F485182

General Info

Members Datasets Scaffolds Average Seq Length
901 653 1802 331

Family's Representative Sequence

Representative Sequence 3300041413|Ga0439465_0034236|Ga0439465_0034236_457_1446
Length 329
Sequence MNTAVLFDNVSRHFGAVRAVDRVTLQVAEGEFFAMLGPSGSGKTTCLRLMAGFEQPTTGHIEIFGETAEGVPPYRRSVFQDYALFPHLSILDNVAYGLMVKGIGREERRKAAEDALAMVKLPGYGARRPGQLSGGQRQRVALARALVNKPKVLLLDEPLGALDLKLREQMQEELKSLQKSLGITFVFVTHDQGEALSMADRIAVFNEGRIQQLGRPEDVYNQPKTRFVADFVGSSNVLSAKLCQSLGLNASFASLRPEAVAIAPAANGALSLSGTVAGRSFLGATNRIVVDVDGNRIAVASPAAQAVPAVGSPVTLSFAARDLHPMEDA

Samples

Sample ID Description Type Environment
1 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
2 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
3 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
4 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
5 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
6 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
7 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
8 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
9 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
10 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
11 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
12 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
13 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
14 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
15 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
16 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
17 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
18 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
19 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
20 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
21 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
22 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
23 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
24 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
25 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
26 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
27 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
28 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
29 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
30 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
31 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
32 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
33 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
34 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
35 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
36 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
37 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
38 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
39 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
40 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
41 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
42 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
43 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
44 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
45 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
46 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
47 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
48 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
49 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
50 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
51 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
52 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
53 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
54 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
55 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
56 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
57 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
58 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
59 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
60 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
61 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
62 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
63 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
64 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
65 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
66 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
67 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
68 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
69 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
70 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
71 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
72 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
73 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
74 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
75 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
76 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
77 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
78 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
79 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
80 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
81 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
82 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
83 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
84 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
85 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
86 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
87 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
88 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
89 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
90 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
91 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
92 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
93 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
94 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
95 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
96 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
97 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
98 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
99 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
100 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
101 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
102 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
103 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
104 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
105 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
106 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
107 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
108 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
109 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
110 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
111 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
112 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
113 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
114 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
115 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
116 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
117 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
118 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
119 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
120 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
121 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
122 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
123 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
124 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
125 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
126 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
127 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
128 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
129 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
130 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
131 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
132 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
133 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
134 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
135 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
136 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
137 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
138 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
139 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
140 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
141 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
142 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
143 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
144 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
145 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
146 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
147 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
148 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
149 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
150 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
151 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
152 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
153 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
154 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
155 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
156 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
212 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
213 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
214 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
215 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
216 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
217 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
218 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
219 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
220 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
221 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
222 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
223 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
224 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
225 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
226 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
227 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
228 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
229 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
230 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
231 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
232 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
233 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
234 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
235 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
236 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
237 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
238 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
239 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
240 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
241 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
242 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
243 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
244 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
245 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
246 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
247 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
248 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
249 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
250 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
251 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
252 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
253 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
254 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
255 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
256 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
257 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
258 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
259 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
260 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
261 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
262 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
263 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
264 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
265 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
266 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
267 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
268 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
269 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
270 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
271 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
272 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
273 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
274 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
275 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
276 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
277 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
278 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
279 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
280 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
281 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
282 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
283 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
284 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
285 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
286 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
287 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
288 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
289 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
290 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
291 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
292 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
293 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
294 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
295 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
296 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
297 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
298 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
299 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
300 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
301 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
302 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
303 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
304 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
305 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
306 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
307 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
308 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
309 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
310 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
311 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
312 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
313 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
314 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
315 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
316 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
317 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
318 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
319 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
320 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
321 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
322 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
323 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
324 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
325 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
326 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
327 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
328 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
329 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
330 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
331 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
332 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
333 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
334 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
335 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
336 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
337 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
338 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
339 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
340 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
341 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
342 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
343 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
344 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
345 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
346 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
347 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
348 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
349 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
350 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
351 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
352 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
353 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
354 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
355 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
356 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
357 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
358 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
359 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
360 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
361 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
362 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
363 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
364 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
365 2509276021 Rhizobium leguminosarum bv. trifolii WSM597 Isolate Nodule
366 2509276033 Rhizobium leguminosarum bv. trifolii WSM2012 Isolate Nodule
367 2510065019 Rhizobium leguminosarum bv. trifolii WSM1689 Isolate Nodule
368 2510461069 Rhizobium sp. PDO1-076 Isolate Rhizosphere
369 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
370 2510917022 Rhizobium sp. AP16 Isolate Rhizosphere
371 2510917028 Rhizobium sp. CF122 Isolate Rhizosphere
372 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
373 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
374 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
375 2513237088 Rhizobium mesoamericanum STM6155 Isolate Nodule
376 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
377 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
378 2513237138 Rhizobium favelukesii OR191 Isolate Nodule
379 2513237146 Rhizobium mongolense USDA 1844 (Illumina) Isolate Nodule
380 2513237159 Rhizobium giardinii bv. giardinii H152 Isolate Nodule
381 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
382 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
383 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
384 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
385 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
386 2515154134 Rhizobium gallicum bv. gallicum R602sp Isolate Nodule
387 2516143018 Ensifer sp. BR816 Isolate Nodule
388 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
389 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
390 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
391 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
392 2523231067 Pleomorphomonas oryzae DSM 16300 Isolate Unclassified
393 2524023209 Rhizobium leucaenae USDA 9039 Isolate Nodule
394 2529292951 Rhizobium sp. CCGE 510 Isolate Nodule
395 2534681796 Rhizobium grahamii CCGE 502 Isolate Nodule
396 2582581283 Rhizobium sp. OK665 Isolate Rhizosphere
397 2582581294 Rhizobium sp. CF394 Isolate Rhizosphere
398 2582581298 Rhizobium alamii YR540 Isolate Rhizosphere
399 2582581299 Rhizobium leguminosarum OV483 Isolate Rhizosphere
400 2582581304 Rhizobium sp. YR519 Isolate Rhizosphere
401 2582581306 Rhizobium sp. YR295 Isolate Rhizosphere
402 2582581307 Rhizobium sp. YR060 Isolate Rhizosphere
403 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
404 2582581315 Agrobacterium rhizogenes YR147 Isolate Rhizosphere
405 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
406 2582581865 Rhizobium sp. CF258 Isolate Rhizosphere
407 2582581866 Rhizobium sp. CF097 Isolate Rhizosphere
408 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
409 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
410 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
411 2585427528 Rhizobium leguminosarum CF307 Isolate Rhizosphere
412 2585427529 Rhizobium alamii YR584 Isolate Rhizosphere
413 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
414 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
415 2585427590 Rhizobium sp. CF048 Isolate Rhizosphere
416 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
417 2585427594 Rhizobium sp. YR528 Isolate Rhizosphere
418 2585427608 Agrobacterium rhizogenes OV677 Isolate Rhizosphere
419 2585427609 Agrobacterium rhizogenes CF263 Isolate Rhizosphere
420 2585428125 Agrobacterium rhizogenes CF262 Isolate Rhizosphere
421 2599185156 Rhizobium sp. NFR03 Isolate Rhizoplane
422 2599185170 Rhizobium mongolense USDA 1844 (PacBio) Isolate Nodule
423 2615840624 Rhizobium aethiopicum HBR26 Isolate Nodule
424 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
425 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
426 2643221599 Rhizobium sp. Root708 Isolate Unclassified
427 2643221607 Rhizobium sp. Root73 Isolate Unclassified
428 2643221634 Rhizobium sp. Root1203 Isolate Unclassified
429 2643221636 Rhizobium sp. Root1204 Isolate Unclassified
430 2643221637 Rhizobium sp. Root1212 Isolate Unclassified
431 2643221643 Rhizobium sp. Root1220 Isolate Unclassified
432 2643221653 Rhizobium sp. Root1240 Isolate Unclassified
433 2643221686 Rhizobium sp. Root1334 Isolate Unclassified
434 2643221688 Rhizobium sp. Root482 Isolate Unclassified
435 2643221689 Rhizobium sp. Root483D2 Isolate Unclassified
436 2643221718 Rhizobium sp. Root268 Isolate Unclassified
437 2643221719 Rhizobium sp. Root274 Isolate Unclassified
438 2643221723 Ensifer sp. Root278 Isolate Unclassified
439 2667528174 Rhizobium sp. NFR17 Isolate Rhizoplane
440 2690316117 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
441 2718217882 Rhizobium sp. N741 Isolate Nodule
442 2718217927 Rhizobium sp. N324 Isolate Nodule
443 2718217997 Rhizobium phaseoli sv. phaseoli R723 Isolate Nodule
444 2718218009 Rhizobium sp. N561 Isolate Nodule
445 2718218199 Rhizobium phaseoli sv. phaseoli N261 Isolate Nodule
446 2718218232 Rhizobium phaseoli sv. phaseoli N161 Isolate Nodule
447 2718218233 Rhizobium phaseoli sv. phaseoli R744 Isolate Nodule
448 2718218235 Rhizobium phaseoli sv. phaseoli R620 Isolate Nodule
449 2718218269 Rhizobium phaseoli sv. phaseoli N671 Isolate Nodule
450 2718218363 Rhizobium sp. N113 Isolate Nodule
451 2718218365 Rhizobium sp. N731 Isolate Nodule
452 2718218366 Rhizobium sp. N621 Isolate Nodule
453 2718218423 Rhizobium sp. N941 Isolate Nodule
454 2721755514 Rhizobium sp. N6212 Isolate Nodule
455 2721755556 Rhizobium phaseoli sv. phaseoli N931 Isolate Nodule
456 2721755684 Rhizobium phaseoli sv. phaseoli N841 Isolate Nodule
457 2721755685 Rhizobium phaseoli sv. phaseoli R611 Isolate Nodule
458 2721755809 Rhizobium sp. N541 Isolate Nodule
459 2721755810 Rhizobium sp. N871 Isolate Nodule
460 2721755819 Rhizobium phaseoli sv. phaseoli N771 Isolate Nodule
461 2721755822 Rhizobium phaseoli sv. phaseoli R650 Isolate Nodule
462 2721755823 Rhizobium phaseoli sv. phaseoli R630 Isolate Nodule
463 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
464 2728369352 Rhizobium phaseoli sv. phaseoli N831 Isolate Nodule
465 2728369365 Rhizobium sp. N1341 Isolate Nodule
466 2728369397 Rhizobium sp. N1314 Isolate Nodule
467 2738541293 Rhizobium sp. GV031 Isolate Unclassified
468 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
469 2738543031 Pleomorphomonas sp. CF100 Isolate Unclassified
470 2751185821 Ensifer shofinae CCBAU 251167 Isolate Unclassified
471 2765235802 Phyllobacterium bourgognense 31-25a Isolate Rhizoplane
472 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
473 2767802442 Phyllobacterium brassicacearum 29-15 Isolate Rhizoplane
474 2775506902 Phyllobacterium zundukense Tri-48 Isolate Unclassified
475 2775506904 Phyllobacterium zundukense Tri-38 Isolate Unclassified
476 2775507266 Rhizobium tropici PRF 81 Isolate Nodule
477 2791355082 Ensifer alkalisoli YIC4027 Isolate Nodule
478 2791355091 Sinorhizobium sp. FG01 Isolate Nodule
479 2791355092 Sinorhizobium sp. NG07B Isolate Nodule
480 2791355094 Sinorhizobium sp. BJ1 Isolate Nodule
481 2791355256 Rhizobium sp. M10 Isolate Nodule
482 2791355259 Rhizobium hidalgonense FH14 Isolate Nodule
483 2791355260 Rhizobium sp. L9 Isolate Nodule
484 2791355261 Rhizobium sp. J15 Isolate Nodule
485 2791355262 Rhizobium sp. M1 Isolate Nodule
486 2791355263 Rhizobium chutanense C5 Isolate Nodule
487 2791355264 Rhizobium sp. S9 Isolate Nodule
488 2791355265 Rhizobium sp. H4 Isolate Nodule
489 2791355266 Rhizobium sp. L43 Isolate Nodule
490 2791355267 Rhizobium sp. L18 Isolate Nodule
491 2802429605 Rhizobium sophoriradicis L101 Isolate Nodule
492 2802429606 Rhizobium sophoriradicis JJW1 Isolate Nodule
493 2802429633 Rhizobium anhuiense J3 Isolate Nodule
494 2802429634 Rhizobium anhuiense S10 Isolate Nodule
495 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
496 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
497 2802429637 Rhizobium anhuiense C15 Isolate Nodule
498 2818991272 Rhizobium sp. SLBN-4 Isolate Unclassified
499 2818991448 Rhizobium miluonense 1234 Isolate Unclassified
500 2818991453 Rhizobium lusitanum 1158 Isolate Unclassified
501 2838016132 Rhizobium phaseoli SEMIA 4071 Isolate Nodule
502 2838022645 Rhizobium aethiopicum SEMIA 4074 Isolate Nodule
503 2838029111 Rhizobium tropici SEMIA 4079 Isolate Nodule
504 2838035591 Rhizobium mongolense SEMIA 4087 Isolate Nodule
505 2838042994 Rhizobium esperanzae SEMIA 4089 Isolate Nodule
506 2838048938 Rhizobium pisi 27/80 Isolate Nodule
507 2838061910 Rhizobium phaseoli L15 Isolate Nodule
508 2838068647 Rhizobium esperanzae VC28 Isolate Nodule
509 2838074704 Sinorhizobium terangae SEMIA 6460 Isolate Unclassified
510 2838661181 Rhizobium mongolense SEMIA 402 Isolate Nodule
511 2838668709 Rhizobium sophoriradicis SEMIA 403 Isolate Nodule
512 2838680041 Rhizobium leguminosarum SEMIA 415 Isolate Nodule
513 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
514 2838694306 Rhizobium leguminosarum SEMIA 421 Isolate Nodule
515 2838701080 Rhizobium aethiopicum SEMIA 428 Isolate Nodule
516 2838707686 Rhizobium leguminosarum SEMIA 430 Isolate Nodule
517 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
518 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
519 2839993093 Phyllobacterium endophyticum PEPV15 Isolate Unclassified
520 2840764183 Phyllobacterium sophorae CCBAU 03422 Isolate Unclassified
521 2840878972 Albibacillus kandeliae J95 Isolate Rhizosphere
522 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
523 2841864319 Rhizobium leguminosarum SEMIA 4052 Isolate Nodule
524 2842077413 Rhizobium leguminosarum SEMIA 422 Isolate Nodule
525 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
526 2842118031 Rhizobium esperanzae SEMIA 420 Isolate Nodule
527 2842146304 Rhizobium sophoriradicis SEMIA 454 Isolate Nodule
528 2842156927 Rhizobium leguminosarum SEMIA 459 Isolate Nodule
529 2842163707 Rhizobium leguminosarum SEMIA 460 Isolate Nodule
530 2842180545 Rhizobium leguminosarum SEMIA 463 Isolate Nodule
531 2842192696 Rhizobium esperanzae SEMIA 468 Isolate Nodule
532 2842198810 Rhizobium aethiopicum SEMIA 470 Isolate Nodule
533 2842205361 Rhizobium etli SEMIA 471 Isolate Nodule
534 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
535 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
536 2842237096 Rhizobium leguminosarum SEMIA 482 Isolate Nodule
537 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
538 2842250916 Rhizobium etli SEMIA 484 Isolate Nodule
539 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
540 2842264693 Rhizobium phaseoli SEMIA 487 Isolate Nodule
541 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
542 2842278818 Rhizobium etli SEMIA 489 Isolate Nodule
543 2842285085 Rhizobium lentis SEMIA 490 Isolate Nodule
544 2842291075 Rhizobium leguminosarum SEMIA 491 Isolate Nodule
545 2842298080 Rhizobium leucaenae SEMIA 492 Isolate Nodule
546 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
547 2842311132 Rhizobium phaseoli SEMIA 4002 Isolate Nodule
548 2842317721 Rhizobium etli SEMIA 4004 Isolate Nodule
549 2842341865 Rhizobium leguminosarum SEMIA 4011 Isolate Nodule
550 2842357229 Rhizobium leucaenae SEMIA 4015 Isolate Nodule
551 2842363717 Rhizobium leguminosarum SEMIA 4016 Isolate Nodule
552 2842370503 Rhizobium leguminosarum SEMIA 4022 Isolate Nodule
553 2842377471 Rhizobium leguminosarum SEMIA 4024 Isolate Nodule
554 2842384541 Rhizobium leguminosarum SEMIA 4025 Isolate Nodule
555 2842395702 Rhizobium ecuadorense SEMIA 4029 Isolate Nodule
556 2842402390 Rhizobium lentis SEMIA 4033 Isolate Nodule
557 2842409023 Rhizobium lentis SEMIA 4034 Isolate Nodule
558 2842415677 Rhizobium lentis SEMIA 4036 Isolate Nodule
559 2842422224 Rhizobium esperanzae SEMIA 4042 Isolate Nodule
560 2842428310 Rhizobium phaseoli SEMIA 4050 Isolate Nodule
561 2842434925 Rhizobium esperanzae SEMIA 4051 Isolate Nodule
562 2842441272 Rhizobium esperanzae SEMIA 4053 Isolate Nodule
563 2842447887 Rhizobium esperanzae SEMIA 4055 Isolate Nodule
564 2842462802 Rhizobium phaseoli SEMIA 4057 Isolate Nodule
565 2842469257 Rhizobium phaseoli SEMIA 4058 Isolate Nodule
566 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
567 2842482326 Rhizobium lusitanum SEMIA 4060 Isolate Nodule
568 2842489311 Rhizobium sophoriradicis SEMIA 4061 Isolate Nodule
569 2842495871 Rhizobium etli SEMIA 4062 Isolate Nodule
570 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
571 2842509118 Rhizobium paranaense SEMIA 4064 Isolate Nodule
572 2842521101 Rhizobium giardinii SEMIA 4084 Isolate Nodule
573 2842922631 Pararhizobium sp. R-72066 Isolate Unclassified
574 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
575 2847417321 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
576 2848992105 Sinorhizobium fredii CCBAU 25509 Isolate Unclassified
577 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
578 2854911287 Brucella lupini LUP21 Isolate Unclassified
579 2855872281 Sinorhizobium fredii PCH1 Isolate Nodule
580 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
581 2891373044 Shinella sp. AETb1-6 Isolate Rhizosphere
582 2894652903 Phyllobacterium sp. SYP-B3895 Isolate Rhizosphere
583 2896384573 Ensifer sp. MPMI2T Isolate Unclassified
584 2899803654 Agrobacterium sp. a22-2 Isolate Unclassified
585 2904578770 Phyllobacterium sp. 586 Isolate Unclassified
586 2913295892 Sinorhizobium kostiensis DSM 13372 Isolate Nodule
587 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
588 2919119836 Phyllobacterium sp. 1468 Isolate Rhizosphere
589 2919408235 Rhizobium miluonense 3199 Isolate Unclassified
590 2920822456 Ensifer sesbaniae CCBAU 65729 Isolate Unclassified
591 2923556063 Rhizobium tibeticum 3740 Isolate Unclassified
592 2933016740 Rhizobium sp. SEMIA 4085 Isolate Nodule
593 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
594 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
595 2933599457 Rhizobium phaseoli M3 Isolate Nodule
596 2935894831 Rhizobium leguminosarum SEMIA 419 Isolate Nodule
597 2935901341 Rhizobium leguminosarum SEMIA 4082 Isolate Nodule
598 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
599 2936375103 Rhizobium changzhiense WYCCWR 11317 Isolate Nodule
600 2936381700 Rhizobium chutanense C16 Isolate Unclassified
601 2937843397 Mesorhizobium xinjiangense lm94 Isolate Rhizosphere
602 2989349275 Shinella kummerowiae CCBAU 25048 Isolate Unclassified
603 2989771324 Rhizobium rhizolycopersici DBTS2 Isolate Rhizosphere
604 2989776772 Rhizobium glycinendophyticum CL12 Isolate Unclassified
605 2996887358 Rhizobium sp. R711 Isolate Nodule
606 2996893221 Rhizobium sp. R635 Isolate Nodule
607 3003930520 Sinorhizobium sp. BG8 Isolate Unclassified
608 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
609 3005445848 Rhizobium sp. WYJ-E13 Isolate Unclassified
610 3005452660 Rhizobium grahamii BG7 Isolate Unclassified
611 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
612 643692032 Sinorhizobium fredii NGR234 Isolate Nodule
613 8005246636 Rhizobium wuzhouense W44 Isolate Rhizosphere
614 8005258706 Rhizobium sp. R693 Isolate Nodule
615 8005275841 Rhizobium sp. N4311 Isolate Nodule
616 8005282627 Rhizobium phaseoli NC1 Isolate Nodule
617 8005289223 Rhizobium bangladeshense 1002 Isolate Nodule
618 8005301065 Rhizobium bangladeshense 1017 Isolate Nodule
619 8005307578 Rhizobium leguminosarum bv. phaseoli LCS0306 Isolate Unclassified
620 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
621 8005321885 Rhizobium sp. R72 Isolate Nodule
622 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
623 8005382845 Rhizobium sp. R634 Isolate Nodule
624 8005395548 Rhizobium sp. R339 Isolate Nodule
625 8005430974 Rhizobium phaseoli Y20 Isolate Nodule
626 8005460587 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
627 8005484373 Rhizobium tropici SARCC-755 Isolate Nodule
628 8005497431 Rhizobium phaseoli CCGM8 Isolate Unclassified
629 8005542996 Rhizobium grahamii CCGM3 Isolate Unclassified
630 8005556819 Rhizobium sp. WYCCWR 11128 Isolate Nodule
631 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
632 8005570704 Rhizobium anhuiense bv. trifolii WYCCWR10015 Isolate Nodule
633 8005619151 Rhizobium phaseoli CCGM2 Isolate Unclassified
634 8005626139 Rhizobium phaseoli Y18 Isolate Nodule
635 8005645114 Rhizobium tropici IGFRI Rhizo-19 Isolate Rhizosphere
636 8005668836 Rhizobium phaseoli CCGM9 Isolate Unclassified
637 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified
638 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule
639 8005695170 Rhizobium sp. RMa-01 Isolate Unclassified
640 8018127388 Rhizobium aegyptiacum 950 Isolate Nodule
641 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
642 8018176218 Rhizobium sp. N122 Isolate Nodule
643 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule
644 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule
645 8024486573 Rhizobium tubonense CCBAU 85046 Isolate Nodule
646 8024501048 Rhizobium sp. H4 Isolate Nodule
647 8046767195 Rhizobium calliandrae CCGE524 Isolate Unclassified
648 8049293176 Ensifer alkalisoli YIC4027 Isolate Nodule
649 8054558443 Rhizobium alarense TRM95111 Isolate Nodule
650 8056375014 Rhizobium redzepovicii 18T Isolate Nodule
651 8056382006 Rhizobium croatiense 13T Isolate Nodule
652 8057575449 Rhizobium mayense CCGE526 Isolate Nodule
653 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 67.48
Metatranscriptomes 0.44
Isolates 32.08

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 13.87
Nodule 21.53
Rhizoplane 3.77
Rhizosphere 48.39
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0439465_0034236 3300041413 Bacteria 1626
2 JGI24751J29686_10001606 3300002459 Bacteria 4671
3 JGI25155J39150_1000012 3300002704 Bacteria 199435
4 JGI25156J39149_1000036 3300002705 Bacteria 110527
5 JGI25156J39149_1000049 3300002705 Bacteria 91988
6 JGI25162J39368_1000146 3300002737 Bacteria 76858
7 JGI25154J39366_1000033 3300002738 Bacteria 184379
8 JGI25157J39369_1000055 3300002741 Bacteria 107875
9 JGI25152J39213_1001334 3300002773 Bacteria 10889
10 JGI25152J39213_1004215 3300002773 Bacteria 4610
11 JGI25150J39212_1000063 3300002774 Bacteria 64558
12 JGI25150J39212_1003198 3300002774 Bacteria 3881
13 JGI25159J45721_1000073 3300002987 Bacteria 48504
14 JGI25159J45721_1000198 3300002987 Bacteria 27927
15 JGI25159J45721_1002886 3300002987 Bacteria 6282
16 JGI25151J46595_10000140 3300003187 Bacteria 95958
17 JGI25151J46595_10000750 3300003187 Bacteria 26476
18 JGI25151J46595_10034572 3300003187 Bacteria 1931
19 JGI25165J46597_1000451 3300003214 Bacteria 41309
20 JGI25165J46597_1001044 3300003214 Bacteria 18066
21 JGI25153J46596_10003011 3300003215 Bacteria 9532
22 JGI25153J46596_10015475 3300003215 Bacteria 3104
23 JGI25153J46596_10028045 3300003215 Bacteria 1961
24 JGI25160J50197_1000006 3300003354 Bacteria 316247
25 JGI25160J50197_1000020 3300003354 Bacteria 232739
26 JGI25160J50197_1002386 3300003354 Bacteria 8763
27 JGI25161J50226_1000004 3300003374 Bacteria 316212
28 JGI25161J50226_1000103 3300003374 Bacteria 67942
29 JGI25161J50226_1008740 3300003374 Bacteria 1522
30 Ga0006562J51391_1153968 3300003578 Bacteria 1360
31 Ga0006562J51391_1153969 3300003578 Bacteria 1430
32 Ga0055526_1000562 3300003771 Bacteria 29362
33 Ga0055526_1004977 3300003771 Bacteria 7798
34 Ga0055526_1020044 3300003771 Bacteria 2402
35 Ga0055524_1005106 3300003775 Bacteria 5935
36 Ga0055524_1006367 3300003775 Bacteria 5125
37 Ga0055536_1000618 3300003781 Bacteria 24148
38 Ga0055528_1000581 3300003790 Bacteria 27606
39 Ga0055528_1009166 3300003790 Bacteria 4164
40 Ga0055528_1011421 3300003790 Bacteria 3526
41 Ga0055528_1014566 3300003790 Bacteria 2901
42 Ga0055528_1023143 3300003790 Bacteria 1907
43 Ga0055540_1000476 3300003792 Bacteria 30954
44 Ga0055540_1003314 3300003792 Bacteria 7851
45 Ga0055540_1023377 3300003792 Bacteria 1558
46 Ga0055531_10021394 3300003794 Bacteria 2510
47 Ga0055543_1000002 3300004625 Bacteria 390020
48 Ga0055543_1000029 3300004625 Bacteria 131452
49 Ga0055543_1000163 3300004625 Bacteria 55480
50 Ga0055543_1002440 3300004625 Bacteria 6147
51 Ga0065165_1000013 3300005262 Bacteria 301887
52 Ga0065165_1000217 3300005262 Bacteria 100170
53 Ga0065165_1008510 3300005262 Bacteria 4780
54 Ga0065165_1024455 3300005262 Bacteria 2028
55 Ga0065715_10004261 3300005293 Bacteria 4374
56 Ga0070676_10008327 3300005328 Bacteria 5588
57 Ga0070683_100078943 3300005329 Bacteria 3080
58 Ga0070690_100111312 3300005330 Bacteria 1827
59 Ga0070670_100000201 3300005331 Bacteria 55479
60 Ga0070670_100004118 3300005331 Bacteria 12153
61 Ga0070680_100038340 3300005336 Bacteria 3876
62 Ga0070682_100009745 3300005337 Bacteria 5439
63 Ga0070660_100013337 3300005339 Bacteria 5892
64 Ga0070689_100052593 3300005340 Bacteria 3150
65 Ga0070691_10000937 3300005341 Bacteria 11856
66 Ga0070687_100013436 3300005343 Bacteria 3649
67 Ga0070661_100317367 3300005344 Bacteria 1216
68 Ga0070668_100007905 3300005347 Bacteria 7896
69 Ga0070668_100087194 3300005347 Bacteria 2456
70 Ga0070669_100003947 3300005353 Bacteria 10731
71 Ga0070671_100015550 3300005355 Bacteria 6148
72 Ga0070674_100000255 3300005356 Bacteria 26391
73 Ga0070673_100098228 3300005364 Bacteria 2406
74 Ga0070688_100018819 3300005365 Bacteria 3993
75 Ga0070688_100135975 3300005365 Bacteria 1664
76 Ga0070659_100022994 3300005366 Bacteria 4766
77 Ga0070667_100009549 3300005367 Bacteria 8043
78 Ga0070667_100232863 3300005367 Bacteria 1643
79 Ga0070667_100243675 3300005367 Bacteria 1606
80 Ga0070709_10028766 3300005434 Bacteria 3317
81 Ga0070714_100036349 3300005435 Bacteria 4130
82 Ga0070713_100122289 3300005436 Bacteria 2284
83 Ga0070710_10010750 3300005437 Bacteria 4500
84 Ga0070701_10001749 3300005438 Bacteria 8179
85 Ga0070711_100000991 3300005439 Bacteria 15051
86 Ga0070705_100023732 3300005440 Bacteria 3299
87 Ga0070694_100027220 3300005444 Bacteria 3712
88 Ga0070663_100004730 3300005455 Bacteria 8030
89 Ga0070678_100131444 3300005456 Bacteria 1989
90 Ga0070662_100110234 3300005457 Bacteria 2096
91 Ga0070662_100270687 3300005457 Bacteria 1371
92 Ga0068867_100033115 3300005459 Bacteria 3740
93 Ga0068867_100038594 3300005459 Bacteria 3477
94 Ga0070707_100072247 3300005468 Bacteria 3325
95 Ga0070679_100007954 3300005530 Bacteria 9951
96 Ga0070684_100002428 3300005535 Bacteria 13740
97 Ga0070697_100002550 3300005536 Bacteria 14021
98 Ga0068853_100009025 3300005539 Bacteria 8030
99 Ga0070672_100201471 3300005543 Bacteria 1664
100 Ga0070686_100001426 3300005544 Bacteria 13485
101 Ga0070696_100015998 3300005546 Bacteria 5044
102 Ga0070696_100087680 3300005546 Bacteria 2211
103 Ga0070693_100008518 3300005547 Bacteria 5062
104 Ga0070704_100020506 3300005549 Bacteria 4263
105 Ga0070704_100021719 3300005549 Bacteria 4166
106 Ga0068855_100227759 3300005563 Bacteria 2088
107 Ga0070664_100167863 3300005564 Bacteria 1945
108 Ga0068857_100049572 3300005577 Bacteria 3725
109 Ga0068854_100003774 3300005578 Bacteria 9473
110 Ga0068856_100041938 3300005614 Bacteria 4499
111 Ga0068856_100187564 3300005614 Bacteria 2082
112 Ga0070702_100002406 3300005615 Bacteria 8057
113 Ga0068852_100015192 3300005616 Bacteria 5959
114 Ga0068859_100098726 3300005617 Bacteria 2974
115 Ga0068859_100107019 3300005617 Bacteria 2856
116 Ga0068864_100008425 3300005618 Bacteria 8506
117 Ga0068866_10002650 3300005718 Bacteria 7397
118 Ga0068861_100019992 3300005719 Bacteria 4789
119 Ga0068851_10072531 3300005834 Bacteria 1784
120 Ga0068870_10071104 3300005840 Bacteria 1898
121 Ga0068863_100007448 3300005841 Bacteria 10711
122 Ga0068858_100006719 3300005842 Bacteria 11192
123 Ga0068858_100062165 3300005842 Bacteria 3453
124 Ga0068858_100067055 3300005842 Bacteria 3324
125 Ga0068860_100025587 3300005843 Bacteria 5692
126 Ga0068860_100176224 3300005843 Bacteria 2066
127 Ga0068860_100305024 3300005843 Bacteria 1561
128 Ga0068862_100019327 3300005844 Bacteria 5684
129 Ga0068862_100070626 3300005844 Bacteria 3014
130 Ga0081455_10001941 3300005937 Bacteria 24850
131 Ga0081455_10004546 3300005937 Bacteria 15486
132 Ga0075365_10089806 3300006038 Bacteria 2092
133 Ga0070716_100005064 3300006173 Bacteria 6358
134 Ga0075367_10002996 3300006178 Bacteria 7903
135 Ga0075369_10001644 3300006186 Bacteria 7706
136 Ga0075366_10009828 3300006195 Bacteria 5350
137 Ga0097621_100021212 3300006237 Bacteria 5020
138 Ga0075370_10081892 3300006353 Bacteria 1855
139 Ga0075428_100171214 3300006844 Bacteria 2353
140 Ga0075431_100001445 3300006847 Bacteria 21876
141 Ga0075431_100038265 3300006847 Bacteria 4939
142 Ga0075431_100171369 3300006847 Bacteria 2230
143 Ga0075433_10234698 3300006852 Bacteria 1628
144 Ga0075434_100099120 3300006871 Bacteria 2919
145 Ga0068865_100028038 3300006881 Bacteria 3726
146 Ga0068865_100061874 3300006881 Bacteria 2626
147 Ga0075436_100011810 3300006914 Bacteria 5992
148 Ga0097620_100098724 3300006931 Bacteria 2974
149 Ga0097620_100107019 3300006931 Bacteria 2856
150 Ga0075435_100014925 3300007076 Bacteria 5826
151 Ga0105251_10080294 3300009011 Bacteria 1508
152 Ga0105240_10000019 3300009093 Bacteria 406211
153 Ga0105245_10316332 3300009098 Bacteria 1536
154 Ga0105247_10002602 3300009101 Bacteria 12197
155 Ga0105247_10007399 3300009101 Bacteria 6741
156 Ga0114129_10006974 3300009147 Bacteria 16079
157 Ga0105243_10029798 3300009148 Bacteria 4199
158 Ga0105243_10039301 3300009148 Bacteria 3687
159 Ga0105241_10015032 3300009174 Bacteria 5670
160 Ga0105242_10046401 3300009176 Bacteria 3524
161 Ga0105242_10104123 3300009176 Bacteria 2409
162 Ga0105248_10014453 3300009177 Bacteria 8689
163 Ga0105248_10030508 3300009177 Bacteria 6020
164 Ga0105248_10124009 3300009177 Bacteria 2914
165 Ga0105237_10003975 3300009545 Bacteria 17286
166 Ga0105237_10025836 3300009545 Bacteria 6004
167 Ga0105238_10005416 3300009551 Bacteria 12611
168 Ga0105249_10007708 3300009553 Bacteria 9380
169 Ga0105249_10028244 3300009553 Bacteria 5064
170 Ga0105249_10059202 3300009553 Bacteria 3513
171 Ga0105249_10499312 3300009553 Bacteria 1262
172 Ga0123341_1000015 3300009765 Bacteria 86184
173 Ga0123342_1005228 3300009766 Bacteria 19065
174 Ga0105239_10037732 3300010375 Bacteria 5295
175 Ga0105246_10014433 3300011119 Bacteria 4969
176 Ga0157373_10060189 3300013100 Bacteria 2690
177 Ga0157373_10061120 3300013100 Bacteria 2668
178 Ga0157371_10027003 3300013102 Bacteria 4167
179 Ga0157370_10003322 3300013104 Bacteria 18953
180 Ga0157370_10063549 3300013104 Bacteria 3496
181 Ga0157369_10015957 3300013105 Bacteria 8451
182 Ga0157374_10015991 3300013296 Bacteria 6590
183 Ga0157378_10176601 3300013297 Bacteria 2007
184 Ga0163162_10074226 3300013306 Bacteria 3459
185 Ga0163162_10402741 3300013306 Bacteria 1501
186 Ga0157372_10015254 3300013307 Bacteria 8230
187 Ga0157375_10005311 3300013308 Bacteria 11188
188 Ga0157375_10011932 3300013308 Bacteria 7688
189 Ga0157375_10020436 3300013308 Bacteria 6049
190 Ga0163163_10367868 3300014325 Bacteria 1495
191 Ga0157380_10012768 3300014326 Bacteria 6102
192 Ga0157380_10102499 3300014326 Bacteria 2386
193 Ga0157380_10175839 3300014326 Bacteria 1875
194 Ga0182008_10039562 3300014497 Bacteria 2356
195 Ga0157377_10011186 3300014745 Bacteria 4472
196 Ga0157377_10167519 3300014745 Bacteria 1371
197 Ga0157379_10032912 3300014968 Bacteria 4622
198 Ga0157379_10048594 3300014968 Bacteria 3787
199 Ga0157379_10049428 3300014968 Bacteria 3755
200 Ga0157376_10034199 3300014969 Bacteria 4102
201 Ga0157376_10064826 3300014969 Bacteria 3082
202 Ga0182007_10005578 3300015262 Bacteria 5506
203 Ga0182005_1004663 3300015265 Bacteria 4382
204 Ga0214542_1000012 3300021321 Bacteria 235800
205 Ga0214543_1000024 3300021327 Bacteria 235745
206 Ga0209435_100005 3300025206 Bacteria 573745
207 Ga0209436_100026 3300025208 Bacteria 90859
208 Ga0209437_100078 3300025233 Bacteria 278088
209 Ga0209437_100174 3300025233 Bacteria 138811
210 Ga0207425_1000080 3300025245 Bacteria 100578
211 Ga0207425_1008661 3300025245 Bacteria 2584
212 Ga0209646_1000011 3300025246 Bacteria 573745
213 Ga0209026_1000008 3300025250 Bacteria 573745
214 Ga0209677_100679 3300025253 Bacteria 17501
215 Ga0209759_1000004 3300025256 Bacteria 573745
216 Ga0209129_1000195 3300025258 Bacteria 80791
217 Ga0209129_1000568 3300025258 Bacteria 25490
218 Ga0209129_1003030 3300025258 Bacteria 7627
219 Ga0209129_1004354 3300025258 Bacteria 5571
220 Ga0209233_1000163 3300025261 Bacteria 152912
221 Ga0209233_1000299 3300025261 Bacteria 60375
222 Ga0209233_1000305 3300025261 Bacteria 58381
223 Ga0209673_1000320 3300025273 Bacteria 88073
224 Ga0209673_1000924 3300025273 Bacteria 37119
225 Ga0209673_1001284 3300025273 Bacteria 25735
226 Ga0209673_1002385 3300025273 Bacteria 13195
227 Ga0209673_1002545 3300025273 Bacteria 12453
228 Ga0209673_1004988 3300025273 Bacteria 6880
229 Ga0209673_1004993 3300025273 Bacteria 6874
230 Ga0209673_1009073 3300025273 Bacteria 4350
231 Ga0209673_1029885 3300025273 Bacteria 1727
232 Ga0209130_1000030 3300025284 Bacteria 323323
233 Ga0209130_1000032 3300025284 Bacteria 316240
234 Ga0209130_1000034 3300025284 Bacteria 302439
235 Ga0209130_1006815 3300025284 Bacteria 3640
236 Ga0209676_1002327 3300025292 Bacteria 13755
237 Ga0209025_1000332 3300025294 Bacteria 104326
238 Ga0209025_1000354 3300025294 Bacteria 98665
239 Ga0209025_1001057 3300025294 Bacteria 40170
240 Ga0209025_1008742 3300025294 Bacteria 7212
241 Ga0209025_1022156 3300025294 Bacteria 3383
242 Ga0209025_1058003 3300025294 Bacteria 1474
243 Ga0209564_1000013 3300025295 Bacteria 775755
244 Ga0209564_1000207 3300025295 Bacteria 135313
245 Ga0209564_1000345 3300025295 Bacteria 88073
246 Ga0209564_1001668 3300025295 Bacteria 21260
247 Ga0209758_1000263 3300025297 Bacteria 104297
248 Ga0209758_1000561 3300025297 Bacteria 58483
249 Ga0209758_1002596 3300025297 Bacteria 18100
250 Ga0209758_1036053 3300025297 Bacteria 1938
251 Ga0209050_1002550 3300025298 Bacteria 15227
252 Ga0209050_1002635 3300025298 Bacteria 14735
253 Ga0209256_1000343 3300025299 Bacteria 75902
254 Ga0209256_1001503 3300025299 Bacteria 23634
255 Ga0209256_1006057 3300025299 Bacteria 6598
256 Ga0209256_1006227 3300025299 Bacteria 6426
257 Ga0209256_1011929 3300025299 Bacteria 3405
258 Ga0209256_1014279 3300025299 Bacteria 2870
259 Ga0209256_1015466 3300025299 Bacteria 2667
260 Ga0207426_1000006 3300025302 Bacteria 1025969
261 Ga0207426_1000047 3300025302 Bacteria 417011
262 Ga0207426_1000077 3300025302 Bacteria 316246
263 Ga0207426_1000296 3300025302 Bacteria 98032
264 Ga0207426_1005194 3300025302 Bacteria 6049
265 Ga0209051_1000236 3300025303 Bacteria 92738
266 Ga0209051_1002497 3300025303 Bacteria 13112
267 Ga0209051_1003879 3300025303 Bacteria 9552
268 Ga0209257_1001852 3300025304 Bacteria 23002
269 Ga0209257_1004236 3300025304 Bacteria 11334
270 Ga0209257_1022881 3300025304 Bacteria 2215
271 Ga0207692_10009040 3300025898 Bacteria 4148
272 Ga0207642_10003712 3300025899 Bacteria 4855
273 Ga0207710_10006511 3300025900 Bacteria 4980
274 Ga0207688_10005265 3300025901 Bacteria 7027
275 Ga0207647_10001136 3300025904 Bacteria 20506
276 Ga0207685_10000555 3300025905 Bacteria 6460
277 Ga0207699_10005354 3300025906 Bacteria 6150
278 Ga0207699_10036650 3300025906 Bacteria 2798
279 Ga0207654_10018973 3300025911 Bacteria 3618
280 Ga0207695_10000049 3300025913 Bacteria 406233
281 Ga0207671_10000107 3300025914 Bacteria 128950
282 Ga0207671_10019919 3300025914 Bacteria 5118
283 Ga0207693_10000551 3300025915 Bacteria 33845
284 Ga0207663_10006654 3300025916 Bacteria 5941
285 Ga0207660_10134930 3300025917 Bacteria 1882
286 Ga0207662_10015005 3300025918 Bacteria 4352
287 Ga0207657_10004689 3300025919 Bacteria 14434
288 Ga0207649_10013621 3300025920 Bacteria 4543
289 Ga0207652_10178679 3300025921 Bacteria 1906
290 Ga0207681_10004932 3300025923 Bacteria 8201
291 Ga0207681_10172630 3300025923 Bacteria 1640
292 Ga0207694_10094331 3300025924 Bacteria 2365
293 Ga0207650_10004756 3300025925 Bacteria 9277
294 Ga0207650_10043322 3300025925 Bacteria 3303
295 Ga0207687_10086612 3300025927 Bacteria 2275
296 Ga0207700_10372463 3300025928 Bacteria 1247
297 Ga0207664_10010884 3300025929 Bacteria 6442
298 Ga0207644_10025012 3300025931 Bacteria 4102
299 Ga0207644_10038574 3300025931 Bacteria 3366
300 Ga0207690_10008586 3300025932 Bacteria 6062
301 Ga0207706_10001303 3300025933 Bacteria 25092
302 Ga0207706_10154934 3300025933 Bacteria 2015
303 Ga0207686_10014721 3300025934 Bacteria 4362
304 Ga0207709_10117281 3300025935 Bacteria 1791
305 Ga0207670_10090640 3300025936 Bacteria 2160
306 Ga0207669_10018870 3300025937 Bacteria 3578
307 Ga0207669_10073434 3300025937 Bacteria 2158
308 Ga0207669_10097434 3300025937 Bacteria 1934
309 Ga0207704_10024870 3300025938 Bacteria 3257
310 Ga0207704_10229135 3300025938 Bacteria 1380
311 Ga0207665_10000478 3300025939 Bacteria 27104
312 Ga0207691_10084630 3300025940 Bacteria 2847
313 Ga0207711_10019400 3300025941 Bacteria 5663
314 Ga0207711_10109752 3300025941 Bacteria 2452
315 Ga0207689_10027495 3300025942 Bacteria 4760
316 Ga0207661_10059640 3300025944 Bacteria 3076
317 Ga0207679_10164657 3300025945 Bacteria 1819
318 Ga0207667_10090442 3300025949 Bacteria 3163
319 Ga0207651_10011597 3300025960 Bacteria 4941
320 Ga0207712_10035739 3300025961 Bacteria 3378
321 Ga0207712_10117171 3300025961 Bacteria 2008
322 Ga0207712_10155806 3300025961 Bacteria 1769
323 Ga0207668_10020539 3300025972 Bacteria 4199
324 Ga0207668_10051401 3300025972 Bacteria 2846
325 Ga0207668_10100447 3300025972 Bacteria 2148
326 Ga0207640_10043337 3300025981 Bacteria 2875
327 Ga0207658_10040219 3300025986 Bacteria 3378
328 Ga0207677_10028300 3300026023 Bacteria 3542
329 Ga0207703_10012880 3300026035 Bacteria 6522
330 Ga0207639_10050996 3300026041 Bacteria 3145
331 Ga0207678_10001177 3300026067 Bacteria 23961
332 Ga0207708_10001719 3300026075 Bacteria 16202
333 Ga0207708_10146537 3300026075 Bacteria 1856
334 Ga0207702_10024534 3300026078 Bacteria 5004
335 Ga0207641_10009946 3300026088 Bacteria 7827
336 Ga0207648_10023059 3300026089 Bacteria 5583
337 Ga0207648_10034146 3300026089 Bacteria 4486
338 Ga0207648_10158377 3300026089 Bacteria 1999
339 Ga0207648_10393935 3300026089 Bacteria 1254
340 Ga0207676_10051930 3300026095 Bacteria 3202
341 Ga0207674_10017275 3300026116 Bacteria 7872
342 Ga0207675_100096520 3300026118 Bacteria 2783
343 Ga0207675_100284008 3300026118 Bacteria 1609
344 Ga0207683_10002755 3300026121 Bacteria 15350
345 Ga0207683_10348984 3300026121 Bacteria 1358
346 Ga0207698_10483987 3300026142 Bacteria 1201
347 Ga0209371_1009479 3300027312 Bacteria 3091
348 Ga0207428_10032560 3300027907 Bacteria 4286
349 Ga0268265_10059098 3300028380 Bacteria 2931
350 Ga0268264_10025585 3300028381 Bacteria 4822
351 Ga0268264_10046645 3300028381 Bacteria 3599
352 Ga0268264_10064602 3300028381 Bacteria 3081
353 Ga0307515_10000582 3300028794 Bacteria 85700
354 Ga0307515_10066660 3300028794 Bacteria 4982
355 Ga0265330_10057123 3300031235 Bacteria 1703
356 Ga0265339_10032582 3300031249 Bacteria 2938
357 Ga0307513_10025406 3300031456 Bacteria 6863
358 Ga0307408_100088960 3300031548 Bacteria 2327
359 Ga0265314_10117542 3300031711 Bacteria 1679
360 Ga0307516_10040071 3300031730 Bacteria 4665
361 Ga0307405_10002639 3300031731 Bacteria 7966
362 Ga0307413_10019699 3300031824 Bacteria 3572
363 Ga0307410_10044755 3300031852 Bacteria 2943
364 Ga0307406_10001664 3300031901 Bacteria 12223
365 Ga0307416_100222981 3300032002 Bacteria 1810
366 Ga0307414_10009844 3300032004 Bacteria 5511
367 Ga0307414_10223321 3300032004 Bacteria 1548
368 Ga0307411_10041252 3300032005 Bacteria 2935
369 Ga0307415_100031872 3300032126 Bacteria 3402
370 Ga0373930_0003763 3300034816 Bacteria 2432
371 Ga0373948_0008856 3300034817 Bacteria 1724
372 Ga0373926_0049717 3300035083 Bacteria 1510
373 Ga0373940_0017764 3300035088 Bacteria 1776
374 Ga0373932_0020569 3300035112 Bacteria 1732
375 Ga0373943_0061736 3300035170 Bacteria 1874
376 Ga0373962_0004361 3300035242 Bacteria 3418
377 Ga0373935_0016743 3300035692 Bacteria 4437
378 Ga0373927_0051251 3300035695 Bacteria 2669
379 Ga0373947_0008051 3300035725 Bacteria 6079
380 Ga0373937_0072265 3300036401 Bacteria 3182
381 Ga0316584_0148992 3300036712 Bacteria 1743
382 Ga0395900_0105037 3300037418 Bacteria 2902
383 Ga0395898_0011073 3300037466 Bacteria 9393
384 Ga0395905_0003153 3300037471 Bacteria 17758
385 Ga0395901_0538400 3300038443 Bacteria 1184
386 Ga0439466_0072270 3300041411 Bacteria 1097
387 Ga0439465_0024740 3300041413 Bacteria 1893
388 Ga0439465_0078750 3300041413 Bacteria 1114
389 Ga0451833_0783907 3300041491 Bacteria 1583
390 Ga0451837_0908075 3300041494 Bacteria 3186
391 Ga0451841_0354402 3300041498 Bacteria 1815
392 Ga0451847_0031456 3300041503 Bacteria 3015
393 Ga0451849_0196173 3300041505 Bacteria 1583
394 Ga0451843_0055679 3300041509 Bacteria 2984
395 Ga0451853_2888965 3300041512 Bacteria 8115
396 Ga0439462_0046650 3300042015 Bacteria 1161
397 Ga0495603_0000740 3300046455 Bacteria 18651
398 Ga0495629_0000841 3300046459 Bacteria 24882
399 Ga0495638_0000591 3300046460 Bacteria 40915
400 Ga0495641_0029644 3300046461 Bacteria 2635
401 Ga0495580_0004062 3300046472 Bacteria 12353
402 Ga0495582_0000461 3300046473 Bacteria 22212
403 Ga0495605_0053266 3300046474 Bacteria 1963
404 Ga0495639_0003136 3300046475 Bacteria 7182
405 Ga0495585_0009526 3300046492 Bacteria 5816
406 Ga0495585_0074985 3300046492 Bacteria 1840
407 Ga0495594_0004429 3300046499 Bacteria 7226
408 Ga0495583_0047098 3300046506 Bacteria 1985
409 Ga0495606_0007602 3300046507 Bacteria 9640
410 Ga0495606_0118411 3300046507 Bacteria 1588
411 Ga0495610_0033376 3300046512 Bacteria 2662
412 Ga0495610_0038229 3300046512 Bacteria 2437
413 Ga0495620_0047266 3300046515 Bacteria 1853
414 Ga0495620_0091569 3300046515 Bacteria 1219
415 Ga0495631_0018486 3300046518 Bacteria 3279
416 Ga0495632_0008120 3300046519 Bacteria 6494
417 Ga0495632_0045150 3300046519 Bacteria 2196
418 Ga0495643_0028455 3300046522 Bacteria 3133
419 Ga0495643_0047695 3300046522 Bacteria 2318
420 Ga0495643_0110013 3300046522 Bacteria 1402
421 Ga0495654_0013123 3300046530 Bacteria 4437
422 Ga0495668_0032989 3300046616 Bacteria 2911
423 Ga0495634_0042228 3300046642 Bacteria 3094
424 Ga0495625_0013649 3300046660 Bacteria 6516
425 Ga0495635_0113819 3300046663 Bacteria 1847
426 Ga0495588_0001977 3300046674 Bacteria 8764
427 Ga0495647_0002052 3300046681 Bacteria 6301
428 Ga0495613_0000595 3300046689 Bacteria 29139
429 Ga0495624_0190902 3300046690 Bacteria 1246
430 Ga0495649_0092474 3300046694 Bacteria 1611
431 Ga0495649_0125167 3300046694 Bacteria 1358
432 Ga0495589_0071460 3300046794 Bacteria 1696
433 Ga0495660_0021555 3300046810 Bacteria 3690
434 Ga0495660_0096056 3300046810 Bacteria 1532
435 Ga0495581_0022400 3300047315 Bacteria 3661
436 Ga0495676_0023326 3300047321 Bacteria 5373
437 Ga0495686_0062725 3300047472 Bacteria 2304
438 Ga0495686_0066598 3300047472 Bacteria 2225
439 Ga0495686_0095117 3300047472 Bacteria 1804
440 Ga0495686_0144950 3300047472 Bacteria 1399
441 Ga0495593_0006408 3300047673 Bacteria 6901
442 Ga0495614_0003145 3300048089 Bacteria 7365
443 Ga0496100_0103989 3300048903 Bacteria 1961
444 Ga0496101_0008511 3300048904 Bacteria 6706
445 Ga0496101_0062769 3300048904 Bacteria 2702
446 Ga0496101_0092769 3300048904 Bacteria 2248
447 Ga0496102_0042393 3300048905 Bacteria 4123
448 Ga0496102_0118971 3300048905 Bacteria 2466
449 Ga0496102_0120332 3300048905 Bacteria 2452
450 Ga0496102_0470931 3300048905 Bacteria 1177
451 Ga0496103_0015637 3300048906 Bacteria 4521
452 Ga0496103_0072482 3300048906 Bacteria 2157
453 Ga0496104_0015695 3300048907 Bacteria 6869
454 Ga0496104_0024916 3300048907 Bacteria 5510
455 Ga0496104_0028197 3300048907 Bacteria 5203
456 Ga0496105_0041368 3300048908 Bacteria 3798
457 Ga0496105_0097483 3300048908 Bacteria 2428
458 Ga0496106_0081222 3300048909 Bacteria 2490
459 Ga0496106_0136421 3300048909 Bacteria 1927
460 Ga0496107_0023830 3300048910 Bacteria 4326
461 Ga0496107_0024245 3300048910 Bacteria 4291
462 Ga0496107_0029776 3300048910 Bacteria 3887
463 Ga0496107_0197639 3300048910 Bacteria 1494
464 Ga0496109_0186002 3300048912 Bacteria 1951
465 Ga0496109_0480138 3300048912 Bacteria 1173
466 Ga0496110_0110336 3300048913 Bacteria 2472
467 Ga0496111_0104412 3300048914 Bacteria 2084
468 Ga0496113_0007347 3300048916 Bacteria 7077
469 Ga0496114_0015063 3300048917 Bacteria 6217
470 Ga0496114_0022902 3300048917 Bacteria 5091
471 Ga0496114_0032206 3300048917 Bacteria 4314
472 Ga0496115_0041766 3300048918 Bacteria 3651
473 Ga0496116_0002361 3300048919 Bacteria 19961
474 Ga0496116_0037398 3300048919 Bacteria 3385
475 Ga0496116_0095918 3300048919 Bacteria 1788
476 Ga0496117_0014505 3300048920 Bacteria 6783
477 Ga0496118_0013335 3300048921 Bacteria 7783
478 Ga0496118_0101960 3300048921 Bacteria 1936
479 Ga0496118_0127256 3300048921 Bacteria 1644
480 Ga0496121_0003259 3300048924 Bacteria 23331
481 Ga0496121_0010789 3300048924 Bacteria 10239
482 Ga0496121_0159142 3300048924 Bacteria 1653
483 Ga0496122_0000106 3300048925 Bacteria 193672
484 Ga0496122_0001278 3300048925 Bacteria 41879
485 Ga0496122_0019999 3300048925 Bacteria 6084
486 Ga0496122_0037047 3300048925 Bacteria 3934
487 Ga0496122_0063286 3300048925 Bacteria 2701
488 Ga0496122_0070806 3300048925 Bacteria 2488
489 Ga0496122_0147193 3300048925 Bacteria 1461
490 Ga0496123_0000022 3300048926 Bacteria 361832
491 Ga0496123_0001041 3300048926 Bacteria 41987
492 Ga0496123_0013107 3300048926 Bacteria 6994
493 Ga0496123_0067195 3300048926 Bacteria 2265
494 Ga0496123_0071286 3300048926 Bacteria 2168
495 Ga0496123_0110354 3300048926 Bacteria 1574
496 Ga0496124_0002119 3300048927 Bacteria 26718
497 Ga0496124_0005723 3300048927 Bacteria 13845
498 Ga0496124_0034683 3300048927 Bacteria 4424
499 Ga0496124_0055620 3300048927 Bacteria 3343
500 Ga0496124_0106350 3300048927 Bacteria 2265
501 Ga0496124_0140060 3300048927 Bacteria 1910
502 Ga0496125_0000248 3300048928 Bacteria 110840
503 Ga0496125_0048689 3300048928 Bacteria 3531
504 Ga0496125_0206313 3300048928 Bacteria 1281
505 Ga0496126_0001356 3300048929 Bacteria 38810
506 Ga0496126_0175120 3300048929 Bacteria 1825
507 Ga0496126_0394147 3300048929 Bacteria 1124
508 Ga0501031_0014187 3300049568 Bacteria 5185
509 Ga0501031_0022978 3300049568 Bacteria 4067
510 Ga0501032_0048925 3300049569 Bacteria 2854
511 Ga0501034_0000012 3300049571 Bacteria 310504
512 Ga0501034_0012058 3300049571 Bacteria 8935
513 Ga0501034_0076067 3300049571 Bacteria 3364
514 Ga0501034_0124056 3300049571 Bacteria 2568
515 Ga0501036_0023907 3300049572 Bacteria 5150
516 Ga0501036_0160805 3300049572 Bacteria 1893
517 Ga0501038_0044867 3300049574 Bacteria 3839
518 Ga0501038_0046663 3300049574 Bacteria 3755
519 Ga0501039_0003920 3300049575 Bacteria 11180
520 Ga0501039_0018420 3300049575 Bacteria 5359
521 Ga0501039_0160520 3300049575 Bacteria 1767
522 Ga0501040_0024229 3300049576 Bacteria 4072
523 Ga0501040_0130545 3300049576 Bacteria 1766
524 Ga0501040_0171802 3300049576 Bacteria 1535
525 Ga0501041_0069220 3300049577 Bacteria 2164
526 Ga0501042_0004481 3300049578 Bacteria 8910
527 Ga0501042_0022673 3300049578 Bacteria 4386
528 Ga0501042_0134833 3300049578 Bacteria 1780
529 Ga0501042_0345287 3300049578 Bacteria 1076
530 Ga0501043_0073761 3300049579 Bacteria 2680
531 Ga0501043_0221007 3300049579 Bacteria 1465
532 Ga0501046_0015793 3300049580 Bacteria 6335
533 Ga0501046_0038960 3300049580 Bacteria 3810
534 Ga0501048_0000273 3300049582 Bacteria 34673
535 Ga0501068_0046151 3300049584 Bacteria 2627
536 Ga0501071_0023237 3300049587 Bacteria 4329
537 Ga0501071_0029103 3300049587 Bacteria 3896
538 Ga0501072_0006088 3300049588 Bacteria 9205
539 Ga0501072_0053262 3300049588 Bacteria 3187
540 Ga0501072_0054012 3300049588 Bacteria 3164
541 Ga0501073_0140292 3300049589 Bacteria 1675
542 Ga0501074_0014204 3300049590 Bacteria 5792
543 Ga0501074_0038403 3300049590 Bacteria 3470
544 Ga0501074_0060746 3300049590 Bacteria 2723
545 Ga0501075_0023280 3300049591 Bacteria 4534
546 Ga0501075_0036618 3300049591 Bacteria 3662
547 Ga0501075_0044409 3300049591 Bacteria 3334
548 Ga0501075_0187604 3300049591 Bacteria 1577
549 Ga0501076_0002471 3300049592 Bacteria 12697
550 Ga0501076_0043386 3300049592 Bacteria 3543
551 Ga0501076_0082967 3300049592 Bacteria 2573
552 Ga0501077_0008785 3300049593 Bacteria 6271
553 Ga0501077_0022687 3300049593 Bacteria 3978
554 Ga0501077_0044815 3300049593 Bacteria 2809
555 Ga0501077_0074918 3300049593 Bacteria 2143
556 Ga0501079_0019944 3300049741 Bacteria 5122
557 Ga0501079_0026235 3300049741 Bacteria 4466
558 Ga0501080_0139956 3300049742 Bacteria 2238
559 Ga0501081_0037782 3300049743 Bacteria 3295
560 Ga0501081_0154454 3300049743 Bacteria 1650
561 Ga0501081_0219610 3300049743 Bacteria 1382
562 Ga0501083_0114300 3300049744 Bacteria 1773
563 Ga0501083_0127847 3300049744 Bacteria 1665
564 Ga0501035_0157576 3300049822 Bacteria 1967
565 Ga0501035_0178307 3300049822 Bacteria 1832
566 Ga0501045_0017016 3300049824 Bacteria 5163
567 Ga0501045_0031367 3300049824 Bacteria 3849
568 Ga0501045_0139227 3300049824 Bacteria 1805
569 Ga0501045_0169094 3300049824 Bacteria 1628
570 nmdc:mga00v17_123950_c1 3300050491 Bacteria 1647
571 nmdc:mga07m45_135359_c1 3300050496 Bacteria 1426
572 nmdc:mga05p37_11818_c1 3300050507 Bacteria 10407
573 nmdc:mga05p37_63064_c1 3300050507 Bacteria 4562
574 nmdc:mga09592_16186_c1 3300050508 Bacteria 6096
575 nmdc:mga06r32_21646_c1 3300050510 Bacteria 5937
576 nmdc:mga06r32_22935_c1 3300050510 Bacteria 5773
577 nmdc:mga06r32_268650_c1 3300050510 Bacteria 1693
578 nmdc:mga08y16_184327_c1 3300050511 Bacteria 2167
579 nmdc:mga0n895_220711_c1 3300050512 Bacteria 1925
580 nmdc:mga08x19_82159_c1 3300050514 Bacteria 2117
581 nmdc:mga0a205_24382_c1 3300050515 Bacteria 5753
582 Ga0495601_0015971 3300053077 Bacteria 4543
583 Ga0500610_0066512 3300053079 Bacteria 1879
584 Ga0495595_0016186 3300053084 Bacteria 3186
585 Ga0495595_0074900 3300053084 Bacteria 1605
586 Ga0495619_0011845 3300053085 Bacteria 5493
587 Ga0495619_0017554 3300053085 Bacteria 4532
588 Ga0500641_0022550 3300053096 Bacteria 2413
589 Ga0500555_034324 3300053103 Bacteria 1428
590 Ga0500569_002019 3300053109 Bacteria 3943
591 Ga0500569_024058 3300053109 Bacteria 1644
592 Ga0500658_0000514 3300053134 Bacteria 16536
593 Ga0500559_0010416 3300053136 Bacteria 3991
594 Ga0500568_0027958 3300053139 Bacteria 2354
595 Ga0500616_0000944 3300053153 Bacteria 31705
596 Ga0500622_0001277 3300053156 Bacteria 20505
597 Ga0500622_0004917 3300053156 Bacteria 8165
598 Ga0500627_0040319 3300053158 Bacteria 2004
599 Ga0501084_0004163 3300054114 Bacteria 11794
600 Ga0501084_0116761 3300054114 Bacteria 2243
601 Ga0501084_0391958 3300054114 Bacteria 1173
602 Ga0587088_000912 3300059508 Bacteria 2805
603 Ga0587088_007114 3300059508 Bacteria 1535
604 Ga0501082_0007075 3300060353 Bacteria 9684
605 Ga0501082_0030168 3300060353 Bacteria 4673
606 Ga0501082_0107325 3300060353 Bacteria 2416
607 Ga0530510_0018441 3300061734 Bacteria 4948
608 Ga0530510_0058582 3300061734 Bacteria 2785
609 Ga0530510_0068599 3300061734 Bacteria 2572
610 Ga0530510_0071714 3300061734 Bacteria 2514
611 Ga0530510_0085966 3300061734 Bacteria 2291
612 Ga0530510_0119915 3300061734 Bacteria 1930
613 2509389768 2509276021 Bacteria 7634384
614 2509447978 2509276033 Bacteria 7180565
615 2510134916 2510065019 Bacteria 6903379
616 2510841730 2510461069 Bacteria 5505000
617 2510896327 2510461076 Bacteria 8618824
618 2511136487 2510917022 Bacteria 6504556
619 2511187261 2510917028 Bacteria 6185411
620 2511195961 2510917030 Bacteria 7460662
621 2513573703 2513237084 Bacteria 7231967
622 2513580089 2513237085 Bacteria 7695351
623 2513599833 2513237088 Bacteria 6927906
624 2513631243 2513237093 Bacteria 7545552
625 2513710862 2513237103 Bacteria 7647401
626 2513867041 2513237138 Bacteria 7368160
627 2513927020 2513237146 Bacteria 7166346
628 2514001434 2513237159 Bacteria 6810126
629 2514023217 2513237162 Bacteria 7468464
630 2515113999 2515075009 Bacteria 7288508
631 2515637172 2515154113 Bacteria 7807172
632 2515642952 2515154114 Bacteria 7848616
633 2515656700 2515154116 Bacteria 7552979
634 2515743643 2515154134 Bacteria 7220242
635 2516204208 2516143018 Bacteria 6951533
636 2517037633 2516653077 Bacteria 7555578
637 2517077918 2516653085 Bacteria 7346596
638 2517096716 2517093000 Bacteria 7412387
639 2517410431 2517287029 Bacteria 6905599
640 2523466234 2523231067 Bacteria 5230452
641 2524460003 2524023209 Bacteria 6679728
642 2530647027 2529292951 Bacteria 6916614
643 2535519334 2534681796 Bacteria 7146037
644 2585169706 2582581283 Bacteria 6030556
645 2585202384 2582581294 Bacteria 6626667
646 2585224703 2582581298 Bacteria 7315509
647 2585227910 2582581299 Bacteria 6518058
648 2585255507 2582581304 Bacteria 5831370
649 2585267345 2582581306 Bacteria 6450535
650 2585274354 2582581307 Bacteria 6597605
651 2585280236 2582581308 Bacteria 7413247
652 2585322513 2582581315 Bacteria 7318924
653 2585335126 2582581316 Bacteria 7774528
654 2585386413 2582581865 Bacteria 6644329
655 2585393322 2582581866 Bacteria 6859583
656 2585402318 2582581867 Bacteria 7184437
657 2585529004 2585427526 Bacteria 7258840
658 2585532465 2585427527 Bacteria 7273426
659 2585540945 2585427528 Bacteria 6842387
660 2585547259 2585427529 Bacteria 7395659
661 2585554518 2585427530 Bacteria 7383882
662 2585560803 2585427531 Bacteria 6992870
663 2585822383 2585427590 Bacteria 6824633
664 2585839707 2585427593 Bacteria 7141551
665 2585845477 2585427594 Bacteria 6180594
666 2585899004 2585427608 Bacteria 6544331
667 2585903402 2585427609 Bacteria 6667127
668 2587981479 2585428125 Bacteria 6662905
669 2599335938 2599185156 Bacteria 5403036
670 2599420486 2599185170 Bacteria 7295545
671 2616295634 2615840624 Bacteria 6557588
672 2616307464 2615840626 Bacteria 7921970
673 2616555010 2615840698 Bacteria 7319877
674 2644006540 2643221599 Bacteria 6292121
675 2644050447 2643221607 Bacteria 6314006
676 2644195984 2643221634 Bacteria 6705461
677 2644205675 2643221636 Bacteria 6583769
678 2644208961 2643221637 Bacteria 5345260
679 2644241957 2643221643 Bacteria 5749658
680 2644299323 2643221653 Bacteria 4569637
681 2644483365 2643221686 Bacteria 6310811
682 2644492093 2643221688 Bacteria 5260751
683 2644499574 2643221689 Bacteria 6042950
684 2644652491 2643221718 Bacteria 5345506
685 2644657551 2643221719 Bacteria 4568197
686 2644675972 2643221723 Bacteria 7095460
687 2671112255 2667528174 Bacteria 6435400
688 2692315479 2690316117 Bacteria 6800650
689 2719182668 2718217882 Bacteria 6556348
690 2719387339 2718217927 Bacteria 6972593
691 2719666984 2718217997 Bacteria 6740740
692 2719733386 2718218009 Bacteria 6478651
693 2720493404 2718218199 Bacteria 6740745
694 2720614875 2718218232 Bacteria 6720332
695 2720621648 2718218233 Bacteria 6662049
696 2720632976 2718218235 Bacteria 6630699
697 2720776700 2718218269 Bacteria 6906114
698 2721148781 2718218363 Bacteria 6524337
699 2721160165 2718218365 Bacteria 6274507
700 2721165594 2718218366 Bacteria 6425255
701 2721400974 2718218423 Bacteria 6438183
702 2722841764 2721755514 Bacteria 6424414
703 2723028288 2721755556 Bacteria 6745503
704 2723561916 2721755684 Bacteria 6859907
705 2723568548 2721755685 Bacteria 6704835
706 2724039787 2721755809 Bacteria 6438790
707 2724046142 2721755810 Bacteria 6479005
708 2724091307 2721755819 Bacteria 6906405
709 2724105813 2721755822 Bacteria 6726041
710 2724111639 2721755823 Bacteria 6752556
711 2725950840 2724679232 Bacteria 7646494
712 2730109224 2728369352 Bacteria 6745171
713 2730165903 2728369365 Bacteria 6555560
714 2730299797 2728369397 Bacteria 6274511
715 2738804813 2738541293 Bacteria 7065685
716 2739035502 2738541333 Bacteria 7106503
717 2739347043 2738543031 Bacteria 5769731
718 2753462084 2751185821 Bacteria 6189929
719 2765469139 2765235802 Bacteria 5618596
720 2766065247 2765235942 Bacteria 7445910
721 2770196381 2767802442 Bacteria 5747986
722 2776268504 2775506902 Bacteria 6208009
723 2776285415 2775506904 Bacteria 5954060
724 2778176074 2775507266 Bacteria 7392367
725 2792585064 2791355082 Bacteria 5973319
726 2792620707 2791355091 Bacteria 6135441
727 2792626067 2791355092 Bacteria 6248105
728 2792639010 2791355094 Bacteria 7011481
729 2793293551 2791355256 Bacteria 6798008
730 2793313004 2791355259 Bacteria 7254731
731 2793319651 2791355260 Bacteria 6598818
732 2793327850 2791355261 Bacteria 6661293
733 2793333464 2791355262 Bacteria 6774204
734 2793342015 2791355263 Bacteria 6872478
735 2793347442 2791355264 Bacteria 6429314
736 2793353773 2791355265 Bacteria 6539969
737 2793359627 2791355266 Bacteria 7116587
738 2793369377 2791355267 Bacteria 7222458
739 2805929478 2802429605 Bacteria 6875453
740 2805935341 2802429606 Bacteria 6346811
741 2806044488 2802429633 Bacteria 7341974
742 2806052689 2802429634 Bacteria 7083200
743 2806058989 2802429635 Bacteria 7650140
744 2806068348 2802429636 Bacteria 7597525
745 2806074468 2802429637 Bacteria 7067217
746 2819243891 2818991272 Bacteria 4622173
747 2819609539 2818991448 Bacteria 6772224
748 2819639635 2818991453 Bacteria 7181617
749 2838019180 2838016132 Bacteria 6577831
750 2838024229 2838022645 Bacteria 6494267
751 2838033195 2838029111 Bacteria 6603031
752 2838040842 2838035591 Bacteria 7166484
753 2838047431 2838042994 Bacteria 6046894
754 2838051101 2838048938 Bacteria 6044578
755 2838063920 2838061910 Bacteria 6794874
756 2838073405 2838068647 Bacteria 6208656
757 2838076782 2838074704 Bacteria 6785777
758 2838664767 2838661181 Bacteria 7385261
759 2838674622 2838668709 Bacteria 6671819
760 2838684882 2838680041 Bacteria 6545511
761 2838691246 2838686498 Bacteria 7807632
762 2838699281 2838694306 Bacteria 6853137
763 2838707020 2838701080 Bacteria 6669771
764 2838712762 2838707686 Bacteria 6619912
765 2838735729 2838729681 Bacteria 7400765
766 2838748631 2838742623 Bacteria 7396178
767 2839997563 2839993093 Bacteria 5512535
768 2840770648 2840764183 Bacteria 6358399
769 2840883643 2840878972 Bacteria 5483153
770 2841853934 2841851746 Bacteria 7532261
771 2841868098 2841864319 Bacteria 6742987
772 2842082239 2842077413 Bacteria 6508645
773 2842113359 2842110456 Bacteria 7656360
774 2842123164 2842118031 Bacteria 7033875
775 2842151710 2842146304 Bacteria 5957337
776 2842162548 2842156927 Bacteria 6894975
777 2842170024 2842163707 Bacteria 6916235
778 2842184985 2842180545 Bacteria 6888678
779 2842198643 2842192696 Bacteria 6147454
780 2842199771 2842198810 Bacteria 6608673
781 2842208389 2842205361 Bacteria 6340321
782 2842220001 2842217011 Bacteria 7497767
783 2842235642 2842229732 Bacteria 7475766
784 2842241936 2842237096 Bacteria 6620661
785 2842249324 2842243621 Bacteria 7421798
786 2842256771 2842250916 Bacteria 6579627
787 2842263539 2842257432 Bacteria 7401195
788 2842266680 2842264693 Bacteria 6472963
789 2842275721 2842271015 Bacteria 7807131
790 2842281602 2842278818 Bacteria 6340002
791 2842288725 2842285085 Bacteria 6011953
792 2842296240 2842291075 Bacteria 7076806
793 2842298773 2842298080 Bacteria 6123127
794 2842308295 2842304105 Bacteria 7023636
795 2842316424 2842311132 Bacteria 6616990
796 2842321311 2842317721 Bacteria 6793725
797 2842345082 2842341865 Bacteria 7003929
798 2842359359 2842357229 Bacteria 6485165
799 2842369198 2842363717 Bacteria 6844742
800 2842375558 2842370503 Bacteria 7038661
801 2842382640 2842377471 Bacteria 7140707
802 2842390041 2842384541 Bacteria 7057858
803 2842398436 2842395702 Bacteria 6780583
804 2842406608 2842402390 Bacteria 6681310
805 2842412965 2842409023 Bacteria 6687331
806 2842419608 2842415677 Bacteria 6596907
807 2842427040 2842422224 Bacteria 6239196
808 2842429999 2842428310 Bacteria 6767288
809 2842436341 2842434925 Bacteria 6502746
810 2842444044 2842441272 Bacteria 6769273
811 2842453650 2842447887 Bacteria 6754142
812 2842464420 2842462802 Bacteria 6588055
813 2842470670 2842469257 Bacteria 6752936
814 2842479928 2842475841 Bacteria 6603183
815 2842483324 2842482326 Bacteria 7212537
816 2842495532 2842489311 Bacteria 6620893
817 2842499077 2842495871 Bacteria 6820686
818 2842507104 2842502639 Bacteria 6604161
819 2842510801 2842509118 Bacteria 6850950
820 2842521886 2842521101 Bacteria 6569494
821 2842926908 2842922631 Bacteria 5824079
822 2844457420 2844454524 Bacteria 7952546
823 2847419461 2847417321 Bacteria 6913799
824 2848994488 2848992105 Bacteria 6810864
825 2852391288 2852387548 Bacteria 8025568
826 2854915800 2854911287 Bacteria 5582813
827 2855872463 2855872281 Bacteria 6964271
828 2857518827 2857516855 Bacteria 7787325
829 2891373421 2891373044 Bacteria 5202277
830 2894657063 2894652903 Bacteria 4587256
831 2896392311 2896384573 Bacteria 7700774
832 2899805221 2899803654 Bacteria 5577784
833 2904584062 2904578770 Bacteria 5302906
834 2913299246 2913295892 Bacteria 6333755
835 2919104645 2919100787 Bacteria 7710546
836 2919124962 2919119836 Bacteria 5208557
837 2919410742 2919408235 Bacteria 6149349
838 2920825322 2920822456 Bacteria 6897201
839 2923558688 2923556063 Bacteria 6793593
840 2933019900 2933016740 Bacteria 6355406
841 2933574744 2933570622 Bacteria 7023390
842 2933589351 2933586486 Bacteria 7667493
843 2933603465 2933599457 Bacteria 5858799
844 2935901207 2935894831 Bacteria 6620579
845 2935907481 2935901341 Bacteria 7341747
846 2936374797 2936367885 Bacteria 7324495
847 2936380489 2936375103 Bacteria 6652732
848 2936382343 2936381700 Bacteria 7006523
849 2937847197 2937843397 Bacteria 5256375
850 2989349752 2989349275 Bacteria 6349068
851 2989774379 2989771324 Bacteria 5605128
852 2989780428 2989776772 Bacteria 4843317
853 2996889292 2996887358 Bacteria 5795980
854 2996894660 2996893221 Bacteria 5823108
855 3003934152 3003930520 Bacteria 5667563
856 3005418419 3005416602 Bacteria 7064308
857 3005449354 3005445848 Bacteria 6906074
858 3005455658 3005452660 Bacteria 5889319
859 639650070 639633055 Bacteria 7751309
860 643826367 643692032 Bacteria 6891900
861 8005249482 8005246636 Bacteria 4933972
862 8005264129 8005258706 Bacteria 6184835
863 8005282086 8005275841 Bacteria 6929066
864 8005285098 8005282627 Bacteria 6675747
865 8005294193 8005289223 Bacteria 6634003
866 8005306606 8005301065 Bacteria 6614431
867 8005309460 8005307578 Bacteria 7395396
868 8005318689 8005314921 Bacteria 7072929
869 8005323819 8005321885 Bacteria 5795980
870 8005382714 8005376324 Bacteria 6590079
871 8005383771 8005382845 Bacteria 6732062
872 8005401097 8005395548 Bacteria 6806915
873 8005434051 8005430974 Bacteria 6689030
874 8005464688 8005460587 Bacteria 7157962
875 8005488429 8005484373 Bacteria 6297373
876 8005501736 8005497431 Bacteria 6477605
877 8005547012 8005542996 Bacteria 7077758
878 8005559091 8005556819 Bacteria 6908598
879 8005566850 8005563573 Bacteria 7153261
880 8005574874 8005570704 Bacteria 6957481
881 8005623090 8005619151 Bacteria 7030230
882 8005631602 8005626139 Bacteria 6534237
883 8005648899 8005645114 Bacteria 6950293
884 8005673158 8005668836 Bacteria 6953162
885 8005682136 8005682033 Bacteria 6726518
886 8005693698 8005688590 Bacteria 6610080
887 8005700939 8005695170 Bacteria 6912330
888 8018133545 8018127388 Bacteria 7351159
889 8018170293 8018163183 Bacteria 7277977
890 8018178394 8018176218 Bacteria 6896178
891 8023687475 8023680758 Bacteria 7729763
892 8024482023 8024479707 Bacteria 6954785
893 8024486950 8024486573 Bacteria 6540512
894 8024505865 8024501048 Bacteria 6427847
895 8046773157 8046767195 Bacteria 7547379
896 8049295387 8049293176 Bacteria 6128433
897 8054562568 8054558443 Bacteria 5204801
898 8056381659 8056375014 Bacteria 7006639
899 8056387096 8056382006 Bacteria 6408074
900 8057581106 8057575449 Bacteria 7367519
901 8057877065 8057874678 Bacteria 7494653
902 Ga0439465_0034236
903 JGI24751J29686_10001606
904 JGI25155J39150_1000012
905 JGI25156J39149_1000036
906 JGI25156J39149_1000049
907 JGI25162J39368_1000146
908 JGI25154J39366_1000033
909 JGI25157J39369_1000055
910 JGI25152J39213_1001334
911 JGI25152J39213_1004215
912 JGI25150J39212_1000063
913 JGI25150J39212_1003198
914 JGI25159J45721_1000073
915 JGI25159J45721_1000198
916 JGI25159J45721_1002886
917 JGI25151J46595_10000140
918 JGI25151J46595_10000750
919 JGI25151J46595_10034572
920 JGI25165J46597_1000451
921 JGI25165J46597_1001044
922 JGI25153J46596_10003011
923 JGI25153J46596_10015475
924 JGI25153J46596_10028045
925 JGI25160J50197_1000006
926 JGI25160J50197_1000020
927 JGI25160J50197_1002386
928 JGI25161J50226_1000004
929 JGI25161J50226_1000103
930 JGI25161J50226_1008740
931 Ga0006562J51391_1153968
932 Ga0006562J51391_1153969
933 Ga0055526_1000562
934 Ga0055526_1004977
935 Ga0055526_1020044
936 Ga0055524_1005106
937 Ga0055524_1006367
938 Ga0055536_1000618
939 Ga0055528_1000581
940 Ga0055528_1009166
941 Ga0055528_1011421
942 Ga0055528_1014566
943 Ga0055528_1023143
944 Ga0055540_1000476
945 Ga0055540_1003314
946 Ga0055540_1023377
947 Ga0055531_10021394
948 Ga0055543_1000002
949 Ga0055543_1000029
950 Ga0055543_1000163
951 Ga0055543_1002440
952 Ga0065165_1000013
953 Ga0065165_1000217
954 Ga0065165_1008510
955 Ga0065165_1024455
956 Ga0065715_10004261
957 Ga0070676_10008327
958 Ga0070683_100078943
959 Ga0070690_100111312
960 Ga0070670_100000201
961 Ga0070670_100004118
962 Ga0070680_100038340
963 Ga0070682_100009745
964 Ga0070660_100013337
965 Ga0070689_100052593
966 Ga0070691_10000937
967 Ga0070687_100013436
968 Ga0070661_100317367
969 Ga0070668_100007905
970 Ga0070668_100087194
971 Ga0070669_100003947
972 Ga0070671_100015550
973 Ga0070674_100000255
974 Ga0070673_100098228
975 Ga0070688_100018819
976 Ga0070688_100135975
977 Ga0070659_100022994
978 Ga0070667_100009549
979 Ga0070667_100232863
980 Ga0070667_100243675
981 Ga0070709_10028766
982 Ga0070714_100036349
983 Ga0070713_100122289
984 Ga0070710_10010750
985 Ga0070701_10001749
986 Ga0070711_100000991
987 Ga0070705_100023732
988 Ga0070694_100027220
989 Ga0070663_100004730
990 Ga0070678_100131444
991 Ga0070662_100110234
992 Ga0070662_100270687
993 Ga0068867_100033115
994 Ga0068867_100038594
995 Ga0070707_100072247
996 Ga0070679_100007954
997 Ga0070684_100002428
998 Ga0070697_100002550
999 Ga0068853_100009025
1000 Ga0070672_100201471
1001 Ga0070686_100001426
1002 Ga0070696_100015998
1003 Ga0070696_100087680
1004 Ga0070693_100008518
1005 Ga0070704_100020506
1006 Ga0070704_100021719
1007 Ga0068855_100227759
1008 Ga0070664_100167863
1009 Ga0068857_100049572
1010 Ga0068854_100003774
1011 Ga0068856_100041938
1012 Ga0068856_100187564
1013 Ga0070702_100002406
1014 Ga0068852_100015192
1015 Ga0068859_100098726
1016 Ga0068859_100107019
1017 Ga0068864_100008425
1018 Ga0068866_10002650
1019 Ga0068861_100019992
1020 Ga0068851_10072531
1021 Ga0068870_10071104
1022 Ga0068863_100007448
1023 Ga0068858_100006719
1024 Ga0068858_100062165
1025 Ga0068858_100067055
1026 Ga0068860_100025587
1027 Ga0068860_100176224
1028 Ga0068860_100305024
1029 Ga0068862_100019327
1030 Ga0068862_100070626
1031 Ga0081455_10001941
1032 Ga0081455_10004546
1033 Ga0075365_10089806
1034 Ga0070716_100005064
1035 Ga0075367_10002996
1036 Ga0075369_10001644
1037 Ga0075366_10009828
1038 Ga0097621_100021212
1039 Ga0075370_10081892
1040 Ga0075428_100171214
1041 Ga0075431_100001445
1042 Ga0075431_100038265
1043 Ga0075431_100171369
1044 Ga0075433_10234698
1045 Ga0075434_100099120
1046 Ga0068865_100028038
1047 Ga0068865_100061874
1048 Ga0075436_100011810
1049 Ga0097620_100098724
1050 Ga0097620_100107019
1051 Ga0075435_100014925
1052 Ga0105251_10080294
1053 Ga0105240_10000019
1054 Ga0105245_10316332
1055 Ga0105247_10002602
1056 Ga0105247_10007399
1057 Ga0114129_10006974
1058 Ga0105243_10029798
1059 Ga0105243_10039301
1060 Ga0105241_10015032
1061 Ga0105242_10046401
1062 Ga0105242_10104123
1063 Ga0105248_10014453
1064 Ga0105248_10030508
1065 Ga0105248_10124009
1066 Ga0105237_10003975
1067 Ga0105237_10025836
1068 Ga0105238_10005416
1069 Ga0105249_10007708
1070 Ga0105249_10028244
1071 Ga0105249_10059202
1072 Ga0105249_10499312
1073 Ga0123341_1000015
1074 Ga0123342_1005228
1075 Ga0105239_10037732
1076 Ga0105246_10014433
1077 Ga0157373_10060189
1078 Ga0157373_10061120
1079 Ga0157371_10027003
1080 Ga0157370_10003322
1081 Ga0157370_10063549
1082 Ga0157369_10015957
1083 Ga0157374_10015991
1084 Ga0157378_10176601
1085 Ga0163162_10074226
1086 Ga0163162_10402741
1087 Ga0157372_10015254
1088 Ga0157375_10005311
1089 Ga0157375_10011932
1090 Ga0157375_10020436
1091 Ga0163163_10367868
1092 Ga0157380_10012768
1093 Ga0157380_10102499
1094 Ga0157380_10175839
1095 Ga0182008_10039562
1096 Ga0157377_10011186
1097 Ga0157377_10167519
1098 Ga0157379_10032912
1099 Ga0157379_10048594
1100 Ga0157379_10049428
1101 Ga0157376_10034199
1102 Ga0157376_10064826
1103 Ga0182007_10005578
1104 Ga0182005_1004663
1105 Ga0214542_1000012
1106 Ga0214543_1000024
1107 Ga0209435_100005
1108 Ga0209436_100026
1109 Ga0209437_100078
1110 Ga0209437_100174
1111 Ga0207425_1000080
1112 Ga0207425_1008661
1113 Ga0209646_1000011
1114 Ga0209026_1000008
1115 Ga0209677_100679
1116 Ga0209759_1000004
1117 Ga0209129_1000195
1118 Ga0209129_1000568
1119 Ga0209129_1003030
1120 Ga0209129_1004354
1121 Ga0209233_1000163
1122 Ga0209233_1000299
1123 Ga0209233_1000305
1124 Ga0209673_1000320
1125 Ga0209673_1000924
1126 Ga0209673_1001284
1127 Ga0209673_1002385
1128 Ga0209673_1002545
1129 Ga0209673_1004988
1130 Ga0209673_1004993
1131 Ga0209673_1009073
1132 Ga0209673_1029885
1133 Ga0209130_1000030
1134 Ga0209130_1000032
1135 Ga0209130_1000034
1136 Ga0209130_1006815
1137 Ga0209676_1002327
1138 Ga0209025_1000332
1139 Ga0209025_1000354
1140 Ga0209025_1001057
1141 Ga0209025_1008742
1142 Ga0209025_1022156
1143 Ga0209025_1058003
1144 Ga0209564_1000013
1145 Ga0209564_1000207
1146 Ga0209564_1000345
1147 Ga0209564_1001668
1148 Ga0209758_1000263
1149 Ga0209758_1000561
1150 Ga0209758_1002596
1151 Ga0209758_1036053
1152 Ga0209050_1002550
1153 Ga0209050_1002635
1154 Ga0209256_1000343
1155 Ga0209256_1001503
1156 Ga0209256_1006057
1157 Ga0209256_1006227
1158 Ga0209256_1011929
1159 Ga0209256_1014279
1160 Ga0209256_1015466
1161 Ga0207426_1000006
1162 Ga0207426_1000047
1163 Ga0207426_1000077
1164 Ga0207426_1000296
1165 Ga0207426_1005194
1166 Ga0209051_1000236
1167 Ga0209051_1002497
1168 Ga0209051_1003879
1169 Ga0209257_1001852
1170 Ga0209257_1004236
1171 Ga0209257_1022881
1172 Ga0207692_10009040
1173 Ga0207642_10003712
1174 Ga0207710_10006511
1175 Ga0207688_10005265
1176 Ga0207647_10001136
1177 Ga0207685_10000555
1178 Ga0207699_10005354
1179 Ga0207699_10036650
1180 Ga0207654_10018973
1181 Ga0207695_10000049
1182 Ga0207671_10000107
1183 Ga0207671_10019919
1184 Ga0207693_10000551
1185 Ga0207663_10006654
1186 Ga0207660_10134930
1187 Ga0207662_10015005
1188 Ga0207657_10004689
1189 Ga0207649_10013621
1190 Ga0207652_10178679
1191 Ga0207681_10004932
1192 Ga0207681_10172630
1193 Ga0207694_10094331
1194 Ga0207650_10004756
1195 Ga0207650_10043322
1196 Ga0207687_10086612
1197 Ga0207700_10372463
1198 Ga0207664_10010884
1199 Ga0207644_10025012
1200 Ga0207644_10038574
1201 Ga0207690_10008586
1202 Ga0207706_10001303
1203 Ga0207706_10154934
1204 Ga0207686_10014721
1205 Ga0207709_10117281
1206 Ga0207670_10090640
1207 Ga0207669_10018870
1208 Ga0207669_10073434
1209 Ga0207669_10097434
1210 Ga0207704_10024870
1211 Ga0207704_10229135
1212 Ga0207665_10000478
1213 Ga0207691_10084630
1214 Ga0207711_10019400
1215 Ga0207711_10109752
1216 Ga0207689_10027495
1217 Ga0207661_10059640
1218 Ga0207679_10164657
1219 Ga0207667_10090442
1220 Ga0207651_10011597
1221 Ga0207712_10035739
1222 Ga0207712_10117171
1223 Ga0207712_10155806
1224 Ga0207668_10020539
1225 Ga0207668_10051401
1226 Ga0207668_10100447
1227 Ga0207640_10043337
1228 Ga0207658_10040219
1229 Ga0207677_10028300
1230 Ga0207703_10012880
1231 Ga0207639_10050996
1232 Ga0207678_10001177
1233 Ga0207708_10001719
1234 Ga0207708_10146537
1235 Ga0207702_10024534
1236 Ga0207641_10009946
1237 Ga0207648_10023059
1238 Ga0207648_10034146
1239 Ga0207648_10158377
1240 Ga0207648_10393935
1241 Ga0207676_10051930
1242 Ga0207674_10017275
1243 Ga0207675_100096520
1244 Ga0207675_100284008
1245 Ga0207683_10002755
1246 Ga0207683_10348984
1247 Ga0207698_10483987
1248 Ga0209371_1009479
1249 Ga0207428_10032560
1250 Ga0268265_10059098
1251 Ga0268264_10025585
1252 Ga0268264_10046645
1253 Ga0268264_10064602
1254 Ga0307515_10000582
1255 Ga0307515_10066660
1256 Ga0265330_10057123
1257 Ga0265339_10032582
1258 Ga0307513_10025406
1259 Ga0307408_100088960
1260 Ga0265314_10117542
1261 Ga0307516_10040071
1262 Ga0307405_10002639
1263 Ga0307413_10019699
1264 Ga0307410_10044755
1265 Ga0307406_10001664
1266 Ga0307416_100222981
1267 Ga0307414_10009844
1268 Ga0307414_10223321
1269 Ga0307411_10041252
1270 Ga0307415_100031872
1271 Ga0373930_0003763
1272 Ga0373948_0008856
1273 Ga0373926_0049717
1274 Ga0373940_0017764
1275 Ga0373932_0020569
1276 Ga0373943_0061736
1277 Ga0373962_0004361
1278 Ga0373935_0016743
1279 Ga0373927_0051251
1280 Ga0373947_0008051
1281 Ga0373937_0072265
1282 Ga0316584_0148992
1283 Ga0395900_0105037
1284 Ga0395898_0011073
1285 Ga0395905_0003153
1286 Ga0395901_0538400
1287 Ga0439466_0072270
1288 Ga0439465_0024740
1289 Ga0439465_0078750
1290 Ga0451833_0783907
1291 Ga0451837_0908075
1292 Ga0451841_0354402
1293 Ga0451847_0031456
1294 Ga0451849_0196173
1295 Ga0451843_0055679
1296 Ga0451853_2888965
1297 Ga0439462_0046650
1298 Ga0495603_0000740
1299 Ga0495629_0000841
1300 Ga0495638_0000591
1301 Ga0495641_0029644
1302 Ga0495580_0004062
1303 Ga0495582_0000461
1304 Ga0495605_0053266
1305 Ga0495639_0003136
1306 Ga0495585_0009526
1307 Ga0495585_0074985
1308 Ga0495594_0004429
1309 Ga0495583_0047098
1310 Ga0495606_0007602
1311 Ga0495606_0118411
1312 Ga0495610_0033376
1313 Ga0495610_0038229
1314 Ga0495620_0047266
1315 Ga0495620_0091569
1316 Ga0495631_0018486
1317 Ga0495632_0008120
1318 Ga0495632_0045150
1319 Ga0495643_0028455
1320 Ga0495643_0047695
1321 Ga0495643_0110013
1322 Ga0495654_0013123
1323 Ga0495668_0032989
1324 Ga0495634_0042228
1325 Ga0495625_0013649
1326 Ga0495635_0113819
1327 Ga0495588_0001977
1328 Ga0495647_0002052
1329 Ga0495613_0000595
1330 Ga0495624_0190902
1331 Ga0495649_0092474
1332 Ga0495649_0125167
1333 Ga0495589_0071460
1334 Ga0495660_0021555
1335 Ga0495660_0096056
1336 Ga0495581_0022400
1337 Ga0495676_0023326
1338 Ga0495686_0062725
1339 Ga0495686_0066598
1340 Ga0495686_0095117
1341 Ga0495686_0144950
1342 Ga0495593_0006408
1343 Ga0495614_0003145
1344 Ga0496100_0103989
1345 Ga0496101_0008511
1346 Ga0496101_0062769
1347 Ga0496101_0092769
1348 Ga0496102_0042393
1349 Ga0496102_0118971
1350 Ga0496102_0120332
1351 Ga0496102_0470931
1352 Ga0496103_0015637
1353 Ga0496103_0072482
1354 Ga0496104_0015695
1355 Ga0496104_0024916
1356 Ga0496104_0028197
1357 Ga0496105_0041368
1358 Ga0496105_0097483
1359 Ga0496106_0081222
1360 Ga0496106_0136421
1361 Ga0496107_0023830
1362 Ga0496107_0024245
1363 Ga0496107_0029776
1364 Ga0496107_0197639
1365 Ga0496109_0186002
1366 Ga0496109_0480138
1367 Ga0496110_0110336
1368 Ga0496111_0104412
1369 Ga0496113_0007347
1370 Ga0496114_0015063
1371 Ga0496114_0022902
1372 Ga0496114_0032206
1373 Ga0496115_0041766
1374 Ga0496116_0002361
1375 Ga0496116_0037398
1376 Ga0496116_0095918
1377 Ga0496117_0014505
1378 Ga0496118_0013335
1379 Ga0496118_0101960
1380 Ga0496118_0127256
1381 Ga0496121_0003259
1382 Ga0496121_0010789
1383 Ga0496121_0159142
1384 Ga0496122_0000106
1385 Ga0496122_0001278
1386 Ga0496122_0019999
1387 Ga0496122_0037047
1388 Ga0496122_0063286
1389 Ga0496122_0070806
1390 Ga0496122_0147193
1391 Ga0496123_0000022
1392 Ga0496123_0001041
1393 Ga0496123_0013107
1394 Ga0496123_0067195
1395 Ga0496123_0071286
1396 Ga0496123_0110354
1397 Ga0496124_0002119
1398 Ga0496124_0005723
1399 Ga0496124_0034683
1400 Ga0496124_0055620
1401 Ga0496124_0106350
1402 Ga0496124_0140060
1403 Ga0496125_0000248
1404 Ga0496125_0048689
1405 Ga0496125_0206313
1406 Ga0496126_0001356
1407 Ga0496126_0175120
1408 Ga0496126_0394147
1409 Ga0501031_0014187
1410 Ga0501031_0022978
1411 Ga0501032_0048925
1412 Ga0501034_0000012
1413 Ga0501034_0012058
1414 Ga0501034_0076067
1415 Ga0501034_0124056
1416 Ga0501036_0023907
1417 Ga0501036_0160805
1418 Ga0501038_0044867
1419 Ga0501038_0046663
1420 Ga0501039_0003920
1421 Ga0501039_0018420
1422 Ga0501039_0160520
1423 Ga0501040_0024229
1424 Ga0501040_0130545
1425 Ga0501040_0171802
1426 Ga0501041_0069220
1427 Ga0501042_0004481
1428 Ga0501042_0022673
1429 Ga0501042_0134833
1430 Ga0501042_0345287
1431 Ga0501043_0073761
1432 Ga0501043_0221007
1433 Ga0501046_0015793
1434 Ga0501046_0038960
1435 Ga0501048_0000273
1436 Ga0501068_0046151
1437 Ga0501071_0023237
1438 Ga0501071_0029103
1439 Ga0501072_0006088
1440 Ga0501072_0053262
1441 Ga0501072_0054012
1442 Ga0501073_0140292
1443 Ga0501074_0014204
1444 Ga0501074_0038403
1445 Ga0501074_0060746
1446 Ga0501075_0023280
1447 Ga0501075_0036618
1448 Ga0501075_0044409
1449 Ga0501075_0187604
1450 Ga0501076_0002471
1451 Ga0501076_0043386
1452 Ga0501076_0082967
1453 Ga0501077_0008785
1454 Ga0501077_0022687
1455 Ga0501077_0044815
1456 Ga0501077_0074918
1457 Ga0501079_0019944
1458 Ga0501079_0026235
1459 Ga0501080_0139956
1460 Ga0501081_0037782
1461 Ga0501081_0154454
1462 Ga0501081_0219610
1463 Ga0501083_0114300
1464 Ga0501083_0127847
1465 Ga0501035_0157576
1466 Ga0501035_0178307
1467 Ga0501045_0017016
1468 Ga0501045_0031367
1469 Ga0501045_0139227
1470 Ga0501045_0169094
1471 nmdc:mga00v17_123950_c1
1472 nmdc:mga07m45_135359_c1
1473 nmdc:mga05p37_11818_c1
1474 nmdc:mga05p37_63064_c1
1475 nmdc:mga09592_16186_c1
1476 nmdc:mga06r32_21646_c1
1477 nmdc:mga06r32_22935_c1
1478 nmdc:mga06r32_268650_c1
1479 nmdc:mga08y16_184327_c1
1480 nmdc:mga0n895_220711_c1
1481 nmdc:mga08x19_82159_c1
1482 nmdc:mga0a205_24382_c1
1483 Ga0495601_0015971
1484 Ga0500610_0066512
1485 Ga0495595_0016186
1486 Ga0495595_0074900
1487 Ga0495619_0011845
1488 Ga0495619_0017554
1489 Ga0500641_0022550
1490 Ga0500555_034324
1491 Ga0500569_002019
1492 Ga0500569_024058
1493 Ga0500658_0000514
1494 Ga0500559_0010416
1495 Ga0500568_0027958
1496 Ga0500616_0000944
1497 Ga0500622_0001277
1498 Ga0500622_0004917
1499 Ga0500627_0040319
1500 Ga0501084_0004163
1501 Ga0501084_0116761
1502 Ga0501084_0391958
1503 Ga0587088_000912
1504 Ga0587088_007114
1505 Ga0501082_0007075
1506 Ga0501082_0030168
1507 Ga0501082_0107325
1508 Ga0530510_0018441
1509 Ga0530510_0058582
1510 Ga0530510_0068599
1511 Ga0530510_0071714
1512 Ga0530510_0085966
1513 Ga0530510_0119915
1514 2509389768
1515 2509447978
1516 2510134916
1517 2510841730
1518 2510896327
1519 2511136487
1520 2511187261
1521 2511195961
1522 2513573703
1523 2513580089
1524 2513599833
1525 2513631243
1526 2513710862
1527 2513867041
1528 2513927020
1529 2514001434
1530 2514023217
1531 2515113999
1532 2515637172
1533 2515642952
1534 2515656700
1535 2515743643
1536 2516204208
1537 2517037633
1538 2517077918
1539 2517096716
1540 2517410431
1541 2523466234
1542 2524460003
1543 2530647027
1544 2535519334
1545 2585169706
1546 2585202384
1547 2585224703
1548 2585227910
1549 2585255507
1550 2585267345
1551 2585274354
1552 2585280236
1553 2585322513
1554 2585335126
1555 2585386413
1556 2585393322
1557 2585402318
1558 2585529004
1559 2585532465
1560 2585540945
1561 2585547259
1562 2585554518
1563 2585560803
1564 2585822383
1565 2585839707
1566 2585845477
1567 2585899004
1568 2585903402
1569 2587981479
1570 2599335938
1571 2599420486
1572 2616295634
1573 2616307464
1574 2616555010
1575 2644006540
1576 2644050447
1577 2644195984
1578 2644205675
1579 2644208961
1580 2644241957
1581 2644299323
1582 2644483365
1583 2644492093
1584 2644499574
1585 2644652491
1586 2644657551
1587 2644675972
1588 2671112255
1589 2692315479
1590 2719182668
1591 2719387339
1592 2719666984
1593 2719733386
1594 2720493404
1595 2720614875
1596 2720621648
1597 2720632976
1598 2720776700
1599 2721148781
1600 2721160165
1601 2721165594
1602 2721400974
1603 2722841764
1604 2723028288
1605 2723561916
1606 2723568548
1607 2724039787
1608 2724046142
1609 2724091307
1610 2724105813
1611 2724111639
1612 2725950840
1613 2730109224
1614 2730165903
1615 2730299797
1616 2738804813
1617 2739035502
1618 2739347043
1619 2753462084
1620 2765469139
1621 2766065247
1622 2770196381
1623 2776268504
1624 2776285415
1625 2778176074
1626 2792585064
1627 2792620707
1628 2792626067
1629 2792639010
1630 2793293551
1631 2793313004
1632 2793319651
1633 2793327850
1634 2793333464
1635 2793342015
1636 2793347442
1637 2793353773
1638 2793359627
1639 2793369377
1640 2805929478
1641 2805935341
1642 2806044488
1643 2806052689
1644 2806058989
1645 2806068348
1646 2806074468
1647 2819243891
1648 2819609539
1649 2819639635
1650 2838019180
1651 2838024229
1652 2838033195
1653 2838040842
1654 2838047431
1655 2838051101
1656 2838063920
1657 2838073405
1658 2838076782
1659 2838664767
1660 2838674622
1661 2838684882
1662 2838691246
1663 2838699281
1664 2838707020
1665 2838712762
1666 2838735729
1667 2838748631
1668 2839997563
1669 2840770648
1670 2840883643
1671 2841853934
1672 2841868098
1673 2842082239
1674 2842113359
1675 2842123164
1676 2842151710
1677 2842162548
1678 2842170024
1679 2842184985
1680 2842198643
1681 2842199771
1682 2842208389
1683 2842220001
1684 2842235642
1685 2842241936
1686 2842249324
1687 2842256771
1688 2842263539
1689 2842266680
1690 2842275721
1691 2842281602
1692 2842288725
1693 2842296240
1694 2842298773
1695 2842308295
1696 2842316424
1697 2842321311
1698 2842345082
1699 2842359359
1700 2842369198
1701 2842375558
1702 2842382640
1703 2842390041
1704 2842398436
1705 2842406608
1706 2842412965
1707 2842419608
1708 2842427040
1709 2842429999
1710 2842436341
1711 2842444044
1712 2842453650
1713 2842464420
1714 2842470670
1715 2842479928
1716 2842483324
1717 2842495532
1718 2842499077
1719 2842507104
1720 2842510801
1721 2842521886
1722 2842926908
1723 2844457420
1724 2847419461
1725 2848994488
1726 2852391288
1727 2854915800
1728 2855872463
1729 2857518827
1730 2891373421
1731 2894657063
1732 2896392311
1733 2899805221
1734 2904584062
1735 2913299246
1736 2919104645
1737 2919124962
1738 2919410742
1739 2920825322
1740 2923558688
1741 2933019900
1742 2933574744
1743 2933589351
1744 2933603465
1745 2935901207
1746 2935907481
1747 2936374797
1748 2936380489
1749 2936382343
1750 2937847197
1751 2989349752
1752 2989774379
1753 2989780428
1754 2996889292
1755 2996894660
1756 3003934152
1757 3005418419
1758 3005449354
1759 3005455658
1760 639650070
1761 643826367
1762 8005249482
1763 8005264129
1764 8005282086
1765 8005285098
1766 8005294193
1767 8005306606
1768 8005309460
1769 8005318689
1770 8005323819
1771 8005382714
1772 8005383771
1773 8005401097
1774 8005434051
1775 8005464688
1776 8005488429
1777 8005501736
1778 8005547012
1779 8005559091
1780 8005566850
1781 8005574874
1782 8005623090
1783 8005631602
1784 8005648899
1785 8005673158
1786 8005682136
1787 8005693698
1788 8005700939
1789 8018133545
1790 8018170293
1791 8018178394
1792 8023687475
1793 8024482023
1794 8024486950
1795 8024505865
1796 8046773157
1797 8049295387
1798 8054562568
1799 8056381659
1800 8056387096
1801 8057581106
1802 8057877065

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

20

160

0.94

PF08402

TOBE_2

TOBE domain

253

326

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
2onk-assembly1.cif.gz_B abc transporter modbc in complex with its binding protein moda 0.9473 4 234
1f3o-assembly1.cif.gz_A-2 crystal structure of mj0796 atp-binding cassette 0.9437 5 218
2pcj-assembly1.cif.gz_B crystal structure of abc transporter (aq_297) from aquifex aeolicus vf5 0.9411 2 218
5xu1-assembly1.cif.gz_A structure of a non-canonical abc transporter from streptococcus pneumoniae r6 0.9396 2 217
8bmp-assembly1.cif.gz_A cryo-em structure of the folate-specific ecf transporter complex in msp2n2 lipid nanodiscs bound to atp and adp 0.9385 2 224
ID Description Score Start End Superfamily
af_P77795_1_218_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9942 1 218 3.40.50.300
af_P77795_1_218_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9896 1 218 3.40.50.300
2awoD01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9785 5 217 3.40.50.300
1oxuA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9725 5 236 3.40.50.300
af_P33360_1_239_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9619 5 234 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A7J9YE84-F1-model_v4 ATP-binding cassette domain-containing protein 0.9716 5 222 GO:0005524
GO:0016887
GO:0055052
AF-A0A7X9BG07-F1-model_v4 ABC transporter ATP-binding protein 0.9692 1 187 GO:0005524
GO:0005886
GO:0015408
GO:0016887
AF-A0A7X9BG07-F1-model_v4 ABC transporter ATP-binding protein 0.9591 1 187 GO:0005524
GO:0005886
GO:0015408
GO:0016887
AF-A0A382FBJ4-F1-model_v4 ABC transporter domain-containing protein 0.9572 76 216 GO:0005524
GO:0005886
GO:0016887
GO:0022857
AF-A0A832FKS4-F1-model_v4 ABC transporter ATP-binding protein 0.9571 3 199 GO:0005524
GO:0016887

Map