132 | Rhizobium phaseoli SEMIA 4071 | Isolate | Nodule |
| 502 | 2838022645 | Rhizobium aethiopicum SEMIA 4074 | Isolate | Nodule |
| 503 | 2838029111 | Rhizobium tropici SEMIA 4079 | Isolate | Nodule |
| 504 | 2838035591 | Rhizobium mongolense SEMIA 4087 | Isolate | Nodule |
| 505 | 2838042994 | Rhizobium esperanzae SEMIA 4089 | Isolate | Nodule |
| 506 | 2838048938 | Rhizobium pisi 27/80 | Isolate | Nodule |
| 507 | 2838061910 | Rhizobium phaseoli L15 | Isolate | Nodule |
| 508 | 2838068647 | Rhizobium esperanzae VC28 | Isolate | Nodule |
| 509 | 2838074704 | Sinorhizobium terangae SEMIA 6460 | Isolate | Unclassified |
| 510 | 2838661181 | Rhizobium mongolense SEMIA 402 | Isolate | Nodule |
| 511 | 2838668709 | Rhizobium sophoriradicis SEMIA 403 | Isolate | Nodule |
| 512 | 2838680041 | Rhizobium leguminosarum SEMIA 415 | Isolate | Nodule |
| 513 | 2838686498 | Rhizobium leguminosarum SEMIA 416 | Isolate | Nodule |
| 514 | 2838694306 | Rhizobium leguminosarum SEMIA 421 | Isolate | Nodule |
| 515 | 2838701080 | Rhizobium aethiopicum SEMIA 428 | Isolate | Nodule |
| 516 | 2838707686 | Rhizobium leguminosarum SEMIA 430 | Isolate | Nodule |
| 517 | 2838729681 | Rhizobium leguminosarum SEMIA 445 | Isolate | Nodule |
| 518 | 2838742623 | Rhizobium leguminosarum SEMIA 449 | Isolate | Nodule |
| 519 | 2839993093 | Phyllobacterium endophyticum PEPV15 | Isolate | Unclassified |
| 520 | 2840764183 | Phyllobacterium sophorae CCBAU 03422 | Isolate | Unclassified |
| 521 | 2840878972 | Albibacillus kandeliae J95 | Isolate | Rhizosphere |
| 522 | 2841851746 | Rhizobium leguminosarum SEMIA 498 | Isolate | Nodule |
| 523 | 2841864319 | Rhizobium leguminosarum SEMIA 4052 | Isolate | Nodule |
| 524 | 2842077413 | Rhizobium leguminosarum SEMIA 422 | Isolate | Nodule |
| 525 | 2842110456 | Rhizobium esperanzae SEMIA 414 | Isolate | Nodule |
| 526 | 2842118031 | Rhizobium esperanzae SEMIA 420 | Isolate | Nodule |
| 527 | 2842146304 | Rhizobium sophoriradicis SEMIA 454 | Isolate | Nodule |
| 528 | 2842156927 | Rhizobium leguminosarum SEMIA 459 | Isolate | Nodule |
| 529 | 2842163707 | Rhizobium leguminosarum SEMIA 460 | Isolate | Nodule |
| 530 | 2842180545 | Rhizobium leguminosarum SEMIA 463 | Isolate | Nodule |
| 531 | 2842192696 | Rhizobium esperanzae SEMIA 468 | Isolate | Nodule |
| 532 | 2842198810 | Rhizobium aethiopicum SEMIA 470 | Isolate | Nodule |
| 533 | 2842205361 | Rhizobium etli SEMIA 471 | Isolate | Nodule |
| 534 | 2842217011 | Rhizobium leguminosarum SEMIA 475 | Isolate | Nodule |
| 535 | 2842229732 | Rhizobium leguminosarum SEMIA 481 | Isolate | Nodule |
| 536 | 2842237096 | Rhizobium leguminosarum SEMIA 482 | Isolate | Nodule |
| 537 | 2842243621 | Rhizobium leguminosarum SEMIA 483 | Isolate | Nodule |
| 538 | 2842250916 | Rhizobium etli SEMIA 484 | Isolate | Nodule |
| 539 | 2842257432 | Rhizobium leguminosarum SEMIA 485 | Isolate | Nodule |
| 540 | 2842264693 | Rhizobium phaseoli SEMIA 487 | Isolate | Nodule |
| 541 | 2842271015 | Rhizobium leguminosarum SEMIA 488 | Isolate | Nodule |
| 542 | 2842278818 | Rhizobium etli SEMIA 489 | Isolate | Nodule |
| 543 | 2842285085 | Rhizobium lentis SEMIA 490 | Isolate | Nodule |
| 544 | 2842291075 | Rhizobium leguminosarum SEMIA 491 | Isolate | Nodule |
| 545 | 2842298080 | Rhizobium leucaenae SEMIA 492 | Isolate | Nodule |
| 546 | 2842304105 | Rhizobium leguminosarum SEMIA 499 | Isolate | Nodule |
| 547 | 2842311132 | Rhizobium phaseoli SEMIA 4002 | Isolate | Nodule |
| 548 | 2842317721 | Rhizobium etli SEMIA 4004 | Isolate | Nodule |
| 549 | 2842341865 | Rhizobium leguminosarum SEMIA 4011 | Isolate | Nodule |
| 550 | 2842357229 | Rhizobium leucaenae SEMIA 4015 | Isolate | Nodule |
| 551 | 2842363717 | Rhizobium leguminosarum SEMIA 4016 | Isolate | Nodule |
| 552 | 2842370503 | Rhizobium leguminosarum SEMIA 4022 | Isolate | Nodule |
| 553 | 2842377471 | Rhizobium leguminosarum SEMIA 4024 | Isolate | Nodule |
| 554 | 2842384541 | Rhizobium leguminosarum SEMIA 4025 | Isolate | Nodule |
| 555 | 2842395702 | Rhizobium ecuadorense SEMIA 4029 | Isolate | Nodule |
| 556 | 2842402390 | Rhizobium lentis SEMIA 4033 | Isolate | Nodule |
| 557 | 2842409023 | Rhizobium lentis SEMIA 4034 | Isolate | Nodule |
| 558 | 2842415677 | Rhizobium lentis SEMIA 4036 | Isolate | Nodule |
| 559 | 2842422224 | Rhizobium esperanzae SEMIA 4042 | Isolate | Nodule |
| 560 | 2842428310 | Rhizobium phaseoli SEMIA 4050 | Isolate | Nodule |
| 561 | 2842434925 | Rhizobium esperanzae SEMIA 4051 | Isolate | Nodule |
| 562 | 2842441272 | Rhizobium esperanzae SEMIA 4053 | Isolate | Nodule |
| 563 | 2842447887 | Rhizobium esperanzae SEMIA 4055 | Isolate | Nodule |
| 564 | 2842462802 | Rhizobium phaseoli SEMIA 4057 | Isolate | Nodule |
| 565 | 2842469257 | Rhizobium phaseoli SEMIA 4058 | Isolate | Nodule |
| 566 | 2842475841 | Rhizobium tropici SEMIA 4059 | Isolate | Nodule |
| 567 | 2842482326 | Rhizobium lusitanum SEMIA 4060 | Isolate | Nodule |
| 568 | 2842489311 | Rhizobium sophoriradicis SEMIA 4061 | Isolate | Nodule |
| 569 | 2842495871 | Rhizobium etli SEMIA 4062 | Isolate | Nodule |
| 570 | 2842502639 | Rhizobium tropici SEMIA 4063 | Isolate | Nodule |
| 571 | 2842509118 | Rhizobium paranaense SEMIA 4064 | Isolate | Nodule |
| 572 | 2842521101 | Rhizobium giardinii SEMIA 4084 | Isolate | Nodule |
| 573 | 2842922631 | Pararhizobium sp. R-72066 | Isolate | Unclassified |
| 574 | 2844454524 | Rhizobium leguminosarum bv. viciae BIHB 1217 | Isolate | Nodule |
| 575 | 2847417321 | Sinorhizobium fredii CCBAU 45436 | Isolate | Unclassified |
| 576 | 2848992105 | Sinorhizobium fredii CCBAU 25509 | Isolate | Unclassified |
| 577 | 2852387548 | Rhizobium jaguaris CCGE525 | Isolate | Unclassified |
| 578 | 2854911287 | Brucella lupini LUP21 | Isolate | Unclassified |
| 579 | 2855872281 | Sinorhizobium fredii PCH1 | Isolate | Nodule |
| 580 | 2857516855 | Rhizobium sp. R-72456 | Isolate | Unclassified |
| 581 | 2891373044 | Shinella sp. AETb1-6 | Isolate | Rhizosphere |
| 582 | 2894652903 | Phyllobacterium sp. SYP-B3895 | Isolate | Rhizosphere |
| 583 | 2896384573 | Ensifer sp. MPMI2T | Isolate | Unclassified |
| 584 | 2899803654 | Agrobacterium sp. a22-2 | Isolate | Unclassified |
| 585 | 2904578770 | Phyllobacterium sp. 586 | Isolate | Unclassified |
| 586 | 2913295892 | Sinorhizobium kostiensis DSM 13372 | Isolate | Nodule |
| 587 | 2919100787 | Rhizobium sp. 1399 | Isolate | Rhizosphere |
| 588 | 2919119836 | Phyllobacterium sp. 1468 | Isolate | Rhizosphere |
| 589 | 2919408235 | Rhizobium miluonense 3199 | Isolate | Unclassified |
| 590 | 2920822456 | Ensifer sesbaniae CCBAU 65729 | Isolate | Unclassified |
| 591 | 2923556063 | Rhizobium tibeticum 3740 | Isolate | Unclassified |
| 592 | 2933016740 | Rhizobium sp. SEMIA 4085 | Isolate | Nodule |
| 593 | 2933570622 | Rhizobium leguminosarum SEMIA 409 | Isolate | Nodule |
| 594 | 2933586486 | Rhizobium leguminosarum SEMIA 4039 | Isolate | Nodule |
| 595 | 2933599457 | Rhizobium phaseoli M3 | Isolate | Nodule |
| 596 | 2935894831 | Rhizobium leguminosarum SEMIA 419 | Isolate | Nodule |
| 597 | 2935901341 | Rhizobium leguminosarum SEMIA 4082 | Isolate | Nodule |
| 598 | 2936367885 | Rhizobium changzhiense WYCCWR 11290 | Isolate | Nodule |
| 599 | 2936375103 | Rhizobium changzhiense WYCCWR 11317 | Isolate | Nodule |
| 600 | 2936381700 | Rhizobium chutanense C16 | Isolate | Unclassified |
| 601 | 2937843397 | Mesorhizobium xinjiangense lm94 | Isolate | Rhizosphere |
| 602 | 2989349275 | Shinella kummerowiae CCBAU 25048 | Isolate | Unclassified |
| 603 | 2989771324 | Rhizobium rhizolycopersici DBTS2 | Isolate | Rhizosphere |
| 604 | 2989776772 | Rhizobium glycinendophyticum CL12 | Isolate | Unclassified |
| 605 | 2996887358 | Rhizobium sp. R711 | Isolate | Nodule |
| 606 | 2996893221 | Rhizobium sp. R635 | Isolate | Nodule |
| 607 | 3003930520 | Sinorhizobium sp. BG8 | Isolate | Unclassified |
| 608 | 3005416602 | Rhizobium sp. P40RR-XXII | Isolate | Rhizosphere |
| 609 | 3005445848 | Rhizobium sp. WYJ-E13 | Isolate | Unclassified |
| 610 | 3005452660 | Rhizobium grahamii BG7 | Isolate | Unclassified |
| 611 | 639633055 | Rhizobium leguminosarum bv. viciae 3841 | Isolate | Unclassified |
| 612 | 643692032 | Sinorhizobium fredii NGR234 | Isolate | Nodule |
| 613 | 8005246636 | Rhizobium wuzhouense W44 | Isolate | Rhizosphere |
| 614 | 8005258706 | Rhizobium sp. R693 | Isolate | Nodule |
| 615 | 8005275841 | Rhizobium sp. N4311 | Isolate | Nodule |
| 616 | 8005282627 | Rhizobium phaseoli NC1 | Isolate | Nodule |
| 617 | 8005289223 | Rhizobium bangladeshense 1002 | Isolate | Nodule |
| 618 | 8005301065 | Rhizobium bangladeshense 1017 | Isolate | Nodule |
| 619 | 8005307578 | Rhizobium leguminosarum bv. phaseoli LCS0306 | Isolate | Unclassified |
| 620 | 8005314921 | Rhizobium sp. P28RR-XV | Isolate | Rhizosphere |
| 621 | 8005321885 | Rhizobium sp. R72 | Isolate | Nodule |
| 622 | 8005376324 | Rhizobium changzhiense WYCCWR 11279 | Isolate | Nodule |
| 623 | 8005382845 | Rhizobium sp. R634 | Isolate | Nodule |
| 624 | 8005395548 | Rhizobium sp. R339 | Isolate | Nodule |
| 625 | 8005430974 | Rhizobium phaseoli Y20 | Isolate | Nodule |
| 626 | 8005460587 | Rhizobium leguminosarum bv. viciae 248 | Isolate | Nodule |
| 627 | 8005484373 | Rhizobium tropici SARCC-755 | Isolate | Nodule |
| 628 | 8005497431 | Rhizobium phaseoli CCGM8 | Isolate | Unclassified |
| 629 | 8005542996 | Rhizobium grahamii CCGM3 | Isolate | Unclassified |
| 630 | 8005556819 | Rhizobium sp. WYCCWR 11128 | Isolate | Nodule |
| 631 | 8005563573 | Rhizobium sp. WYCCWR 11152 | Isolate | Nodule |
| 632 | 8005570704 | Rhizobium anhuiense bv. trifolii WYCCWR10015 | Isolate | Nodule |
| 633 | 8005619151 | Rhizobium phaseoli CCGM2 | Isolate | Unclassified |
| 634 | 8005626139 | Rhizobium phaseoli Y18 | Isolate | Nodule |
| 635 | 8005645114 | Rhizobium tropici IGFRI Rhizo-19 | Isolate | Rhizosphere |
| 636 | 8005668836 | Rhizobium phaseoli CCGM9 | Isolate | Unclassified |
| 637 | 8005682033 | Rhizobium dioscoreae S-93 | Isolate | Unclassified |
| 638 | 8005688590 | Rhizobium bangladeshense 1024 | Isolate | Nodule |
| 639 | 8005695170 | Rhizobium sp. RMa-01 | Isolate | Unclassified |
| 640 | 8018127388 | Rhizobium aegyptiacum 950 | Isolate | Nodule |
| 641 | 8018163183 | Rhizobium sp. WYCCWR 11146 | Isolate | Nodule |
| 642 | 8018176218 | Rhizobium sp. N122 | Isolate | Nodule |
| 643 | 8023680758 | Rhizobium leguminosarum SARCC-132 | Isolate | Nodule |
| 644 | 8024479707 | Rhizobium leguminosarum Tri-43 | Isolate | Nodule |
| 645 | 8024486573 | Rhizobium tubonense CCBAU 85046 | Isolate | Nodule |
| 646 | 8024501048 | Rhizobium sp. H4 | Isolate | Nodule |
| 647 | 8046767195 | Rhizobium calliandrae CCGE524 | Isolate | Unclassified |
| 648 | 8049293176 | Ensifer alkalisoli YIC4027 | Isolate | Nodule |
| 649 | 8054558443 | Rhizobium alarense TRM95111 | Isolate | Nodule |
| 650 | 8056375014 | Rhizobium redzepovicii 18T | Isolate | Nodule |
| 651 | 8056382006 | Rhizobium croatiense 13T | Isolate | Nodule |
| 652 | 8057575449 | Rhizobium mayense CCGE526 | Isolate | Nodule |
| 653 | 8057874678 | Rhizobium acaciae 1AS12 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 67.48 |
| Metatranscriptomes | 0.44 |
| Isolates | 32.08 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 13.87 |
| Nodule | 21.53 |
| Rhizoplane | 3.77 |
| Rhizosphere | 48.39 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0439465_0034236 | 3300041413 | Bacteria | 1626 |
| 2 | JGI24751J29686_10001606 | 3300002459 | Bacteria | 4671 |
| 3 | JGI25155J39150_1000012 | 3300002704 | Bacteria | 199435 |
| 4 | JGI25156J39149_1000036 | 3300002705 | Bacteria | 110527 |
| 5 | JGI25156J39149_1000049 | 3300002705 | Bacteria | 91988 |
| 6 | JGI25162J39368_1000146 | 3300002737 | Bacteria | 76858 |
| 7 | JGI25154J39366_1000033 | 3300002738 | Bacteria | 184379 |
| 8 | JGI25157J39369_1000055 | 3300002741 | Bacteria | 107875 |
| 9 | JGI25152J39213_1001334 | 3300002773 | Bacteria | 10889 |
| 10 | JGI25152J39213_1004215 | 3300002773 | Bacteria | 4610 |
| 11 | JGI25150J39212_1000063 | 3300002774 | Bacteria | 64558 |
| 12 | JGI25150J39212_1003198 | 3300002774 | Bacteria | 3881 |
| 13 | JGI25159J45721_1000073 | 3300002987 | Bacteria | 48504 |
| 14 | JGI25159J45721_1000198 | 3300002987 | Bacteria | 27927 |
| 15 | JGI25159J45721_1002886 | 3300002987 | Bacteria | 6282 |
| 16 | JGI25151J46595_10000140 | 3300003187 | Bacteria | 95958 |
| 17 | JGI25151J46595_10000750 | 3300003187 | Bacteria | 26476 |
| 18 | JGI25151J46595_10034572 | 3300003187 | Bacteria | 1931 |
| 19 | JGI25165J46597_1000451 | 3300003214 | Bacteria | 41309 |
| 20 | JGI25165J46597_1001044 | 3300003214 | Bacteria | 18066 |
| 21 | JGI25153J46596_10003011 | 3300003215 | Bacteria | 9532 |
| 22 | JGI25153J46596_10015475 | 3300003215 | Bacteria | 3104 |
| 23 | JGI25153J46596_10028045 | 3300003215 | Bacteria | 1961 |
| 24 | JGI25160J50197_1000006 | 3300003354 | Bacteria | 316247 |
| 25 | JGI25160J50197_1000020 | 3300003354 | Bacteria | 232739 |
| 26 | JGI25160J50197_1002386 | 3300003354 | Bacteria | 8763 |
| 27 | JGI25161J50226_1000004 | 3300003374 | Bacteria | 316212 |
| 28 | JGI25161J50226_1000103 | 3300003374 | Bacteria | 67942 |
| 29 | JGI25161J50226_1008740 | 3300003374 | Bacteria | 1522 |
| 30 | Ga0006562J51391_1153968 | 3300003578 | Bacteria | 1360 |
| 31 | Ga0006562J51391_1153969 | 3300003578 | Bacteria | 1430 |
| 32 | Ga0055526_1000562 | 3300003771 | Bacteria | 29362 |
| 33 | Ga0055526_1004977 | 3300003771 | Bacteria | 7798 |
| 34 | Ga0055526_1020044 | 3300003771 | Bacteria | 2402 |
| 35 | Ga0055524_1005106 | 3300003775 | Bacteria | 5935 |
| 36 | Ga0055524_1006367 | 3300003775 | Bacteria | 5125 |
| 37 | Ga0055536_1000618 | 3300003781 | Bacteria | 24148 |
| 38 | Ga0055528_1000581 | 3300003790 | Bacteria | 27606 |
| 39 | Ga0055528_1009166 | 3300003790 | Bacteria | 4164 |
| 40 | Ga0055528_1011421 | 3300003790 | Bacteria | 3526 |
| 41 | Ga0055528_1014566 | 3300003790 | Bacteria | 2901 |
| 42 | Ga0055528_1023143 | 3300003790 | Bacteria | 1907 |
| 43 | Ga0055540_1000476 | 3300003792 | Bacteria | 30954 |
| 44 | Ga0055540_1003314 | 3300003792 | Bacteria | 7851 |
| 45 | Ga0055540_1023377 | 3300003792 | Bacteria | 1558 |
| 46 | Ga0055531_10021394 | 3300003794 | Bacteria | 2510 |
| 47 | Ga0055543_1000002 | 3300004625 | Bacteria | 390020 |
| 48 | Ga0055543_1000029 | 3300004625 | Bacteria | 131452 |
| 49 | Ga0055543_1000163 | 3300004625 | Bacteria | 55480 |
| 50 | Ga0055543_1002440 | 3300004625 | Bacteria | 6147 |
| 51 | Ga0065165_1000013 | 3300005262 | Bacteria | 301887 |
| 52 | Ga0065165_1000217 | 3300005262 | Bacteria | 100170 |
| 53 | Ga0065165_1008510 | 3300005262 | Bacteria | 4780 |
| 54 | Ga0065165_1024455 | 3300005262 | Bacteria | 2028 |
| 55 | Ga0065715_10004261 | 3300005293 | Bacteria | 4374 |
| 56 | Ga0070676_10008327 | 3300005328 | Bacteria | 5588 |
| 57 | Ga0070683_100078943 | 3300005329 | Bacteria | 3080 |
| 58 | Ga0070690_100111312 | 3300005330 | Bacteria | 1827 |
| 59 | Ga0070670_100000201 | 3300005331 | Bacteria | 55479 |
| 60 | Ga0070670_100004118 | 3300005331 | Bacteria | 12153 |
| 61 | Ga0070680_100038340 | 3300005336 | Bacteria | 3876 |
| 62 | Ga0070682_100009745 | 3300005337 | Bacteria | 5439 |
| 63 | Ga0070660_100013337 | 3300005339 | Bacteria | 5892 |
| 64 | Ga0070689_100052593 | 3300005340 | Bacteria | 3150 |
| 65 | Ga0070691_10000937 | 3300005341 | Bacteria | 11856 |
| 66 | Ga0070687_100013436 | 3300005343 | Bacteria | 3649 |
| 67 | Ga0070661_100317367 | 3300005344 | Bacteria | 1216 |
| 68 | Ga0070668_100007905 | 3300005347 | Bacteria | 7896 |
| 69 | Ga0070668_100087194 | 3300005347 | Bacteria | 2456 |
| 70 | Ga0070669_100003947 | 3300005353 | Bacteria | 10731 |
| 71 | Ga0070671_100015550 | 3300005355 | Bacteria | 6148 |
| 72 | Ga0070674_100000255 | 3300005356 | Bacteria | 26391 |
| 73 | Ga0070673_100098228 | 3300005364 | Bacteria | 2406 |
| 74 | Ga0070688_100018819 | 3300005365 | Bacteria | 3993 |
| 75 | Ga0070688_100135975 | 3300005365 | Bacteria | 1664 |
| 76 | Ga0070659_100022994 | 3300005366 | Bacteria | 4766 |
| 77 | Ga0070667_100009549 | 3300005367 | Bacteria | 8043 |
| 78 | Ga0070667_100232863 | 3300005367 | Bacteria | 1643 |
| 79 | Ga0070667_100243675 | 3300005367 | Bacteria | 1606 |
| 80 | Ga0070709_10028766 | 3300005434 | Bacteria | 3317 |
| 81 | Ga0070714_100036349 | 3300005435 | Bacteria | 4130 |
| 82 | Ga0070713_100122289 | 3300005436 | Bacteria | 2284 |
| 83 | Ga0070710_10010750 | 3300005437 | Bacteria | 4500 |
| 84 | Ga0070701_10001749 | 3300005438 | Bacteria | 8179 |
| 85 | Ga0070711_100000991 | 3300005439 | Bacteria | 15051 |
| 86 | Ga0070705_100023732 | 3300005440 | Bacteria | 3299 |
| 87 | Ga0070694_100027220 | 3300005444 | Bacteria | 3712 |
| 88 | Ga0070663_100004730 | 3300005455 | Bacteria | 8030 |
| 89 | Ga0070678_100131444 | 3300005456 | Bacteria | 1989 |
| 90 | Ga0070662_100110234 | 3300005457 | Bacteria | 2096 |
| 91 | Ga0070662_100270687 | 3300005457 | Bacteria | 1371 |
| 92 | Ga0068867_100033115 | 3300005459 | Bacteria | 3740 |
| 93 | Ga0068867_100038594 | 3300005459 | Bacteria | 3477 |
| 94 | Ga0070707_100072247 | 3300005468 | Bacteria | 3325 |
| 95 | Ga0070679_100007954 | 3300005530 | Bacteria | 9951 |
| 96 | Ga0070684_100002428 | 3300005535 | Bacteria | 13740 |
| 97 | Ga0070697_100002550 | 3300005536 | Bacteria | 14021 |
| 98 | Ga0068853_100009025 | 3300005539 | Bacteria | 8030 |
| 99 | Ga0070672_100201471 | 3300005543 | Bacteria | 1664 |
| 100 | Ga0070686_100001426 | 3300005544 | Bacteria | 13485 |
| 101 | Ga0070696_100015998 | 3300005546 | Bacteria | 5044 |
| 102 | Ga0070696_100087680 | 3300005546 | Bacteria | 2211 |
| 103 | Ga0070693_100008518 | 3300005547 | Bacteria | 5062 |
| 104 | Ga0070704_100020506 | 3300005549 | Bacteria | 4263 |
| 105 | Ga0070704_100021719 | 3300005549 | Bacteria | 4166 |
| 106 | Ga0068855_100227759 | 3300005563 | Bacteria | 2088 |
| 107 | Ga0070664_100167863 | 3300005564 | Bacteria | 1945 |
| 108 | Ga0068857_100049572 | 3300005577 | Bacteria | 3725 |
| 109 | Ga0068854_100003774 | 3300005578 | Bacteria | 9473 |
| 110 | Ga0068856_100041938 | 3300005614 | Bacteria | 4499 |
| 111 | Ga0068856_100187564 | 3300005614 | Bacteria | 2082 |
| 112 | Ga0070702_100002406 | 3300005615 | Bacteria | 8057 |
| 113 | Ga0068852_100015192 | 3300005616 | Bacteria | 5959 |
| 114 | Ga0068859_100098726 | 3300005617 | Bacteria | 2974 |
| 115 | Ga0068859_100107019 | 3300005617 | Bacteria | 2856 |
| 116 | Ga0068864_100008425 | 3300005618 | Bacteria | 8506 |
| 117 | Ga0068866_10002650 | 3300005718 | Bacteria | 7397 |
| 118 | Ga0068861_100019992 | 3300005719 | Bacteria | 4789 |
| 119 | Ga0068851_10072531 | 3300005834 | Bacteria | 1784 |
| 120 | Ga0068870_10071104 | 3300005840 | Bacteria | 1898 |
| 121 | Ga0068863_100007448 | 3300005841 | Bacteria | 10711 |
| 122 | Ga0068858_100006719 | 3300005842 | Bacteria | 11192 |
| 123 | Ga0068858_100062165 | 3300005842 | Bacteria | 3453 |
| 124 | Ga0068858_100067055 | 3300005842 | Bacteria | 3324 |
| 125 | Ga0068860_100025587 | 3300005843 | Bacteria | 5692 |
| 126 | Ga0068860_100176224 | 3300005843 | Bacteria | 2066 |
| 127 | Ga0068860_100305024 | 3300005843 | Bacteria | 1561 |
| 128 | Ga0068862_100019327 | 3300005844 | Bacteria | 5684 |
| 129 | Ga0068862_100070626 | 3300005844 | Bacteria | 3014 |
| 130 | Ga0081455_10001941 | 3300005937 | Bacteria | 24850 |
| 131 | Ga0081455_10004546 | 3300005937 | Bacteria | 15486 |
| 132 | Ga0075365_10089806 | 3300006038 | Bacteria | 2092 |
| 133 | Ga0070716_100005064 | 3300006173 | Bacteria | 6358 |
| 134 | Ga0075367_10002996 | 3300006178 | Bacteria | 7903 |
| 135 | Ga0075369_10001644 | 3300006186 | Bacteria | 7706 |
| 136 | Ga0075366_10009828 | 3300006195 | Bacteria | 5350 |
| 137 | Ga0097621_100021212 | 3300006237 | Bacteria | 5020 |
| 138 | Ga0075370_10081892 | 3300006353 | Bacteria | 1855 |
| 139 | Ga0075428_100171214 | 3300006844 | Bacteria | 2353 |
| 140 | Ga0075431_100001445 | 3300006847 | Bacteria | 21876 |
| 141 | Ga0075431_100038265 | 3300006847 | Bacteria | 4939 |
| 142 | Ga0075431_100171369 | 3300006847 | Bacteria | 2230 |
| 143 | Ga0075433_10234698 | 3300006852 | Bacteria | 1628 |
| 144 | Ga0075434_100099120 | 3300006871 | Bacteria | 2919 |
| 145 | Ga0068865_100028038 | 3300006881 | Bacteria | 3726 |
| 146 | Ga0068865_100061874 | 3300006881 | Bacteria | 2626 |
| 147 | Ga0075436_100011810 | 3300006914 | Bacteria | 5992 |
| 148 | Ga0097620_100098724 | 3300006931 | Bacteria | 2974 |
| 149 | Ga0097620_100107019 | 3300006931 | Bacteria | 2856 |
| 150 | Ga0075435_100014925 | 3300007076 | Bacteria | 5826 |
| 151 | Ga0105251_10080294 | 3300009011 | Bacteria | 1508 |
| 152 | Ga0105240_10000019 | 3300009093 | Bacteria | 406211 |
| 153 | Ga0105245_10316332 | 3300009098 | Bacteria | 1536 |
| 154 | Ga0105247_10002602 | 3300009101 | Bacteria | 12197 |
| 155 | Ga0105247_10007399 | 3300009101 | Bacteria | 6741 |
| 156 | Ga0114129_10006974 | 3300009147 | Bacteria | 16079 |
| 157 | Ga0105243_10029798 | 3300009148 | Bacteria | 4199 |
| 158 | Ga0105243_10039301 | 3300009148 | Bacteria | 3687 |
| 159 | Ga0105241_10015032 | 3300009174 | Bacteria | 5670 |
| 160 | Ga0105242_10046401 | 3300009176 | Bacteria | 3524 |
| 161 | Ga0105242_10104123 | 3300009176 | Bacteria | 2409 |
| 162 | Ga0105248_10014453 | 3300009177 | Bacteria | 8689 |
| 163 | Ga0105248_10030508 | 3300009177 | Bacteria | 6020 |
| 164 | Ga0105248_10124009 | 3300009177 | Bacteria | 2914 |
| 165 | Ga0105237_10003975 | 3300009545 | Bacteria | 17286 |
| 166 | Ga0105237_10025836 | 3300009545 | Bacteria | 6004 |
| 167 | Ga0105238_10005416 | 3300009551 | Bacteria | 12611 |
| 168 | Ga0105249_10007708 | 3300009553 | Bacteria | 9380 |
| 169 | Ga0105249_10028244 | 3300009553 | Bacteria | 5064 |
| 170 | Ga0105249_10059202 | 3300009553 | Bacteria | 3513 |
| 171 | Ga0105249_10499312 | 3300009553 | Bacteria | 1262 |
| 172 | Ga0123341_1000015 | 3300009765 | Bacteria | 86184 |
| 173 | Ga0123342_1005228 | 3300009766 | Bacteria | 19065 |
| 174 | Ga0105239_10037732 | 3300010375 | Bacteria | 5295 |
| 175 | Ga0105246_10014433 | 3300011119 | Bacteria | 4969 |
| 176 | Ga0157373_10060189 | 3300013100 | Bacteria | 2690 |
| 177 | Ga0157373_10061120 | 3300013100 | Bacteria | 2668 |
| 178 | Ga0157371_10027003 | 3300013102 | Bacteria | 4167 |
| 179 | Ga0157370_10003322 | 3300013104 | Bacteria | 18953 |
| 180 | Ga0157370_10063549 | 3300013104 | Bacteria | 3496 |
| 181 | Ga0157369_10015957 | 3300013105 | Bacteria | 8451 |
| 182 | Ga0157374_10015991 | 3300013296 | Bacteria | 6590 |
| 183 | Ga0157378_10176601 | 3300013297 | Bacteria | 2007 |
| 184 | Ga0163162_10074226 | 3300013306 | Bacteria | 3459 |
| 185 | Ga0163162_10402741 | 3300013306 | Bacteria | 1501 |
| 186 | Ga0157372_10015254 | 3300013307 | Bacteria | 8230 |
| 187 | Ga0157375_10005311 | 3300013308 | Bacteria | 11188 |
| 188 | Ga0157375_10011932 | 3300013308 | Bacteria | 7688 |
| 189 | Ga0157375_10020436 | 3300013308 | Bacteria | 6049 |
| 190 | Ga0163163_10367868 | 3300014325 | Bacteria | 1495 |
| 191 | Ga0157380_10012768 | 3300014326 | Bacteria | 6102 |
| 192 | Ga0157380_10102499 | 3300014326 | Bacteria | 2386 |
| 193 | Ga0157380_10175839 | 3300014326 | Bacteria | 1875 |
| 194 | Ga0182008_10039562 | 3300014497 | Bacteria | 2356 |
| 195 | Ga0157377_10011186 | 3300014745 | Bacteria | 4472 |
| 196 | Ga0157377_10167519 | 3300014745 | Bacteria | 1371 |
| 197 | Ga0157379_10032912 | 3300014968 | Bacteria | 4622 |
| 198 | Ga0157379_10048594 | 3300014968 | Bacteria | 3787 |
| 199 | Ga0157379_10049428 | 3300014968 | Bacteria | 3755 |
| 200 | Ga0157376_10034199 | 3300014969 | Bacteria | 4102 |
| 201 | Ga0157376_10064826 | 3300014969 | Bacteria | 3082 |
| 202 | Ga0182007_10005578 | 3300015262 | Bacteria | 5506 |
| 203 | Ga0182005_1004663 | 3300015265 | Bacteria | 4382 |
| 204 | Ga0214542_1000012 | 3300021321 | Bacteria | 235800 |
| 205 | Ga0214543_1000024 | 3300021327 | Bacteria | 235745 |
| 206 | Ga0209435_100005 | 3300025206 | Bacteria | 573745 |
| 207 | Ga0209436_100026 | 3300025208 | Bacteria | 90859 |
| 208 | Ga0209437_100078 | 3300025233 | Bacteria | 278088 |
| 209 | Ga0209437_100174 | 3300025233 | Bacteria | 138811 |
| 210 | Ga0207425_1000080 | 3300025245 | Bacteria | 100578 |
| 211 | Ga0207425_1008661 | 3300025245 | Bacteria | 2584 |
| 212 | Ga0209646_1000011 | 3300025246 | Bacteria | 573745 |
| 213 | Ga0209026_1000008 | 3300025250 | Bacteria | 573745 |
| 214 | Ga0209677_100679 | 3300025253 | Bacteria | 17501 |
| 215 | Ga0209759_1000004 | 3300025256 | Bacteria | 573745 |
| 216 | Ga0209129_1000195 | 3300025258 | Bacteria | 80791 |
| 217 | Ga0209129_1000568 | 3300025258 | Bacteria | 25490 |
| 218 | Ga0209129_1003030 | 3300025258 | Bacteria | 7627 |
| 219 | Ga0209129_1004354 | 3300025258 | Bacteria | 5571 |
| 220 | Ga0209233_1000163 | 3300025261 | Bacteria | 152912 |
| 221 | Ga0209233_1000299 | 3300025261 | Bacteria | 60375 |
| 222 | Ga0209233_1000305 | 3300025261 | Bacteria | 58381 |
| 223 | Ga0209673_1000320 | 3300025273 | Bacteria | 88073 |
| 224 | Ga0209673_1000924 | 3300025273 | Bacteria | 37119 |
| 225 | Ga0209673_1001284 | 3300025273 | Bacteria | 25735 |
| 226 | Ga0209673_1002385 | 3300025273 | Bacteria | 13195 |
| 227 | Ga0209673_1002545 | 3300025273 | Bacteria | 12453 |
| 228 | Ga0209673_1004988 | 3300025273 | Bacteria | 6880 |
| 229 | Ga0209673_1004993 | 3300025273 | Bacteria | 6874 |
| 230 | Ga0209673_1009073 | 3300025273 | Bacteria | 4350 |
| 231 | Ga0209673_1029885 | 3300025273 | Bacteria | 1727 |
| 232 | Ga0209130_1000030 | 3300025284 | Bacteria | 323323 |
| 233 | Ga0209130_1000032 | 3300025284 | Bacteria | 316240 |
| 234 | Ga0209130_1000034 | 3300025284 | Bacteria | 302439 |
| 235 | Ga0209130_1006815 | 3300025284 | Bacteria | 3640 |
| 236 | Ga0209676_1002327 | 3300025292 | Bacteria | 13755 |
| 237 | Ga0209025_1000332 | 3300025294 | Bacteria | 104326 |
| 238 | Ga0209025_1000354 | 3300025294 | Bacteria | 98665 |
| 239 | Ga0209025_1001057 | 3300025294 | Bacteria | 40170 |
| 240 | Ga0209025_1008742 | 3300025294 | Bacteria | 7212 |
| 241 | Ga0209025_1022156 | 3300025294 | Bacteria | 3383 |
| 242 | Ga0209025_1058003 | 3300025294 | Bacteria | 1474 |
| 243 | Ga0209564_1000013 | 3300025295 | Bacteria | 775755 |
| 244 | Ga0209564_1000207 | 3300025295 | Bacteria | 135313 |
| 245 | Ga0209564_1000345 | 3300025295 | Bacteria | 88073 |
| 246 | Ga0209564_1001668 | 3300025295 | Bacteria | 21260 |
| 247 | Ga0209758_1000263 | 3300025297 | Bacteria | 104297 |
| 248 | Ga0209758_1000561 | 3300025297 | Bacteria | 58483 |
| 249 | Ga0209758_1002596 | 3300025297 | Bacteria | 18100 |
| 250 | Ga0209758_1036053 | 3300025297 | Bacteria | 1938 |
| 251 | Ga0209050_1002550 | 3300025298 | Bacteria | 15227 |
| 252 | Ga0209050_1002635 | 3300025298 | Bacteria | 14735 |
| 253 | Ga0209256_1000343 | 3300025299 | Bacteria | 75902 |
| 254 | Ga0209256_1001503 | 3300025299 | Bacteria | 23634 |
| 255 | Ga0209256_1006057 | 3300025299 | Bacteria | 6598 |
| 256 | Ga0209256_1006227 | 3300025299 | Bacteria | 6426 |
| 257 | Ga0209256_1011929 | 3300025299 | Bacteria | 3405 |
| 258 | Ga0209256_1014279 | 3300025299 | Bacteria | 2870 |
| 259 | Ga0209256_1015466 | 3300025299 | Bacteria | 2667 |
| 260 | Ga0207426_1000006 | 3300025302 | Bacteria | 1025969 |
| 261 | Ga0207426_1000047 | 3300025302 | Bacteria | 417011 |
| 262 | Ga0207426_1000077 | 3300025302 | Bacteria | 316246 |
| 263 | Ga0207426_1000296 | 3300025302 | Bacteria | 98032 |
| 264 | Ga0207426_1005194 | 3300025302 | Bacteria | 6049 |
| 265 | Ga0209051_1000236 | 3300025303 | Bacteria | 92738 |
| 266 | Ga0209051_1002497 | 3300025303 | Bacteria | 13112 |
| 267 | Ga0209051_1003879 | 3300025303 | Bacteria | 9552 |
| 268 | Ga0209257_1001852 | 3300025304 | Bacteria | 23002 |
| 269 | Ga0209257_1004236 | 3300025304 | Bacteria | 11334 |
| 270 | Ga0209257_1022881 | 3300025304 | Bacteria | 2215 |
| 271 | Ga0207692_10009040 | 3300025898 | Bacteria | 4148 |
| 272 | Ga0207642_10003712 | 3300025899 | Bacteria | 4855 |
| 273 | Ga0207710_10006511 | 3300025900 | Bacteria | 4980 |
| 274 | Ga0207688_10005265 | 3300025901 | Bacteria | 7027 |
| 275 | Ga0207647_10001136 | 3300025904 | Bacteria | 20506 |
| 276 | Ga0207685_10000555 | 3300025905 | Bacteria | 6460 |
| 277 | Ga0207699_10005354 | 3300025906 | Bacteria | 6150 |
| 278 | Ga0207699_10036650 | 3300025906 | Bacteria | 2798 |
| 279 | Ga0207654_10018973 | 3300025911 | Bacteria | 3618 |
| 280 | Ga0207695_10000049 | 3300025913 | Bacteria | 406233 |
| 281 | Ga0207671_10000107 | 3300025914 | Bacteria | 128950 |
| 282 | Ga0207671_10019919 | 3300025914 | Bacteria | 5118 |
| 283 | Ga0207693_10000551 | 3300025915 | Bacteria | 33845 |
| 284 | Ga0207663_10006654 | 3300025916 | Bacteria | 5941 |
| 285 | Ga0207660_10134930 | 3300025917 | Bacteria | 1882 |
| 286 | Ga0207662_10015005 | 3300025918 | Bacteria | 4352 |
| 287 | Ga0207657_10004689 | 3300025919 | Bacteria | 14434 |
| 288 | Ga0207649_10013621 | 3300025920 | Bacteria | 4543 |
| 289 | Ga0207652_10178679 | 3300025921 | Bacteria | 1906 |
| 290 | Ga0207681_10004932 | 3300025923 | Bacteria | 8201 |
| 291 | Ga0207681_10172630 | 3300025923 | Bacteria | 1640 |
| 292 | Ga0207694_10094331 | 3300025924 | Bacteria | 2365 |
| 293 | Ga0207650_10004756 | 3300025925 | Bacteria | 9277 |
| 294 | Ga0207650_10043322 | 3300025925 | Bacteria | 3303 |
| 295 | Ga0207687_10086612 | 3300025927 | Bacteria | 2275 |
| 296 | Ga0207700_10372463 | 3300025928 | Bacteria | 1247 |
| 297 | Ga0207664_10010884 | 3300025929 | Bacteria | 6442 |
| 298 | Ga0207644_10025012 | 3300025931 | Bacteria | 4102 |
| 299 | Ga0207644_10038574 | 3300025931 | Bacteria | 3366 |
| 300 | Ga0207690_10008586 | 3300025932 | Bacteria | 6062 |
| 301 | Ga0207706_10001303 | 3300025933 | Bacteria | 25092 |
| 302 | Ga0207706_10154934 | 3300025933 | Bacteria | 2015 |
| 303 | Ga0207686_10014721 | 3300025934 | Bacteria | 4362 |
| 304 | Ga0207709_10117281 | 3300025935 | Bacteria | 1791 |
| 305 | Ga0207670_10090640 | 3300025936 | Bacteria | 2160 |
| 306 | Ga0207669_10018870 | 3300025937 | Bacteria | 3578 |
| 307 | Ga0207669_10073434 | 3300025937 | Bacteria | 2158 |
| 308 | Ga0207669_10097434 | 3300025937 | Bacteria | 1934 |
| 309 | Ga0207704_10024870 | 3300025938 | Bacteria | 3257 |
| 310 | Ga0207704_10229135 | 3300025938 | Bacteria | 1380 |
| 311 | Ga0207665_10000478 | 3300025939 | Bacteria | 27104 |
| 312 | Ga0207691_10084630 | 3300025940 | Bacteria | 2847 |
| 313 | Ga0207711_10019400 | 3300025941 | Bacteria | 5663 |
| 314 | Ga0207711_10109752 | 3300025941 | Bacteria | 2452 |
| 315 | Ga0207689_10027495 | 3300025942 | Bacteria | 4760 |
| 316 | Ga0207661_10059640 | 3300025944 | Bacteria | 3076 |
| 317 | Ga0207679_10164657 | 3300025945 | Bacteria | 1819 |
| 318 | Ga0207667_10090442 | 3300025949 | Bacteria | 3163 |
| 319 | Ga0207651_10011597 | 3300025960 | Bacteria | 4941 |
| 320 | Ga0207712_10035739 | 3300025961 | Bacteria | 3378 |
| 321 | Ga0207712_10117171 | 3300025961 | Bacteria | 2008 |
| 322 | Ga0207712_10155806 | 3300025961 | Bacteria | 1769 |
| 323 | Ga0207668_10020539 | 3300025972 | Bacteria | 4199 |
| 324 | Ga0207668_10051401 | 3300025972 | Bacteria | 2846 |
| 325 | Ga0207668_10100447 | 3300025972 | Bacteria | 2148 |
| 326 | Ga0207640_10043337 | 3300025981 | Bacteria | 2875 |
| 327 | Ga0207658_10040219 | 3300025986 | Bacteria | 3378 |
| 328 | Ga0207677_10028300 | 3300026023 | Bacteria | 3542 |
| 329 | Ga0207703_10012880 | 3300026035 | Bacteria | 6522 |
| 330 | Ga0207639_10050996 | 3300026041 | Bacteria | 3145 |
| 331 | Ga0207678_10001177 | 3300026067 | Bacteria | 23961 |
| 332 | Ga0207708_10001719 | 3300026075 | Bacteria | 16202 |
| 333 | Ga0207708_10146537 | 3300026075 | Bacteria | 1856 |
| 334 | Ga0207702_10024534 | 3300026078 | Bacteria | 5004 |
| 335 | Ga0207641_10009946 | 3300026088 | Bacteria | 7827 |
| 336 | Ga0207648_10023059 | 3300026089 | Bacteria | 5583 |
| 337 | Ga0207648_10034146 | 3300026089 | Bacteria | 4486 |
| 338 | Ga0207648_10158377 | 3300026089 | Bacteria | 1999 |
| 339 | Ga0207648_10393935 | 3300026089 | Bacteria | 1254 |
| 340 | Ga0207676_10051930 | 3300026095 | Bacteria | 3202 |
| 341 | Ga0207674_10017275 | 3300026116 | Bacteria | 7872 |
| 342 | Ga0207675_100096520 | 3300026118 | Bacteria | 2783 |
| 343 | Ga0207675_100284008 | 3300026118 | Bacteria | 1609 |
| 344 | Ga0207683_10002755 | 3300026121 | Bacteria | 15350 |
| 345 | Ga0207683_10348984 | 3300026121 | Bacteria | 1358 |
| 346 | Ga0207698_10483987 | 3300026142 | Bacteria | 1201 |
| 347 | Ga0209371_1009479 | 3300027312 | Bacteria | 3091 |
| 348 | Ga0207428_10032560 | 3300027907 | Bacteria | 4286 |
| 349 | Ga0268265_10059098 | 3300028380 | Bacteria | 2931 |
| 350 | Ga0268264_10025585 | 3300028381 | Bacteria | 4822 |
| 351 | Ga0268264_10046645 | 3300028381 | Bacteria | 3599 |
| 352 | Ga0268264_10064602 | 3300028381 | Bacteria | 3081 |
| 353 | Ga0307515_10000582 | 3300028794 | Bacteria | 85700 |
| 354 | Ga0307515_10066660 | 3300028794 | Bacteria | 4982 |
| 355 | Ga0265330_10057123 | 3300031235 | Bacteria | 1703 |
| 356 | Ga0265339_10032582 | 3300031249 | Bacteria | 2938 |
| 357 | Ga0307513_10025406 | 3300031456 | Bacteria | 6863 |
| 358 | Ga0307408_100088960 | 3300031548 | Bacteria | 2327 |
| 359 | Ga0265314_10117542 | 3300031711 | Bacteria | 1679 |
| 360 | Ga0307516_10040071 | 3300031730 | Bacteria | 4665 |
| 361 | Ga0307405_10002639 | 3300031731 | Bacteria | 7966 |
| 362 | Ga0307413_10019699 | 3300031824 | Bacteria | 3572 |
| 363 | Ga0307410_10044755 | 3300031852 | Bacteria | 2943 |
| 364 | Ga0307406_10001664 | 3300031901 | Bacteria | 12223 |
| 365 | Ga0307416_100222981 | 3300032002 | Bacteria | 1810 |
| 366 | Ga0307414_10009844 | 3300032004 | Bacteria | 5511 |
| 367 | Ga0307414_10223321 | 3300032004 | Bacteria | 1548 |
| 368 | Ga0307411_10041252 | 3300032005 | Bacteria | 2935 |
| 369 | Ga0307415_100031872 | 3300032126 | Bacteria | 3402 |
| 370 | Ga0373930_0003763 | 3300034816 | Bacteria | 2432 |
| 371 | Ga0373948_0008856 | 3300034817 | Bacteria | 1724 |
| 372 | Ga0373926_0049717 | 3300035083 | Bacteria | 1510 |
| 373 | Ga0373940_0017764 | 3300035088 | Bacteria | 1776 |
| 374 | Ga0373932_0020569 | 3300035112 | Bacteria | 1732 |
| 375 | Ga0373943_0061736 | 3300035170 | Bacteria | 1874 |
| 376 | Ga0373962_0004361 | 3300035242 | Bacteria | 3418 |
| 377 | Ga0373935_0016743 | 3300035692 | Bacteria | 4437 |
| 378 | Ga0373927_0051251 | 3300035695 | Bacteria | 2669 |
| 379 | Ga0373947_0008051 | 3300035725 | Bacteria | 6079 |
| 380 | Ga0373937_0072265 | 3300036401 | Bacteria | 3182 |
| 381 | Ga0316584_0148992 | 3300036712 | Bacteria | 1743 |
| 382 | Ga0395900_0105037 | 3300037418 | Bacteria | 2902 |
| 383 | Ga0395898_0011073 | 3300037466 | Bacteria | 9393 |
| 384 | Ga0395905_0003153 | 3300037471 | Bacteria | 17758 |
| 385 | Ga0395901_0538400 | 3300038443 | Bacteria | 1184 |
| 386 | Ga0439466_0072270 | 3300041411 | Bacteria | 1097 |
| 387 | Ga0439465_0024740 | 3300041413 | Bacteria | 1893 |
| 388 | Ga0439465_0078750 | 3300041413 | Bacteria | 1114 |
| 389 | Ga0451833_0783907 | 3300041491 | Bacteria | 1583 |
| 390 | Ga0451837_0908075 | 3300041494 | Bacteria | 3186 |
| 391 | Ga0451841_0354402 | 3300041498 | Bacteria | 1815 |
| 392 | Ga0451847_0031456 | 3300041503 | Bacteria | 3015 |
| 393 | Ga0451849_0196173 | 3300041505 | Bacteria | 1583 |
| 394 | Ga0451843_0055679 | 3300041509 | Bacteria | 2984 |
| 395 | Ga0451853_2888965 | 3300041512 | Bacteria | 8115 |
| 396 | Ga0439462_0046650 | 3300042015 | Bacteria | 1161 |
| 397 | Ga0495603_0000740 | 3300046455 | Bacteria | 18651 |
| 398 | Ga0495629_0000841 | 3300046459 | Bacteria | 24882 |
| 399 | Ga0495638_0000591 | 3300046460 | Bacteria | 40915 |
| 400 | Ga0495641_0029644 | 3300046461 | Bacteria | 2635 |
| 401 | Ga0495580_0004062 | 3300046472 | Bacteria | 12353 |
| 402 | Ga0495582_0000461 | 3300046473 | Bacteria | 22212 |
| 403 | Ga0495605_0053266 | 3300046474 | Bacteria | 1963 |
| 404 | Ga0495639_0003136 | 3300046475 | Bacteria | 7182 |
| 405 | Ga0495585_0009526 | 3300046492 | Bacteria | 5816 |
| 406 | Ga0495585_0074985 | 3300046492 | Bacteria | 1840 |
| 407 | Ga0495594_0004429 | 3300046499 | Bacteria | 7226 |
| 408 | Ga0495583_0047098 | 3300046506 | Bacteria | 1985 |
| 409 | Ga0495606_0007602 | 3300046507 | Bacteria | 9640 |
| 410 | Ga0495606_0118411 | 3300046507 | Bacteria | 1588 |
| 411 | Ga0495610_0033376 | 3300046512 | Bacteria | 2662 |
| 412 | Ga0495610_0038229 | 3300046512 | Bacteria | 2437 |
| 413 | Ga0495620_0047266 | 3300046515 | Bacteria | 1853 |
| 414 | Ga0495620_0091569 | 3300046515 | Bacteria | 1219 |
| 415 | Ga0495631_0018486 | 3300046518 | Bacteria | 3279 |
| 416 | Ga0495632_0008120 | 3300046519 | Bacteria | 6494 |
| 417 | Ga0495632_0045150 | 3300046519 | Bacteria | 2196 |
| 418 | Ga0495643_0028455 | 3300046522 | Bacteria | 3133 |
| 419 | Ga0495643_0047695 | 3300046522 | Bacteria | 2318 |
| 420 | Ga0495643_0110013 | 3300046522 | Bacteria | 1402 |
| 421 | Ga0495654_0013123 | 3300046530 | Bacteria | 4437 |
| 422 | Ga0495668_0032989 | 3300046616 | Bacteria | 2911 |
| 423 | Ga0495634_0042228 | 3300046642 | Bacteria | 3094 |
| 424 | Ga0495625_0013649 | 3300046660 | Bacteria | 6516 |
| 425 | Ga0495635_0113819 | 3300046663 | Bacteria | 1847 |
| 426 | Ga0495588_0001977 | 3300046674 | Bacteria | 8764 |
| 427 | Ga0495647_0002052 | 3300046681 | Bacteria | 6301 |
| 428 | Ga0495613_0000595 | 3300046689 | Bacteria | 29139 |
| 429 | Ga0495624_0190902 | 3300046690 | Bacteria | 1246 |
| 430 | Ga0495649_0092474 | 3300046694 | Bacteria | 1611 |
| 431 | Ga0495649_0125167 | 3300046694 | Bacteria | 1358 |
| 432 | Ga0495589_0071460 | 3300046794 | Bacteria | 1696 |
| 433 | Ga0495660_0021555 | 3300046810 | Bacteria | 3690 |
| 434 | Ga0495660_0096056 | 3300046810 | Bacteria | 1532 |
| 435 | Ga0495581_0022400 | 3300047315 | Bacteria | 3661 |
| 436 | Ga0495676_0023326 | 3300047321 | Bacteria | 5373 |
| 437 | Ga0495686_0062725 | 3300047472 | Bacteria | 2304 |
| 438 | Ga0495686_0066598 | 3300047472 | Bacteria | 2225 |
| 439 | Ga0495686_0095117 | 3300047472 | Bacteria | 1804 |
| 440 | Ga0495686_0144950 | 3300047472 | Bacteria | 1399 |
| 441 | Ga0495593_0006408 | 3300047673 | Bacteria | 6901 |
| 442 | Ga0495614_0003145 | 3300048089 | Bacteria | 7365 |
| 443 | Ga0496100_0103989 | 3300048903 | Bacteria | 1961 |
| 444 | Ga0496101_0008511 | 3300048904 | Bacteria | 6706 |
| 445 | Ga0496101_0062769 | 3300048904 | Bacteria | 2702 |
| 446 | Ga0496101_0092769 | 3300048904 | Bacteria | 2248 |
| 447 | Ga0496102_0042393 | 3300048905 | Bacteria | 4123 |
| 448 | Ga0496102_0118971 | 3300048905 | Bacteria | 2466 |
| 449 | Ga0496102_0120332 | 3300048905 | Bacteria | 2452 |
| 450 | Ga0496102_0470931 | 3300048905 | Bacteria | 1177 |
| 451 | Ga0496103_0015637 | 3300048906 | Bacteria | 4521 |
| 452 | Ga0496103_0072482 | 3300048906 | Bacteria | 2157 |
| 453 | Ga0496104_0015695 | 3300048907 | Bacteria | 6869 |
| 454 | Ga0496104_0024916 | 3300048907 | Bacteria | 5510 |
| 455 | Ga0496104_0028197 | 3300048907 | Bacteria | 5203 |
| 456 | Ga0496105_0041368 | 3300048908 | Bacteria | 3798 |
| 457 | Ga0496105_0097483 | 3300048908 | Bacteria | 2428 |
| 458 | Ga0496106_0081222 | 3300048909 | Bacteria | 2490 |
| 459 | Ga0496106_0136421 | 3300048909 | Bacteria | 1927 |
| 460 | Ga0496107_0023830 | 3300048910 | Bacteria | 4326 |
| 461 | Ga0496107_0024245 | 3300048910 | Bacteria | 4291 |
| 462 | Ga0496107_0029776 | 3300048910 | Bacteria | 3887 |
| 463 | Ga0496107_0197639 | 3300048910 | Bacteria | 1494 |
| 464 | Ga0496109_0186002 | 3300048912 | Bacteria | 1951 |
| 465 | Ga0496109_0480138 | 3300048912 | Bacteria | 1173 |
| 466 | Ga0496110_0110336 | 3300048913 | Bacteria | 2472 |
| 467 | Ga0496111_0104412 | 3300048914 | Bacteria | 2084 |
| 468 | Ga0496113_0007347 | 3300048916 | Bacteria | 7077 |
| 469 | Ga0496114_0015063 | 3300048917 | Bacteria | 6217 |
| 470 | Ga0496114_0022902 | 3300048917 | Bacteria | 5091 |
| 471 | Ga0496114_0032206 | 3300048917 | Bacteria | 4314 |
| 472 | Ga0496115_0041766 | 3300048918 | Bacteria | 3651 |
| 473 | Ga0496116_0002361 | 3300048919 | Bacteria | 19961 |
| 474 | Ga0496116_0037398 | 3300048919 | Bacteria | 3385 |
| 475 | Ga0496116_0095918 | 3300048919 | Bacteria | 1788 |
| 476 | Ga0496117_0014505 | 3300048920 | Bacteria | 6783 |
| 477 | Ga0496118_0013335 | 3300048921 | Bacteria | 7783 |
| 478 | Ga0496118_0101960 | 3300048921 | Bacteria | 1936 |
| 479 | Ga0496118_0127256 | 3300048921 | Bacteria | 1644 |
| 480 | Ga0496121_0003259 | 3300048924 | Bacteria | 23331 |
| 481 | Ga0496121_0010789 | 3300048924 | Bacteria | 10239 |
| 482 | Ga0496121_0159142 | 3300048924 | Bacteria | 1653 |
| 483 | Ga0496122_0000106 | 3300048925 | Bacteria | 193672 |
| 484 | Ga0496122_0001278 | 3300048925 | Bacteria | 41879 |
| 485 | Ga0496122_0019999 | 3300048925 | Bacteria | 6084 |
| 486 | Ga0496122_0037047 | 3300048925 | Bacteria | 3934 |
| 487 | Ga0496122_0063286 | 3300048925 | Bacteria | 2701 |
| 488 | Ga0496122_0070806 | 3300048925 | Bacteria | 2488 |
| 489 | Ga0496122_0147193 | 3300048925 | Bacteria | 1461 |
| 490 | Ga0496123_0000022 | 3300048926 | Bacteria | 361832 |
| 491 | Ga0496123_0001041 | 3300048926 | Bacteria | 41987 |
| 492 | Ga0496123_0013107 | 3300048926 | Bacteria | 6994 |
| 493 | Ga0496123_0067195 | 3300048926 | Bacteria | 2265 |
| 494 | Ga0496123_0071286 | 3300048926 | Bacteria | 2168 |
| 495 | Ga0496123_0110354 | 3300048926 | Bacteria | 1574 |
| 496 | Ga0496124_0002119 | 3300048927 | Bacteria | 26718 |
| 497 | Ga0496124_0005723 | 3300048927 | Bacteria | 13845 |
| 498 | Ga0496124_0034683 | 3300048927 | Bacteria | 4424 |
| 499 | Ga0496124_0055620 | 3300048927 | Bacteria | 3343 |
| 500 | Ga0496124_0106350 | 3300048927 | Bacteria | 2265 |
| 501 | Ga0496124_0140060 | 3300048927 | Bacteria | 1910 |
| 502 | Ga0496125_0000248 | 3300048928 | Bacteria | 110840 |
| 503 | Ga0496125_0048689 | 3300048928 | Bacteria | 3531 |
| 504 | Ga0496125_0206313 | 3300048928 | Bacteria | 1281 |
| 505 | Ga0496126_0001356 | 3300048929 | Bacteria | 38810 |
| 506 | Ga0496126_0175120 | 3300048929 | Bacteria | 1825 |
| 507 | Ga0496126_0394147 | 3300048929 | Bacteria | 1124 |
| 508 | Ga0501031_0014187 | 3300049568 | Bacteria | 5185 |
| 509 | Ga0501031_0022978 | 3300049568 | Bacteria | 4067 |
| 510 | Ga0501032_0048925 | 3300049569 | Bacteria | 2854 |
| 511 | Ga0501034_0000012 | 3300049571 | Bacteria | 310504 |
| 512 | Ga0501034_0012058 | 3300049571 | Bacteria | 8935 |
| 513 | Ga0501034_0076067 | 3300049571 | Bacteria | 3364 |
| 514 | Ga0501034_0124056 | 3300049571 | Bacteria | 2568 |
| 515 | Ga0501036_0023907 | 3300049572 | Bacteria | 5150 |
| 516 | Ga0501036_0160805 | 3300049572 | Bacteria | 1893 |
| 517 | Ga0501038_0044867 | 3300049574 | Bacteria | 3839 |
| 518 | Ga0501038_0046663 | 3300049574 | Bacteria | 3755 |
| 519 | Ga0501039_0003920 | 3300049575 | Bacteria | 11180 |
| 520 | Ga0501039_0018420 | 3300049575 | Bacteria | 5359 |
| 521 | Ga0501039_0160520 | 3300049575 | Bacteria | 1767 |
| 522 | Ga0501040_0024229 | 3300049576 | Bacteria | 4072 |
| 523 | Ga0501040_0130545 | 3300049576 | Bacteria | 1766 |
| 524 | Ga0501040_0171802 | 3300049576 | Bacteria | 1535 |
| 525 | Ga0501041_0069220 | 3300049577 | Bacteria | 2164 |
| 526 | Ga0501042_0004481 | 3300049578 | Bacteria | 8910 |
| 527 | Ga0501042_0022673 | 3300049578 | Bacteria | 4386 |
| 528 | Ga0501042_0134833 | 3300049578 | Bacteria | 1780 |
| 529 | Ga0501042_0345287 | 3300049578 | Bacteria | 1076 |
| 530 | Ga0501043_0073761 | 3300049579 | Bacteria | 2680 |
| 531 | Ga0501043_0221007 | 3300049579 | Bacteria | 1465 |
| 532 | Ga0501046_0015793 | 3300049580 | Bacteria | 6335 |
| 533 | Ga0501046_0038960 | 3300049580 | Bacteria | 3810 |
| 534 | Ga0501048_0000273 | 3300049582 | Bacteria | 34673 |
| 535 | Ga0501068_0046151 | 3300049584 | Bacteria | 2627 |
| 536 | Ga0501071_0023237 | 3300049587 | Bacteria | 4329 |
| 537 | Ga0501071_0029103 | 3300049587 | Bacteria | 3896 |
| 538 | Ga0501072_0006088 | 3300049588 | Bacteria | 9205 |
| 539 | Ga0501072_0053262 | 3300049588 | Bacteria | 3187 |
| 540 | Ga0501072_0054012 | 3300049588 | Bacteria | 3164 |
| 541 | Ga0501073_0140292 | 3300049589 | Bacteria | 1675 |
| 542 | Ga0501074_0014204 | 3300049590 | Bacteria | 5792 |
| 543 | Ga0501074_0038403 | 3300049590 | Bacteria | 3470 |
| 544 | Ga0501074_0060746 | 3300049590 | Bacteria | 2723 |
| 545 | Ga0501075_0023280 | 3300049591 | Bacteria | 4534 |
| 546 | Ga0501075_0036618 | 3300049591 | Bacteria | 3662 |
| 547 | Ga0501075_0044409 | 3300049591 | Bacteria | 3334 |
| 548 | Ga0501075_0187604 | 3300049591 | Bacteria | 1577 |
| 549 | Ga0501076_0002471 | 3300049592 | Bacteria | 12697 |
| 550 | Ga0501076_0043386 | 3300049592 | Bacteria | 3543 |
| 551 | Ga0501076_0082967 | 3300049592 | Bacteria | 2573 |
| 552 | Ga0501077_0008785 | 3300049593 | Bacteria | 6271 |
| 553 | Ga0501077_0022687 | 3300049593 | Bacteria | 3978 |
| 554 | Ga0501077_0044815 | 3300049593 | Bacteria | 2809 |
| 555 | Ga0501077_0074918 | 3300049593 | Bacteria | 2143 |
| 556 | Ga0501079_0019944 | 3300049741 | Bacteria | 5122 |
| 557 | Ga0501079_0026235 | 3300049741 | Bacteria | 4466 |
| 558 | Ga0501080_0139956 | 3300049742 | Bacteria | 2238 |
| 559 | Ga0501081_0037782 | 3300049743 | Bacteria | 3295 |
| 560 | Ga0501081_0154454 | 3300049743 | Bacteria | 1650 |
| 561 | Ga0501081_0219610 | 3300049743 | Bacteria | 1382 |
| 562 | Ga0501083_0114300 | 3300049744 | Bacteria | 1773 |
| 563 | Ga0501083_0127847 | 3300049744 | Bacteria | 1665 |
| 564 | Ga0501035_0157576 | 3300049822 | Bacteria | 1967 |
| 565 | Ga0501035_0178307 | 3300049822 | Bacteria | 1832 |
| 566 | Ga0501045_0017016 | 3300049824 | Bacteria | 5163 |
| 567 | Ga0501045_0031367 | 3300049824 | Bacteria | 3849 |
| 568 | Ga0501045_0139227 | 3300049824 | Bacteria | 1805 |
| 569 | Ga0501045_0169094 | 3300049824 | Bacteria | 1628 |
| 570 | nmdc:mga00v17_123950_c1 | 3300050491 | Bacteria | 1647 |
| 571 | nmdc:mga07m45_135359_c1 | 3300050496 | Bacteria | 1426 |
| 572 | nmdc:mga05p37_11818_c1 | 3300050507 | Bacteria | 10407 |
| 573 | nmdc:mga05p37_63064_c1 | 3300050507 | Bacteria | 4562 |
| 574 | nmdc:mga09592_16186_c1 | 3300050508 | Bacteria | 6096 |
| 575 | nmdc:mga06r32_21646_c1 | 3300050510 | Bacteria | 5937 |
| 576 | nmdc:mga06r32_22935_c1 | 3300050510 | Bacteria | 5773 |
| 577 | nmdc:mga06r32_268650_c1 | 3300050510 | Bacteria | 1693 |
| 578 | nmdc:mga08y16_184327_c1 | 3300050511 | Bacteria | 2167 |
| 579 | nmdc:mga0n895_220711_c1 | 3300050512 | Bacteria | 1925 |
| 580 | nmdc:mga08x19_82159_c1 | 3300050514 | Bacteria | 2117 |
| 581 | nmdc:mga0a205_24382_c1 | 3300050515 | Bacteria | 5753 |
| 582 | Ga0495601_0015971 | 3300053077 | Bacteria | 4543 |
| 583 | Ga0500610_0066512 | 3300053079 | Bacteria | 1879 |
| 584 | Ga0495595_0016186 | 3300053084 | Bacteria | 3186 |
| 585 | Ga0495595_0074900 | 3300053084 | Bacteria | 1605 |
| 586 | Ga0495619_0011845 | 3300053085 | Bacteria | 5493 |
| 587 | Ga0495619_0017554 | 3300053085 | Bacteria | 4532 |
| 588 | Ga0500641_0022550 | 3300053096 | Bacteria | 2413 |
| 589 | Ga0500555_034324 | 3300053103 | Bacteria | 1428 |
| 590 | Ga0500569_002019 | 3300053109 | Bacteria | 3943 |
| 591 | Ga0500569_024058 | 3300053109 | Bacteria | 1644 |
| 592 | Ga0500658_0000514 | 3300053134 | Bacteria | 16536 |
| 593 | Ga0500559_0010416 | 3300053136 | Bacteria | 3991 |
| 594 | Ga0500568_0027958 | 3300053139 | Bacteria | 2354 |
| 595 | Ga0500616_0000944 | 3300053153 | Bacteria | 31705 |
| 596 | Ga0500622_0001277 | 3300053156 | Bacteria | 20505 |
| 597 | Ga0500622_0004917 | 3300053156 | Bacteria | 8165 |
| 598 | Ga0500627_0040319 | 3300053158 | Bacteria | 2004 |
| 599 | Ga0501084_0004163 | 3300054114 | Bacteria | 11794 |
| 600 | Ga0501084_0116761 | 3300054114 | Bacteria | 2243 |
| 601 | Ga0501084_0391958 | 3300054114 | Bacteria | 1173 |
| 602 | Ga0587088_000912 | 3300059508 | Bacteria | 2805 |
| 603 | Ga0587088_007114 | 3300059508 | Bacteria | 1535 |
| 604 | Ga0501082_0007075 | 3300060353 | Bacteria | 9684 |
| 605 | Ga0501082_0030168 | 3300060353 | Bacteria | 4673 |
| 606 | Ga0501082_0107325 | 3300060353 | Bacteria | 2416 |
| 607 | Ga0530510_0018441 | 3300061734 | Bacteria | 4948 |
| 608 | Ga0530510_0058582 | 3300061734 | Bacteria | 2785 |
| 609 | Ga0530510_0068599 | 3300061734 | Bacteria | 2572 |
| 610 | Ga0530510_0071714 | 3300061734 | Bacteria | 2514 |
| 611 | Ga0530510_0085966 | 3300061734 | Bacteria | 2291 |
| 612 | Ga0530510_0119915 | 3300061734 | Bacteria | 1930 |
| 613 | 2509389768 | 2509276021 | Bacteria | 7634384 |
| 614 | 2509447978 | 2509276033 | Bacteria | 7180565 |
| 615 | 2510134916 | 2510065019 | Bacteria | 6903379 |
| 616 | 2510841730 | 2510461069 | Bacteria | 5505000 |
| 617 | 2510896327 | 2510461076 | Bacteria | 8618824 |
| 618 | 2511136487 | 2510917022 | Bacteria | 6504556 |
| 619 | 2511187261 | 2510917028 | Bacteria | 6185411 |
| 620 | 2511195961 | 2510917030 | Bacteria | 7460662 |
| 621 | 2513573703 | 2513237084 | Bacteria | 7231967 |
| 622 | 2513580089 | 2513237085 | Bacteria | 7695351 |
| 623 | 2513599833 | 2513237088 | Bacteria | 6927906 |
| 624 | 2513631243 | 2513237093 | Bacteria | 7545552 |
| 625 | 2513710862 | 2513237103 | Bacteria | 7647401 |
| 626 | 2513867041 | 2513237138 | Bacteria | 7368160 |
| 627 | 2513927020 | 2513237146 | Bacteria | 7166346 |
| 628 | 2514001434 | 2513237159 | Bacteria | 6810126 |
| 629 | 2514023217 | 2513237162 | Bacteria | 7468464 |
| 630 | 2515113999 | 2515075009 | Bacteria | 7288508 |
| 631 | 2515637172 | 2515154113 | Bacteria | 7807172 |
| 632 | 2515642952 | 2515154114 | Bacteria | 7848616 |
| 633 | 2515656700 | 2515154116 | Bacteria | 7552979 |
| 634 | 2515743643 | 2515154134 | Bacteria | 7220242 |
| 635 | 2516204208 | 2516143018 | Bacteria | 6951533 |
| 636 | 2517037633 | 2516653077 | Bacteria | 7555578 |
| 637 | 2517077918 | 2516653085 | Bacteria | 7346596 |
| 638 | 2517096716 | 2517093000 | Bacteria | 7412387 |
| 639 | 2517410431 | 2517287029 | Bacteria | 6905599 |
| 640 | 2523466234 | 2523231067 | Bacteria | 5230452 |
| 641 | 2524460003 | 2524023209 | Bacteria | 6679728 |
| 642 | 2530647027 | 2529292951 | Bacteria | 6916614 |
| 643 | 2535519334 | 2534681796 | Bacteria | 7146037 |
| 644 | 2585169706 | 2582581283 | Bacteria | 6030556 |
| 645 | 2585202384 | 2582581294 | Bacteria | 6626667 |
| 646 | 2585224703 | 2582581298 | Bacteria | 7315509 |
| 647 | 2585227910 | 2582581299 | Bacteria | 6518058 |
| 648 | 2585255507 | 2582581304 | Bacteria | 5831370 |
| 649 | 2585267345 | 2582581306 | Bacteria | 6450535 |
| 650 | 2585274354 | 2582581307 | Bacteria | 6597605 |
| 651 | 2585280236 | 2582581308 | Bacteria | 7413247 |
| 652 | 2585322513 | 2582581315 | Bacteria | 7318924 |
| 653 | 2585335126 | 2582581316 | Bacteria | 7774528 |
| 654 | 2585386413 | 2582581865 | Bacteria | 6644329 |
| 655 | 2585393322 | 2582581866 | Bacteria | 6859583 |
| 656 | 2585402318 | 2582581867 | Bacteria | 7184437 |
| 657 | 2585529004 | 2585427526 | Bacteria | 7258840 |
| 658 | 2585532465 | 2585427527 | Bacteria | 7273426 |
| 659 | 2585540945 | 2585427528 | Bacteria | 6842387 |
| 660 | 2585547259 | 2585427529 | Bacteria | 7395659 |
| 661 | 2585554518 | 2585427530 | Bacteria | 7383882 |
| 662 | 2585560803 | 2585427531 | Bacteria | 6992870 |
| 663 | 2585822383 | 2585427590 | Bacteria | 6824633 |
| 664 | 2585839707 | 2585427593 | Bacteria | 7141551 |
| 665 | 2585845477 | 2585427594 | Bacteria | 6180594 |
| 666 | 2585899004 | 2585427608 | Bacteria | 6544331 |
| 667 | 2585903402 | 2585427609 | Bacteria | 6667127 |
| 668 | 2587981479 | 2585428125 | Bacteria | 6662905 |
| 669 | 2599335938 | 2599185156 | Bacteria | 5403036 |
| 670 | 2599420486 | 2599185170 | Bacteria | 7295545 |
| 671 | 2616295634 | 2615840624 | Bacteria | 6557588 |
| 672 | 2616307464 | 2615840626 | Bacteria | 7921970 |
| 673 | 2616555010 | 2615840698 | Bacteria | 7319877 |
| 674 | 2644006540 | 2643221599 | Bacteria | 6292121 |
| 675 | 2644050447 | 2643221607 | Bacteria | 6314006 |
| 676 | 2644195984 | 2643221634 | Bacteria | 6705461 |
| 677 | 2644205675 | 2643221636 | Bacteria | 6583769 |
| 678 | 2644208961 | 2643221637 | Bacteria | 5345260 |
| 679 | 2644241957 | 2643221643 | Bacteria | 5749658 |
| 680 | 2644299323 | 2643221653 | Bacteria | 4569637 |
| 681 | 2644483365 | 2643221686 | Bacteria | 6310811 |
| 682 | 2644492093 | 2643221688 | Bacteria | 5260751 |
| 683 | 2644499574 | 2643221689 | Bacteria | 6042950 |
| 684 | 2644652491 | 2643221718 | Bacteria | 5345506 |
| 685 | 2644657551 | 2643221719 | Bacteria | 4568197 |
| 686 | 2644675972 | 2643221723 | Bacteria | 7095460 |
| 687 | 2671112255 | 2667528174 | Bacteria | 6435400 |
| 688 | 2692315479 | 2690316117 | Bacteria | 6800650 |
| 689 | 2719182668 | 2718217882 | Bacteria | 6556348 |
| 690 | 2719387339 | 2718217927 | Bacteria | 6972593 |
| 691 | 2719666984 | 2718217997 | Bacteria | 6740740 |
| 692 | 2719733386 | 2718218009 | Bacteria | 6478651 |
| 693 | 2720493404 | 2718218199 | Bacteria | 6740745 |
| 694 | 2720614875 | 2718218232 | Bacteria | 6720332 |
| 695 | 2720621648 | 2718218233 | Bacteria | 6662049 |
| 696 | 2720632976 | 2718218235 | Bacteria | 6630699 |
| 697 | 2720776700 | 2718218269 | Bacteria | 6906114 |
| 698 | 2721148781 | 2718218363 | Bacteria | 6524337 |
| 699 | 2721160165 | 2718218365 | Bacteria | 6274507 |
| 700 | 2721165594 | 2718218366 | Bacteria | 6425255 |
| 701 | 2721400974 | 2718218423 | Bacteria | 6438183 |
| 702 | 2722841764 | 2721755514 | Bacteria | 6424414 |
| 703 | 2723028288 | 2721755556 | Bacteria | 6745503 |
| 704 | 2723561916 | 2721755684 | Bacteria | 6859907 |
| 705 | 2723568548 | 2721755685 | Bacteria | 6704835 |
| 706 | 2724039787 | 2721755809 | Bacteria | 6438790 |
| 707 | 2724046142 | 2721755810 | Bacteria | 6479005 |
| 708 | 2724091307 | 2721755819 | Bacteria | 6906405 |
| 709 | 2724105813 | 2721755822 | Bacteria | 6726041 |
| 710 | 2724111639 | 2721755823 | Bacteria | 6752556 |
| 711 | 2725950840 | 2724679232 | Bacteria | 7646494 |
| 712 | 2730109224 | 2728369352 | Bacteria | 6745171 |
| 713 | 2730165903 | 2728369365 | Bacteria | 6555560 |
| 714 | 2730299797 | 2728369397 | Bacteria | 6274511 |
| 715 | 2738804813 | 2738541293 | Bacteria | 7065685 |
| 716 | 2739035502 | 2738541333 | Bacteria | 7106503 |
| 717 | 2739347043 | 2738543031 | Bacteria | 5769731 |
| 718 | 2753462084 | 2751185821 | Bacteria | 6189929 |
| 719 | 2765469139 | 2765235802 | Bacteria | 5618596 |
| 720 | 2766065247 | 2765235942 | Bacteria | 7445910 |
| 721 | 2770196381 | 2767802442 | Bacteria | 5747986 |
| 722 | 2776268504 | 2775506902 | Bacteria | 6208009 |
| 723 | 2776285415 | 2775506904 | Bacteria | 5954060 |
| 724 | 2778176074 | 2775507266 | Bacteria | 7392367 |
| 725 | 2792585064 | 2791355082 | Bacteria | 5973319 |
| 726 | 2792620707 | 2791355091 | Bacteria | 6135441 |
| 727 | 2792626067 | 2791355092 | Bacteria | 6248105 |
| 728 | 2792639010 | 2791355094 | Bacteria | 7011481 |
| 729 | 2793293551 | 2791355256 | Bacteria | 6798008 |
| 730 | 2793313004 | 2791355259 | Bacteria | 7254731 |
| 731 | 2793319651 | 2791355260 | Bacteria | 6598818 |
| 732 | 2793327850 | 2791355261 | Bacteria | 6661293 |
| 733 | 2793333464 | 2791355262 | Bacteria | 6774204 |
| 734 | 2793342015 | 2791355263 | Bacteria | 6872478 |
| 735 | 2793347442 | 2791355264 | Bacteria | 6429314 |
| 736 | 2793353773 | 2791355265 | Bacteria | 6539969 |
| 737 | 2793359627 | 2791355266 | Bacteria | 7116587 |
| 738 | 2793369377 | 2791355267 | Bacteria | 7222458 |
| 739 | 2805929478 | 2802429605 | Bacteria | 6875453 |
| 740 | 2805935341 | 2802429606 | Bacteria | 6346811 |
| 741 | 2806044488 | 2802429633 | Bacteria | 7341974 |
| 742 | 2806052689 | 2802429634 | Bacteria | 7083200 |
| 743 | 2806058989 | 2802429635 | Bacteria | 7650140 |
| 744 | 2806068348 | 2802429636 | Bacteria | 7597525 |
| 745 | 2806074468 | 2802429637 | Bacteria | 7067217 |
| 746 | 2819243891 | 2818991272 | Bacteria | 4622173 |
| 747 | 2819609539 | 2818991448 | Bacteria | 6772224 |
| 748 | 2819639635 | 2818991453 | Bacteria | 7181617 |
| 749 | 2838019180 | 2838016132 | Bacteria | 6577831 |
| 750 | 2838024229 | 2838022645 | Bacteria | 6494267 |
| 751 | 2838033195 | 2838029111 | Bacteria | 6603031 |
| 752 | 2838040842 | 2838035591 | Bacteria | 7166484 |
| 753 | 2838047431 | 2838042994 | Bacteria | 6046894 |
| 754 | 2838051101 | 2838048938 | Bacteria | 6044578 |
| 755 | 2838063920 | 2838061910 | Bacteria | 6794874 |
| 756 | 2838073405 | 2838068647 | Bacteria | 6208656 |
| 757 | 2838076782 | 2838074704 | Bacteria | 6785777 |
| 758 | 2838664767 | 2838661181 | Bacteria | 7385261 |
| 759 | 2838674622 | 2838668709 | Bacteria | 6671819 |
| 760 | 2838684882 | 2838680041 | Bacteria | 6545511 |
| 761 | 2838691246 | 2838686498 | Bacteria | 7807632 |
| 762 | 2838699281 | 2838694306 | Bacteria | 6853137 |
| 763 | 2838707020 | 2838701080 | Bacteria | 6669771 |
| 764 | 2838712762 | 2838707686 | Bacteria | 6619912 |
| 765 | 2838735729 | 2838729681 | Bacteria | 7400765 |
| 766 | 2838748631 | 2838742623 | Bacteria | 7396178 |
| 767 | 2839997563 | 2839993093 | Bacteria | 5512535 |
| 768 | 2840770648 | 2840764183 | Bacteria | 6358399 |
| 769 | 2840883643 | 2840878972 | Bacteria | 5483153 |
| 770 | 2841853934 | 2841851746 | Bacteria | 7532261 |
| 771 | 2841868098 | 2841864319 | Bacteria | 6742987 |
| 772 | 2842082239 | 2842077413 | Bacteria | 6508645 |
| 773 | 2842113359 | 2842110456 | Bacteria | 7656360 |
| 774 | 2842123164 | 2842118031 | Bacteria | 7033875 |
| 775 | 2842151710 | 2842146304 | Bacteria | 5957337 |
| 776 | 2842162548 | 2842156927 | Bacteria | 6894975 |
| 777 | 2842170024 | 2842163707 | Bacteria | 6916235 |
| 778 | 2842184985 | 2842180545 | Bacteria | 6888678 |
| 779 | 2842198643 | 2842192696 | Bacteria | 6147454 |
| 780 | 2842199771 | 2842198810 | Bacteria | 6608673 |
| 781 | 2842208389 | 2842205361 | Bacteria | 6340321 |
| 782 | 2842220001 | 2842217011 | Bacteria | 7497767 |
| 783 | 2842235642 | 2842229732 | Bacteria | 7475766 |
| 784 | 2842241936 | 2842237096 | Bacteria | 6620661 |
| 785 | 2842249324 | 2842243621 | Bacteria | 7421798 |
| 786 | 2842256771 | 2842250916 | Bacteria | 6579627 |
| 787 | 2842263539 | 2842257432 | Bacteria | 7401195 |
| 788 | 2842266680 | 2842264693 | Bacteria | 6472963 |
| 789 | 2842275721 | 2842271015 | Bacteria | 7807131 |
| 790 | 2842281602 | 2842278818 | Bacteria | 6340002 |
| 791 | 2842288725 | 2842285085 | Bacteria | 6011953 |
| 792 | 2842296240 | 2842291075 | Bacteria | 7076806 |
| 793 | 2842298773 | 2842298080 | Bacteria | 6123127 |
| 794 | 2842308295 | 2842304105 | Bacteria | 7023636 |
| 795 | 2842316424 | 2842311132 | Bacteria | 6616990 |
| 796 | 2842321311 | 2842317721 | Bacteria | 6793725 |
| 797 | 2842345082 | 2842341865 | Bacteria | 7003929 |
| 798 | 2842359359 | 2842357229 | Bacteria | 6485165 |
| 799 | 2842369198 | 2842363717 | Bacteria | 6844742 |
| 800 | 2842375558 | 2842370503 | Bacteria | 7038661 |
| 801 | 2842382640 | 2842377471 | Bacteria | 7140707 |
| 802 | 2842390041 | 2842384541 | Bacteria | 7057858 |
| 803 | 2842398436 | 2842395702 | Bacteria | 6780583 |
| 804 | 2842406608 | 2842402390 | Bacteria | 6681310 |
| 805 | 2842412965 | 2842409023 | Bacteria | 6687331 |
| 806 | 2842419608 | 2842415677 | Bacteria | 6596907 |
| 807 | 2842427040 | 2842422224 | Bacteria | 6239196 |
| 808 | 2842429999 | 2842428310 | Bacteria | 6767288 |
| 809 | 2842436341 | 2842434925 | Bacteria | 6502746 |
| 810 | 2842444044 | 2842441272 | Bacteria | 6769273 |
| 811 | 2842453650 | 2842447887 | Bacteria | 6754142 |
| 812 | 2842464420 | 2842462802 | Bacteria | 6588055 |
| 813 | 2842470670 | 2842469257 | Bacteria | 6752936 |
| 814 | 2842479928 | 2842475841 | Bacteria | 6603183 |
| 815 | 2842483324 | 2842482326 | Bacteria | 7212537 |
| 816 | 2842495532 | 2842489311 | Bacteria | 6620893 |
| 817 | 2842499077 | 2842495871 | Bacteria | 6820686 |
| 818 | 2842507104 | 2842502639 | Bacteria | 6604161 |
| 819 | 2842510801 | 2842509118 | Bacteria | 6850950 |
| 820 | 2842521886 | 2842521101 | Bacteria | 6569494 |
| 821 | 2842926908 | 2842922631 | Bacteria | 5824079 |
| 822 | 2844457420 | 2844454524 | Bacteria | 7952546 |
| 823 | 2847419461 | 2847417321 | Bacteria | 6913799 |
| 824 | 2848994488 | 2848992105 | Bacteria | 6810864 |
| 825 | 2852391288 | 2852387548 | Bacteria | 8025568 |
| 826 | 2854915800 | 2854911287 | Bacteria | 5582813 |
| 827 | 2855872463 | 2855872281 | Bacteria | 6964271 |
| 828 | 2857518827 | 2857516855 | Bacteria | 7787325 |
| 829 | 2891373421 | 2891373044 | Bacteria | 5202277 |
| 830 | 2894657063 | 2894652903 | Bacteria | 4587256 |
| 831 | 2896392311 | 2896384573 | Bacteria | 7700774 |
| 832 | 2899805221 | 2899803654 | Bacteria | 5577784 |
| 833 | 2904584062 | 2904578770 | Bacteria | 5302906 |
| 834 | 2913299246 | 2913295892 | Bacteria | 6333755 |
| 835 | 2919104645 | 2919100787 | Bacteria | 7710546 |
| 836 | 2919124962 | 2919119836 | Bacteria | 5208557 |
| 837 | 2919410742 | 2919408235 | Bacteria | 6149349 |
| 838 | 2920825322 | 2920822456 | Bacteria | 6897201 |
| 839 | 2923558688 | 2923556063 | Bacteria | 6793593 |
| 840 | 2933019900 | 2933016740 | Bacteria | 6355406 |
| 841 | 2933574744 | 2933570622 | Bacteria | 7023390 |
| 842 | 2933589351 | 2933586486 | Bacteria | 7667493 |
| 843 | 2933603465 | 2933599457 | Bacteria | 5858799 |
| 844 | 2935901207 | 2935894831 | Bacteria | 6620579 |
| 845 | 2935907481 | 2935901341 | Bacteria | 7341747 |
| 846 | 2936374797 | 2936367885 | Bacteria | 7324495 |
| 847 | 2936380489 | 2936375103 | Bacteria | 6652732 |
| 848 | 2936382343 | 2936381700 | Bacteria | 7006523 |
| 849 | 2937847197 | 2937843397 | Bacteria | 5256375 |
| 850 | 2989349752 | 2989349275 | Bacteria | 6349068 |
| 851 | 2989774379 | 2989771324 | Bacteria | 5605128 |
| 852 | 2989780428 | 2989776772 | Bacteria | 4843317 |
| 853 | 2996889292 | 2996887358 | Bacteria | 5795980 |
| 854 | 2996894660 | 2996893221 | Bacteria | 5823108 |
| 855 | 3003934152 | 3003930520 | Bacteria | 5667563 |
| 856 | 3005418419 | 3005416602 | Bacteria | 7064308 |
| 857 | 3005449354 | 3005445848 | Bacteria | 6906074 |
| 858 | 3005455658 | 3005452660 | Bacteria | 5889319 |
| 859 | 639650070 | 639633055 | Bacteria | 7751309 |
| 860 | 643826367 | 643692032 | Bacteria | 6891900 |
| 861 | 8005249482 | 8005246636 | Bacteria | 4933972 |
| 862 | 8005264129 | 8005258706 | Bacteria | 6184835 |
| 863 | 8005282086 | 8005275841 | Bacteria | 6929066 |
| 864 | 8005285098 | 8005282627 | Bacteria | 6675747 |
| 865 | 8005294193 | 8005289223 | Bacteria | 6634003 |
| 866 | 8005306606 | 8005301065 | Bacteria | 6614431 |
| 867 | 8005309460 | 8005307578 | Bacteria | 7395396 |
| 868 | 8005318689 | 8005314921 | Bacteria | 7072929 |
| 869 | 8005323819 | 8005321885 | Bacteria | 5795980 |
| 870 | 8005382714 | 8005376324 | Bacteria | 6590079 |
| 871 | 8005383771 | 8005382845 | Bacteria | 6732062 |
| 872 | 8005401097 | 8005395548 | Bacteria | 6806915 |
| 873 | 8005434051 | 8005430974 | Bacteria | 6689030 |
| 874 | 8005464688 | 8005460587 | Bacteria | 7157962 |
| 875 | 8005488429 | 8005484373 | Bacteria | 6297373 |
| 876 | 8005501736 | 8005497431 | Bacteria | 6477605 |
| 877 | 8005547012 | 8005542996 | Bacteria | 7077758 |
| 878 | 8005559091 | 8005556819 | Bacteria | 6908598 |
| 879 | 8005566850 | 8005563573 | Bacteria | 7153261 |
| 880 | 8005574874 | 8005570704 | Bacteria | 6957481 |
| 881 | 8005623090 | 8005619151 | Bacteria | 7030230 |
| 882 | 8005631602 | 8005626139 | Bacteria | 6534237 |
| 883 | 8005648899 | 8005645114 | Bacteria | 6950293 |
| 884 | 8005673158 | 8005668836 | Bacteria | 6953162 |
| 885 | 8005682136 | 8005682033 | Bacteria | 6726518 |
| 886 | 8005693698 | 8005688590 | Bacteria | 6610080 |
| 887 | 8005700939 | 8005695170 | Bacteria | 6912330 |
| 888 | 8018133545 | 8018127388 | Bacteria | 7351159 |
| 889 | 8018170293 | 8018163183 | Bacteria | 7277977 |
| 890 | 8018178394 | 8018176218 | Bacteria | 6896178 |
| 891 | 8023687475 | 8023680758 | Bacteria | 7729763 |
| 892 | 8024482023 | 8024479707 | Bacteria | 6954785 |
| 893 | 8024486950 | 8024486573 | Bacteria | 6540512 |
| 894 | 8024505865 | 8024501048 | Bacteria | 6427847 |
| 895 | 8046773157 | 8046767195 | Bacteria | 7547379 |
| 896 | 8049295387 | 8049293176 | Bacteria | 6128433 |
| 897 | 8054562568 | 8054558443 | Bacteria | 5204801 |
| 898 | 8056381659 | 8056375014 | Bacteria | 7006639 |
| 899 | 8056387096 | 8056382006 | Bacteria | 6408074 |
| 900 | 8057581106 | 8057575449 | Bacteria | 7367519 |
| 901 | 8057877065 | 8057874678 | Bacteria | 7494653 |
| 902 | Ga0439465_0034236 | |||
| 903 | JGI24751J29686_10001606 | |||
| 904 | JGI25155J39150_1000012 | |||
| 905 | JGI25156J39149_1000036 | |||
| 906 | JGI25156J39149_1000049 | |||
| 907 | JGI25162J39368_1000146 | |||
| 908 | JGI25154J39366_1000033 | |||
| 909 | JGI25157J39369_1000055 | |||
| 910 | JGI25152J39213_1001334 | |||
| 911 | JGI25152J39213_1004215 | |||
| 912 | JGI25150J39212_1000063 | |||
| 913 | JGI25150J39212_1003198 | |||
| 914 | JGI25159J45721_1000073 | |||
| 915 | JGI25159J45721_1000198 | |||
| 916 | JGI25159J45721_1002886 | |||
| 917 | JGI25151J46595_10000140 | |||
| 918 | JGI25151J46595_10000750 | |||
| 919 | JGI25151J46595_10034572 | |||
| 920 | JGI25165J46597_1000451 | |||
| 921 | JGI25165J46597_1001044 | |||
| 922 | JGI25153J46596_10003011 | |||
| 923 | JGI25153J46596_10015475 | |||
| 924 | JGI25153J46596_10028045 | |||
| 925 | JGI25160J50197_1000006 | |||
| 926 | JGI25160J50197_1000020 | |||
| 927 | JGI25160J50197_1002386 | |||
| 928 | JGI25161J50226_1000004 | |||
| 929 | JGI25161J50226_1000103 | |||
| 930 | JGI25161J50226_1008740 | |||
| 931 | Ga0006562J51391_1153968 | |||
| 932 | Ga0006562J51391_1153969 | |||
| 933 | Ga0055526_1000562 | |||
| 934 | Ga0055526_1004977 | |||
| 935 | Ga0055526_1020044 | |||
| 936 | Ga0055524_1005106 | |||
| 937 | Ga0055524_1006367 | |||
| 938 | Ga0055536_1000618 | |||
| 939 | Ga0055528_1000581 | |||
| 940 | Ga0055528_1009166 | |||
| 941 | Ga0055528_1011421 | |||
| 942 | Ga0055528_1014566 | |||
| 943 | Ga0055528_1023143 | |||
| 944 | Ga0055540_1000476 | |||
| 945 | Ga0055540_1003314 | |||
| 946 | Ga0055540_1023377 | |||
| 947 | Ga0055531_10021394 | |||
| 948 | Ga0055543_1000002 | |||
| 949 | Ga0055543_1000029 | |||
| 950 | Ga0055543_1000163 | |||
| 951 | Ga0055543_1002440 | |||
| 952 | Ga0065165_1000013 | |||
| 953 | Ga0065165_1000217 | |||
| 954 | Ga0065165_1008510 | |||
| 955 | Ga0065165_1024455 | |||
| 956 | Ga0065715_10004261 | |||
| 957 | Ga0070676_10008327 | |||
| 958 | Ga0070683_100078943 | |||
| 959 | Ga0070690_100111312 | |||
| 960 | Ga0070670_100000201 | |||
| 961 | Ga0070670_100004118 | |||
| 962 | Ga0070680_100038340 | |||
| 963 | Ga0070682_100009745 | |||
| 964 | Ga0070660_100013337 | |||
| 965 | Ga0070689_100052593 | |||
| 966 | Ga0070691_10000937 | |||
| 967 | Ga0070687_100013436 | |||
| 968 | Ga0070661_100317367 | |||
| 969 | Ga0070668_100007905 | |||
| 970 | Ga0070668_100087194 | |||
| 971 | Ga0070669_100003947 | |||
| 972 | Ga0070671_100015550 | |||
| 973 | Ga0070674_100000255 | |||
| 974 | Ga0070673_100098228 | |||
| 975 | Ga0070688_100018819 | |||
| 976 | Ga0070688_100135975 | |||
| 977 | Ga0070659_100022994 | |||
| 978 | Ga0070667_100009549 | |||
| 979 | Ga0070667_100232863 | |||
| 980 | Ga0070667_100243675 | |||
| 981 | Ga0070709_10028766 | |||
| 982 | Ga0070714_100036349 | |||
| 983 | Ga0070713_100122289 | |||
| 984 | Ga0070710_10010750 | |||
| 985 | Ga0070701_10001749 | |||
| 986 | Ga0070711_100000991 | |||
| 987 | Ga0070705_100023732 | |||
| 988 | Ga0070694_100027220 | |||
| 989 | Ga0070663_100004730 | |||
| 990 | Ga0070678_100131444 | |||
| 991 | Ga0070662_100110234 | |||
| 992 | Ga0070662_100270687 | |||
| 993 | Ga0068867_100033115 | |||
| 994 | Ga0068867_100038594 | |||
| 995 | Ga0070707_100072247 | |||
| 996 | Ga0070679_100007954 | |||
| 997 | Ga0070684_100002428 | |||
| 998 | Ga0070697_100002550 | |||
| 999 | Ga0068853_100009025 | |||
| 1000 | Ga0070672_100201471 | |||
| 1001 | Ga0070686_100001426 | |||
| 1002 | Ga0070696_100015998 | |||
| 1003 | Ga0070696_100087680 | |||
| 1004 | Ga0070693_100008518 | |||
| 1005 | Ga0070704_100020506 | |||
| 1006 | Ga0070704_100021719 | |||
| 1007 | Ga0068855_100227759 | |||
| 1008 | Ga0070664_100167863 | |||
| 1009 | Ga0068857_100049572 | |||
| 1010 | Ga0068854_100003774 | |||
| 1011 | Ga0068856_100041938 | |||
| 1012 | Ga0068856_100187564 | |||
| 1013 | Ga0070702_100002406 | |||
| 1014 | Ga0068852_100015192 | |||
| 1015 | Ga0068859_100098726 | |||
| 1016 | Ga0068859_100107019 | |||
| 1017 | Ga0068864_100008425 | |||
| 1018 | Ga0068866_10002650 | |||
| 1019 | Ga0068861_100019992 | |||
| 1020 | Ga0068851_10072531 | |||
| 1021 | Ga0068870_10071104 | |||
| 1022 | Ga0068863_100007448 | |||
| 1023 | Ga0068858_100006719 | |||
| 1024 | Ga0068858_100062165 | |||
| 1025 | Ga0068858_100067055 | |||
| 1026 | Ga0068860_100025587 | |||
| 1027 | Ga0068860_100176224 | |||
| 1028 | Ga0068860_100305024 | |||
| 1029 | Ga0068862_100019327 | |||
| 1030 | Ga0068862_100070626 | |||
| 1031 | Ga0081455_10001941 | |||
| 1032 | Ga0081455_10004546 | |||
| 1033 | Ga0075365_10089806 | |||
| 1034 | Ga0070716_100005064 | |||
| 1035 | Ga0075367_10002996 | |||
| 1036 | Ga0075369_10001644 | |||
| 1037 | Ga0075366_10009828 | |||
| 1038 | Ga0097621_100021212 | |||
| 1039 | Ga0075370_10081892 | |||
| 1040 | Ga0075428_100171214 | |||
| 1041 | Ga0075431_100001445 | |||
| 1042 | Ga0075431_100038265 | |||
| 1043 | Ga0075431_100171369 | |||
| 1044 | Ga0075433_10234698 | |||
| 1045 | Ga0075434_100099120 | |||
| 1046 | Ga0068865_100028038 | |||
| 1047 | Ga0068865_100061874 | |||
| 1048 | Ga0075436_100011810 | |||
| 1049 | Ga0097620_100098724 | |||
| 1050 | Ga0097620_100107019 | |||
| 1051 | Ga0075435_100014925 | |||
| 1052 | Ga0105251_10080294 | |||
| 1053 | Ga0105240_10000019 | |||
| 1054 | Ga0105245_10316332 | |||
| 1055 | Ga0105247_10002602 | |||
| 1056 | Ga0105247_10007399 | |||
| 1057 | Ga0114129_10006974 | |||
| 1058 | Ga0105243_10029798 | |||
| 1059 | Ga0105243_10039301 | |||
| 1060 | Ga0105241_10015032 | |||
| 1061 | Ga0105242_10046401 | |||
| 1062 | Ga0105242_10104123 | |||
| 1063 | Ga0105248_10014453 | |||
| 1064 | Ga0105248_10030508 | |||
| 1065 | Ga0105248_10124009 | |||
| 1066 | Ga0105237_10003975 | |||
| 1067 | Ga0105237_10025836 | |||
| 1068 | Ga0105238_10005416 | |||
| 1069 | Ga0105249_10007708 | |||
| 1070 | Ga0105249_10028244 | |||
| 1071 | Ga0105249_10059202 | |||
| 1072 | Ga0105249_10499312 | |||
| 1073 | Ga0123341_1000015 | |||
| 1074 | Ga0123342_1005228 | |||
| 1075 | Ga0105239_10037732 | |||
| 1076 | Ga0105246_10014433 | |||
| 1077 | Ga0157373_10060189 | |||
| 1078 | Ga0157373_10061120 | |||
| 1079 | Ga0157371_10027003 | |||
| 1080 | Ga0157370_10003322 | |||
| 1081 | Ga0157370_10063549 | |||
| 1082 | Ga0157369_10015957 | |||
| 1083 | Ga0157374_10015991 | |||
| 1084 | Ga0157378_10176601 | |||
| 1085 | Ga0163162_10074226 | |||
| 1086 | Ga0163162_10402741 | |||
| 1087 | Ga0157372_10015254 | |||
| 1088 | Ga0157375_10005311 | |||
| 1089 | Ga0157375_10011932 | |||
| 1090 | Ga0157375_10020436 | |||
| 1091 | Ga0163163_10367868 | |||
| 1092 | Ga0157380_10012768 | |||
| 1093 | Ga0157380_10102499 | |||
| 1094 | Ga0157380_10175839 | |||
| 1095 | Ga0182008_10039562 | |||
| 1096 | Ga0157377_10011186 | |||
| 1097 | Ga0157377_10167519 | |||
| 1098 | Ga0157379_10032912 | |||
| 1099 | Ga0157379_10048594 | |||
| 1100 | Ga0157379_10049428 | |||
| 1101 | Ga0157376_10034199 | |||
| 1102 | Ga0157376_10064826 | |||
| 1103 | Ga0182007_10005578 | |||
| 1104 | Ga0182005_1004663 | |||
| 1105 | Ga0214542_1000012 | |||
| 1106 | Ga0214543_1000024 | |||
| 1107 | Ga0209435_100005 | |||
| 1108 | Ga0209436_100026 | |||
| 1109 | Ga0209437_100078 | |||
| 1110 | Ga0209437_100174 | |||
| 1111 | Ga0207425_1000080 | |||
| 1112 | Ga0207425_1008661 | |||
| 1113 | Ga0209646_1000011 | |||
| 1114 | Ga0209026_1000008 | |||
| 1115 | Ga0209677_100679 | |||
| 1116 | Ga0209759_1000004 | |||
| 1117 | Ga0209129_1000195 | |||
| 1118 | Ga0209129_1000568 | |||
| 1119 | Ga0209129_1003030 | |||
| 1120 | Ga0209129_1004354 | |||
| 1121 | Ga0209233_1000163 | |||
| 1122 | Ga0209233_1000299 | |||
| 1123 | Ga0209233_1000305 | |||
| 1124 | Ga0209673_1000320 | |||
| 1125 | Ga0209673_1000924 | |||
| 1126 | Ga0209673_1001284 | |||
| 1127 | Ga0209673_1002385 | |||
| 1128 | Ga0209673_1002545 | |||
| 1129 | Ga0209673_1004988 | |||
| 1130 | Ga0209673_1004993 | |||
| 1131 | Ga0209673_1009073 | |||
| 1132 | Ga0209673_1029885 | |||
| 1133 | Ga0209130_1000030 | |||
| 1134 | Ga0209130_1000032 | |||
| 1135 | Ga0209130_1000034 | |||
| 1136 | Ga0209130_1006815 | |||
| 1137 | Ga0209676_1002327 | |||
| 1138 | Ga0209025_1000332 | |||
| 1139 | Ga0209025_1000354 | |||
| 1140 | Ga0209025_1001057 | |||
| 1141 | Ga0209025_1008742 | |||
| 1142 | Ga0209025_1022156 | |||
| 1143 | Ga0209025_1058003 | |||
| 1144 | Ga0209564_1000013 | |||
| 1145 | Ga0209564_1000207 | |||
| 1146 | Ga0209564_1000345 | |||
| 1147 | Ga0209564_1001668 | |||
| 1148 | Ga0209758_1000263 | |||
| 1149 | Ga0209758_1000561 | |||
| 1150 | Ga0209758_1002596 | |||
| 1151 | Ga0209758_1036053 | |||
| 1152 | Ga0209050_1002550 | |||
| 1153 | Ga0209050_1002635 | |||
| 1154 | Ga0209256_1000343 | |||
| 1155 | Ga0209256_1001503 | |||
| 1156 | Ga0209256_1006057 | |||
| 1157 | Ga0209256_1006227 | |||
| 1158 | Ga0209256_1011929 | |||
| 1159 | Ga0209256_1014279 | |||
| 1160 | Ga0209256_1015466 | |||
| 1161 | Ga0207426_1000006 | |||
| 1162 | Ga0207426_1000047 | |||
| 1163 | Ga0207426_1000077 | |||
| 1164 | Ga0207426_1000296 | |||
| 1165 | Ga0207426_1005194 | |||
| 1166 | Ga0209051_1000236 | |||
| 1167 | Ga0209051_1002497 | |||
| 1168 | Ga0209051_1003879 | |||
| 1169 | Ga0209257_1001852 | |||
| 1170 | Ga0209257_1004236 | |||
| 1171 | Ga0209257_1022881 | |||
| 1172 | Ga0207692_10009040 | |||
| 1173 | Ga0207642_10003712 | |||
| 1174 | Ga0207710_10006511 | |||
| 1175 | Ga0207688_10005265 | |||
| 1176 | Ga0207647_10001136 | |||
| 1177 | Ga0207685_10000555 | |||
| 1178 | Ga0207699_10005354 | |||
| 1179 | Ga0207699_10036650 | |||
| 1180 | Ga0207654_10018973 | |||
| 1181 | Ga0207695_10000049 | |||
| 1182 | Ga0207671_10000107 | |||
| 1183 | Ga0207671_10019919 | |||
| 1184 | Ga0207693_10000551 | |||
| 1185 | Ga0207663_10006654 | |||
| 1186 | Ga0207660_10134930 | |||
| 1187 | Ga0207662_10015005 | |||
| 1188 | Ga0207657_10004689 | |||
| 1189 | Ga0207649_10013621 | |||
| 1190 | Ga0207652_10178679 | |||
| 1191 | Ga0207681_10004932 | |||
| 1192 | Ga0207681_10172630 | |||
| 1193 | Ga0207694_10094331 | |||
| 1194 | Ga0207650_10004756 | |||
| 1195 | Ga0207650_10043322 | |||
| 1196 | Ga0207687_10086612 | |||
| 1197 | Ga0207700_10372463 | |||
| 1198 | Ga0207664_10010884 | |||
| 1199 | Ga0207644_10025012 | |||
| 1200 | Ga0207644_10038574 | |||
| 1201 | Ga0207690_10008586 | |||
| 1202 | Ga0207706_10001303 | |||
| 1203 | Ga0207706_10154934 | |||
| 1204 | Ga0207686_10014721 | |||
| 1205 | Ga0207709_10117281 | |||
| 1206 | Ga0207670_10090640 | |||
| 1207 | Ga0207669_10018870 | |||
| 1208 | Ga0207669_10073434 | |||
| 1209 | Ga0207669_10097434 | |||
| 1210 | Ga0207704_10024870 | |||
| 1211 | Ga0207704_10229135 | |||
| 1212 | Ga0207665_10000478 | |||
| 1213 | Ga0207691_10084630 | |||
| 1214 | Ga0207711_10019400 | |||
| 1215 | Ga0207711_10109752 | |||
| 1216 | Ga0207689_10027495 | |||
| 1217 | Ga0207661_10059640 | |||
| 1218 | Ga0207679_10164657 | |||
| 1219 | Ga0207667_10090442 | |||
| 1220 | Ga0207651_10011597 | |||
| 1221 | Ga0207712_10035739 | |||
| 1222 | Ga0207712_10117171 | |||
| 1223 | Ga0207712_10155806 | |||
| 1224 | Ga0207668_10020539 | |||
| 1225 | Ga0207668_10051401 | |||
| 1226 | Ga0207668_10100447 | |||
| 1227 | Ga0207640_10043337 | |||
| 1228 | Ga0207658_10040219 | |||
| 1229 | Ga0207677_10028300 | |||
| 1230 | Ga0207703_10012880 | |||
| 1231 | Ga0207639_10050996 | |||
| 1232 | Ga0207678_10001177 | |||
| 1233 | Ga0207708_10001719 | |||
| 1234 | Ga0207708_10146537 | |||
| 1235 | Ga0207702_10024534 | |||
| 1236 | Ga0207641_10009946 | |||
| 1237 | Ga0207648_10023059 | |||
| 1238 | Ga0207648_10034146 | |||
| 1239 | Ga0207648_10158377 | |||
| 1240 | Ga0207648_10393935 | |||
| 1241 | Ga0207676_10051930 | |||
| 1242 | Ga0207674_10017275 | |||
| 1243 | Ga0207675_100096520 | |||
| 1244 | Ga0207675_100284008 | |||
| 1245 | Ga0207683_10002755 | |||
| 1246 | Ga0207683_10348984 | |||
| 1247 | Ga0207698_10483987 | |||
| 1248 | Ga0209371_1009479 | |||
| 1249 | Ga0207428_10032560 | |||
| 1250 | Ga0268265_10059098 | |||
| 1251 | Ga0268264_10025585 | |||
| 1252 | Ga0268264_10046645 | |||
| 1253 | Ga0268264_10064602 | |||
| 1254 | Ga0307515_10000582 | |||
| 1255 | Ga0307515_10066660 | |||
| 1256 | Ga0265330_10057123 | |||
| 1257 | Ga0265339_10032582 | |||
| 1258 | Ga0307513_10025406 | |||
| 1259 | Ga0307408_100088960 | |||
| 1260 | Ga0265314_10117542 | |||
| 1261 | Ga0307516_10040071 | |||
| 1262 | Ga0307405_10002639 | |||
| 1263 | Ga0307413_10019699 | |||
| 1264 | Ga0307410_10044755 | |||
| 1265 | Ga0307406_10001664 | |||
| 1266 | Ga0307416_100222981 | |||
| 1267 | Ga0307414_10009844 | |||
| 1268 | Ga0307414_10223321 | |||
| 1269 | Ga0307411_10041252 | |||
| 1270 | Ga0307415_100031872 | |||
| 1271 | Ga0373930_0003763 | |||
| 1272 | Ga0373948_0008856 | |||
| 1273 | Ga0373926_0049717 | |||
| 1274 | Ga0373940_0017764 | |||
| 1275 | Ga0373932_0020569 | |||
| 1276 | Ga0373943_0061736 | |||
| 1277 | Ga0373962_0004361 | |||
| 1278 | Ga0373935_0016743 | |||
| 1279 | Ga0373927_0051251 | |||
| 1280 | Ga0373947_0008051 | |||
| 1281 | Ga0373937_0072265 | |||
| 1282 | Ga0316584_0148992 | |||
| 1283 | Ga0395900_0105037 | |||
| 1284 | Ga0395898_0011073 | |||
| 1285 | Ga0395905_0003153 | |||
| 1286 | Ga0395901_0538400 | |||
| 1287 | Ga0439466_0072270 | |||
| 1288 | Ga0439465_0024740 | |||
| 1289 | Ga0439465_0078750 | |||
| 1290 | Ga0451833_0783907 | |||
| 1291 | Ga0451837_0908075 | |||
| 1292 | Ga0451841_0354402 | |||
| 1293 | Ga0451847_0031456 | |||
| 1294 | Ga0451849_0196173 | |||
| 1295 | Ga0451843_0055679 | |||
| 1296 | Ga0451853_2888965 | |||
| 1297 | Ga0439462_0046650 | |||
| 1298 | Ga0495603_0000740 | |||
| 1299 | Ga0495629_0000841 | |||
| 1300 | Ga0495638_0000591 | |||
| 1301 | Ga0495641_0029644 | |||
| 1302 | Ga0495580_0004062 | |||
| 1303 | Ga0495582_0000461 | |||
| 1304 | Ga0495605_0053266 | |||
| 1305 | Ga0495639_0003136 | |||
| 1306 | Ga0495585_0009526 | |||
| 1307 | Ga0495585_0074985 | |||
| 1308 | Ga0495594_0004429 | |||
| 1309 | Ga0495583_0047098 | |||
| 1310 | Ga0495606_0007602 | |||
| 1311 | Ga0495606_0118411 | |||
| 1312 | Ga0495610_0033376 | |||
| 1313 | Ga0495610_0038229 | |||
| 1314 | Ga0495620_0047266 | |||
| 1315 | Ga0495620_0091569 | |||
| 1316 | Ga0495631_0018486 | |||
| 1317 | Ga0495632_0008120 | |||
| 1318 | Ga0495632_0045150 | |||
| 1319 | Ga0495643_0028455 | |||
| 1320 | Ga0495643_0047695 | |||
| 1321 | Ga0495643_0110013 | |||
| 1322 | Ga0495654_0013123 | |||
| 1323 | Ga0495668_0032989 | |||
| 1324 | Ga0495634_0042228 | |||
| 1325 | Ga0495625_0013649 | |||
| 1326 | Ga0495635_0113819 | |||
| 1327 | Ga0495588_0001977 | |||
| 1328 | Ga0495647_0002052 | |||
| 1329 | Ga0495613_0000595 | |||
| 1330 | Ga0495624_0190902 | |||
| 1331 | Ga0495649_0092474 | |||
| 1332 | Ga0495649_0125167 | |||
| 1333 | Ga0495589_0071460 | |||
| 1334 | Ga0495660_0021555 | |||
| 1335 | Ga0495660_0096056 | |||
| 1336 | Ga0495581_0022400 | |||
| 1337 | Ga0495676_0023326 | |||
| 1338 | Ga0495686_0062725 | |||
| 1339 | Ga0495686_0066598 | |||
| 1340 | Ga0495686_0095117 | |||
| 1341 | Ga0495686_0144950 | |||
| 1342 | Ga0495593_0006408 | |||
| 1343 | Ga0495614_0003145 | |||
| 1344 | Ga0496100_0103989 | |||
| 1345 | Ga0496101_0008511 | |||
| 1346 | Ga0496101_0062769 | |||
| 1347 | Ga0496101_0092769 | |||
| 1348 | Ga0496102_0042393 | |||
| 1349 | Ga0496102_0118971 | |||
| 1350 | Ga0496102_0120332 | |||
| 1351 | Ga0496102_0470931 | |||
| 1352 | Ga0496103_0015637 | |||
| 1353 | Ga0496103_0072482 | |||
| 1354 | Ga0496104_0015695 | |||
| 1355 | Ga0496104_0024916 | |||
| 1356 | Ga0496104_0028197 | |||
| 1357 | Ga0496105_0041368 | |||
| 1358 | Ga0496105_0097483 | |||
| 1359 | Ga0496106_0081222 | |||
| 1360 | Ga0496106_0136421 | |||
| 1361 | Ga0496107_0023830 | |||
| 1362 | Ga0496107_0024245 | |||
| 1363 | Ga0496107_0029776 | |||
| 1364 | Ga0496107_0197639 | |||
| 1365 | Ga0496109_0186002 | |||
| 1366 | Ga0496109_0480138 | |||
| 1367 | Ga0496110_0110336 | |||
| 1368 | Ga0496111_0104412 | |||
| 1369 | Ga0496113_0007347 | |||
| 1370 | Ga0496114_0015063 | |||
| 1371 | Ga0496114_0022902 | |||
| 1372 | Ga0496114_0032206 | |||
| 1373 | Ga0496115_0041766 | |||
| 1374 | Ga0496116_0002361 | |||
| 1375 | Ga0496116_0037398 | |||
| 1376 | Ga0496116_0095918 | |||
| 1377 | Ga0496117_0014505 | |||
| 1378 | Ga0496118_0013335 | |||
| 1379 | Ga0496118_0101960 | |||
| 1380 | Ga0496118_0127256 | |||
| 1381 | Ga0496121_0003259 | |||
| 1382 | Ga0496121_0010789 | |||
| 1383 | Ga0496121_0159142 | |||
| 1384 | Ga0496122_0000106 | |||
| 1385 | Ga0496122_0001278 | |||
| 1386 | Ga0496122_0019999 | |||
| 1387 | Ga0496122_0037047 | |||
| 1388 | Ga0496122_0063286 | |||
| 1389 | Ga0496122_0070806 | |||
| 1390 | Ga0496122_0147193 | |||
| 1391 | Ga0496123_0000022 | |||
| 1392 | Ga0496123_0001041 | |||
| 1393 | Ga0496123_0013107 | |||
| 1394 | Ga0496123_0067195 | |||
| 1395 | Ga0496123_0071286 | |||
| 1396 | Ga0496123_0110354 | |||
| 1397 | Ga0496124_0002119 | |||
| 1398 | Ga0496124_0005723 | |||
| 1399 | Ga0496124_0034683 | |||
| 1400 | Ga0496124_0055620 | |||
| 1401 | Ga0496124_0106350 | |||
| 1402 | Ga0496124_0140060 | |||
| 1403 | Ga0496125_0000248 | |||
| 1404 | Ga0496125_0048689 | |||
| 1405 | Ga0496125_0206313 | |||
| 1406 | Ga0496126_0001356 | |||
| 1407 | Ga0496126_0175120 | |||
| 1408 | Ga0496126_0394147 | |||
| 1409 | Ga0501031_0014187 | |||
| 1410 | Ga0501031_0022978 | |||
| 1411 | Ga0501032_0048925 | |||
| 1412 | Ga0501034_0000012 | |||
| 1413 | Ga0501034_0012058 | |||
| 1414 | Ga0501034_0076067 | |||
| 1415 | Ga0501034_0124056 | |||
| 1416 | Ga0501036_0023907 | |||
| 1417 | Ga0501036_0160805 | |||
| 1418 | Ga0501038_0044867 | |||
| 1419 | Ga0501038_0046663 | |||
| 1420 | Ga0501039_0003920 | |||
| 1421 | Ga0501039_0018420 | |||
| 1422 | Ga0501039_0160520 | |||
| 1423 | Ga0501040_0024229 | |||
| 1424 | Ga0501040_0130545 | |||
| 1425 | Ga0501040_0171802 | |||
| 1426 | Ga0501041_0069220 | |||
| 1427 | Ga0501042_0004481 | |||
| 1428 | Ga0501042_0022673 | |||
| 1429 | Ga0501042_0134833 | |||
| 1430 | Ga0501042_0345287 | |||
| 1431 | Ga0501043_0073761 | |||
| 1432 | Ga0501043_0221007 | |||
| 1433 | Ga0501046_0015793 | |||
| 1434 | Ga0501046_0038960 | |||
| 1435 | Ga0501048_0000273 | |||
| 1436 | Ga0501068_0046151 | |||
| 1437 | Ga0501071_0023237 | |||
| 1438 | Ga0501071_0029103 | |||
| 1439 | Ga0501072_0006088 | |||
| 1440 | Ga0501072_0053262 | |||
| 1441 | Ga0501072_0054012 | |||
| 1442 | Ga0501073_0140292 | |||
| 1443 | Ga0501074_0014204 | |||
| 1444 | Ga0501074_0038403 | |||
| 1445 | Ga0501074_0060746 | |||
| 1446 | Ga0501075_0023280 | |||
| 1447 | Ga0501075_0036618 | |||
| 1448 | Ga0501075_0044409 | |||
| 1449 | Ga0501075_0187604 | |||
| 1450 | Ga0501076_0002471 | |||
| 1451 | Ga0501076_0043386 | |||
| 1452 | Ga0501076_0082967 | |||
| 1453 | Ga0501077_0008785 | |||
| 1454 | Ga0501077_0022687 | |||
| 1455 | Ga0501077_0044815 | |||
| 1456 | Ga0501077_0074918 | |||
| 1457 | Ga0501079_0019944 | |||
| 1458 | Ga0501079_0026235 | |||
| 1459 | Ga0501080_0139956 | |||
| 1460 | Ga0501081_0037782 | |||
| 1461 | Ga0501081_0154454 | |||
| 1462 | Ga0501081_0219610 | |||
| 1463 | Ga0501083_0114300 | |||
| 1464 | Ga0501083_0127847 | |||
| 1465 | Ga0501035_0157576 | |||
| 1466 | Ga0501035_0178307 | |||
| 1467 | Ga0501045_0017016 | |||
| 1468 | Ga0501045_0031367 | |||
| 1469 | Ga0501045_0139227 | |||
| 1470 | Ga0501045_0169094 | |||
| 1471 | nmdc:mga00v17_123950_c1 | |||
| 1472 | nmdc:mga07m45_135359_c1 | |||
| 1473 | nmdc:mga05p37_11818_c1 | |||
| 1474 | nmdc:mga05p37_63064_c1 | |||
| 1475 | nmdc:mga09592_16186_c1 | |||
| 1476 | nmdc:mga06r32_21646_c1 | |||
| 1477 | nmdc:mga06r32_22935_c1 | |||
| 1478 | nmdc:mga06r32_268650_c1 | |||
| 1479 | nmdc:mga08y16_184327_c1 | |||
| 1480 | nmdc:mga0n895_220711_c1 | |||
| 1481 | nmdc:mga08x19_82159_c1 | |||
| 1482 | nmdc:mga0a205_24382_c1 | |||
| 1483 | Ga0495601_0015971 | |||
| 1484 | Ga0500610_0066512 | |||
| 1485 | Ga0495595_0016186 | |||
| 1486 | Ga0495595_0074900 | |||
| 1487 | Ga0495619_0011845 | |||
| 1488 | Ga0495619_0017554 | |||
| 1489 | Ga0500641_0022550 | |||
| 1490 | Ga0500555_034324 | |||
| 1491 | Ga0500569_002019 | |||
| 1492 | Ga0500569_024058 | |||
| 1493 | Ga0500658_0000514 | |||
| 1494 | Ga0500559_0010416 | |||
| 1495 | Ga0500568_0027958 | |||
| 1496 | Ga0500616_0000944 | |||
| 1497 | Ga0500622_0001277 | |||
| 1498 | Ga0500622_0004917 | |||
| 1499 | Ga0500627_0040319 | |||
| 1500 | Ga0501084_0004163 | |||
| 1501 | Ga0501084_0116761 | |||
| 1502 | Ga0501084_0391958 | |||
| 1503 | Ga0587088_000912 | |||
| 1504 | Ga0587088_007114 | |||
| 1505 | Ga0501082_0007075 | |||
| 1506 | Ga0501082_0030168 | |||
| 1507 | Ga0501082_0107325 | |||
| 1508 | Ga0530510_0018441 | |||
| 1509 | Ga0530510_0058582 | |||
| 1510 | Ga0530510_0068599 | |||
| 1511 | Ga0530510_0071714 | |||
| 1512 | Ga0530510_0085966 | |||
| 1513 | Ga0530510_0119915 | |||
| 1514 | 2509389768 | |||
| 1515 | 2509447978 | |||
| 1516 | 2510134916 | |||
| 1517 | 2510841730 | |||
| 1518 | 2510896327 | |||
| 1519 | 2511136487 | |||
| 1520 | 2511187261 | |||
| 1521 | 2511195961 | |||
| 1522 | 2513573703 | |||
| 1523 | 2513580089 | |||
| 1524 | 2513599833 | |||
| 1525 | 2513631243 | |||
| 1526 | 2513710862 | |||
| 1527 | 2513867041 | |||
| 1528 | 2513927020 | |||
| 1529 | 2514001434 | |||
| 1530 | 2514023217 | |||
| 1531 | 2515113999 | |||
| 1532 | 2515637172 | |||
| 1533 | 2515642952 | |||
| 1534 | 2515656700 | |||
| 1535 | 2515743643 | |||
| 1536 | 2516204208 | |||
| 1537 | 2517037633 | |||
| 1538 | 2517077918 | |||
| 1539 | 2517096716 | |||
| 1540 | 2517410431 | |||
| 1541 | 2523466234 | |||
| 1542 | 2524460003 | |||
| 1543 | 2530647027 | |||
| 1544 | 2535519334 | |||
| 1545 | 2585169706 | |||
| 1546 | 2585202384 | |||
| 1547 | 2585224703 | |||
| 1548 | 2585227910 | |||
| 1549 | 2585255507 | |||
| 1550 | 2585267345 | |||
| 1551 | 2585274354 | |||
| 1552 | 2585280236 | |||
| 1553 | 2585322513 | |||
| 1554 | 2585335126 | |||
| 1555 | 2585386413 | |||
| 1556 | 2585393322 | |||
| 1557 | 2585402318 | |||
| 1558 | 2585529004 | |||
| 1559 | 2585532465 | |||
| 1560 | 2585540945 | |||
| 1561 | 2585547259 | |||
| 1562 | 2585554518 | |||
| 1563 | 2585560803 | |||
| 1564 | 2585822383 | |||
| 1565 | 2585839707 | |||
| 1566 | 2585845477 | |||
| 1567 | 2585899004 | |||
| 1568 | 2585903402 | |||
| 1569 | 2587981479 | |||
| 1570 | 2599335938 | |||
| 1571 | 2599420486 | |||
| 1572 | 2616295634 | |||
| 1573 | 2616307464 | |||
| 1574 | 2616555010 | |||
| 1575 | 2644006540 | |||
| 1576 | 2644050447 | |||
| 1577 | 2644195984 | |||
| 1578 | 2644205675 | |||
| 1579 | 2644208961 | |||
| 1580 | 2644241957 | |||
| 1581 | 2644299323 | |||
| 1582 | 2644483365 | |||
| 1583 | 2644492093 | |||
| 1584 | 2644499574 | |||
| 1585 | 2644652491 | |||
| 1586 | 2644657551 | |||
| 1587 | 2644675972 | |||
| 1588 | 2671112255 | |||
| 1589 | 2692315479 | |||
| 1590 | 2719182668 | |||
| 1591 | 2719387339 | |||
| 1592 | 2719666984 | |||
| 1593 | 2719733386 | |||
| 1594 | 2720493404 | |||
| 1595 | 2720614875 | |||
| 1596 | 2720621648 | |||
| 1597 | 2720632976 | |||
| 1598 | 2720776700 | |||
| 1599 | 2721148781 | |||
| 1600 | 2721160165 | |||
| 1601 | 2721165594 | |||
| 1602 | 2721400974 | |||
| 1603 | 2722841764 | |||
| 1604 | 2723028288 | |||
| 1605 | 2723561916 | |||
| 1606 | 2723568548 | |||
| 1607 | 2724039787 | |||
| 1608 | 2724046142 | |||
| 1609 | 2724091307 | |||
| 1610 | 2724105813 | |||
| 1611 | 2724111639 | |||
| 1612 | 2725950840 | |||
| 1613 | 2730109224 | |||
| 1614 | 2730165903 | |||
| 1615 | 2730299797 | |||
| 1616 | 2738804813 | |||
| 1617 | 2739035502 | |||
| 1618 | 2739347043 | |||
| 1619 | 2753462084 | |||
| 1620 | 2765469139 | |||
| 1621 | 2766065247 | |||
| 1622 | 2770196381 | |||
| 1623 | 2776268504 | |||
| 1624 | 2776285415 | |||
| 1625 | 2778176074 | |||
| 1626 | 2792585064 | |||
| 1627 | 2792620707 | |||
| 1628 | 2792626067 | |||
| 1629 | 2792639010 | |||
| 1630 | 2793293551 | |||
| 1631 | 2793313004 | |||
| 1632 | 2793319651 | |||
| 1633 | 2793327850 | |||
| 1634 | 2793333464 | |||
| 1635 | 2793342015 | |||
| 1636 | 2793347442 | |||
| 1637 | 2793353773 | |||
| 1638 | 2793359627 | |||
| 1639 | 2793369377 | |||
| 1640 | 2805929478 | |||
| 1641 | 2805935341 | |||
| 1642 | 2806044488 | |||
| 1643 | 2806052689 | |||
| 1644 | 2806058989 | |||
| 1645 | 2806068348 | |||
| 1646 | 2806074468 | |||
| 1647 | 2819243891 | |||
| 1648 | 2819609539 | |||
| 1649 | 2819639635 | |||
| 1650 | 2838019180 | |||
| 1651 | 2838024229 | |||
| 1652 | 2838033195 | |||
| 1653 | 2838040842 | |||
| 1654 | 2838047431 | |||
| 1655 | 2838051101 | |||
| 1656 | 2838063920 | |||
| 1657 | 2838073405 | |||
| 1658 | 2838076782 | |||
| 1659 | 2838664767 | |||
| 1660 | 2838674622 | |||
| 1661 | 2838684882 | |||
| 1662 | 2838691246 | |||
| 1663 | 2838699281 | |||
| 1664 | 2838707020 | |||
| 1665 | 2838712762 | |||
| 1666 | 2838735729 | |||
| 1667 | 2838748631 | |||
| 1668 | 2839997563 | |||
| 1669 | 2840770648 | |||
| 1670 | 2840883643 | |||
| 1671 | 2841853934 | |||
| 1672 | 2841868098 | |||
| 1673 | 2842082239 | |||
| 1674 | 2842113359 | |||
| 1675 | 2842123164 | |||
| 1676 | 2842151710 | |||
| 1677 | 2842162548 | |||
| 1678 | 2842170024 | |||
| 1679 | 2842184985 | |||
| 1680 | 2842198643 | |||
| 1681 | 2842199771 | |||
| 1682 | 2842208389 | |||
| 1683 | 2842220001 | |||
| 1684 | 2842235642 | |||
| 1685 | 2842241936 | |||
| 1686 | 2842249324 | |||
| 1687 | 2842256771 | |||
| 1688 | 2842263539 | |||
| 1689 | 2842266680 | |||
| 1690 | 2842275721 | |||
| 1691 | 2842281602 | |||
| 1692 | 2842288725 | |||
| 1693 | 2842296240 | |||
| 1694 | 2842298773 | |||
| 1695 | 2842308295 | |||
| 1696 | 2842316424 | |||
| 1697 | 2842321311 | |||
| 1698 | 2842345082 | |||
| 1699 | 2842359359 | |||
| 1700 | 2842369198 | |||
| 1701 | 2842375558 | |||
| 1702 | 2842382640 | |||
| 1703 | 2842390041 | |||
| 1704 | 2842398436 | |||
| 1705 | 2842406608 | |||
| 1706 | 2842412965 | |||
| 1707 | 2842419608 | |||
| 1708 | 2842427040 | |||
| 1709 | 2842429999 | |||
| 1710 | 2842436341 | |||
| 1711 | 2842444044 | |||
| 1712 | 2842453650 | |||
| 1713 | 2842464420 | |||
| 1714 | 2842470670 | |||
| 1715 | 2842479928 | |||
| 1716 | 2842483324 | |||
| 1717 | 2842495532 | |||
| 1718 | 2842499077 | |||
| 1719 | 2842507104 | |||
| 1720 | 2842510801 | |||
| 1721 | 2842521886 | |||
| 1722 | 2842926908 | |||
| 1723 | 2844457420 | |||
| 1724 | 2847419461 | |||
| 1725 | 2848994488 | |||
| 1726 | 2852391288 | |||
| 1727 | 2854915800 | |||
| 1728 | 2855872463 | |||
| 1729 | 2857518827 | |||
| 1730 | 2891373421 | |||
| 1731 | 2894657063 | |||
| 1732 | 2896392311 | |||
| 1733 | 2899805221 | |||
| 1734 | 2904584062 | |||
| 1735 | 2913299246 | |||
| 1736 | 2919104645 | |||
| 1737 | 2919124962 | |||
| 1738 | 2919410742 | |||
| 1739 | 2920825322 | |||
| 1740 | 2923558688 | |||
| 1741 | 2933019900 | |||
| 1742 | 2933574744 | |||
| 1743 | 2933589351 | |||
| 1744 | 2933603465 | |||
| 1745 | 2935901207 | |||
| 1746 | 2935907481 | |||
| 1747 | 2936374797 | |||
| 1748 | 2936380489 | |||
| 1749 | 2936382343 | |||
| 1750 | 2937847197 | |||
| 1751 | 2989349752 | |||
| 1752 | 2989774379 | |||
| 1753 | 2989780428 | |||
| 1754 | 2996889292 | |||
| 1755 | 2996894660 | |||
| 1756 | 3003934152 | |||
| 1757 | 3005418419 | |||
| 1758 | 3005449354 | |||
| 1759 | 3005455658 | |||
| 1760 | 639650070 | |||
| 1761 | 643826367 | |||
| 1762 | 8005249482 | |||
| 1763 | 8005264129 | |||
| 1764 | 8005282086 | |||
| 1765 | 8005285098 | |||
| 1766 | 8005294193 | |||
| 1767 | 8005306606 | |||
| 1768 | 8005309460 | |||
| 1769 | 8005318689 | |||
| 1770 | 8005323819 | |||
| 1771 | 8005382714 | |||
| 1772 | 8005383771 | |||
| 1773 | 8005401097 | |||
| 1774 | 8005434051 | |||
| 1775 | 8005464688 | |||
| 1776 | 8005488429 | |||
| 1777 | 8005501736 | |||
| 1778 | 8005547012 | |||
| 1779 | 8005559091 | |||
| 1780 | 8005566850 | |||
| 1781 | 8005574874 | |||
| 1782 | 8005623090 | |||
| 1783 | 8005631602 | |||
| 1784 | 8005648899 | |||
| 1785 | 8005673158 | |||
| 1786 | 8005682136 | |||
| 1787 | 8005693698 | |||
| 1788 | 8005700939 | |||
| 1789 | 8018133545 | |||
| 1790 | 8018170293 | |||
| 1791 | 8018178394 | |||
| 1792 | 8023687475 | |||
| 1793 | 8024482023 | |||
| 1794 | 8024486950 | |||
| 1795 | 8024505865 | |||
| 1796 | 8046773157 | |||
| 1797 | 8049295387 | |||
| 1798 | 8054562568 | |||
| 1799 | 8056381659 | |||
| 1800 | 8056387096 | |||
| 1801 | 8057581106 | |||
| 1802 | 8057877065 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2onk-assembly1.cif.gz_B | abc transporter modbc in complex with its binding protein moda | 0.9473 | 4 | 234 |
| 1f3o-assembly1.cif.gz_A-2 | crystal structure of mj0796 atp-binding cassette | 0.9437 | 5 | 218 |
| 2pcj-assembly1.cif.gz_B | crystal structure of abc transporter (aq_297) from aquifex aeolicus vf5 | 0.9411 | 2 | 218 |
| 5xu1-assembly1.cif.gz_A | structure of a non-canonical abc transporter from streptococcus pneumoniae r6 | 0.9396 | 2 | 217 |
| 8bmp-assembly1.cif.gz_A | cryo-em structure of the folate-specific ecf transporter complex in msp2n2 lipid nanodiscs bound to atp and adp | 0.9385 | 2 | 224 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P77795_1_218_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9942 | 1 | 218 | 3.40.50.300 |
| af_P77795_1_218_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9896 | 1 | 218 | 3.40.50.300 |
| 2awoD01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9785 | 5 | 217 | 3.40.50.300 |
| 1oxuA01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9725 | 5 | 236 | 3.40.50.300 |
| af_P33360_1_239_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9619 | 5 | 234 | 3.40.50.300 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7J9YE84-F1-model_v4 | ATP-binding cassette domain-containing protein | 0.9716 | 5 | 222 |
GO:0005524
GO:0016887 GO:0055052 |
| AF-A0A7X9BG07-F1-model_v4 | ABC transporter ATP-binding protein | 0.9692 | 1 | 187 |
GO:0005524
GO:0005886 GO:0015408 GO:0016887 |
| AF-A0A7X9BG07-F1-model_v4 | ABC transporter ATP-binding protein | 0.9591 | 1 | 187 |
GO:0005524
GO:0005886 GO:0015408 GO:0016887 |
| AF-A0A382FBJ4-F1-model_v4 | ABC transporter domain-containing protein | 0.9572 | 76 | 216 |
GO:0005524
GO:0005886 GO:0016887 GO:0022857 |
| AF-A0A832FKS4-F1-model_v4 | ABC transporter ATP-binding protein | 0.9571 | 3 | 199 |
GO:0005524
GO:0016887 |