F485191

General Info

Members Datasets Scaffolds Average Seq Length
901 384 1802 133

Family's Representative Sequence

Representative Sequence 3300049824|Ga0501045_0131245|Ga0501045_0131245_1180_1626
Length 148
Sequence VYAVTVRDHVMVAHSLTGEVFGPAQALHGATFTVDATFRGPRLDGHGILVDIGLVTEVLRAVLDPLRYRNLDNLDEVPELAGRNTTTEVLAGFVAGRLVDEVRSGALVEAREHVTGVIVTLHESHVAWASCELPVELPVDEADRREGA

Samples

Sample ID Description Type Environment
1 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
2 2162886006 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v1 Metagenome Rhizosphere
3 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
4 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
5 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
6 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
7 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
8 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
9 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
10 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
11 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
12 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
13 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
14 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
15 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
16 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
17 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
18 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
19 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
20 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
21 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
22 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
23 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
24 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
25 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
26 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
27 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
28 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
29 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
30 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
31 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
32 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
33 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
34 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
35 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
36 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
37 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
38 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
39 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
40 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
41 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
42 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
43 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
44 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
45 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
46 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
47 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
48 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
49 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
50 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
51 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
52 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
53 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
54 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
55 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
56 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
57 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
58 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
59 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
60 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
61 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
62 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
63 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
64 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
65 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
66 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
67 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
68 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
69 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
70 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
71 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
72 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
73 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
74 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
75 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
76 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
77 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
78 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
79 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
80 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
81 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
82 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
83 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
84 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
85 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
86 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
87 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
88 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
89 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
90 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
91 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
92 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
93 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
94 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
95 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
96 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
97 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
98 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
99 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
100 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
101 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
102 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
103 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
104 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
105 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
106 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
107 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
108 3300012476 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.yng.070610 Metagenome Rhizosphere
109 3300012483 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.yng.040610 Metagenome Rhizosphere
110 3300012491 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.8.old.040610 Metagenome Rhizosphere
111 3300012497 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 Metagenome Rhizosphere
112 3300012515 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 Metagenome Rhizosphere
113 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
114 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
115 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
116 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
117 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
118 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
119 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
120 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
121 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
122 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
123 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
124 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
125 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
126 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
127 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
128 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
129 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
130 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
131 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
132 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
133 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
191 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
192 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
193 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
194 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
198 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
199 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
200 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
201 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
202 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
203 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
204 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
205 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
206 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
207 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
208 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
209 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
210 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
211 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
212 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
213 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
214 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
215 3300033527 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
216 3300033529 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
217 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
218 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
219 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
220 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
221 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
222 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
223 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
224 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
225 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
226 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
227 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
228 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
229 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
230 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
231 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
232 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
233 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
234 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
235 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
236 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
237 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
238 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
239 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
240 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
241 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
242 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
243 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
244 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
245 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
246 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
247 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
248 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
249 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
250 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
251 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
252 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
253 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
254 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
255 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
256 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
257 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
258 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
259 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
260 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
261 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
262 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
263 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
264 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
265 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
266 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
267 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
268 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
269 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
270 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
271 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
272 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
273 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
274 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
275 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
276 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
277 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
278 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
279 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
280 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
281 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
282 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
283 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
284 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
285 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
286 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
287 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
288 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
289 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
290 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
291 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
292 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
293 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
294 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
295 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
296 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
297 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
298 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
299 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
300 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
301 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
302 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
303 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
304 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
305 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
306 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
307 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
308 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
309 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
310 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
311 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
312 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
313 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
314 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
315 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
316 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
317 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
318 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
319 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
320 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
321 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
322 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
323 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
324 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
325 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
326 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
327 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
328 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
329 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
330 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
331 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
332 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
333 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
334 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
335 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
336 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
337 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
338 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
339 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
340 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
341 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
342 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
343 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
344 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
345 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
346 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
347 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
348 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
349 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
350 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
351 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
352 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
353 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
354 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
355 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
356 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
357 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
358 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
359 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
360 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
361 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
362 2831935698 Jishengella sp. AZ1-13 Isolate Unclassified
363 2855670206 Micromonospora noduli Lupac 07 Isolate Nodule
364 2855676851 Micromonospora saelicesensis GAR05 Isolate Unclassified
365 2857288857 Micromonospora noduli ONO23 Isolate Unclassified
366 2858848962 Micromonospora saelicesensis GAR06 Isolate Unclassified
367 2858882152 Micromonospora noduli MED15 Isolate Nodule
368 2858888857 Micromonospora saelicesensis Lupac 06 Isolate Unclassified
369 2867507094 Micromonospora zingiberis PLAI 1-1 Isolate Unclassified
370 2869048445 Micromonospora saelicesensis PSN01 Isolate Unclassified
371 2869061728 Micromonospora noduli ONO86 Isolate Unclassified
372 2869068681 Micromonospora noduli GUI43 Isolate Unclassified
373 2880489317 Micromonospora ureilytica DSM 101692 Isolate Unclassified
374 2880495981 Micromonospora vinacea DSM 101695 Isolate Unclassified
375 2887478801 Catellatospora paridis NEAU-CL2 Isolate Rhizosphere
376 2929219909 Micromonospora sp. R-75348 Hybrid assembly Isolate Unclassified
377 2929226422 Micromonospora sp. R-74116 Hybrid assembly Isolate Unclassified
378 2954002825 Streptomyces turgidiscabies W2I16 Isolate Rhizosphere
379 2996221748 Micromonospora veneta CAP181 Isolate Unclassified
380 3006425503 Streptomyces zingiberis PLAI1-29 Isolate Unclassified
381 8003830390 Micromonospora parastrephiae STR1_7 Isolate Rhizosphere
382 8045830549 Microbacterium yannicii DSM 23203 Isolate Unclassified
383 8054704163 Micromonospora trifolii NIE79 Isolate Nodule
384 8056060235 Nocardiopsis endophytica RSe5-2 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 96.67
Metatranscriptomes 0.78
Isolates 2.55

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.33
Nodule 0.33
Rhizoplane 3.88
Rhizosphere 90.23
Stem 0
Stem Tuber 0
Unclassified 5.88

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501045_0131245 3300049824 Bacteria 1862
2 SwRhRL3b_contig_3460783 2162886006 Bacteria 912
3 JGI24743J22301_10107733 3300001991 Bacteria 604
4 JGI24035J26624_1009098 3300002126 Bacteria 976
5 JGI24034J26672_10053415 3300002239 Unclassified 698
6 JGI24751J29686_10060933 3300002459 Unclassified 777
7 JGI25405J52794_10061110 3300003911 Bacteria 815
8 JGI25405J52794_10100024 3300003911 Bacteria 646
9 Ga0065704_10343157 3300005289 Unclassified 820
10 Ga0065712_10136214 3300005290 Unclassified 1495
11 Ga0065712_10245180 3300005290 Bacteria 974
12 Ga0065715_10213745 3300005293 Unclassified 1299
13 Ga0065707_10097402 3300005295 Unclassified 3178
14 Ga0065707_10154738 3300005295 Bacteria 1620
15 Ga0070658_10367241 3300005327 Bacteria 1233
16 Ga0070658_10373820 3300005327 Bacteria 1222
17 Ga0070658_10586158 3300005327 Bacteria 966
18 Ga0070658_10845987 3300005327 Bacteria 795
19 Ga0070676_10150239 3300005328 Unclassified 1490
20 Ga0070676_10217824 3300005328 Bacteria 1259
21 Ga0070683_100009018 3300005329 Bacteria 8509
22 Ga0070683_100340788 3300005329 Bacteria 1427
23 Ga0070683_100913565 3300005329 Bacteria 842
24 Ga0070690_100017828 3300005330 Bacteria 4280
25 Ga0070690_100191427 3300005330 Bacteria 1418
26 Ga0070670_100029747 3300005331 Unclassified 4704
27 Ga0070670_100847248 3300005331 Bacteria 827
28 Ga0070677_10004811 3300005333 Bacteria 4429
29 Ga0070677_10045918 3300005333 Unclassified 1744
30 Ga0070677_10069375 3300005333 Bacteria 1478
31 Ga0070677_10158051 3300005333 Bacteria 1061
32 Ga0068869_100002221 3300005334 Bacteria 11683
33 Ga0068869_100071156 3300005334 Bacteria 2575
34 Ga0068869_100110311 3300005334 Bacteria 2092
35 Ga0068869_101018754 3300005334 Bacteria 722
36 Ga0070666_10032828 3300005335 Unclassified 3431
37 Ga0070666_10418801 3300005335 Bacteria 964
38 Ga0070666_10521855 3300005335 Bacteria 862
39 Ga0070682_100433314 3300005337 Bacteria 1002
40 Ga0070682_100776759 3300005337 Bacteria 776
41 Ga0068868_100038641 3300005338 Bacteria 3705
42 Ga0068868_100278107 3300005338 Bacteria 1416
43 Ga0068868_100287642 3300005338 Bacteria 1393
44 Ga0068868_100549378 3300005338 Bacteria 1018
45 Ga0068868_100632765 3300005338 Bacteria 951
46 Ga0068868_100673874 3300005338 Bacteria 923
47 Ga0068868_101189418 3300005338 Bacteria 704
48 Ga0068868_101992326 3300005338 Bacteria 551
49 Ga0070660_100038449 3300005339 Bacteria 3633
50 Ga0070660_100273953 3300005339 Bacteria 1380
51 Ga0070660_100289994 3300005339 Bacteria 1340
52 Ga0070660_100319429 3300005339 Bacteria 1275
53 Ga0070660_100523295 3300005339 Bacteria 988
54 Ga0070660_100540999 3300005339 Bacteria 971
55 Ga0070689_100659626 3300005340 Bacteria 911
56 Ga0070691_10479183 3300005341 Bacteria 715
57 Ga0070691_10534184 3300005341 Bacteria 683
58 Ga0070687_100472298 3300005343 Bacteria 839
59 Ga0070661_100084028 3300005344 Bacteria 2352
60 Ga0070661_101117545 3300005344 Bacteria 657
61 Ga0070692_10041858 3300005345 Bacteria 2349
62 Ga0070692_10122283 3300005345 Bacteria 1453
63 Ga0070692_10145507 3300005345 Unclassified 1345
64 Ga0070692_10177713 3300005345 Bacteria 1231
65 Ga0070692_10224424 3300005345 Bacteria 1112
66 Ga0070668_100279897 3300005347 Bacteria 1393
67 Ga0070668_100616145 3300005347 Bacteria 951
68 Ga0070669_100013184 3300005353 Bacteria 5875
69 Ga0070669_100515594 3300005353 Bacteria 993
70 Ga0070675_100006132 3300005354 Bacteria 9217
71 Ga0070675_100033370 3300005354 Unclassified 4173
72 Ga0070675_100420627 3300005354 Bacteria 1195
73 Ga0070675_100537655 3300005354 Bacteria 1056
74 Ga0070675_100721451 3300005354 Bacteria 908
75 Ga0070671_100097228 3300005355 Bacteria 2469
76 Ga0070671_100202232 3300005355 Bacteria 1685
77 Ga0070671_100352062 3300005355 Bacteria 1257
78 Ga0070671_100699861 3300005355 Unclassified 879
79 Ga0070671_100746074 3300005355 Bacteria 851
80 Ga0070674_100000544 3300005356 Bacteria 18881
81 Ga0070674_100167708 3300005356 Unclassified 1671
82 Ga0070673_100145181 3300005364 Bacteria 2005
83 Ga0070673_100158082 3300005364 Unclassified 1925
84 Ga0070673_102144682 3300005364 Bacteria 531
85 Ga0070688_100199593 3300005365 Bacteria 1399
86 Ga0070659_100000749 3300005366 Bacteria 23637
87 Ga0070659_100129103 3300005366 Bacteria 2052
88 Ga0070659_100461731 3300005366 Bacteria 1078
89 Ga0070659_100579527 3300005366 Bacteria 963
90 Ga0070667_100025125 3300005367 Bacteria 4952
91 Ga0070667_100106006 3300005367 Unclassified 2433
92 Ga0070714_100095290 3300005435 Bacteria 2614
93 Ga0070701_10077193 3300005438 Bacteria 1795
94 Ga0070701_10207908 3300005438 Bacteria 1160
95 Ga0070701_10501528 3300005438 Bacteria 788
96 Ga0070705_100596208 3300005440 Bacteria 854
97 Ga0070700_100030218 3300005441 Bacteria 3236
98 Ga0070700_100115966 3300005441 Bacteria 1788
99 Ga0070700_100907334 3300005441 Bacteria 718
100 Ga0070700_101024352 3300005441 Unclassified 680
101 Ga0070694_100023115 3300005444 Bacteria 3994
102 Ga0070694_100161379 3300005444 Bacteria 1645
103 Ga0070663_100411390 3300005455 Bacteria 1108
104 Ga0070663_100448640 3300005455 Bacteria 1063
105 Ga0070663_100499031 3300005455 Bacteria 1010
106 Ga0070663_100922495 3300005455 Bacteria 755
107 Ga0070678_100042329 3300005456 Bacteria 3236
108 Ga0070678_100366712 3300005456 Unclassified 1242
109 Ga0070678_100691760 3300005456 Bacteria 918
110 Ga0070678_100746672 3300005456 Bacteria 885
111 Ga0070662_100563455 3300005457 Bacteria 956
112 Ga0070681_10008128 3300005458 Bacteria 10268
113 Ga0068867_100090993 3300005459 Unclassified 2315
114 Ga0068867_100485513 3300005459 Bacteria 1059
115 Ga0068867_100659766 3300005459 Bacteria 919
116 Ga0068867_101631604 3300005459 Bacteria 603
117 Ga0070685_10057253 3300005466 Bacteria 2268
118 Ga0070685_10393956 3300005466 Bacteria 957
119 Ga0070685_10800463 3300005466 Bacteria 695
120 Ga0070707_101177509 3300005468 Bacteria 732
121 Ga0070698_100009538 3300005471 Bacteria 10392
122 Ga0070698_100062331 3300005471 Bacteria 3762
123 Ga0070699_100007694 3300005518 Bacteria 9367
124 Ga0070699_100026880 3300005518 Bacteria 4964
125 Ga0070699_100361136 3300005518 Bacteria 1309
126 Ga0070699_101013187 3300005518 Bacteria 761
127 Ga0070679_100095891 3300005530 Bacteria 2954
128 Ga0070679_100235223 3300005530 Bacteria 1791
129 Ga0070679_101307657 3300005530 Bacteria 671
130 Ga0070684_100245691 3300005535 Bacteria 1635
131 Ga0068853_100001645 3300005539 Bacteria 16333
132 Ga0068853_100104448 3300005539 Bacteria 2508
133 Ga0068853_100442630 3300005539 Unclassified 1221
134 Ga0070672_100017354 3300005543 Bacteria 5178
135 Ga0070672_100055953 3300005543 Unclassified 3092
136 Ga0070672_100082058 3300005543 Bacteria 2586
137 Ga0070672_100195555 3300005543 Bacteria 1690
138 Ga0070686_100077221 3300005544 Unclassified 2195
139 Ga0070686_100120558 3300005544 Bacteria 1800
140 Ga0070686_100140415 3300005544 Bacteria 1681
141 Ga0070695_100060607 3300005545 Bacteria 2453
142 Ga0070695_100256262 3300005545 Bacteria 1276
143 Ga0070696_100004294 3300005546 Bacteria 9497
144 Ga0070696_100018940 3300005546 Bacteria 4660
145 Ga0070696_100039359 3300005546 Bacteria 3265
146 Ga0070696_100556411 3300005546 Bacteria 920
147 Ga0070696_100792142 3300005546 Bacteria 779
148 Ga0070696_101471694 3300005546 Bacteria 582
149 Ga0070693_100898021 3300005547 Bacteria 664
150 Ga0070693_101204669 3300005547 Bacteria 582
151 Ga0070665_100109938 3300005548 Bacteria 2758
152 Ga0070665_101093863 3300005548 Bacteria 809
153 Ga0070704_100132523 3300005549 Unclassified 1934
154 Ga0068855_100003924 3300005563 Bacteria 18149
155 Ga0068855_100009335 3300005563 Bacteria 11847
156 Ga0068855_100360694 3300005563 Bacteria 1599
157 Ga0068855_100557175 3300005563 Bacteria 1240
158 Ga0068855_100880545 3300005563 Bacteria 947
159 Ga0070664_100158710 3300005564 Bacteria 2000
160 Ga0070664_101134681 3300005564 Bacteria 737
161 Ga0070664_101296912 3300005564 Bacteria 688
162 Ga0068857_100001028 3300005577 Bacteria 21558
163 Ga0068857_100042691 3300005577 Bacteria 4024
164 Ga0068857_100087638 3300005577 Bacteria 2784
165 Ga0068857_100643105 3300005577 Bacteria 1005
166 Ga0068857_101119469 3300005577 Bacteria 761
167 Ga0068857_101780350 3300005577 Bacteria 603
168 Ga0068854_100138311 3300005578 Bacteria 1866
169 Ga0068854_100209574 3300005578 Bacteria 1536
170 Ga0068854_100379410 3300005578 Bacteria 1164
171 Ga0068854_101144725 3300005578 Bacteria 695
172 Ga0068856_100007464 3300005614 Bacteria 10673
173 Ga0068856_100253488 3300005614 Bacteria 1775
174 Ga0068856_100326297 3300005614 Bacteria 1552
175 Ga0068856_100398562 3300005614 Bacteria 1396
176 Ga0068856_100460188 3300005614 Bacteria 1293
177 Ga0068856_100982191 3300005614 Bacteria 863
178 Ga0068856_101008091 3300005614 Bacteria 851
179 Ga0070702_100280465 3300005615 Bacteria 1144
180 Ga0070702_100515960 3300005615 Bacteria 880
181 Ga0068852_100000501 3300005616 Bacteria 25721
182 Ga0068852_100003952 3300005616 Bacteria 10419
183 Ga0068852_100327024 3300005616 Bacteria 1490
184 Ga0068852_100758852 3300005616 Bacteria 982
185 Ga0068852_100934819 3300005616 Bacteria 885
186 Ga0068852_101025884 3300005616 Bacteria 844
187 Ga0068859_100059842 3300005617 Bacteria 3838
188 Ga0068859_100081703 3300005617 Unclassified 3274
189 Ga0068859_100094875 3300005617 Bacteria 3036
190 Ga0068859_100112913 3300005617 Bacteria 2781
191 Ga0068859_100171965 3300005617 Bacteria 2247
192 Ga0068864_100061604 3300005618 Bacteria 3250
193 Ga0068864_100233712 3300005618 Bacteria 1701
194 Ga0068864_100299165 3300005618 Unclassified 1506
195 Ga0068864_100762940 3300005618 Bacteria 949
196 Ga0068864_100797927 3300005618 Bacteria 928
197 Ga0068864_101451172 3300005618 Bacteria 689
198 Ga0068861_100205632 3300005719 Bacteria 1655
199 Ga0068861_100842939 3300005719 Unclassified 864
200 Ga0068851_10000008 3300005834 Bacteria 231006
201 Ga0068870_10091451 3300005840 Bacteria 1702
202 Ga0068863_100149326 3300005841 Bacteria 2236
203 Ga0068863_101914873 3300005841 Bacteria 603
204 Ga0068858_100000096 3300005842 Bacteria 91762
205 Ga0068860_100039330 3300005843 Bacteria 4523
206 Ga0068860_101012029 3300005843 Bacteria 849
207 Ga0068860_101133563 3300005843 Bacteria 802
208 Ga0068862_100024900 3300005844 Bacteria 5022
209 Ga0068862_100168038 3300005844 Bacteria 1962
210 Ga0068862_100277670 3300005844 Unclassified 1534
211 Ga0081455_10006304 3300005937 Bacteria 12749
212 Ga0081455_10013986 3300005937 Bacteria 7888
213 Ga0081455_10040847 3300005937 Bacteria 4087
214 Ga0081455_10096008 3300005937 Bacteria 2391
215 Ga0081455_10105002 3300005937 Bacteria 2259
216 Ga0081455_10809970 3300005937 Bacteria 587
217 Ga0081538_10000373 3300005981 Bacteria 51152
218 Ga0081538_10017097 3300005981 Bacteria 5522
219 Ga0081538_10019586 3300005981 Bacteria 5019
220 Ga0081538_10067575 3300005981 Bacteria 1994
221 Ga0081538_10235638 3300005981 Bacteria 711
222 Ga0081540_1209222 3300005983 Bacteria 703
223 Ga0070717_10243916 3300006028 Bacteria 1585
224 Ga0075368_10361241 3300006042 Bacteria 633
225 Ga0075432_10007952 3300006058 Bacteria 3615
226 Ga0075367_10246392 3300006178 Bacteria 1120
227 Ga0097621_100561334 3300006237 Bacteria 1040
228 Ga0097621_100846297 3300006237 Bacteria 849
229 Ga0075370_10151045 3300006353 Bacteria 1361
230 Ga0075428_100000241 3300006844 Bacteria 53452
231 Ga0075428_100054973 3300006844 Bacteria 4362
232 Ga0075428_100060000 3300006844 Bacteria 4165
233 Ga0075428_100339706 3300006844 Bacteria 1613
234 Ga0075428_101188755 3300006844 Bacteria 804
235 Ga0075430_100000048 3300006846 Bacteria 63512
236 Ga0075430_100219158 3300006846 Bacteria 1579
237 Ga0075430_100484127 3300006846 Bacteria 1021
238 Ga0075431_100000208 3300006847 Bacteria 43484
239 Ga0075431_100038131 3300006847 Unclassified 4948
240 Ga0075431_100831966 3300006847 Bacteria 895
241 Ga0075433_10000736 3300006852 Bacteria 22450
242 Ga0075433_10077745 3300006852 Bacteria 2923
243 Ga0075433_10474300 3300006852 Bacteria 1102
244 Ga0075434_100087794 3300006871 Bacteria 3111
245 Ga0075434_100134988 3300006871 Bacteria 2487
246 Ga0075434_100348743 3300006871 Bacteria 1501
247 Ga0075434_100673161 3300006871 Bacteria 1053
248 Ga0075434_100740557 3300006871 Bacteria 1000
249 Ga0075429_100000967 3300006880 Bacteria 22796
250 Ga0075429_100105292 3300006880 Bacteria 2464
251 Ga0075429_100114285 3300006880 Bacteria 2360
252 Ga0068865_100093875 3300006881 Bacteria 2182
253 Ga0068865_100638252 3300006881 Bacteria 904
254 Ga0075436_100800275 3300006914 Bacteria 702
255 Ga0097620_100059840 3300006931 Bacteria 3838
256 Ga0097620_100081701 3300006931 Unclassified 3274
257 Ga0097620_100094876 3300006931 Bacteria 3036
258 Ga0097620_100112911 3300006931 Bacteria 2781
259 Ga0097620_100171978 3300006931 Bacteria 2247
260 Ga0105240_10021974 3300009093 Bacteria 8475
261 Ga0105240_10027961 3300009093 Bacteria 7376
262 Ga0105240_10779281 3300009093 Bacteria 1037
263 Ga0111539_10041498 3300009094 Bacteria 5532
264 Ga0111539_10052732 3300009094 Bacteria 4841
265 Ga0111539_10349205 3300009094 Bacteria 1722
266 Ga0111539_10723624 3300009094 Bacteria 1158
267 Ga0111539_10857997 3300009094 Bacteria 1056
268 Ga0111539_10869734 3300009094 Unclassified 1049
269 Ga0111539_10964560 3300009094 Bacteria 991
270 Ga0105245_10038504 3300009098 Bacteria 4254
271 Ga0105245_10281609 3300009098 Bacteria 1625
272 Ga0105245_10346400 3300009098 Bacteria 1471
273 Ga0105245_10394612 3300009098 Bacteria 1381
274 Ga0105245_10513343 3300009098 Bacteria 1216
275 Ga0105245_10544958 3300009098 Bacteria 1181
276 Ga0105245_10603910 3300009098 Bacteria 1124
277 Ga0105245_11868469 3300009098 Bacteria 654
278 Ga0105245_12515130 3300009098 Bacteria 568
279 Ga0105247_10548317 3300009101 Bacteria 850
280 Ga0114129_10018879 3300009147 Bacteria 9822
281 Ga0114129_10065623 3300009147 Bacteria 5066
282 Ga0114129_10100818 3300009147 Bacteria 3995
283 Ga0114129_10315805 3300009147 Bacteria 2078
284 Ga0114129_10382098 3300009147 Bacteria 1860
285 Ga0114129_11396036 3300009147 Unclassified 864
286 Ga0105243_10305119 3300009148 Bacteria 1444
287 Ga0105243_10925634 3300009148 Bacteria 869
288 Ga0105243_11313961 3300009148 Bacteria 741
289 Ga0105241_10225464 3300009174 Unclassified 1577
290 Ga0105248_10000713 3300009177 Bacteria 37644
291 Ga0105248_10077338 3300009177 Bacteria 3741
292 Ga0105248_10662210 3300009177 Bacteria 1178
293 Ga0105237_10000688 3300009545 Bacteria 46838
294 Ga0105237_10004883 3300009545 Bacteria 15361
295 Ga0105237_11214233 3300009545 Bacteria 761
296 Ga0105237_11510539 3300009545 Bacteria 678
297 Ga0105238_10006959 3300009551 Bacteria 11300
298 Ga0105238_10161194 3300009551 Bacteria 2218
299 Ga0105238_10465246 3300009551 Bacteria 1263
300 Ga0105238_11933722 3300009551 Bacteria 623
301 Ga0105249_10001062 3300009553 Bacteria 24367
302 Ga0105249_10261594 3300009553 Bacteria 1720
303 Ga0105249_10442756 3300009553 Bacteria 1337
304 Ga0105249_10543417 3300009553 Bacteria 1212
305 Ga0105249_11537618 3300009553 Bacteria 738
306 Ga0105239_10147347 3300010375 Bacteria 2626
307 Ga0105239_10155042 3300010375 Bacteria 2557
308 Ga0105239_10464557 3300010375 Bacteria 1437
309 Ga0105239_10802157 3300010375 Bacteria 1079
310 Ga0105239_11724564 3300010375 Unclassified 725
311 Ga0105239_11892425 3300010375 Bacteria 692
312 Ga0105246_10074532 3300011119 Bacteria 2399
313 Ga0105246_10220356 3300011119 Bacteria 1487
314 Ga0105246_11208256 3300011119 Bacteria 696
315 Ga0157344_1023062 3300012476 Bacteria 550
316 Ga0157337_1004159 3300012483 Bacteria 911
317 Ga0157329_1004243 3300012491 Bacteria 920
318 Ga0157319_1008431 3300012497 Bacteria 788
319 Ga0157338_1022790 3300012515 Bacteria 743
320 Ga0157371_10075353 3300013102 Bacteria 2389
321 Ga0157371_10173744 3300013102 Bacteria 1540
322 Ga0157371_10509930 3300013102 Bacteria 889
323 Ga0157370_10043788 3300013104 Bacteria 4306
324 Ga0157370_10397559 3300013104 Bacteria 1269
325 Ga0157370_10648815 3300013104 Bacteria 965
326 Ga0157369_10146550 3300013105 Bacteria 2496
327 Ga0157369_10383825 3300013105 Bacteria 1458
328 Ga0157374_10174753 3300013296 Unclassified 2096
329 Ga0157374_10351983 3300013296 Bacteria 1464
330 Ga0157374_11291659 3300013296 Bacteria 752
331 Ga0157374_12725080 3300013296 Bacteria 522
332 Ga0157378_10235559 3300013297 Unclassified 1747
333 Ga0163162_10001014 3300013306 Bacteria 26094
334 Ga0163162_10247613 3300013306 Bacteria 1914
335 Ga0163162_10753827 3300013306 Bacteria 1093
336 Ga0163162_10909142 3300013306 Bacteria 993
337 Ga0163162_12669277 3300013306 Bacteria 575
338 Ga0157372_10000303 3300013307 Bacteria 54864
339 Ga0157372_10286550 3300013307 Bacteria 1915
340 Ga0157372_10293629 3300013307 Bacteria 1890
341 Ga0157372_11785184 3300013307 Bacteria 707
342 Ga0157375_10017739 3300013308 Bacteria 6435
343 Ga0157375_10073830 3300013308 Bacteria 3431
344 Ga0157375_11431133 3300013308 Bacteria 815
345 Ga0157375_11672543 3300013308 Bacteria 753
346 Ga0163163_10113196 3300014325 Unclassified 2743
347 Ga0163163_10315846 3300014325 Bacteria 1616
348 Ga0157380_10008742 3300014326 Bacteria 7235
349 Ga0157380_10027580 3300014326 Bacteria 4320
350 Ga0157380_10173203 3300014326 Unclassified 1888
351 Ga0157380_10503459 3300014326 Bacteria 1177
352 Ga0157380_11438659 3300014326 Bacteria 741
353 Ga0182008_10306201 3300014497 Bacteria 833
354 Ga0157377_10317183 3300014745 Bacteria 1034
355 Ga0157377_10334535 3300014745 Bacteria 1011
356 Ga0157377_10506590 3300014745 Bacteria 845
357 Ga0157379_10172327 3300014968 Bacteria 1953
358 Ga0157379_10856821 3300014968 Bacteria 860
359 Ga0157376_10094004 3300014969 Bacteria 2604
360 Ga0157376_11067894 3300014969 Bacteria 832
361 Ga0157376_11515382 3300014969 Bacteria 704
362 Ga0163161_10027815 3300017792 Unclassified 4012
363 Ga0163161_10245228 3300017792 Bacteria 1395
364 Ga0197907_10030690 3300020069 Bacteria 882
365 Ga0206354_10719424 3300020081 Bacteria 618
366 Ga0224712_10064155 3300022467 Bacteria 1473
367 Ga0209148_1001379 3300025254 Bacteria 12636
368 Ga0207426_1092055 3300025302 Bacteria 801
369 Ga0207697_10000517 3300025315 Bacteria 21741
370 Ga0207697_10062739 3300025315 Unclassified 1548
371 Ga0207656_10000005 3300025321 Bacteria 490514
372 Ga0207682_10007235 3300025893 Bacteria 4436
373 Ga0207682_10011183 3300025893 Unclassified 3509
374 Ga0207682_10011919 3300025893 Bacteria 3395
375 Ga0207642_10121635 3300025899 Bacteria 1347
376 Ga0207710_10131947 3300025900 Bacteria 1200
377 Ga0207688_10019212 3300025901 Bacteria 3721
378 Ga0207688_10027679 3300025901 Bacteria 3118
379 Ga0207688_10137359 3300025901 Bacteria 1437
380 Ga0207688_10684024 3300025901 Bacteria 648
381 Ga0207680_10060351 3300025903 Bacteria 2308
382 Ga0207680_10134592 3300025903 Bacteria 1632
383 Ga0207680_10449127 3300025903 Bacteria 915
384 Ga0207699_11218863 3300025906 Bacteria 557
385 Ga0207645_10000648 3300025907 Bacteria 28907
386 Ga0207645_10080681 3300025907 Unclassified 2086
387 Ga0207645_10180081 3300025907 Bacteria 1386
388 Ga0207643_10000535 3300025908 Bacteria 24402
389 Ga0207643_10030163 3300025908 Unclassified 3018
390 Ga0207643_10034341 3300025908 Bacteria 2842
391 Ga0207643_10339261 3300025908 Bacteria 941
392 Ga0207705_10019591 3300025909 Bacteria 4837
393 Ga0207705_10036147 3300025909 Bacteria 3535
394 Ga0207705_10125425 3300025909 Bacteria 1908
395 Ga0207705_10355435 3300025909 Bacteria 1129
396 Ga0207705_10591444 3300025909 Bacteria 863
397 Ga0207705_11092228 3300025909 Bacteria 615
398 Ga0207654_10000001 3300025911 Bacteria 1816198
399 Ga0207707_10104231 3300025912 Bacteria 2479
400 Ga0207695_10005054 3300025913 Bacteria 17692
401 Ga0207695_10075339 3300025913 Bacteria 3434
402 Ga0207695_10591249 3300025913 Bacteria 991
403 Ga0207671_10000016 3300025914 Bacteria 435413
404 Ga0207671_10026676 3300025914 Bacteria 4325
405 Ga0207660_10151925 3300025917 Bacteria 1780
406 Ga0207662_10008294 3300025918 Bacteria 5687
407 Ga0207662_10178674 3300025918 Bacteria 1365
408 Ga0207657_10017089 3300025919 Bacteria 6975
409 Ga0207657_10045205 3300025919 Bacteria 3866
410 Ga0207657_10309354 3300025919 Bacteria 1251
411 Ga0207657_10828047 3300025919 Bacteria 715
412 Ga0207649_10079211 3300025920 Bacteria 2122
413 Ga0207649_10673257 3300025920 Bacteria 801
414 Ga0207652_10067301 3300025921 Bacteria 3106
415 Ga0207646_10290620 3300025922 Bacteria 1477
416 Ga0207681_10019493 3300025923 Bacteria 4286
417 Ga0207681_10199790 3300025923 Unclassified 1534
418 Ga0207694_10000196 3300025924 Bacteria 60714
419 Ga0207650_10518227 3300025925 Bacteria 998
420 Ga0207659_10004355 3300025926 Bacteria 8554
421 Ga0207659_10136974 3300025926 Bacteria 1896
422 Ga0207659_10619886 3300025926 Bacteria 923
423 Ga0207659_10716075 3300025926 Bacteria 857
424 Ga0207659_11052460 3300025926 Bacteria 700
425 Ga0207687_10016104 3300025927 Bacteria 4907
426 Ga0207687_10169791 3300025927 Bacteria 1681
427 Ga0207687_10262691 3300025927 Bacteria 1377
428 Ga0207687_10471563 3300025927 Bacteria 1044
429 Ga0207687_11179682 3300025927 Bacteria 658
430 Ga0207664_10412600 3300025929 Bacteria 1202
431 Ga0207664_10417670 3300025929 Bacteria 1194
432 Ga0207644_10218069 3300025931 Bacteria 1511
433 Ga0207644_10260810 3300025931 Bacteria 1386
434 Ga0207644_10282557 3300025931 Bacteria 1333
435 Ga0207690_10135811 3300025932 Bacteria 1806
436 Ga0207706_10043147 3300025933 Bacteria 3997
437 Ga0207706_10140431 3300025933 Unclassified 2125
438 Ga0207706_10307749 3300025933 Bacteria 1380
439 Ga0207670_10359036 3300025936 Bacteria 1156
440 Ga0207669_10032629 3300025937 Unclassified 2927
441 Ga0207704_10469516 3300025938 Bacteria 1008
442 Ga0207665_10133132 3300025939 Bacteria 1767
443 Ga0207665_10272599 3300025939 Bacteria 1257
444 Ga0207691_10005699 3300025940 Bacteria 12041
445 Ga0207691_10008272 3300025940 Bacteria 9986
446 Ga0207691_10043448 3300025940 Bacteria 4142
447 Ga0207691_11065462 3300025940 Bacteria 673
448 Ga0207711_10004705 3300025941 Bacteria 11597
449 Ga0207711_10044903 3300025941 Bacteria 3774
450 Ga0207689_10009006 3300025942 Bacteria 8644
451 Ga0207689_10069451 3300025942 Bacteria 2895
452 Ga0207689_10090331 3300025942 Bacteria 2517
453 Ga0207689_10106985 3300025942 Unclassified 2298
454 Ga0207679_12000900 3300025945 Bacteria 527
455 Ga0207667_10000437 3300025949 Bacteria 55848
456 Ga0207667_10001482 3300025949 Bacteria 29458
457 Ga0207667_10008673 3300025949 Bacteria 12051
458 Ga0207667_10072070 3300025949 Bacteria 3591
459 Ga0207667_10253870 3300025949 Bacteria 1799
460 Ga0207667_10346354 3300025949 Bacteria 1516
461 Ga0207667_10617899 3300025949 Bacteria 1091
462 Ga0207667_10619589 3300025949 Bacteria 1090
463 Ga0207651_10282454 3300025960 Bacteria 1372
464 Ga0207651_11430641 3300025960 Bacteria 622
465 Ga0207712_10004201 3300025961 Bacteria 9089
466 Ga0207712_10253215 3300025961 Bacteria 1424
467 Ga0207712_10357744 3300025961 Bacteria 1215
468 Ga0207712_11788531 3300025961 Bacteria 551
469 Ga0207668_10060983 3300025972 Bacteria 2650
470 Ga0207668_11665739 3300025972 Bacteria 576
471 Ga0207640_10178867 3300025981 Bacteria 1588
472 Ga0207640_10207338 3300025981 Bacteria 1490
473 Ga0207640_10910209 3300025981 Bacteria 769
474 Ga0207640_10925196 3300025981 Bacteria 763
475 Ga0207658_10026447 3300025986 Bacteria 4068
476 Ga0207658_10106792 3300025986 Unclassified 2205
477 Ga0207677_10142275 3300026023 Bacteria 1838
478 Ga0207677_10284429 3300026023 Bacteria 1359
479 Ga0207677_10369522 3300026023 Bacteria 1207
480 Ga0207677_10422969 3300026023 Bacteria 1135
481 Ga0207677_10487532 3300026023 Bacteria 1063
482 Ga0207677_10656431 3300026023 Bacteria 926
483 Ga0207677_10756108 3300026023 Bacteria 867
484 Ga0207677_11167194 3300026023 Bacteria 704
485 Ga0207677_11496225 3300026023 Bacteria 623
486 Ga0207703_10001625 3300026035 Bacteria 20245
487 Ga0207703_10423802 3300026035 Bacteria 1239
488 Ga0207703_10910396 3300026035 Bacteria 842
489 Ga0207639_10024131 3300026041 Bacteria 4397
490 Ga0207639_10040933 3300026041 Bacteria 3462
491 Ga0207639_11653178 3300026041 Bacteria 600
492 Ga0207678_10170373 3300026067 Bacteria 1859
493 Ga0207678_10441042 3300026067 Bacteria 1131
494 Ga0207678_10578198 3300026067 Bacteria 984
495 Ga0207708_10030195 3300026075 Bacteria 4110
496 Ga0207708_10215985 3300026075 Bacteria 1534
497 Ga0207708_10547439 3300026075 Bacteria 975
498 Ga0207702_10012173 3300026078 Bacteria 7159
499 Ga0207702_10129325 3300026078 Bacteria 2271
500 Ga0207702_10434827 3300026078 Bacteria 1271
501 Ga0207702_10740140 3300026078 Bacteria 970
502 Ga0207702_11323409 3300026078 Bacteria 714
503 Ga0207702_11394922 3300026078 Bacteria 694
504 Ga0207702_12194378 3300026078 Bacteria 541
505 Ga0207641_10007623 3300026088 Bacteria 8999
506 Ga0207641_10203174 3300026088 Bacteria 1828
507 Ga0207641_10379506 3300026088 Bacteria 1353
508 Ga0207648_10139502 3300026089 Unclassified 2136
509 Ga0207648_10169731 3300026089 Bacteria 1928
510 Ga0207648_11020160 3300026089 Bacteria 775
511 Ga0207676_10012542 3300026095 Bacteria 6077
512 Ga0207676_10082449 3300026095 Bacteria 2616
513 Ga0207676_10090865 3300026095 Unclassified 2507
514 Ga0207676_11073057 3300026095 Bacteria 795
515 Ga0207674_10000405 3300026116 Bacteria 55884
516 Ga0207674_10052476 3300026116 Bacteria 4159
517 Ga0207674_10059478 3300026116 Bacteria 3866
518 Ga0207674_10229526 3300026116 Bacteria 1804
519 Ga0207674_11500722 3300026116 Bacteria 643
520 Ga0207674_12141616 3300026116 Bacteria 523
521 Ga0207675_100004393 3300026118 Bacteria 13619
522 Ga0207675_100007784 3300026118 Bacteria 10107
523 Ga0207675_100071349 3300026118 Bacteria 3247
524 Ga0207683_10010725 3300026121 Bacteria 7812
525 Ga0207683_10026823 3300026121 Unclassified 4976
526 Ga0207683_10199495 3300026121 Bacteria 1818
527 Ga0207683_10507555 3300026121 Bacteria 1114
528 Ga0207698_10000078 3300026142 Bacteria 65050
529 Ga0207698_10002196 3300026142 Bacteria 11542
530 Ga0207698_10088340 3300026142 Bacteria 2528
531 Ga0207698_10284769 3300026142 Bacteria 1530
532 Ga0209971_1120311 3300027682 Bacteria 645
533 Ga0209813_10107658 3300027866 Bacteria 956
534 Ga0209974_10164236 3300027876 Bacteria 807
535 Ga0207428_10024405 3300027907 Bacteria 5076
536 Ga0207428_10233919 3300027907 Bacteria 1374
537 Ga0207428_10807162 3300027907 Bacteria 666
538 Ga0268266_10133401 3300028379 Bacteria 2223
539 Ga0268266_10238596 3300028379 Bacteria 1677
540 Ga0268265_10024124 3300028380 Bacteria 4298
541 Ga0268265_10032259 3300028380 Unclassified 3794
542 Ga0268265_10140220 3300028380 Bacteria 2023
543 Ga0268265_12285336 3300028380 Bacteria 548
544 Ga0268264_10130699 3300028381 Bacteria 2225
545 Ga0268264_10624537 3300028381 Bacteria 1064
546 Ga0268264_11437897 3300028381 Bacteria 700
547 Ga0307408_100439923 3300031548 Bacteria 1129
548 Ga0307408_100839797 3300031548 Bacteria 837
549 Ga0307408_101157656 3300031548 Bacteria 720
550 Ga0316575_10001600 3300031665 Bacteria 7380
551 Ga0316579_10011276 3300031691 Bacteria 3796
552 Ga0316576_10050031 3300031727 Bacteria 3037
553 Ga0316576_10171686 3300031727 Bacteria 1636
554 Ga0316578_10004010 3300031728 Bacteria 6873
555 Ga0316578_10208559 3300031728 Bacteria 1175
556 Ga0307405_10297494 3300031731 Bacteria 1223
557 Ga0307405_11226242 3300031731 Bacteria 650
558 Ga0316577_10021111 3300031733 Bacteria 3611
559 Ga0316577_10235428 3300031733 Bacteria 1035
560 Ga0307413_10029884 3300031824 Bacteria 3055
561 Ga0307413_10113399 3300031824 Bacteria 1820
562 Ga0307413_10326403 3300031824 Bacteria 1174
563 Ga0307410_11131806 3300031852 Bacteria 680
564 Ga0307406_10058838 3300031901 Bacteria 2471
565 Ga0307406_10395189 3300031901 Bacteria 1094
566 Ga0307406_10722552 3300031901 Bacteria 834
567 Ga0307406_10728478 3300031901 Bacteria 830
568 Ga0307406_11080728 3300031901 Bacteria 692
569 Ga0307406_11540519 3300031901 Bacteria 586
570 Ga0307412_10365308 3300031911 Bacteria 1164
571 Ga0307409_100727410 3300031995 Bacteria 994
572 Ga0307416_100177135 3300032002 Bacteria 1994
573 Ga0307416_100531847 3300032002 Bacteria 1246
574 Ga0307416_103788366 3300032002 Bacteria 506
575 Ga0307414_10122243 3300032004 Bacteria 2004
576 Ga0307414_10511001 3300032004 Bacteria 1065
577 Ga0307414_11144964 3300032004 Bacteria 719
578 Ga0307411_10926525 3300032005 Bacteria 776
579 Ga0307411_11015558 3300032005 Bacteria 743
580 Ga0307411_11158205 3300032005 Bacteria 699
581 Ga0307415_100429465 3300032126 Bacteria 1136
582 Ga0307415_100498756 3300032126 Bacteria 1064
583 Ga0316583_10114392 3300032133 Bacteria 941
584 Ga0316593_10007319 3300032168 Bacteria 3026
585 Ga0316586_1014057 3300033527 Bacteria 1260
586 Ga0316587_1062345 3300033529 Bacteria 692
587 Ga0316596_1076268 3300033541 Bacteria 899
588 Ga0373940_0251984 3300035088 Bacteria 595
589 Ga0373952_0169780 3300035092 Bacteria 623
590 Ga0373932_0011563 3300035112 Bacteria 2159
591 Ga0373939_0159872 3300035114 Bacteria 826
592 Ga0373953_0005571 3300035117 Bacteria 4095
593 Ga0373953_0407045 3300035117 Bacteria 599
594 Ga0373954_0010182 3300035118 Bacteria 4144
595 Ga0373956_0011874 3300035119 Bacteria 3598
596 Ga0373957_0176131 3300035120 Bacteria 885
597 Ga0373957_0417527 3300035120 Bacteria 578
598 Ga0373955_0018329 3300035172 Bacteria 3480
599 Ga0373955_0078130 3300035172 Bacteria 1865
600 Ga0373942_0194021 3300035207 Bacteria 671
601 Ga0373962_0016027 3300035242 Bacteria 1928
602 Ga0373962_0204756 3300035242 Bacteria 669
603 Ga0316574_0007133 3300035398 Bacteria 6107
604 Ga0373924_0014182 3300035410 Bacteria 3009
605 Ga0373931_0258353 3300035691 Bacteria 1062
606 Ga0373933_0003076 3300035724 Bacteria 9302
607 Ga0373937_0011980 3300036401 Bacteria 7612
608 Ga0316582_0016585 3300036647 Bacteria 4239
609 Ga0316582_0195668 3300036647 Bacteria 1378
610 Ga0316582_0353159 3300036647 Bacteria 1011
611 Ga0316584_0002064 3300036712 Bacteria 12572
612 Ga0316584_0057306 3300036712 Bacteria 2916
613 Ga0395900_0356212 3300037418 Bacteria 1436
614 Ga0395900_1217516 3300037418 Bacteria 668
615 Ga0395900_1656355 3300037418 Bacteria 551
616 Ga0395898_0163578 3300037466 Bacteria 2129
617 Ga0395901_0264956 3300038443 Bacteria 1788
618 Ga0436362_1073426 3300039453 Bacteria 533
619 Ga0439465_0024249 3300041413 Bacteria 1911
620 Ga0439465_0197368 3300041413 Bacteria 732
621 Ga0451795_0846601 3300041456 Bacteria 785
622 Ga0451807_2331222 3300041486 Bacteria 625
623 Ga0451807_2660586 3300041486 Bacteria 816
624 Ga0439448_0229132 3300042005 Bacteria 654
625 Ga0439448_0287680 3300042005 Bacteria 583
626 Ga0439450_012941 3300042008 Bacteria 1666
627 Ga0450923_044577 3300042125 Bacteria 940
628 Ga0439435_0057780 3300042436 Bacteria 1124
629 Ga0439459_0004614 3300042438 Bacteria 2224
630 Ga0439464_0054081 3300042439 Bacteria 1166
631 Ga0439440_0009970 3300042993 Bacteria 1976
632 Ga0466969_0081090 3300044656 Bacteria 1549
633 Ga0466965_0227077 3300044683 Bacteria 996
634 Ga0466966_0138851 3300044684 Bacteria 1486
635 Ga0466961_0519695 3300044693 Bacteria 718
636 Ga0466961_0635230 3300044693 Bacteria 641
637 Ga0466963_0591109 3300044694 Bacteria 784
638 Ga0466963_1109621 3300044694 Bacteria 556
639 Ga0466971_0587126 3300044719 Bacteria 555
640 Ga0466970_0396247 3300044765 Bacteria 787
641 Ga0466970_0592951 3300044765 Bacteria 642
642 Ga0466957_0082035 3300044842 Bacteria 2009
643 Ga0466957_0313114 3300044842 Bacteria 1057
644 Ga0466960_0007662 3300044901 Bacteria 4395
645 Ga0466958_0166076 3300045836 Bacteria 1396
646 Ga0466958_0504308 3300045836 Bacteria 785
647 Ga0466967_0000739 3300045976 Bacteria 16761
648 Ga0466967_0454479 3300045976 Bacteria 1252
649 Ga0466967_0645276 3300045976 Bacteria 1047
650 Ga0466967_1230676 3300045976 Bacteria 746
651 Ga0466967_2194709 3300045976 Bacteria 548
652 Ga0466967_2563465 3300045976 Bacteria 505
653 Ga0495590_0001438 3300046457 Bacteria 10274
654 Ga0495641_0095566 3300046461 Bacteria 1327
655 Ga0495584_0214622 3300046491 Bacteria 978
656 Ga0495606_0002983 3300046507 Bacteria 18608
657 Ga0495642_0034777 3300046528 Bacteria 2031
658 Ga0495640_0086467 3300046533 Bacteria 2076
659 Ga0495640_0104777 3300046533 Bacteria 1853
660 Ga0495587_0743784 3300046536 Bacteria 537
661 Ga0495598_0040556 3300046537 Bacteria 1358
662 Ga0495667_0102790 3300046559 Bacteria 1848
663 Ga0495656_0406633 3300046615 Bacteria 713
664 Ga0495656_0581439 3300046615 Bacteria 598
665 Ga0495668_0002487 3300046616 Bacteria 15099
666 Ga0495625_0014245 3300046660 Bacteria 6357
667 Ga0495625_0324273 3300046660 Bacteria 980
668 Ga0495635_0081532 3300046663 Bacteria 2214
669 Ga0495659_0072648 3300046664 Bacteria 1291
670 Ga0495659_0132995 3300046664 Bacteria 987
671 Ga0495647_0045876 3300046681 Bacteria 1681
672 Ga0495669_0221135 3300046684 Bacteria 908
673 Ga0495581_0321925 3300047315 Bacteria 903
674 Ga0495636_0471550 3300047318 Bacteria 604
675 Ga0495636_0633288 3300047318 Bacteria 524
676 Ga0495636_0697513 3300047318 Bacteria 501
677 Ga0495676_0132259 3300047321 Bacteria 1799
678 Ga0495680_0233594 3300047322 Bacteria 1308
679 Ga0495683_0101187 3300047323 Bacteria 1385
680 Ga0495686_0261887 3300047472 Bacteria 968
681 Ga0495602_0191483 3300048088 Bacteria 1568
682 Ga0495614_0539767 3300048089 Bacteria 557
683 Ga0495626_0001210 3300048091 Bacteria 21305
684 Ga0496102_0115362 3300048905 Bacteria 2506
685 Ga0496102_0204800 3300048905 Bacteria 1860
686 Ga0496104_0000086 3300048907 Bacteria 89916
687 Ga0496104_0027869 3300048907 Bacteria 5230
688 Ga0496104_0251154 3300048907 Bacteria 1681
689 Ga0496104_1007604 3300048907 Bacteria 737
690 Ga0496104_1425882 3300048907 Bacteria 596
691 Ga0496105_0000126 3300048908 Bacteria 51169
692 Ga0496105_0116726 3300048908 Bacteria 2202
693 Ga0496105_0187311 3300048908 Bacteria 1693
694 Ga0496106_1250834 3300048909 Bacteria 578
695 Ga0496107_0762153 3300048910 Bacteria 710
696 Ga0496108_0093186 3300048911 Bacteria 2562
697 Ga0496108_0255872 3300048911 Bacteria 1523
698 Ga0496109_0002834 3300048912 Bacteria 14531
699 Ga0496109_0682699 3300048912 Bacteria 964
700 Ga0496109_0822649 3300048912 Bacteria 867
701 Ga0496109_0853634 3300048912 Bacteria 848
702 Ga0496110_0018428 3300048913 Bacteria 5854
703 Ga0496110_0160757 3300048913 Bacteria 2036
704 Ga0496110_0399204 3300048913 Bacteria 1253
705 Ga0496111_0262548 3300048914 Bacteria 1281
706 Ga0496111_0600121 3300048914 Bacteria 806
707 Ga0496112_0056822 3300048915 Bacteria 3852
708 Ga0496112_0078054 3300048915 Bacteria 3275
709 Ga0496113_0009600 3300048916 Bacteria 6351
710 Ga0496113_0110508 3300048916 Bacteria 2139
711 Ga0496114_0126356 3300048917 Bacteria 2205
712 Ga0496114_0353088 3300048917 Bacteria 1300
713 Ga0496114_1237384 3300048917 Bacteria 633
714 Ga0496115_0095992 3300048918 Bacteria 2427
715 Ga0496115_0847580 3300048918 Bacteria 708
716 Ga0496117_0277177 3300048920 Bacteria 900
717 Ga0496118_0046316 3300048921 Bacteria 3385
718 Ga0496118_0502711 3300048921 Bacteria 602
719 Ga0496119_0007381 3300048922 Bacteria 9924
720 Ga0496119_0024772 3300048922 Bacteria 4210
721 Ga0496119_0060350 3300048922 Bacteria 2271
722 Ga0496120_0000929 3300048923 Bacteria 40563
723 Ga0496120_0002952 3300048923 Bacteria 16205
724 Ga0496120_0018072 3300048923 Bacteria 4554
725 Ga0496125_0120419 3300048928 Bacteria 1874
726 Ga0496126_0372998 3300048929 Bacteria 1163
727 Ga0496126_0678838 3300048929 Bacteria 803
728 Ga0501031_0252010 3300049568 Bacteria 1147
729 Ga0501032_0200840 3300049569 Bacteria 1301
730 Ga0501032_0707410 3300049569 Bacteria 638
731 Ga0501033_0021283 3300049570 Bacteria 4892
732 Ga0501033_0108029 3300049570 Bacteria 2027
733 Ga0501033_0117903 3300049570 Bacteria 1928
734 Ga0501033_0319448 3300049570 Bacteria 1091
735 Ga0501033_0367901 3300049570 Bacteria 1005
736 Ga0501033_0660233 3300049570 Bacteria 714
737 Ga0501034_0006121 3300049571 Bacteria 12981
738 Ga0501034_0085168 3300049571 Bacteria 3162
739 Ga0501034_0271558 3300049571 Bacteria 1636
740 Ga0501036_0012840 3300049572 Bacteria 6952
741 Ga0501036_0148278 3300049572 Bacteria 1979
742 Ga0501036_0154879 3300049572 Bacteria 1933
743 Ga0501036_0859529 3300049572 Bacteria 745
744 Ga0501036_0893982 3300049572 Bacteria 729
745 Ga0501037_0028904 3300049573 Bacteria 4096
746 Ga0501037_0064654 3300049573 Bacteria 2666
747 Ga0501038_0054733 3300049574 Bacteria 3430
748 Ga0501038_0064680 3300049574 Bacteria 3118
749 Ga0501038_0168500 3300049574 Bacteria 1775
750 Ga0501038_0358256 3300049574 Bacteria 1135
751 Ga0501038_0845179 3300049574 Bacteria 678
752 Ga0501039_0037099 3300049575 Bacteria 3762
753 Ga0501039_1105477 3300049575 Bacteria 614
754 Ga0501040_0053540 3300049576 Bacteria 2764
755 Ga0501040_0187258 3300049576 Bacteria 1468
756 Ga0501040_0386731 3300049576 Bacteria 1004
757 Ga0501040_1286106 3300049576 Bacteria 531
758 Ga0501042_0007990 3300049578 Bacteria 6964
759 Ga0501042_0109698 3300049578 Bacteria 1987
760 Ga0501042_0198013 3300049578 Bacteria 1449
761 Ga0501043_0093461 3300049579 Bacteria 2364
762 Ga0501043_0098355 3300049579 Bacteria 2300
763 Ga0501043_0243849 3300049579 Bacteria 1385
764 Ga0501043_0753321 3300049579 Bacteria 708
765 Ga0501046_0022138 3300049580 Bacteria 5238
766 Ga0501046_0373368 3300049580 Bacteria 1033
767 Ga0501046_0529657 3300049580 Bacteria 841
768 Ga0501046_0875744 3300049580 Unclassified 627
769 Ga0501047_0074959 3300049581 Bacteria 3256
770 Ga0501047_0080728 3300049581 Bacteria 3126
771 Ga0501047_0111398 3300049581 Bacteria 2619
772 Ga0501047_0121925 3300049581 Bacteria 2488
773 Ga0501048_0094392 3300049582 Bacteria 2110
774 Ga0501048_0495978 3300049582 Bacteria 875
775 Ga0501048_0829302 3300049582 Bacteria 665
776 Ga0501068_0607586 3300049584 Bacteria 713
777 Ga0501068_0611256 3300049584 Bacteria 711
778 Ga0501069_0302026 3300049585 Bacteria 939
779 Ga0501070_0131590 3300049586 Bacteria 2066
780 Ga0501070_0264456 3300049586 Bacteria 1406
781 Ga0501070_0474318 3300049586 Bacteria 1007
782 Ga0501070_0823189 3300049586 Bacteria 728
783 Ga0501070_0827838 3300049586 Bacteria 725
784 Ga0501072_0024908 3300049588 Bacteria 4659
785 Ga0501072_0288915 3300049588 Bacteria 1304
786 Ga0501072_0424607 3300049588 Bacteria 1054
787 Ga0501072_1179167 3300049588 Bacteria 595
788 Ga0501073_0095252 3300049589 Bacteria 2067
789 Ga0501074_0031707 3300049590 Bacteria 3829
790 Ga0501074_0147029 3300049590 Bacteria 1685
791 Ga0501075_0014503 3300049591 Bacteria 5648
792 Ga0501075_0242739 3300049591 Bacteria 1373
793 Ga0501075_0574857 3300049591 Bacteria 860
794 Ga0501075_0660678 3300049591 Bacteria 797
795 Ga0501075_1016725 3300049591 Bacteria 630
796 Ga0501076_0056232 3300049592 Bacteria 3122
797 Ga0501079_0116617 3300049741 Bacteria 2076
798 Ga0501079_0128982 3300049741 Bacteria 1968
799 Ga0501079_0651691 3300049741 Bacteria 829
800 Ga0501079_0917777 3300049741 Bacteria 690
801 Ga0501079_0941400 3300049741 Bacteria 680
802 Ga0501079_1472496 3300049741 Bacteria 536
803 Ga0501080_0078366 3300049742 Bacteria 3073
804 Ga0501080_0168721 3300049742 Bacteria 2019
805 Ga0501081_0004930 3300049743 Bacteria 8582
806 Ga0501035_0004214 3300049822 Bacteria 13666
807 Ga0501035_0016512 3300049822 Bacteria 6807
808 Ga0501035_0022802 3300049822 Bacteria 5750
809 Ga0501035_0032464 3300049822 Bacteria 4749
810 Ga0501035_0066675 3300049822 Bacteria 3194
811 Ga0501035_0134017 3300049822 Bacteria 2158
812 Ga0501044_0002891 3300049823 Bacteria 19562
813 Ga0501044_0014143 3300049823 Bacteria 8616
814 Ga0501045_0036012 3300049824 Bacteria 3594
815 Ga0501045_0044865 3300049824 Bacteria 3220
816 Ga0501045_0056807 3300049824 Bacteria 2863
817 Ga0501045_0135195 3300049824 Bacteria 1833
818 Ga0501045_0471056 3300049824 Bacteria 933
819 Ga0501045_0795859 3300049824 Bacteria 696
820 nmdc:mga03683_582541_c1 3300050489 Bacteria 547
821 nmdc:mga06z11_463191_c1 3300050494 Bacteria 766
822 nmdc:mga04h51_126597_c1 3300050495 Bacteria 956
823 nmdc:mga05p37_52206_c1 3300050507 Bacteria 4083
824 nmdc:mga05p37_528457_c1 3300050507 Bacteria 1348
825 nmdc:mga05p37_903526_c1 3300050507 Bacteria 952
826 nmdc:mga09592_378_c1 3300050508 Bacteria 32615
827 nmdc:mga09592_40034_c1 3300050508 Bacteria 3937
828 nmdc:mga09592_508379_c1 3300050508 Bacteria 1037
829 nmdc:mga09592_714634_c1 3300050508 Bacteria 852
830 nmdc:mga0qj67_126_c1 3300050509 Bacteria 50369
831 nmdc:mga0qj67_142815_c1 3300050509 Bacteria 1941
832 nmdc:mga0qj67_219647_c1 3300050509 Bacteria 1543
833 nmdc:mga0qj67_456379_c1 3300050509 Bacteria 1029
834 nmdc:mga06r32_182_c1 3300050510 Bacteria 49502
835 nmdc:mga06r32_8009_c1 3300050510 Bacteria 9501
836 nmdc:mga06r32_929958_c1 3300050510 Bacteria 825
837 nmdc:mga08y16_1114338_c1 3300050511 Bacteria 764
838 nmdc:mga08y16_123231_c1 3300050511 Unclassified 2697
839 nmdc:mga08y16_186300_c1 3300050511 Bacteria 2154
840 nmdc:mga08y16_235306_c1 3300050511 Bacteria 1894
841 nmdc:mga08y16_326206_c1 3300050511 Bacteria 1580
842 nmdc:mga08y16_97144_c1 3300050511 Bacteria 3067
843 nmdc:mga0n895_131099_c1 3300050512 Bacteria 2532
844 nmdc:mga0n895_1535195_c1 3300050512 Bacteria 632
845 nmdc:mga0n895_228791_c1 3300050512 Bacteria 1888
846 nmdc:mga0n895_378445_c1 3300050512 Bacteria 1433
847 nmdc:mga0n895_986799_c1 3300050512 Bacteria 824
848 nmdc:mga0n895_992800_c1 3300050512 Bacteria 821
849 nmdc:mga0rr50_337482_c1 3300050513 Bacteria 1266
850 nmdc:mga0rr50_930899_c1 3300050513 Bacteria 741
851 nmdc:mga0a205_1473668_c1 3300050515 Bacteria 529
852 nmdc:mga0a205_154952_c1 3300050515 Bacteria 2190
853 nmdc:mga0a205_22886_c1 3300050515 Bacteria 5925
854 nmdc:mga0a205_598576_c1 3300050515 Bacteria 956
855 Ga0495601_0037186 3300053077 Bacteria 3043
856 Ga0500635_0028151 3300053080 Bacteria 1792
857 Ga0495595_0032151 3300053084 Bacteria 2362
858 Ga0495619_0002780 3300053085 Bacteria 11418
859 Ga0500651_0005924 3300053093 Bacteria 7012
860 Ga0500560_003627 3300053107 Bacteria 3153
861 Ga0500572_078659 3300053111 Bacteria 1030
862 Ga0500559_0014784 3300053136 Bacteria 3297
863 Ga0500564_287622 3300053138 Bacteria 636
864 Ga0500590_000842 3300053148 Bacteria 11534
865 Ga0500616_0000183 3300053153 Bacteria 103074
866 Ga0500616_0002208 3300053153 Bacteria 16677
867 Ga0500616_0149350 3300053153 Bacteria 1083
868 Ga0500620_000536 3300053155 Bacteria 6611
869 Ga0500645_015972 3300053730 Bacteria 2372
870 Ga0501084_0303688 3300054114 Bacteria 1348
871 Ga0501084_0642123 3300054114 Bacteria 896
872 Ga0590075_011698 3300059424 Bacteria 2125
873 Ga0590077_104633 3300059426 Bacteria 663
874 Ga0501082_0110640 3300060353 Bacteria 2378
875 Ga0466962_0085882 3300061719 Bacteria 1506
876 Ga0466962_0164101 3300061719 Bacteria 1080
877 Ga0466962_0624659 3300061719 Bacteria 550
878 Ga0530510_0008102 3300061734 Bacteria 7325
879 2831937025 2831935698 Bacteria 5963223
880 2855675010 2855670206 Bacteria 7120389
881 2855679973 2855676851 Bacteria 7063653
882 2857289992 2857288857 Bacteria 7189066
883 2858849483 2858848962 Bacteria 6963058
884 2858882372 2858882152 Bacteria 7230291
885 2858892786 2858888857 Bacteria 7060307
886 2867507342 2867507094 Bacteria 6506033
887 2869050593 2869048445 Bacteria 6875584
888 2869066345 2869061728 Bacteria 7112407
889 2869074240 2869068681 Bacteria 7205615
890 2880490990 2880489317 Bacteria 7096270
891 2880501525 2880495981 Bacteria 7340502
892 2887480962 2887478801 Bacteria 8972725
893 2929223648 2929219909 Bacteria 6984360
894 2929230004 2929226422 Bacteria 7248583
895 2954009797 2954002825 Bacteria 9173742
896 2996225229 2996221748 Bacteria 6799777
897 3006427501 3006425503 Bacteria 6491253
898 8003836806 8003830390 Bacteria 6541657
899 8045834107 8045830549 Bacteria 4444727
900 8054709881 8054704163 Bacteria 7247792
901 8056061431 8056060235 Bacteria 7259403
902 Ga0501045_0131245
903 SwRhRL3b_contig_3460783
904 JGI24743J22301_10107733
905 JGI24035J26624_1009098
906 JGI24034J26672_10053415
907 JGI24751J29686_10060933
908 JGI25405J52794_10061110
909 JGI25405J52794_10100024
910 Ga0065704_10343157
911 Ga0065712_10136214
912 Ga0065712_10245180
913 Ga0065715_10213745
914 Ga0065707_10097402
915 Ga0065707_10154738
916 Ga0070658_10367241
917 Ga0070658_10373820
918 Ga0070658_10586158
919 Ga0070658_10845987
920 Ga0070676_10150239
921 Ga0070676_10217824
922 Ga0070683_100009018
923 Ga0070683_100340788
924 Ga0070683_100913565
925 Ga0070690_100017828
926 Ga0070690_100191427
927 Ga0070670_100029747
928 Ga0070670_100847248
929 Ga0070677_10004811
930 Ga0070677_10045918
931 Ga0070677_10069375
932 Ga0070677_10158051
933 Ga0068869_100002221
934 Ga0068869_100071156
935 Ga0068869_100110311
936 Ga0068869_101018754
937 Ga0070666_10032828
938 Ga0070666_10418801
939 Ga0070666_10521855
940 Ga0070682_100433314
941 Ga0070682_100776759
942 Ga0068868_100038641
943 Ga0068868_100278107
944 Ga0068868_100287642
945 Ga0068868_100549378
946 Ga0068868_100632765
947 Ga0068868_100673874
948 Ga0068868_101189418
949 Ga0068868_101992326
950 Ga0070660_100038449
951 Ga0070660_100273953
952 Ga0070660_100289994
953 Ga0070660_100319429
954 Ga0070660_100523295
955 Ga0070660_100540999
956 Ga0070689_100659626
957 Ga0070691_10479183
958 Ga0070691_10534184
959 Ga0070687_100472298
960 Ga0070661_100084028
961 Ga0070661_101117545
962 Ga0070692_10041858
963 Ga0070692_10122283
964 Ga0070692_10145507
965 Ga0070692_10177713
966 Ga0070692_10224424
967 Ga0070668_100279897
968 Ga0070668_100616145
969 Ga0070669_100013184
970 Ga0070669_100515594
971 Ga0070675_100006132
972 Ga0070675_100033370
973 Ga0070675_100420627
974 Ga0070675_100537655
975 Ga0070675_100721451
976 Ga0070671_100097228
977 Ga0070671_100202232
978 Ga0070671_100352062
979 Ga0070671_100699861
980 Ga0070671_100746074
981 Ga0070674_100000544
982 Ga0070674_100167708
983 Ga0070673_100145181
984 Ga0070673_100158082
985 Ga0070673_102144682
986 Ga0070688_100199593
987 Ga0070659_100000749
988 Ga0070659_100129103
989 Ga0070659_100461731
990 Ga0070659_100579527
991 Ga0070667_100025125
992 Ga0070667_100106006
993 Ga0070714_100095290
994 Ga0070701_10077193
995 Ga0070701_10207908
996 Ga0070701_10501528
997 Ga0070705_100596208
998 Ga0070700_100030218
999 Ga0070700_100115966
1000 Ga0070700_100907334
1001 Ga0070700_101024352
1002 Ga0070694_100023115
1003 Ga0070694_100161379
1004 Ga0070663_100411390
1005 Ga0070663_100448640
1006 Ga0070663_100499031
1007 Ga0070663_100922495
1008 Ga0070678_100042329
1009 Ga0070678_100366712
1010 Ga0070678_100691760
1011 Ga0070678_100746672
1012 Ga0070662_100563455
1013 Ga0070681_10008128
1014 Ga0068867_100090993
1015 Ga0068867_100485513
1016 Ga0068867_100659766
1017 Ga0068867_101631604
1018 Ga0070685_10057253
1019 Ga0070685_10393956
1020 Ga0070685_10800463
1021 Ga0070707_101177509
1022 Ga0070698_100009538
1023 Ga0070698_100062331
1024 Ga0070699_100007694
1025 Ga0070699_100026880
1026 Ga0070699_100361136
1027 Ga0070699_101013187
1028 Ga0070679_100095891
1029 Ga0070679_100235223
1030 Ga0070679_101307657
1031 Ga0070684_100245691
1032 Ga0068853_100001645
1033 Ga0068853_100104448
1034 Ga0068853_100442630
1035 Ga0070672_100017354
1036 Ga0070672_100055953
1037 Ga0070672_100082058
1038 Ga0070672_100195555
1039 Ga0070686_100077221
1040 Ga0070686_100120558
1041 Ga0070686_100140415
1042 Ga0070695_100060607
1043 Ga0070695_100256262
1044 Ga0070696_100004294
1045 Ga0070696_100018940
1046 Ga0070696_100039359
1047 Ga0070696_100556411
1048 Ga0070696_100792142
1049 Ga0070696_101471694
1050 Ga0070693_100898021
1051 Ga0070693_101204669
1052 Ga0070665_100109938
1053 Ga0070665_101093863
1054 Ga0070704_100132523
1055 Ga0068855_100003924
1056 Ga0068855_100009335
1057 Ga0068855_100360694
1058 Ga0068855_100557175
1059 Ga0068855_100880545
1060 Ga0070664_100158710
1061 Ga0070664_101134681
1062 Ga0070664_101296912
1063 Ga0068857_100001028
1064 Ga0068857_100042691
1065 Ga0068857_100087638
1066 Ga0068857_100643105
1067 Ga0068857_101119469
1068 Ga0068857_101780350
1069 Ga0068854_100138311
1070 Ga0068854_100209574
1071 Ga0068854_100379410
1072 Ga0068854_101144725
1073 Ga0068856_100007464
1074 Ga0068856_100253488
1075 Ga0068856_100326297
1076 Ga0068856_100398562
1077 Ga0068856_100460188
1078 Ga0068856_100982191
1079 Ga0068856_101008091
1080 Ga0070702_100280465
1081 Ga0070702_100515960
1082 Ga0068852_100000501
1083 Ga0068852_100003952
1084 Ga0068852_100327024
1085 Ga0068852_100758852
1086 Ga0068852_100934819
1087 Ga0068852_101025884
1088 Ga0068859_100059842
1089 Ga0068859_100081703
1090 Ga0068859_100094875
1091 Ga0068859_100112913
1092 Ga0068859_100171965
1093 Ga0068864_100061604
1094 Ga0068864_100233712
1095 Ga0068864_100299165
1096 Ga0068864_100762940
1097 Ga0068864_100797927
1098 Ga0068864_101451172
1099 Ga0068861_100205632
1100 Ga0068861_100842939
1101 Ga0068851_10000008
1102 Ga0068870_10091451
1103 Ga0068863_100149326
1104 Ga0068863_101914873
1105 Ga0068858_100000096
1106 Ga0068860_100039330
1107 Ga0068860_101012029
1108 Ga0068860_101133563
1109 Ga0068862_100024900
1110 Ga0068862_100168038
1111 Ga0068862_100277670
1112 Ga0081455_10006304
1113 Ga0081455_10013986
1114 Ga0081455_10040847
1115 Ga0081455_10096008
1116 Ga0081455_10105002
1117 Ga0081455_10809970
1118 Ga0081538_10000373
1119 Ga0081538_10017097
1120 Ga0081538_10019586
1121 Ga0081538_10067575
1122 Ga0081538_10235638
1123 Ga0081540_1209222
1124 Ga0070717_10243916
1125 Ga0075368_10361241
1126 Ga0075432_10007952
1127 Ga0075367_10246392
1128 Ga0097621_100561334
1129 Ga0097621_100846297
1130 Ga0075370_10151045
1131 Ga0075428_100000241
1132 Ga0075428_100054973
1133 Ga0075428_100060000
1134 Ga0075428_100339706
1135 Ga0075428_101188755
1136 Ga0075430_100000048
1137 Ga0075430_100219158
1138 Ga0075430_100484127
1139 Ga0075431_100000208
1140 Ga0075431_100038131
1141 Ga0075431_100831966
1142 Ga0075433_10000736
1143 Ga0075433_10077745
1144 Ga0075433_10474300
1145 Ga0075434_100087794
1146 Ga0075434_100134988
1147 Ga0075434_100348743
1148 Ga0075434_100673161
1149 Ga0075434_100740557
1150 Ga0075429_100000967
1151 Ga0075429_100105292
1152 Ga0075429_100114285
1153 Ga0068865_100093875
1154 Ga0068865_100638252
1155 Ga0075436_100800275
1156 Ga0097620_100059840
1157 Ga0097620_100081701
1158 Ga0097620_100094876
1159 Ga0097620_100112911
1160 Ga0097620_100171978
1161 Ga0105240_10021974
1162 Ga0105240_10027961
1163 Ga0105240_10779281
1164 Ga0111539_10041498
1165 Ga0111539_10052732
1166 Ga0111539_10349205
1167 Ga0111539_10723624
1168 Ga0111539_10857997
1169 Ga0111539_10869734
1170 Ga0111539_10964560
1171 Ga0105245_10038504
1172 Ga0105245_10281609
1173 Ga0105245_10346400
1174 Ga0105245_10394612
1175 Ga0105245_10513343
1176 Ga0105245_10544958
1177 Ga0105245_10603910
1178 Ga0105245_11868469
1179 Ga0105245_12515130
1180 Ga0105247_10548317
1181 Ga0114129_10018879
1182 Ga0114129_10065623
1183 Ga0114129_10100818
1184 Ga0114129_10315805
1185 Ga0114129_10382098
1186 Ga0114129_11396036
1187 Ga0105243_10305119
1188 Ga0105243_10925634
1189 Ga0105243_11313961
1190 Ga0105241_10225464
1191 Ga0105248_10000713
1192 Ga0105248_10077338
1193 Ga0105248_10662210
1194 Ga0105237_10000688
1195 Ga0105237_10004883
1196 Ga0105237_11214233
1197 Ga0105237_11510539
1198 Ga0105238_10006959
1199 Ga0105238_10161194
1200 Ga0105238_10465246
1201 Ga0105238_11933722
1202 Ga0105249_10001062
1203 Ga0105249_10261594
1204 Ga0105249_10442756
1205 Ga0105249_10543417
1206 Ga0105249_11537618
1207 Ga0105239_10147347
1208 Ga0105239_10155042
1209 Ga0105239_10464557
1210 Ga0105239_10802157
1211 Ga0105239_11724564
1212 Ga0105239_11892425
1213 Ga0105246_10074532
1214 Ga0105246_10220356
1215 Ga0105246_11208256
1216 Ga0157344_1023062
1217 Ga0157337_1004159
1218 Ga0157329_1004243
1219 Ga0157319_1008431
1220 Ga0157338_1022790
1221 Ga0157371_10075353
1222 Ga0157371_10173744
1223 Ga0157371_10509930
1224 Ga0157370_10043788
1225 Ga0157370_10397559
1226 Ga0157370_10648815
1227 Ga0157369_10146550
1228 Ga0157369_10383825
1229 Ga0157374_10174753
1230 Ga0157374_10351983
1231 Ga0157374_11291659
1232 Ga0157374_12725080
1233 Ga0157378_10235559
1234 Ga0163162_10001014
1235 Ga0163162_10247613
1236 Ga0163162_10753827
1237 Ga0163162_10909142
1238 Ga0163162_12669277
1239 Ga0157372_10000303
1240 Ga0157372_10286550
1241 Ga0157372_10293629
1242 Ga0157372_11785184
1243 Ga0157375_10017739
1244 Ga0157375_10073830
1245 Ga0157375_11431133
1246 Ga0157375_11672543
1247 Ga0163163_10113196
1248 Ga0163163_10315846
1249 Ga0157380_10008742
1250 Ga0157380_10027580
1251 Ga0157380_10173203
1252 Ga0157380_10503459
1253 Ga0157380_11438659
1254 Ga0182008_10306201
1255 Ga0157377_10317183
1256 Ga0157377_10334535
1257 Ga0157377_10506590
1258 Ga0157379_10172327
1259 Ga0157379_10856821
1260 Ga0157376_10094004
1261 Ga0157376_11067894
1262 Ga0157376_11515382
1263 Ga0163161_10027815
1264 Ga0163161_10245228
1265 Ga0197907_10030690
1266 Ga0206354_10719424
1267 Ga0224712_10064155
1268 Ga0209148_1001379
1269 Ga0207426_1092055
1270 Ga0207697_10000517
1271 Ga0207697_10062739
1272 Ga0207656_10000005
1273 Ga0207682_10007235
1274 Ga0207682_10011183
1275 Ga0207682_10011919
1276 Ga0207642_10121635
1277 Ga0207710_10131947
1278 Ga0207688_10019212
1279 Ga0207688_10027679
1280 Ga0207688_10137359
1281 Ga0207688_10684024
1282 Ga0207680_10060351
1283 Ga0207680_10134592
1284 Ga0207680_10449127
1285 Ga0207699_11218863
1286 Ga0207645_10000648
1287 Ga0207645_10080681
1288 Ga0207645_10180081
1289 Ga0207643_10000535
1290 Ga0207643_10030163
1291 Ga0207643_10034341
1292 Ga0207643_10339261
1293 Ga0207705_10019591
1294 Ga0207705_10036147
1295 Ga0207705_10125425
1296 Ga0207705_10355435
1297 Ga0207705_10591444
1298 Ga0207705_11092228
1299 Ga0207654_10000001
1300 Ga0207707_10104231
1301 Ga0207695_10005054
1302 Ga0207695_10075339
1303 Ga0207695_10591249
1304 Ga0207671_10000016
1305 Ga0207671_10026676
1306 Ga0207660_10151925
1307 Ga0207662_10008294
1308 Ga0207662_10178674
1309 Ga0207657_10017089
1310 Ga0207657_10045205
1311 Ga0207657_10309354
1312 Ga0207657_10828047
1313 Ga0207649_10079211
1314 Ga0207649_10673257
1315 Ga0207652_10067301
1316 Ga0207646_10290620
1317 Ga0207681_10019493
1318 Ga0207681_10199790
1319 Ga0207694_10000196
1320 Ga0207650_10518227
1321 Ga0207659_10004355
1322 Ga0207659_10136974
1323 Ga0207659_10619886
1324 Ga0207659_10716075
1325 Ga0207659_11052460
1326 Ga0207687_10016104
1327 Ga0207687_10169791
1328 Ga0207687_10262691
1329 Ga0207687_10471563
1330 Ga0207687_11179682
1331 Ga0207664_10412600
1332 Ga0207664_10417670
1333 Ga0207644_10218069
1334 Ga0207644_10260810
1335 Ga0207644_10282557
1336 Ga0207690_10135811
1337 Ga0207706_10043147
1338 Ga0207706_10140431
1339 Ga0207706_10307749
1340 Ga0207670_10359036
1341 Ga0207669_10032629
1342 Ga0207704_10469516
1343 Ga0207665_10133132
1344 Ga0207665_10272599
1345 Ga0207691_10005699
1346 Ga0207691_10008272
1347 Ga0207691_10043448
1348 Ga0207691_11065462
1349 Ga0207711_10004705
1350 Ga0207711_10044903
1351 Ga0207689_10009006
1352 Ga0207689_10069451
1353 Ga0207689_10090331
1354 Ga0207689_10106985
1355 Ga0207679_12000900
1356 Ga0207667_10000437
1357 Ga0207667_10001482
1358 Ga0207667_10008673
1359 Ga0207667_10072070
1360 Ga0207667_10253870
1361 Ga0207667_10346354
1362 Ga0207667_10617899
1363 Ga0207667_10619589
1364 Ga0207651_10282454
1365 Ga0207651_11430641
1366 Ga0207712_10004201
1367 Ga0207712_10253215
1368 Ga0207712_10357744
1369 Ga0207712_11788531
1370 Ga0207668_10060983
1371 Ga0207668_11665739
1372 Ga0207640_10178867
1373 Ga0207640_10207338
1374 Ga0207640_10910209
1375 Ga0207640_10925196
1376 Ga0207658_10026447
1377 Ga0207658_10106792
1378 Ga0207677_10142275
1379 Ga0207677_10284429
1380 Ga0207677_10369522
1381 Ga0207677_10422969
1382 Ga0207677_10487532
1383 Ga0207677_10656431
1384 Ga0207677_10756108
1385 Ga0207677_11167194
1386 Ga0207677_11496225
1387 Ga0207703_10001625
1388 Ga0207703_10423802
1389 Ga0207703_10910396
1390 Ga0207639_10024131
1391 Ga0207639_10040933
1392 Ga0207639_11653178
1393 Ga0207678_10170373
1394 Ga0207678_10441042
1395 Ga0207678_10578198
1396 Ga0207708_10030195
1397 Ga0207708_10215985
1398 Ga0207708_10547439
1399 Ga0207702_10012173
1400 Ga0207702_10129325
1401 Ga0207702_10434827
1402 Ga0207702_10740140
1403 Ga0207702_11323409
1404 Ga0207702_11394922
1405 Ga0207702_12194378
1406 Ga0207641_10007623
1407 Ga0207641_10203174
1408 Ga0207641_10379506
1409 Ga0207648_10139502
1410 Ga0207648_10169731
1411 Ga0207648_11020160
1412 Ga0207676_10012542
1413 Ga0207676_10082449
1414 Ga0207676_10090865
1415 Ga0207676_11073057
1416 Ga0207674_10000405
1417 Ga0207674_10052476
1418 Ga0207674_10059478
1419 Ga0207674_10229526
1420 Ga0207674_11500722
1421 Ga0207674_12141616
1422 Ga0207675_100004393
1423 Ga0207675_100007784
1424 Ga0207675_100071349
1425 Ga0207683_10010725
1426 Ga0207683_10026823
1427 Ga0207683_10199495
1428 Ga0207683_10507555
1429 Ga0207698_10000078
1430 Ga0207698_10002196
1431 Ga0207698_10088340
1432 Ga0207698_10284769
1433 Ga0209971_1120311
1434 Ga0209813_10107658
1435 Ga0209974_10164236
1436 Ga0207428_10024405
1437 Ga0207428_10233919
1438 Ga0207428_10807162
1439 Ga0268266_10133401
1440 Ga0268266_10238596
1441 Ga0268265_10024124
1442 Ga0268265_10032259
1443 Ga0268265_10140220
1444 Ga0268265_12285336
1445 Ga0268264_10130699
1446 Ga0268264_10624537
1447 Ga0268264_11437897
1448 Ga0307408_100439923
1449 Ga0307408_100839797
1450 Ga0307408_101157656
1451 Ga0316575_10001600
1452 Ga0316579_10011276
1453 Ga0316576_10050031
1454 Ga0316576_10171686
1455 Ga0316578_10004010
1456 Ga0316578_10208559
1457 Ga0307405_10297494
1458 Ga0307405_11226242
1459 Ga0316577_10021111
1460 Ga0316577_10235428
1461 Ga0307413_10029884
1462 Ga0307413_10113399
1463 Ga0307413_10326403
1464 Ga0307410_11131806
1465 Ga0307406_10058838
1466 Ga0307406_10395189
1467 Ga0307406_10722552
1468 Ga0307406_10728478
1469 Ga0307406_11080728
1470 Ga0307406_11540519
1471 Ga0307412_10365308
1472 Ga0307409_100727410
1473 Ga0307416_100177135
1474 Ga0307416_100531847
1475 Ga0307416_103788366
1476 Ga0307414_10122243
1477 Ga0307414_10511001
1478 Ga0307414_11144964
1479 Ga0307411_10926525
1480 Ga0307411_11015558
1481 Ga0307411_11158205
1482 Ga0307415_100429465
1483 Ga0307415_100498756
1484 Ga0316583_10114392
1485 Ga0316593_10007319
1486 Ga0316586_1014057
1487 Ga0316587_1062345
1488 Ga0316596_1076268
1489 Ga0373940_0251984
1490 Ga0373952_0169780
1491 Ga0373932_0011563
1492 Ga0373939_0159872
1493 Ga0373953_0005571
1494 Ga0373953_0407045
1495 Ga0373954_0010182
1496 Ga0373956_0011874
1497 Ga0373957_0176131
1498 Ga0373957_0417527
1499 Ga0373955_0018329
1500 Ga0373955_0078130
1501 Ga0373942_0194021
1502 Ga0373962_0016027
1503 Ga0373962_0204756
1504 Ga0316574_0007133
1505 Ga0373924_0014182
1506 Ga0373931_0258353
1507 Ga0373933_0003076
1508 Ga0373937_0011980
1509 Ga0316582_0016585
1510 Ga0316582_0195668
1511 Ga0316582_0353159
1512 Ga0316584_0002064
1513 Ga0316584_0057306
1514 Ga0395900_0356212
1515 Ga0395900_1217516
1516 Ga0395900_1656355
1517 Ga0395898_0163578
1518 Ga0395901_0264956
1519 Ga0436362_1073426
1520 Ga0439465_0024249
1521 Ga0439465_0197368
1522 Ga0451795_0846601
1523 Ga0451807_2331222
1524 Ga0451807_2660586
1525 Ga0439448_0229132
1526 Ga0439448_0287680
1527 Ga0439450_012941
1528 Ga0450923_044577
1529 Ga0439435_0057780
1530 Ga0439459_0004614
1531 Ga0439464_0054081
1532 Ga0439440_0009970
1533 Ga0466969_0081090
1534 Ga0466965_0227077
1535 Ga0466966_0138851
1536 Ga0466961_0519695
1537 Ga0466961_0635230
1538 Ga0466963_0591109
1539 Ga0466963_1109621
1540 Ga0466971_0587126
1541 Ga0466970_0396247
1542 Ga0466970_0592951
1543 Ga0466957_0082035
1544 Ga0466957_0313114
1545 Ga0466960_0007662
1546 Ga0466958_0166076
1547 Ga0466958_0504308
1548 Ga0466967_0000739
1549 Ga0466967_0454479
1550 Ga0466967_0645276
1551 Ga0466967_1230676
1552 Ga0466967_2194709
1553 Ga0466967_2563465
1554 Ga0495590_0001438
1555 Ga0495641_0095566
1556 Ga0495584_0214622
1557 Ga0495606_0002983
1558 Ga0495642_0034777
1559 Ga0495640_0086467
1560 Ga0495640_0104777
1561 Ga0495587_0743784
1562 Ga0495598_0040556
1563 Ga0495667_0102790
1564 Ga0495656_0406633
1565 Ga0495656_0581439
1566 Ga0495668_0002487
1567 Ga0495625_0014245
1568 Ga0495625_0324273
1569 Ga0495635_0081532
1570 Ga0495659_0072648
1571 Ga0495659_0132995
1572 Ga0495647_0045876
1573 Ga0495669_0221135
1574 Ga0495581_0321925
1575 Ga0495636_0471550
1576 Ga0495636_0633288
1577 Ga0495636_0697513
1578 Ga0495676_0132259
1579 Ga0495680_0233594
1580 Ga0495683_0101187
1581 Ga0495686_0261887
1582 Ga0495602_0191483
1583 Ga0495614_0539767
1584 Ga0495626_0001210
1585 Ga0496102_0115362
1586 Ga0496102_0204800
1587 Ga0496104_0000086
1588 Ga0496104_0027869
1589 Ga0496104_0251154
1590 Ga0496104_1007604
1591 Ga0496104_1425882
1592 Ga0496105_0000126
1593 Ga0496105_0116726
1594 Ga0496105_0187311
1595 Ga0496106_1250834
1596 Ga0496107_0762153
1597 Ga0496108_0093186
1598 Ga0496108_0255872
1599 Ga0496109_0002834
1600 Ga0496109_0682699
1601 Ga0496109_0822649
1602 Ga0496109_0853634
1603 Ga0496110_0018428
1604 Ga0496110_0160757
1605 Ga0496110_0399204
1606 Ga0496111_0262548
1607 Ga0496111_0600121
1608 Ga0496112_0056822
1609 Ga0496112_0078054
1610 Ga0496113_0009600
1611 Ga0496113_0110508
1612 Ga0496114_0126356
1613 Ga0496114_0353088
1614 Ga0496114_1237384
1615 Ga0496115_0095992
1616 Ga0496115_0847580
1617 Ga0496117_0277177
1618 Ga0496118_0046316
1619 Ga0496118_0502711
1620 Ga0496119_0007381
1621 Ga0496119_0024772
1622 Ga0496119_0060350
1623 Ga0496120_0000929
1624 Ga0496120_0002952
1625 Ga0496120_0018072
1626 Ga0496125_0120419
1627 Ga0496126_0372998
1628 Ga0496126_0678838
1629 Ga0501031_0252010
1630 Ga0501032_0200840
1631 Ga0501032_0707410
1632 Ga0501033_0021283
1633 Ga0501033_0108029
1634 Ga0501033_0117903
1635 Ga0501033_0319448
1636 Ga0501033_0367901
1637 Ga0501033_0660233
1638 Ga0501034_0006121
1639 Ga0501034_0085168
1640 Ga0501034_0271558
1641 Ga0501036_0012840
1642 Ga0501036_0148278
1643 Ga0501036_0154879
1644 Ga0501036_0859529
1645 Ga0501036_0893982
1646 Ga0501037_0028904
1647 Ga0501037_0064654
1648 Ga0501038_0054733
1649 Ga0501038_0064680
1650 Ga0501038_0168500
1651 Ga0501038_0358256
1652 Ga0501038_0845179
1653 Ga0501039_0037099
1654 Ga0501039_1105477
1655 Ga0501040_0053540
1656 Ga0501040_0187258
1657 Ga0501040_0386731
1658 Ga0501040_1286106
1659 Ga0501042_0007990
1660 Ga0501042_0109698
1661 Ga0501042_0198013
1662 Ga0501043_0093461
1663 Ga0501043_0098355
1664 Ga0501043_0243849
1665 Ga0501043_0753321
1666 Ga0501046_0022138
1667 Ga0501046_0373368
1668 Ga0501046_0529657
1669 Ga0501046_0875744
1670 Ga0501047_0074959
1671 Ga0501047_0080728
1672 Ga0501047_0111398
1673 Ga0501047_0121925
1674 Ga0501048_0094392
1675 Ga0501048_0495978
1676 Ga0501048_0829302
1677 Ga0501068_0607586
1678 Ga0501068_0611256
1679 Ga0501069_0302026
1680 Ga0501070_0131590
1681 Ga0501070_0264456
1682 Ga0501070_0474318
1683 Ga0501070_0823189
1684 Ga0501070_0827838
1685 Ga0501072_0024908
1686 Ga0501072_0288915
1687 Ga0501072_0424607
1688 Ga0501072_1179167
1689 Ga0501073_0095252
1690 Ga0501074_0031707
1691 Ga0501074_0147029
1692 Ga0501075_0014503
1693 Ga0501075_0242739
1694 Ga0501075_0574857
1695 Ga0501075_0660678
1696 Ga0501075_1016725
1697 Ga0501076_0056232
1698 Ga0501079_0116617
1699 Ga0501079_0128982
1700 Ga0501079_0651691
1701 Ga0501079_0917777
1702 Ga0501079_0941400
1703 Ga0501079_1472496
1704 Ga0501080_0078366
1705 Ga0501080_0168721
1706 Ga0501081_0004930
1707 Ga0501035_0004214
1708 Ga0501035_0016512
1709 Ga0501035_0022802
1710 Ga0501035_0032464
1711 Ga0501035_0066675
1712 Ga0501035_0134017
1713 Ga0501044_0002891
1714 Ga0501044_0014143
1715 Ga0501045_0036012
1716 Ga0501045_0044865
1717 Ga0501045_0056807
1718 Ga0501045_0135195
1719 Ga0501045_0471056
1720 Ga0501045_0795859
1721 nmdc:mga03683_582541_c1
1722 nmdc:mga06z11_463191_c1
1723 nmdc:mga04h51_126597_c1
1724 nmdc:mga05p37_52206_c1
1725 nmdc:mga05p37_528457_c1
1726 nmdc:mga05p37_903526_c1
1727 nmdc:mga09592_378_c1
1728 nmdc:mga09592_40034_c1
1729 nmdc:mga09592_508379_c1
1730 nmdc:mga09592_714634_c1
1731 nmdc:mga0qj67_126_c1
1732 nmdc:mga0qj67_142815_c1
1733 nmdc:mga0qj67_219647_c1
1734 nmdc:mga0qj67_456379_c1
1735 nmdc:mga06r32_182_c1
1736 nmdc:mga06r32_8009_c1
1737 nmdc:mga06r32_929958_c1
1738 nmdc:mga08y16_1114338_c1
1739 nmdc:mga08y16_123231_c1
1740 nmdc:mga08y16_186300_c1
1741 nmdc:mga08y16_235306_c1
1742 nmdc:mga08y16_326206_c1
1743 nmdc:mga08y16_97144_c1
1744 nmdc:mga0n895_131099_c1
1745 nmdc:mga0n895_1535195_c1
1746 nmdc:mga0n895_228791_c1
1747 nmdc:mga0n895_378445_c1
1748 nmdc:mga0n895_986799_c1
1749 nmdc:mga0n895_992800_c1
1750 nmdc:mga0rr50_337482_c1
1751 nmdc:mga0rr50_930899_c1
1752 nmdc:mga0a205_1473668_c1
1753 nmdc:mga0a205_154952_c1
1754 nmdc:mga0a205_22886_c1
1755 nmdc:mga0a205_598576_c1
1756 Ga0495601_0037186
1757 Ga0500635_0028151
1758 Ga0495595_0032151
1759 Ga0495619_0002780
1760 Ga0500651_0005924
1761 Ga0500560_003627
1762 Ga0500572_078659
1763 Ga0500559_0014784
1764 Ga0500564_287622
1765 Ga0500590_000842
1766 Ga0500616_0000183
1767 Ga0500616_0002208
1768 Ga0500616_0149350
1769 Ga0500620_000536
1770 Ga0500645_015972
1771 Ga0501084_0303688
1772 Ga0501084_0642123
1773 Ga0590075_011698
1774 Ga0590077_104633
1775 Ga0501082_0110640
1776 Ga0466962_0085882
1777 Ga0466962_0164101
1778 Ga0466962_0624659
1779 Ga0530510_0008102
1780 2831937025
1781 2855675010
1782 2855679973
1783 2857289992
1784 2858849483
1785 2858882372
1786 2858892786
1787 2867507342
1788 2869050593
1789 2869066345
1790 2869074240
1791 2880490990
1792 2880501525
1793 2887480962
1794 2929223648
1795 2929230004
1796 2954009797
1797 2996225229
1798 3006427501
1799 8003836806
1800 8045834107
1801 8054709881
1802 8056061431

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01242

PTPS

6-pyruvoyl tetrahydropterin synthase

3

134

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
3d7j-assembly1.cif.gz_D sco6650, a 6-pyruvoyltetrahydropterin synthase homolog from streptomyces coelicolor 0.9887 2 131
3d7j-assembly1.cif.gz_D sco6650, a 6-pyruvoyltetrahydropterin synthase homolog from streptomyces coelicolor 0.9524 2 131
3qn9-assembly1.cif.gz_A crystal structure of a 6-pyruvoyltetrahydropterin synthase homologue from esherichia coli 0.8334 2 128
2dtt-assembly2.cif.gz_E crystal structure of 6-pyruvoyl tetrahydrobiopterin synthase from pyrococcus horikoshii ot3 complexed with (1'r,2's)-biopterin 0.8193 2 130
3m0n-assembly1.cif.gz_A plasmodium vivax 6-pyruvoyltetrahydropterin synthase (ptps), e37a catalytic residue mutant 0.8142 2 131
ID Description Score Start End Superfamily
3d7jC00 Alpha Beta;2-Layer Sandwich;Tetrahydropterin Synthase; Chain A;6-pyruvoyl tetrahydropterin synthase/QueD 0.9912 2 131 3.30.479.10
3d7jC00 Alpha Beta;2-Layer Sandwich;Tetrahydropterin Synthase; Chain A;6-pyruvoyl tetrahydropterin synthase/QueD 0.9545 2 131 3.30.479.10
4ntmA00 Alpha Beta;2-Layer Sandwich;Tetrahydropterin Synthase; Chain A;6-pyruvoyl tetrahydropterin synthase/QueD 0.8185 1 130 3.30.479.10
4ntmA00 Alpha Beta;2-Layer Sandwich;Tetrahydropterin Synthase; Chain A;6-pyruvoyl tetrahydropterin synthase/QueD 0.8118 1 130 3.30.479.10
af_Q2G1X5_11_135_3.30.479.10 Alpha Beta;2-Layer Sandwich;Tetrahydropterin Synthase; Chain A;6-pyruvoyl tetrahydropterin synthase/QueD 0.8087 2 130 3.30.479.10
ID Description Score Start End GO Terms
AF-A0A4U6R347-F1-model_v4 6-carboxy-5,6,7,8-tetrahydropterin synthase (EC 4.1.2.50) (Queuosine biosynthesis protein QueD) 0.996 1 131 GO:0046872
GO:0070497
AF-A0A537RE69-F1-model_v4 6-carboxy-5,6,7,8-tetrahydropterin synthase (EC 4.1.2.50) (Queuosine biosynthesis protein QueD) 0.9954 2 132 GO:0070497
AF-A0A2N2S8J1-F1-model_v4 6-carboxy-5,6,7,8-tetrahydropterin synthase (EC 4.1.2.50) (Queuosine biosynthesis protein QueD) 0.995 1 119 GO:0046872
GO:0070497
AF-A0A2S5ZBC8-F1-model_v4 6-carboxy-5,6,7,8-tetrahydropterin synthase (EC 4.1.2.50) (Queuosine biosynthesis protein QueD) 0.9941 1 131 GO:0046872
GO:0070497
AF-A0A7K2MGU2-F1-model_v4 6-carboxy-5,6,7,8-tetrahydropterin synthase (EC 4.1.2.50) (Queuosine biosynthesis protein QueD) 0.994 1 89 GO:0046872
GO:0070497

Map