F485191
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 901 | 384 | 1802 | 133 |
Family's Representative Sequence
| Representative Sequence | 3300049824|Ga0501045_0131245|Ga0501045_0131245_1180_1626 |
| Length | 148 |
| Sequence | VYAVTVRDHVMVAHSLTGEVFGPAQALHGATFTVDATFRGPRLDGHGILVDIGLVTEVLRAVLDPLRYRNLDNLDEVPELAGRNTTTEVLAGFVAGRLVDEVRSGALVEAREHVTGVIVTLHESHVAWASCELPVELPVDEADRREGA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 2 | 2162886006 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v1 | Metagenome | Rhizosphere |
| 3 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 4 | 3300002126 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 | Metagenome | Rhizosphere |
| 5 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 6 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 7 | 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 8 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 9 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 10 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 11 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 12 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 15 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 16 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 19 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 21 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 22 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 24 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 25 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 26 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 28 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 35 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 39 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 41 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 42 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 46 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 47 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 48 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 49 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 50 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 52 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 53 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 54 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 56 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 57 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 61 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 62 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 64 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 65 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 66 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 68 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 69 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 70 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 71 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 72 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 73 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 74 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 75 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 76 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 77 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 78 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 79 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 80 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 81 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 82 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 83 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 84 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 86 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 87 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 88 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 89 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 90 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 91 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 92 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 93 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 94 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300012476 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.yng.070610 | Metagenome | Rhizosphere |
| 109 | 3300012483 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.yng.040610 | Metagenome | Rhizosphere |
| 110 | 3300012491 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.8.old.040610 | Metagenome | Rhizosphere |
| 111 | 3300012497 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 | Metagenome | Rhizosphere |
| 112 | 3300012515 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 | Metagenome | Rhizosphere |
| 113 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 124 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 129 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 130 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 131 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 132 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 133 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 192 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 194 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 198 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 199 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 200 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 201 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 202 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 203 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 204 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 205 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 206 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 207 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 208 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 209 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 210 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 211 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 212 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 213 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 214 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 215 | 3300033527 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 216 | 3300033529 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 217 | 3300033541 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 218 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 219 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 220 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 221 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 222 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 223 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 224 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 225 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 226 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 227 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 228 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 229 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 230 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 231 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 232 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 233 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 234 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 235 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 236 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 237 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 238 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 239 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 240 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 241 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 242 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 243 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 244 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 245 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 246 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 247 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 248 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 249 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 250 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 251 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 252 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 253 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 254 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 255 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 256 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 257 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 258 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 259 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 260 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 261 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 287 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 288 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 289 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 290 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 291 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 292 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 293 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 294 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 295 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 296 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 297 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 298 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 299 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 300 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 301 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 302 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 303 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 304 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 305 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 306 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 307 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 308 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 309 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 310 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 311 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 312 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 313 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 314 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 315 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 316 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 317 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 318 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 319 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 320 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 321 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 322 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 323 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 324 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 325 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 326 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 327 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 328 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 329 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 330 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 331 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 332 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 333 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 334 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 335 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 336 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 337 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 338 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 339 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 340 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 341 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 342 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 343 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 345 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 348 | 3300053107 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere | Metagenome | Endosphere |
| 349 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 350 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 351 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 352 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 353 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 354 | 3300053155 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere | Metagenome | Endosphere |
| 355 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 356 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 357 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 358 | 3300059426 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 359 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 360 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 361 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 362 | 2831935698 | Jishengella sp. AZ1-13 | Isolate | Unclassified |
| 363 | 2855670206 | Micromonospora noduli Lupac 07 | Isolate | Nodule |
| 364 | 2855676851 | Micromonospora saelicesensis GAR05 | Isolate | Unclassified |
| 365 | 2857288857 | Micromonospora noduli ONO23 | Isolate | Unclassified |
| 366 | 2858848962 | Micromonospora saelicesensis GAR06 | Isolate | Unclassified |
| 367 | 2858882152 | Micromonospora noduli MED15 | Isolate | Nodule |
| 368 | 2858888857 | Micromonospora saelicesensis Lupac 06 | Isolate | Unclassified |
| 369 | 2867507094 | Micromonospora zingiberis PLAI 1-1 | Isolate | Unclassified |
| 370 | 2869048445 | Micromonospora saelicesensis PSN01 | Isolate | Unclassified |
| 371 | 2869061728 | Micromonospora noduli ONO86 | Isolate | Unclassified |
| 372 | 2869068681 | Micromonospora noduli GUI43 | Isolate | Unclassified |
| 373 | 2880489317 | Micromonospora ureilytica DSM 101692 | Isolate | Unclassified |
| 374 | 2880495981 | Micromonospora vinacea DSM 101695 | Isolate | Unclassified |
| 375 | 2887478801 | Catellatospora paridis NEAU-CL2 | Isolate | Rhizosphere |
| 376 | 2929219909 | Micromonospora sp. R-75348 Hybrid assembly | Isolate | Unclassified |
| 377 | 2929226422 | Micromonospora sp. R-74116 Hybrid assembly | Isolate | Unclassified |
| 378 | 2954002825 | Streptomyces turgidiscabies W2I16 | Isolate | Rhizosphere |
| 379 | 2996221748 | Micromonospora veneta CAP181 | Isolate | Unclassified |
| 380 | 3006425503 | Streptomyces zingiberis PLAI1-29 | Isolate | Unclassified |
| 381 | 8003830390 | Micromonospora parastrephiae STR1_7 | Isolate | Rhizosphere |
| 382 | 8045830549 | Microbacterium yannicii DSM 23203 | Isolate | Unclassified |
| 383 | 8054704163 | Micromonospora trifolii NIE79 | Isolate | Nodule |
| 384 | 8056060235 | Nocardiopsis endophytica RSe5-2 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 96.67 |
| Metatranscriptomes | 0.78 |
| Isolates | 2.55 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 2.33 |
| Nodule | 0.33 |
| Rhizoplane | 3.88 |
| Rhizosphere | 90.23 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 5.88 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0501045_0131245 | 3300049824 | Bacteria | 1862 |
| 2 | SwRhRL3b_contig_3460783 | 2162886006 | Bacteria | 912 |
| 3 | JGI24743J22301_10107733 | 3300001991 | Bacteria | 604 |
| 4 | JGI24035J26624_1009098 | 3300002126 | Bacteria | 976 |
| 5 | JGI24034J26672_10053415 | 3300002239 | Unclassified | 698 |
| 6 | JGI24751J29686_10060933 | 3300002459 | Unclassified | 777 |
| 7 | JGI25405J52794_10061110 | 3300003911 | Bacteria | 815 |
| 8 | JGI25405J52794_10100024 | 3300003911 | Bacteria | 646 |
| 9 | Ga0065704_10343157 | 3300005289 | Unclassified | 820 |
| 10 | Ga0065712_10136214 | 3300005290 | Unclassified | 1495 |
| 11 | Ga0065712_10245180 | 3300005290 | Bacteria | 974 |
| 12 | Ga0065715_10213745 | 3300005293 | Unclassified | 1299 |
| 13 | Ga0065707_10097402 | 3300005295 | Unclassified | 3178 |
| 14 | Ga0065707_10154738 | 3300005295 | Bacteria | 1620 |
| 15 | Ga0070658_10367241 | 3300005327 | Bacteria | 1233 |
| 16 | Ga0070658_10373820 | 3300005327 | Bacteria | 1222 |
| 17 | Ga0070658_10586158 | 3300005327 | Bacteria | 966 |
| 18 | Ga0070658_10845987 | 3300005327 | Bacteria | 795 |
| 19 | Ga0070676_10150239 | 3300005328 | Unclassified | 1490 |
| 20 | Ga0070676_10217824 | 3300005328 | Bacteria | 1259 |
| 21 | Ga0070683_100009018 | 3300005329 | Bacteria | 8509 |
| 22 | Ga0070683_100340788 | 3300005329 | Bacteria | 1427 |
| 23 | Ga0070683_100913565 | 3300005329 | Bacteria | 842 |
| 24 | Ga0070690_100017828 | 3300005330 | Bacteria | 4280 |
| 25 | Ga0070690_100191427 | 3300005330 | Bacteria | 1418 |
| 26 | Ga0070670_100029747 | 3300005331 | Unclassified | 4704 |
| 27 | Ga0070670_100847248 | 3300005331 | Bacteria | 827 |
| 28 | Ga0070677_10004811 | 3300005333 | Bacteria | 4429 |
| 29 | Ga0070677_10045918 | 3300005333 | Unclassified | 1744 |
| 30 | Ga0070677_10069375 | 3300005333 | Bacteria | 1478 |
| 31 | Ga0070677_10158051 | 3300005333 | Bacteria | 1061 |
| 32 | Ga0068869_100002221 | 3300005334 | Bacteria | 11683 |
| 33 | Ga0068869_100071156 | 3300005334 | Bacteria | 2575 |
| 34 | Ga0068869_100110311 | 3300005334 | Bacteria | 2092 |
| 35 | Ga0068869_101018754 | 3300005334 | Bacteria | 722 |
| 36 | Ga0070666_10032828 | 3300005335 | Unclassified | 3431 |
| 37 | Ga0070666_10418801 | 3300005335 | Bacteria | 964 |
| 38 | Ga0070666_10521855 | 3300005335 | Bacteria | 862 |
| 39 | Ga0070682_100433314 | 3300005337 | Bacteria | 1002 |
| 40 | Ga0070682_100776759 | 3300005337 | Bacteria | 776 |
| 41 | Ga0068868_100038641 | 3300005338 | Bacteria | 3705 |
| 42 | Ga0068868_100278107 | 3300005338 | Bacteria | 1416 |
| 43 | Ga0068868_100287642 | 3300005338 | Bacteria | 1393 |
| 44 | Ga0068868_100549378 | 3300005338 | Bacteria | 1018 |
| 45 | Ga0068868_100632765 | 3300005338 | Bacteria | 951 |
| 46 | Ga0068868_100673874 | 3300005338 | Bacteria | 923 |
| 47 | Ga0068868_101189418 | 3300005338 | Bacteria | 704 |
| 48 | Ga0068868_101992326 | 3300005338 | Bacteria | 551 |
| 49 | Ga0070660_100038449 | 3300005339 | Bacteria | 3633 |
| 50 | Ga0070660_100273953 | 3300005339 | Bacteria | 1380 |
| 51 | Ga0070660_100289994 | 3300005339 | Bacteria | 1340 |
| 52 | Ga0070660_100319429 | 3300005339 | Bacteria | 1275 |
| 53 | Ga0070660_100523295 | 3300005339 | Bacteria | 988 |
| 54 | Ga0070660_100540999 | 3300005339 | Bacteria | 971 |
| 55 | Ga0070689_100659626 | 3300005340 | Bacteria | 911 |
| 56 | Ga0070691_10479183 | 3300005341 | Bacteria | 715 |
| 57 | Ga0070691_10534184 | 3300005341 | Bacteria | 683 |
| 58 | Ga0070687_100472298 | 3300005343 | Bacteria | 839 |
| 59 | Ga0070661_100084028 | 3300005344 | Bacteria | 2352 |
| 60 | Ga0070661_101117545 | 3300005344 | Bacteria | 657 |
| 61 | Ga0070692_10041858 | 3300005345 | Bacteria | 2349 |
| 62 | Ga0070692_10122283 | 3300005345 | Bacteria | 1453 |
| 63 | Ga0070692_10145507 | 3300005345 | Unclassified | 1345 |
| 64 | Ga0070692_10177713 | 3300005345 | Bacteria | 1231 |
| 65 | Ga0070692_10224424 | 3300005345 | Bacteria | 1112 |
| 66 | Ga0070668_100279897 | 3300005347 | Bacteria | 1393 |
| 67 | Ga0070668_100616145 | 3300005347 | Bacteria | 951 |
| 68 | Ga0070669_100013184 | 3300005353 | Bacteria | 5875 |
| 69 | Ga0070669_100515594 | 3300005353 | Bacteria | 993 |
| 70 | Ga0070675_100006132 | 3300005354 | Bacteria | 9217 |
| 71 | Ga0070675_100033370 | 3300005354 | Unclassified | 4173 |
| 72 | Ga0070675_100420627 | 3300005354 | Bacteria | 1195 |
| 73 | Ga0070675_100537655 | 3300005354 | Bacteria | 1056 |
| 74 | Ga0070675_100721451 | 3300005354 | Bacteria | 908 |
| 75 | Ga0070671_100097228 | 3300005355 | Bacteria | 2469 |
| 76 | Ga0070671_100202232 | 3300005355 | Bacteria | 1685 |
| 77 | Ga0070671_100352062 | 3300005355 | Bacteria | 1257 |
| 78 | Ga0070671_100699861 | 3300005355 | Unclassified | 879 |
| 79 | Ga0070671_100746074 | 3300005355 | Bacteria | 851 |
| 80 | Ga0070674_100000544 | 3300005356 | Bacteria | 18881 |
| 81 | Ga0070674_100167708 | 3300005356 | Unclassified | 1671 |
| 82 | Ga0070673_100145181 | 3300005364 | Bacteria | 2005 |
| 83 | Ga0070673_100158082 | 3300005364 | Unclassified | 1925 |
| 84 | Ga0070673_102144682 | 3300005364 | Bacteria | 531 |
| 85 | Ga0070688_100199593 | 3300005365 | Bacteria | 1399 |
| 86 | Ga0070659_100000749 | 3300005366 | Bacteria | 23637 |
| 87 | Ga0070659_100129103 | 3300005366 | Bacteria | 2052 |
| 88 | Ga0070659_100461731 | 3300005366 | Bacteria | 1078 |
| 89 | Ga0070659_100579527 | 3300005366 | Bacteria | 963 |
| 90 | Ga0070667_100025125 | 3300005367 | Bacteria | 4952 |
| 91 | Ga0070667_100106006 | 3300005367 | Unclassified | 2433 |
| 92 | Ga0070714_100095290 | 3300005435 | Bacteria | 2614 |
| 93 | Ga0070701_10077193 | 3300005438 | Bacteria | 1795 |
| 94 | Ga0070701_10207908 | 3300005438 | Bacteria | 1160 |
| 95 | Ga0070701_10501528 | 3300005438 | Bacteria | 788 |
| 96 | Ga0070705_100596208 | 3300005440 | Bacteria | 854 |
| 97 | Ga0070700_100030218 | 3300005441 | Bacteria | 3236 |
| 98 | Ga0070700_100115966 | 3300005441 | Bacteria | 1788 |
| 99 | Ga0070700_100907334 | 3300005441 | Bacteria | 718 |
| 100 | Ga0070700_101024352 | 3300005441 | Unclassified | 680 |
| 101 | Ga0070694_100023115 | 3300005444 | Bacteria | 3994 |
| 102 | Ga0070694_100161379 | 3300005444 | Bacteria | 1645 |
| 103 | Ga0070663_100411390 | 3300005455 | Bacteria | 1108 |
| 104 | Ga0070663_100448640 | 3300005455 | Bacteria | 1063 |
| 105 | Ga0070663_100499031 | 3300005455 | Bacteria | 1010 |
| 106 | Ga0070663_100922495 | 3300005455 | Bacteria | 755 |
| 107 | Ga0070678_100042329 | 3300005456 | Bacteria | 3236 |
| 108 | Ga0070678_100366712 | 3300005456 | Unclassified | 1242 |
| 109 | Ga0070678_100691760 | 3300005456 | Bacteria | 918 |
| 110 | Ga0070678_100746672 | 3300005456 | Bacteria | 885 |
| 111 | Ga0070662_100563455 | 3300005457 | Bacteria | 956 |
| 112 | Ga0070681_10008128 | 3300005458 | Bacteria | 10268 |
| 113 | Ga0068867_100090993 | 3300005459 | Unclassified | 2315 |
| 114 | Ga0068867_100485513 | 3300005459 | Bacteria | 1059 |
| 115 | Ga0068867_100659766 | 3300005459 | Bacteria | 919 |
| 116 | Ga0068867_101631604 | 3300005459 | Bacteria | 603 |
| 117 | Ga0070685_10057253 | 3300005466 | Bacteria | 2268 |
| 118 | Ga0070685_10393956 | 3300005466 | Bacteria | 957 |
| 119 | Ga0070685_10800463 | 3300005466 | Bacteria | 695 |
| 120 | Ga0070707_101177509 | 3300005468 | Bacteria | 732 |
| 121 | Ga0070698_100009538 | 3300005471 | Bacteria | 10392 |
| 122 | Ga0070698_100062331 | 3300005471 | Bacteria | 3762 |
| 123 | Ga0070699_100007694 | 3300005518 | Bacteria | 9367 |
| 124 | Ga0070699_100026880 | 3300005518 | Bacteria | 4964 |
| 125 | Ga0070699_100361136 | 3300005518 | Bacteria | 1309 |
| 126 | Ga0070699_101013187 | 3300005518 | Bacteria | 761 |
| 127 | Ga0070679_100095891 | 3300005530 | Bacteria | 2954 |
| 128 | Ga0070679_100235223 | 3300005530 | Bacteria | 1791 |
| 129 | Ga0070679_101307657 | 3300005530 | Bacteria | 671 |
| 130 | Ga0070684_100245691 | 3300005535 | Bacteria | 1635 |
| 131 | Ga0068853_100001645 | 3300005539 | Bacteria | 16333 |
| 132 | Ga0068853_100104448 | 3300005539 | Bacteria | 2508 |
| 133 | Ga0068853_100442630 | 3300005539 | Unclassified | 1221 |
| 134 | Ga0070672_100017354 | 3300005543 | Bacteria | 5178 |
| 135 | Ga0070672_100055953 | 3300005543 | Unclassified | 3092 |
| 136 | Ga0070672_100082058 | 3300005543 | Bacteria | 2586 |
| 137 | Ga0070672_100195555 | 3300005543 | Bacteria | 1690 |
| 138 | Ga0070686_100077221 | 3300005544 | Unclassified | 2195 |
| 139 | Ga0070686_100120558 | 3300005544 | Bacteria | 1800 |
| 140 | Ga0070686_100140415 | 3300005544 | Bacteria | 1681 |
| 141 | Ga0070695_100060607 | 3300005545 | Bacteria | 2453 |
| 142 | Ga0070695_100256262 | 3300005545 | Bacteria | 1276 |
| 143 | Ga0070696_100004294 | 3300005546 | Bacteria | 9497 |
| 144 | Ga0070696_100018940 | 3300005546 | Bacteria | 4660 |
| 145 | Ga0070696_100039359 | 3300005546 | Bacteria | 3265 |
| 146 | Ga0070696_100556411 | 3300005546 | Bacteria | 920 |
| 147 | Ga0070696_100792142 | 3300005546 | Bacteria | 779 |
| 148 | Ga0070696_101471694 | 3300005546 | Bacteria | 582 |
| 149 | Ga0070693_100898021 | 3300005547 | Bacteria | 664 |
| 150 | Ga0070693_101204669 | 3300005547 | Bacteria | 582 |
| 151 | Ga0070665_100109938 | 3300005548 | Bacteria | 2758 |
| 152 | Ga0070665_101093863 | 3300005548 | Bacteria | 809 |
| 153 | Ga0070704_100132523 | 3300005549 | Unclassified | 1934 |
| 154 | Ga0068855_100003924 | 3300005563 | Bacteria | 18149 |
| 155 | Ga0068855_100009335 | 3300005563 | Bacteria | 11847 |
| 156 | Ga0068855_100360694 | 3300005563 | Bacteria | 1599 |
| 157 | Ga0068855_100557175 | 3300005563 | Bacteria | 1240 |
| 158 | Ga0068855_100880545 | 3300005563 | Bacteria | 947 |
| 159 | Ga0070664_100158710 | 3300005564 | Bacteria | 2000 |
| 160 | Ga0070664_101134681 | 3300005564 | Bacteria | 737 |
| 161 | Ga0070664_101296912 | 3300005564 | Bacteria | 688 |
| 162 | Ga0068857_100001028 | 3300005577 | Bacteria | 21558 |
| 163 | Ga0068857_100042691 | 3300005577 | Bacteria | 4024 |
| 164 | Ga0068857_100087638 | 3300005577 | Bacteria | 2784 |
| 165 | Ga0068857_100643105 | 3300005577 | Bacteria | 1005 |
| 166 | Ga0068857_101119469 | 3300005577 | Bacteria | 761 |
| 167 | Ga0068857_101780350 | 3300005577 | Bacteria | 603 |
| 168 | Ga0068854_100138311 | 3300005578 | Bacteria | 1866 |
| 169 | Ga0068854_100209574 | 3300005578 | Bacteria | 1536 |
| 170 | Ga0068854_100379410 | 3300005578 | Bacteria | 1164 |
| 171 | Ga0068854_101144725 | 3300005578 | Bacteria | 695 |
| 172 | Ga0068856_100007464 | 3300005614 | Bacteria | 10673 |
| 173 | Ga0068856_100253488 | 3300005614 | Bacteria | 1775 |
| 174 | Ga0068856_100326297 | 3300005614 | Bacteria | 1552 |
| 175 | Ga0068856_100398562 | 3300005614 | Bacteria | 1396 |
| 176 | Ga0068856_100460188 | 3300005614 | Bacteria | 1293 |
| 177 | Ga0068856_100982191 | 3300005614 | Bacteria | 863 |
| 178 | Ga0068856_101008091 | 3300005614 | Bacteria | 851 |
| 179 | Ga0070702_100280465 | 3300005615 | Bacteria | 1144 |
| 180 | Ga0070702_100515960 | 3300005615 | Bacteria | 880 |
| 181 | Ga0068852_100000501 | 3300005616 | Bacteria | 25721 |
| 182 | Ga0068852_100003952 | 3300005616 | Bacteria | 10419 |
| 183 | Ga0068852_100327024 | 3300005616 | Bacteria | 1490 |
| 184 | Ga0068852_100758852 | 3300005616 | Bacteria | 982 |
| 185 | Ga0068852_100934819 | 3300005616 | Bacteria | 885 |
| 186 | Ga0068852_101025884 | 3300005616 | Bacteria | 844 |
| 187 | Ga0068859_100059842 | 3300005617 | Bacteria | 3838 |
| 188 | Ga0068859_100081703 | 3300005617 | Unclassified | 3274 |
| 189 | Ga0068859_100094875 | 3300005617 | Bacteria | 3036 |
| 190 | Ga0068859_100112913 | 3300005617 | Bacteria | 2781 |
| 191 | Ga0068859_100171965 | 3300005617 | Bacteria | 2247 |
| 192 | Ga0068864_100061604 | 3300005618 | Bacteria | 3250 |
| 193 | Ga0068864_100233712 | 3300005618 | Bacteria | 1701 |
| 194 | Ga0068864_100299165 | 3300005618 | Unclassified | 1506 |
| 195 | Ga0068864_100762940 | 3300005618 | Bacteria | 949 |
| 196 | Ga0068864_100797927 | 3300005618 | Bacteria | 928 |
| 197 | Ga0068864_101451172 | 3300005618 | Bacteria | 689 |
| 198 | Ga0068861_100205632 | 3300005719 | Bacteria | 1655 |
| 199 | Ga0068861_100842939 | 3300005719 | Unclassified | 864 |
| 200 | Ga0068851_10000008 | 3300005834 | Bacteria | 231006 |
| 201 | Ga0068870_10091451 | 3300005840 | Bacteria | 1702 |
| 202 | Ga0068863_100149326 | 3300005841 | Bacteria | 2236 |
| 203 | Ga0068863_101914873 | 3300005841 | Bacteria | 603 |
| 204 | Ga0068858_100000096 | 3300005842 | Bacteria | 91762 |
| 205 | Ga0068860_100039330 | 3300005843 | Bacteria | 4523 |
| 206 | Ga0068860_101012029 | 3300005843 | Bacteria | 849 |
| 207 | Ga0068860_101133563 | 3300005843 | Bacteria | 802 |
| 208 | Ga0068862_100024900 | 3300005844 | Bacteria | 5022 |
| 209 | Ga0068862_100168038 | 3300005844 | Bacteria | 1962 |
| 210 | Ga0068862_100277670 | 3300005844 | Unclassified | 1534 |
| 211 | Ga0081455_10006304 | 3300005937 | Bacteria | 12749 |
| 212 | Ga0081455_10013986 | 3300005937 | Bacteria | 7888 |
| 213 | Ga0081455_10040847 | 3300005937 | Bacteria | 4087 |
| 214 | Ga0081455_10096008 | 3300005937 | Bacteria | 2391 |
| 215 | Ga0081455_10105002 | 3300005937 | Bacteria | 2259 |
| 216 | Ga0081455_10809970 | 3300005937 | Bacteria | 587 |
| 217 | Ga0081538_10000373 | 3300005981 | Bacteria | 51152 |
| 218 | Ga0081538_10017097 | 3300005981 | Bacteria | 5522 |
| 219 | Ga0081538_10019586 | 3300005981 | Bacteria | 5019 |
| 220 | Ga0081538_10067575 | 3300005981 | Bacteria | 1994 |
| 221 | Ga0081538_10235638 | 3300005981 | Bacteria | 711 |
| 222 | Ga0081540_1209222 | 3300005983 | Bacteria | 703 |
| 223 | Ga0070717_10243916 | 3300006028 | Bacteria | 1585 |
| 224 | Ga0075368_10361241 | 3300006042 | Bacteria | 633 |
| 225 | Ga0075432_10007952 | 3300006058 | Bacteria | 3615 |
| 226 | Ga0075367_10246392 | 3300006178 | Bacteria | 1120 |
| 227 | Ga0097621_100561334 | 3300006237 | Bacteria | 1040 |
| 228 | Ga0097621_100846297 | 3300006237 | Bacteria | 849 |
| 229 | Ga0075370_10151045 | 3300006353 | Bacteria | 1361 |
| 230 | Ga0075428_100000241 | 3300006844 | Bacteria | 53452 |
| 231 | Ga0075428_100054973 | 3300006844 | Bacteria | 4362 |
| 232 | Ga0075428_100060000 | 3300006844 | Bacteria | 4165 |
| 233 | Ga0075428_100339706 | 3300006844 | Bacteria | 1613 |
| 234 | Ga0075428_101188755 | 3300006844 | Bacteria | 804 |
| 235 | Ga0075430_100000048 | 3300006846 | Bacteria | 63512 |
| 236 | Ga0075430_100219158 | 3300006846 | Bacteria | 1579 |
| 237 | Ga0075430_100484127 | 3300006846 | Bacteria | 1021 |
| 238 | Ga0075431_100000208 | 3300006847 | Bacteria | 43484 |
| 239 | Ga0075431_100038131 | 3300006847 | Unclassified | 4948 |
| 240 | Ga0075431_100831966 | 3300006847 | Bacteria | 895 |
| 241 | Ga0075433_10000736 | 3300006852 | Bacteria | 22450 |
| 242 | Ga0075433_10077745 | 3300006852 | Bacteria | 2923 |
| 243 | Ga0075433_10474300 | 3300006852 | Bacteria | 1102 |
| 244 | Ga0075434_100087794 | 3300006871 | Bacteria | 3111 |
| 245 | Ga0075434_100134988 | 3300006871 | Bacteria | 2487 |
| 246 | Ga0075434_100348743 | 3300006871 | Bacteria | 1501 |
| 247 | Ga0075434_100673161 | 3300006871 | Bacteria | 1053 |
| 248 | Ga0075434_100740557 | 3300006871 | Bacteria | 1000 |
| 249 | Ga0075429_100000967 | 3300006880 | Bacteria | 22796 |
| 250 | Ga0075429_100105292 | 3300006880 | Bacteria | 2464 |
| 251 | Ga0075429_100114285 | 3300006880 | Bacteria | 2360 |
| 252 | Ga0068865_100093875 | 3300006881 | Bacteria | 2182 |
| 253 | Ga0068865_100638252 | 3300006881 | Bacteria | 904 |
| 254 | Ga0075436_100800275 | 3300006914 | Bacteria | 702 |
| 255 | Ga0097620_100059840 | 3300006931 | Bacteria | 3838 |
| 256 | Ga0097620_100081701 | 3300006931 | Unclassified | 3274 |
| 257 | Ga0097620_100094876 | 3300006931 | Bacteria | 3036 |
| 258 | Ga0097620_100112911 | 3300006931 | Bacteria | 2781 |
| 259 | Ga0097620_100171978 | 3300006931 | Bacteria | 2247 |
| 260 | Ga0105240_10021974 | 3300009093 | Bacteria | 8475 |
| 261 | Ga0105240_10027961 | 3300009093 | Bacteria | 7376 |
| 262 | Ga0105240_10779281 | 3300009093 | Bacteria | 1037 |
| 263 | Ga0111539_10041498 | 3300009094 | Bacteria | 5532 |
| 264 | Ga0111539_10052732 | 3300009094 | Bacteria | 4841 |
| 265 | Ga0111539_10349205 | 3300009094 | Bacteria | 1722 |
| 266 | Ga0111539_10723624 | 3300009094 | Bacteria | 1158 |
| 267 | Ga0111539_10857997 | 3300009094 | Bacteria | 1056 |
| 268 | Ga0111539_10869734 | 3300009094 | Unclassified | 1049 |
| 269 | Ga0111539_10964560 | 3300009094 | Bacteria | 991 |
| 270 | Ga0105245_10038504 | 3300009098 | Bacteria | 4254 |
| 271 | Ga0105245_10281609 | 3300009098 | Bacteria | 1625 |
| 272 | Ga0105245_10346400 | 3300009098 | Bacteria | 1471 |
| 273 | Ga0105245_10394612 | 3300009098 | Bacteria | 1381 |
| 274 | Ga0105245_10513343 | 3300009098 | Bacteria | 1216 |
| 275 | Ga0105245_10544958 | 3300009098 | Bacteria | 1181 |
| 276 | Ga0105245_10603910 | 3300009098 | Bacteria | 1124 |
| 277 | Ga0105245_11868469 | 3300009098 | Bacteria | 654 |
| 278 | Ga0105245_12515130 | 3300009098 | Bacteria | 568 |
| 279 | Ga0105247_10548317 | 3300009101 | Bacteria | 850 |
| 280 | Ga0114129_10018879 | 3300009147 | Bacteria | 9822 |
| 281 | Ga0114129_10065623 | 3300009147 | Bacteria | 5066 |
| 282 | Ga0114129_10100818 | 3300009147 | Bacteria | 3995 |
| 283 | Ga0114129_10315805 | 3300009147 | Bacteria | 2078 |
| 284 | Ga0114129_10382098 | 3300009147 | Bacteria | 1860 |
| 285 | Ga0114129_11396036 | 3300009147 | Unclassified | 864 |
| 286 | Ga0105243_10305119 | 3300009148 | Bacteria | 1444 |
| 287 | Ga0105243_10925634 | 3300009148 | Bacteria | 869 |
| 288 | Ga0105243_11313961 | 3300009148 | Bacteria | 741 |
| 289 | Ga0105241_10225464 | 3300009174 | Unclassified | 1577 |
| 290 | Ga0105248_10000713 | 3300009177 | Bacteria | 37644 |
| 291 | Ga0105248_10077338 | 3300009177 | Bacteria | 3741 |
| 292 | Ga0105248_10662210 | 3300009177 | Bacteria | 1178 |
| 293 | Ga0105237_10000688 | 3300009545 | Bacteria | 46838 |
| 294 | Ga0105237_10004883 | 3300009545 | Bacteria | 15361 |
| 295 | Ga0105237_11214233 | 3300009545 | Bacteria | 761 |
| 296 | Ga0105237_11510539 | 3300009545 | Bacteria | 678 |
| 297 | Ga0105238_10006959 | 3300009551 | Bacteria | 11300 |
| 298 | Ga0105238_10161194 | 3300009551 | Bacteria | 2218 |
| 299 | Ga0105238_10465246 | 3300009551 | Bacteria | 1263 |
| 300 | Ga0105238_11933722 | 3300009551 | Bacteria | 623 |
| 301 | Ga0105249_10001062 | 3300009553 | Bacteria | 24367 |
| 302 | Ga0105249_10261594 | 3300009553 | Bacteria | 1720 |
| 303 | Ga0105249_10442756 | 3300009553 | Bacteria | 1337 |
| 304 | Ga0105249_10543417 | 3300009553 | Bacteria | 1212 |
| 305 | Ga0105249_11537618 | 3300009553 | Bacteria | 738 |
| 306 | Ga0105239_10147347 | 3300010375 | Bacteria | 2626 |
| 307 | Ga0105239_10155042 | 3300010375 | Bacteria | 2557 |
| 308 | Ga0105239_10464557 | 3300010375 | Bacteria | 1437 |
| 309 | Ga0105239_10802157 | 3300010375 | Bacteria | 1079 |
| 310 | Ga0105239_11724564 | 3300010375 | Unclassified | 725 |
| 311 | Ga0105239_11892425 | 3300010375 | Bacteria | 692 |
| 312 | Ga0105246_10074532 | 3300011119 | Bacteria | 2399 |
| 313 | Ga0105246_10220356 | 3300011119 | Bacteria | 1487 |
| 314 | Ga0105246_11208256 | 3300011119 | Bacteria | 696 |
| 315 | Ga0157344_1023062 | 3300012476 | Bacteria | 550 |
| 316 | Ga0157337_1004159 | 3300012483 | Bacteria | 911 |
| 317 | Ga0157329_1004243 | 3300012491 | Bacteria | 920 |
| 318 | Ga0157319_1008431 | 3300012497 | Bacteria | 788 |
| 319 | Ga0157338_1022790 | 3300012515 | Bacteria | 743 |
| 320 | Ga0157371_10075353 | 3300013102 | Bacteria | 2389 |
| 321 | Ga0157371_10173744 | 3300013102 | Bacteria | 1540 |
| 322 | Ga0157371_10509930 | 3300013102 | Bacteria | 889 |
| 323 | Ga0157370_10043788 | 3300013104 | Bacteria | 4306 |
| 324 | Ga0157370_10397559 | 3300013104 | Bacteria | 1269 |
| 325 | Ga0157370_10648815 | 3300013104 | Bacteria | 965 |
| 326 | Ga0157369_10146550 | 3300013105 | Bacteria | 2496 |
| 327 | Ga0157369_10383825 | 3300013105 | Bacteria | 1458 |
| 328 | Ga0157374_10174753 | 3300013296 | Unclassified | 2096 |
| 329 | Ga0157374_10351983 | 3300013296 | Bacteria | 1464 |
| 330 | Ga0157374_11291659 | 3300013296 | Bacteria | 752 |
| 331 | Ga0157374_12725080 | 3300013296 | Bacteria | 522 |
| 332 | Ga0157378_10235559 | 3300013297 | Unclassified | 1747 |
| 333 | Ga0163162_10001014 | 3300013306 | Bacteria | 26094 |
| 334 | Ga0163162_10247613 | 3300013306 | Bacteria | 1914 |
| 335 | Ga0163162_10753827 | 3300013306 | Bacteria | 1093 |
| 336 | Ga0163162_10909142 | 3300013306 | Bacteria | 993 |
| 337 | Ga0163162_12669277 | 3300013306 | Bacteria | 575 |
| 338 | Ga0157372_10000303 | 3300013307 | Bacteria | 54864 |
| 339 | Ga0157372_10286550 | 3300013307 | Bacteria | 1915 |
| 340 | Ga0157372_10293629 | 3300013307 | Bacteria | 1890 |
| 341 | Ga0157372_11785184 | 3300013307 | Bacteria | 707 |
| 342 | Ga0157375_10017739 | 3300013308 | Bacteria | 6435 |
| 343 | Ga0157375_10073830 | 3300013308 | Bacteria | 3431 |
| 344 | Ga0157375_11431133 | 3300013308 | Bacteria | 815 |
| 345 | Ga0157375_11672543 | 3300013308 | Bacteria | 753 |
| 346 | Ga0163163_10113196 | 3300014325 | Unclassified | 2743 |
| 347 | Ga0163163_10315846 | 3300014325 | Bacteria | 1616 |
| 348 | Ga0157380_10008742 | 3300014326 | Bacteria | 7235 |
| 349 | Ga0157380_10027580 | 3300014326 | Bacteria | 4320 |
| 350 | Ga0157380_10173203 | 3300014326 | Unclassified | 1888 |
| 351 | Ga0157380_10503459 | 3300014326 | Bacteria | 1177 |
| 352 | Ga0157380_11438659 | 3300014326 | Bacteria | 741 |
| 353 | Ga0182008_10306201 | 3300014497 | Bacteria | 833 |
| 354 | Ga0157377_10317183 | 3300014745 | Bacteria | 1034 |
| 355 | Ga0157377_10334535 | 3300014745 | Bacteria | 1011 |
| 356 | Ga0157377_10506590 | 3300014745 | Bacteria | 845 |
| 357 | Ga0157379_10172327 | 3300014968 | Bacteria | 1953 |
| 358 | Ga0157379_10856821 | 3300014968 | Bacteria | 860 |
| 359 | Ga0157376_10094004 | 3300014969 | Bacteria | 2604 |
| 360 | Ga0157376_11067894 | 3300014969 | Bacteria | 832 |
| 361 | Ga0157376_11515382 | 3300014969 | Bacteria | 704 |
| 362 | Ga0163161_10027815 | 3300017792 | Unclassified | 4012 |
| 363 | Ga0163161_10245228 | 3300017792 | Bacteria | 1395 |
| 364 | Ga0197907_10030690 | 3300020069 | Bacteria | 882 |
| 365 | Ga0206354_10719424 | 3300020081 | Bacteria | 618 |
| 366 | Ga0224712_10064155 | 3300022467 | Bacteria | 1473 |
| 367 | Ga0209148_1001379 | 3300025254 | Bacteria | 12636 |
| 368 | Ga0207426_1092055 | 3300025302 | Bacteria | 801 |
| 369 | Ga0207697_10000517 | 3300025315 | Bacteria | 21741 |
| 370 | Ga0207697_10062739 | 3300025315 | Unclassified | 1548 |
| 371 | Ga0207656_10000005 | 3300025321 | Bacteria | 490514 |
| 372 | Ga0207682_10007235 | 3300025893 | Bacteria | 4436 |
| 373 | Ga0207682_10011183 | 3300025893 | Unclassified | 3509 |
| 374 | Ga0207682_10011919 | 3300025893 | Bacteria | 3395 |
| 375 | Ga0207642_10121635 | 3300025899 | Bacteria | 1347 |
| 376 | Ga0207710_10131947 | 3300025900 | Bacteria | 1200 |
| 377 | Ga0207688_10019212 | 3300025901 | Bacteria | 3721 |
| 378 | Ga0207688_10027679 | 3300025901 | Bacteria | 3118 |
| 379 | Ga0207688_10137359 | 3300025901 | Bacteria | 1437 |
| 380 | Ga0207688_10684024 | 3300025901 | Bacteria | 648 |
| 381 | Ga0207680_10060351 | 3300025903 | Bacteria | 2308 |
| 382 | Ga0207680_10134592 | 3300025903 | Bacteria | 1632 |
| 383 | Ga0207680_10449127 | 3300025903 | Bacteria | 915 |
| 384 | Ga0207699_11218863 | 3300025906 | Bacteria | 557 |
| 385 | Ga0207645_10000648 | 3300025907 | Bacteria | 28907 |
| 386 | Ga0207645_10080681 | 3300025907 | Unclassified | 2086 |
| 387 | Ga0207645_10180081 | 3300025907 | Bacteria | 1386 |
| 388 | Ga0207643_10000535 | 3300025908 | Bacteria | 24402 |
| 389 | Ga0207643_10030163 | 3300025908 | Unclassified | 3018 |
| 390 | Ga0207643_10034341 | 3300025908 | Bacteria | 2842 |
| 391 | Ga0207643_10339261 | 3300025908 | Bacteria | 941 |
| 392 | Ga0207705_10019591 | 3300025909 | Bacteria | 4837 |
| 393 | Ga0207705_10036147 | 3300025909 | Bacteria | 3535 |
| 394 | Ga0207705_10125425 | 3300025909 | Bacteria | 1908 |
| 395 | Ga0207705_10355435 | 3300025909 | Bacteria | 1129 |
| 396 | Ga0207705_10591444 | 3300025909 | Bacteria | 863 |
| 397 | Ga0207705_11092228 | 3300025909 | Bacteria | 615 |
| 398 | Ga0207654_10000001 | 3300025911 | Bacteria | 1816198 |
| 399 | Ga0207707_10104231 | 3300025912 | Bacteria | 2479 |
| 400 | Ga0207695_10005054 | 3300025913 | Bacteria | 17692 |
| 401 | Ga0207695_10075339 | 3300025913 | Bacteria | 3434 |
| 402 | Ga0207695_10591249 | 3300025913 | Bacteria | 991 |
| 403 | Ga0207671_10000016 | 3300025914 | Bacteria | 435413 |
| 404 | Ga0207671_10026676 | 3300025914 | Bacteria | 4325 |
| 405 | Ga0207660_10151925 | 3300025917 | Bacteria | 1780 |
| 406 | Ga0207662_10008294 | 3300025918 | Bacteria | 5687 |
| 407 | Ga0207662_10178674 | 3300025918 | Bacteria | 1365 |
| 408 | Ga0207657_10017089 | 3300025919 | Bacteria | 6975 |
| 409 | Ga0207657_10045205 | 3300025919 | Bacteria | 3866 |
| 410 | Ga0207657_10309354 | 3300025919 | Bacteria | 1251 |
| 411 | Ga0207657_10828047 | 3300025919 | Bacteria | 715 |
| 412 | Ga0207649_10079211 | 3300025920 | Bacteria | 2122 |
| 413 | Ga0207649_10673257 | 3300025920 | Bacteria | 801 |
| 414 | Ga0207652_10067301 | 3300025921 | Bacteria | 3106 |
| 415 | Ga0207646_10290620 | 3300025922 | Bacteria | 1477 |
| 416 | Ga0207681_10019493 | 3300025923 | Bacteria | 4286 |
| 417 | Ga0207681_10199790 | 3300025923 | Unclassified | 1534 |
| 418 | Ga0207694_10000196 | 3300025924 | Bacteria | 60714 |
| 419 | Ga0207650_10518227 | 3300025925 | Bacteria | 998 |
| 420 | Ga0207659_10004355 | 3300025926 | Bacteria | 8554 |
| 421 | Ga0207659_10136974 | 3300025926 | Bacteria | 1896 |
| 422 | Ga0207659_10619886 | 3300025926 | Bacteria | 923 |
| 423 | Ga0207659_10716075 | 3300025926 | Bacteria | 857 |
| 424 | Ga0207659_11052460 | 3300025926 | Bacteria | 700 |
| 425 | Ga0207687_10016104 | 3300025927 | Bacteria | 4907 |
| 426 | Ga0207687_10169791 | 3300025927 | Bacteria | 1681 |
| 427 | Ga0207687_10262691 | 3300025927 | Bacteria | 1377 |
| 428 | Ga0207687_10471563 | 3300025927 | Bacteria | 1044 |
| 429 | Ga0207687_11179682 | 3300025927 | Bacteria | 658 |
| 430 | Ga0207664_10412600 | 3300025929 | Bacteria | 1202 |
| 431 | Ga0207664_10417670 | 3300025929 | Bacteria | 1194 |
| 432 | Ga0207644_10218069 | 3300025931 | Bacteria | 1511 |
| 433 | Ga0207644_10260810 | 3300025931 | Bacteria | 1386 |
| 434 | Ga0207644_10282557 | 3300025931 | Bacteria | 1333 |
| 435 | Ga0207690_10135811 | 3300025932 | Bacteria | 1806 |
| 436 | Ga0207706_10043147 | 3300025933 | Bacteria | 3997 |
| 437 | Ga0207706_10140431 | 3300025933 | Unclassified | 2125 |
| 438 | Ga0207706_10307749 | 3300025933 | Bacteria | 1380 |
| 439 | Ga0207670_10359036 | 3300025936 | Bacteria | 1156 |
| 440 | Ga0207669_10032629 | 3300025937 | Unclassified | 2927 |
| 441 | Ga0207704_10469516 | 3300025938 | Bacteria | 1008 |
| 442 | Ga0207665_10133132 | 3300025939 | Bacteria | 1767 |
| 443 | Ga0207665_10272599 | 3300025939 | Bacteria | 1257 |
| 444 | Ga0207691_10005699 | 3300025940 | Bacteria | 12041 |
| 445 | Ga0207691_10008272 | 3300025940 | Bacteria | 9986 |
| 446 | Ga0207691_10043448 | 3300025940 | Bacteria | 4142 |
| 447 | Ga0207691_11065462 | 3300025940 | Bacteria | 673 |
| 448 | Ga0207711_10004705 | 3300025941 | Bacteria | 11597 |
| 449 | Ga0207711_10044903 | 3300025941 | Bacteria | 3774 |
| 450 | Ga0207689_10009006 | 3300025942 | Bacteria | 8644 |
| 451 | Ga0207689_10069451 | 3300025942 | Bacteria | 2895 |
| 452 | Ga0207689_10090331 | 3300025942 | Bacteria | 2517 |
| 453 | Ga0207689_10106985 | 3300025942 | Unclassified | 2298 |
| 454 | Ga0207679_12000900 | 3300025945 | Bacteria | 527 |
| 455 | Ga0207667_10000437 | 3300025949 | Bacteria | 55848 |
| 456 | Ga0207667_10001482 | 3300025949 | Bacteria | 29458 |
| 457 | Ga0207667_10008673 | 3300025949 | Bacteria | 12051 |
| 458 | Ga0207667_10072070 | 3300025949 | Bacteria | 3591 |
| 459 | Ga0207667_10253870 | 3300025949 | Bacteria | 1799 |
| 460 | Ga0207667_10346354 | 3300025949 | Bacteria | 1516 |
| 461 | Ga0207667_10617899 | 3300025949 | Bacteria | 1091 |
| 462 | Ga0207667_10619589 | 3300025949 | Bacteria | 1090 |
| 463 | Ga0207651_10282454 | 3300025960 | Bacteria | 1372 |
| 464 | Ga0207651_11430641 | 3300025960 | Bacteria | 622 |
| 465 | Ga0207712_10004201 | 3300025961 | Bacteria | 9089 |
| 466 | Ga0207712_10253215 | 3300025961 | Bacteria | 1424 |
| 467 | Ga0207712_10357744 | 3300025961 | Bacteria | 1215 |
| 468 | Ga0207712_11788531 | 3300025961 | Bacteria | 551 |
| 469 | Ga0207668_10060983 | 3300025972 | Bacteria | 2650 |
| 470 | Ga0207668_11665739 | 3300025972 | Bacteria | 576 |
| 471 | Ga0207640_10178867 | 3300025981 | Bacteria | 1588 |
| 472 | Ga0207640_10207338 | 3300025981 | Bacteria | 1490 |
| 473 | Ga0207640_10910209 | 3300025981 | Bacteria | 769 |
| 474 | Ga0207640_10925196 | 3300025981 | Bacteria | 763 |
| 475 | Ga0207658_10026447 | 3300025986 | Bacteria | 4068 |
| 476 | Ga0207658_10106792 | 3300025986 | Unclassified | 2205 |
| 477 | Ga0207677_10142275 | 3300026023 | Bacteria | 1838 |
| 478 | Ga0207677_10284429 | 3300026023 | Bacteria | 1359 |
| 479 | Ga0207677_10369522 | 3300026023 | Bacteria | 1207 |
| 480 | Ga0207677_10422969 | 3300026023 | Bacteria | 1135 |
| 481 | Ga0207677_10487532 | 3300026023 | Bacteria | 1063 |
| 482 | Ga0207677_10656431 | 3300026023 | Bacteria | 926 |
| 483 | Ga0207677_10756108 | 3300026023 | Bacteria | 867 |
| 484 | Ga0207677_11167194 | 3300026023 | Bacteria | 704 |
| 485 | Ga0207677_11496225 | 3300026023 | Bacteria | 623 |
| 486 | Ga0207703_10001625 | 3300026035 | Bacteria | 20245 |
| 487 | Ga0207703_10423802 | 3300026035 | Bacteria | 1239 |
| 488 | Ga0207703_10910396 | 3300026035 | Bacteria | 842 |
| 489 | Ga0207639_10024131 | 3300026041 | Bacteria | 4397 |
| 490 | Ga0207639_10040933 | 3300026041 | Bacteria | 3462 |
| 491 | Ga0207639_11653178 | 3300026041 | Bacteria | 600 |
| 492 | Ga0207678_10170373 | 3300026067 | Bacteria | 1859 |
| 493 | Ga0207678_10441042 | 3300026067 | Bacteria | 1131 |
| 494 | Ga0207678_10578198 | 3300026067 | Bacteria | 984 |
| 495 | Ga0207708_10030195 | 3300026075 | Bacteria | 4110 |
| 496 | Ga0207708_10215985 | 3300026075 | Bacteria | 1534 |
| 497 | Ga0207708_10547439 | 3300026075 | Bacteria | 975 |
| 498 | Ga0207702_10012173 | 3300026078 | Bacteria | 7159 |
| 499 | Ga0207702_10129325 | 3300026078 | Bacteria | 2271 |
| 500 | Ga0207702_10434827 | 3300026078 | Bacteria | 1271 |
| 501 | Ga0207702_10740140 | 3300026078 | Bacteria | 970 |
| 502 | Ga0207702_11323409 | 3300026078 | Bacteria | 714 |
| 503 | Ga0207702_11394922 | 3300026078 | Bacteria | 694 |
| 504 | Ga0207702_12194378 | 3300026078 | Bacteria | 541 |
| 505 | Ga0207641_10007623 | 3300026088 | Bacteria | 8999 |
| 506 | Ga0207641_10203174 | 3300026088 | Bacteria | 1828 |
| 507 | Ga0207641_10379506 | 3300026088 | Bacteria | 1353 |
| 508 | Ga0207648_10139502 | 3300026089 | Unclassified | 2136 |
| 509 | Ga0207648_10169731 | 3300026089 | Bacteria | 1928 |
| 510 | Ga0207648_11020160 | 3300026089 | Bacteria | 775 |
| 511 | Ga0207676_10012542 | 3300026095 | Bacteria | 6077 |
| 512 | Ga0207676_10082449 | 3300026095 | Bacteria | 2616 |
| 513 | Ga0207676_10090865 | 3300026095 | Unclassified | 2507 |
| 514 | Ga0207676_11073057 | 3300026095 | Bacteria | 795 |
| 515 | Ga0207674_10000405 | 3300026116 | Bacteria | 55884 |
| 516 | Ga0207674_10052476 | 3300026116 | Bacteria | 4159 |
| 517 | Ga0207674_10059478 | 3300026116 | Bacteria | 3866 |
| 518 | Ga0207674_10229526 | 3300026116 | Bacteria | 1804 |
| 519 | Ga0207674_11500722 | 3300026116 | Bacteria | 643 |
| 520 | Ga0207674_12141616 | 3300026116 | Bacteria | 523 |
| 521 | Ga0207675_100004393 | 3300026118 | Bacteria | 13619 |
| 522 | Ga0207675_100007784 | 3300026118 | Bacteria | 10107 |
| 523 | Ga0207675_100071349 | 3300026118 | Bacteria | 3247 |
| 524 | Ga0207683_10010725 | 3300026121 | Bacteria | 7812 |
| 525 | Ga0207683_10026823 | 3300026121 | Unclassified | 4976 |
| 526 | Ga0207683_10199495 | 3300026121 | Bacteria | 1818 |
| 527 | Ga0207683_10507555 | 3300026121 | Bacteria | 1114 |
| 528 | Ga0207698_10000078 | 3300026142 | Bacteria | 65050 |
| 529 | Ga0207698_10002196 | 3300026142 | Bacteria | 11542 |
| 530 | Ga0207698_10088340 | 3300026142 | Bacteria | 2528 |
| 531 | Ga0207698_10284769 | 3300026142 | Bacteria | 1530 |
| 532 | Ga0209971_1120311 | 3300027682 | Bacteria | 645 |
| 533 | Ga0209813_10107658 | 3300027866 | Bacteria | 956 |
| 534 | Ga0209974_10164236 | 3300027876 | Bacteria | 807 |
| 535 | Ga0207428_10024405 | 3300027907 | Bacteria | 5076 |
| 536 | Ga0207428_10233919 | 3300027907 | Bacteria | 1374 |
| 537 | Ga0207428_10807162 | 3300027907 | Bacteria | 666 |
| 538 | Ga0268266_10133401 | 3300028379 | Bacteria | 2223 |
| 539 | Ga0268266_10238596 | 3300028379 | Bacteria | 1677 |
| 540 | Ga0268265_10024124 | 3300028380 | Bacteria | 4298 |
| 541 | Ga0268265_10032259 | 3300028380 | Unclassified | 3794 |
| 542 | Ga0268265_10140220 | 3300028380 | Bacteria | 2023 |
| 543 | Ga0268265_12285336 | 3300028380 | Bacteria | 548 |
| 544 | Ga0268264_10130699 | 3300028381 | Bacteria | 2225 |
| 545 | Ga0268264_10624537 | 3300028381 | Bacteria | 1064 |
| 546 | Ga0268264_11437897 | 3300028381 | Bacteria | 700 |
| 547 | Ga0307408_100439923 | 3300031548 | Bacteria | 1129 |
| 548 | Ga0307408_100839797 | 3300031548 | Bacteria | 837 |
| 549 | Ga0307408_101157656 | 3300031548 | Bacteria | 720 |
| 550 | Ga0316575_10001600 | 3300031665 | Bacteria | 7380 |
| 551 | Ga0316579_10011276 | 3300031691 | Bacteria | 3796 |
| 552 | Ga0316576_10050031 | 3300031727 | Bacteria | 3037 |
| 553 | Ga0316576_10171686 | 3300031727 | Bacteria | 1636 |
| 554 | Ga0316578_10004010 | 3300031728 | Bacteria | 6873 |
| 555 | Ga0316578_10208559 | 3300031728 | Bacteria | 1175 |
| 556 | Ga0307405_10297494 | 3300031731 | Bacteria | 1223 |
| 557 | Ga0307405_11226242 | 3300031731 | Bacteria | 650 |
| 558 | Ga0316577_10021111 | 3300031733 | Bacteria | 3611 |
| 559 | Ga0316577_10235428 | 3300031733 | Bacteria | 1035 |
| 560 | Ga0307413_10029884 | 3300031824 | Bacteria | 3055 |
| 561 | Ga0307413_10113399 | 3300031824 | Bacteria | 1820 |
| 562 | Ga0307413_10326403 | 3300031824 | Bacteria | 1174 |
| 563 | Ga0307410_11131806 | 3300031852 | Bacteria | 680 |
| 564 | Ga0307406_10058838 | 3300031901 | Bacteria | 2471 |
| 565 | Ga0307406_10395189 | 3300031901 | Bacteria | 1094 |
| 566 | Ga0307406_10722552 | 3300031901 | Bacteria | 834 |
| 567 | Ga0307406_10728478 | 3300031901 | Bacteria | 830 |
| 568 | Ga0307406_11080728 | 3300031901 | Bacteria | 692 |
| 569 | Ga0307406_11540519 | 3300031901 | Bacteria | 586 |
| 570 | Ga0307412_10365308 | 3300031911 | Bacteria | 1164 |
| 571 | Ga0307409_100727410 | 3300031995 | Bacteria | 994 |
| 572 | Ga0307416_100177135 | 3300032002 | Bacteria | 1994 |
| 573 | Ga0307416_100531847 | 3300032002 | Bacteria | 1246 |
| 574 | Ga0307416_103788366 | 3300032002 | Bacteria | 506 |
| 575 | Ga0307414_10122243 | 3300032004 | Bacteria | 2004 |
| 576 | Ga0307414_10511001 | 3300032004 | Bacteria | 1065 |
| 577 | Ga0307414_11144964 | 3300032004 | Bacteria | 719 |
| 578 | Ga0307411_10926525 | 3300032005 | Bacteria | 776 |
| 579 | Ga0307411_11015558 | 3300032005 | Bacteria | 743 |
| 580 | Ga0307411_11158205 | 3300032005 | Bacteria | 699 |
| 581 | Ga0307415_100429465 | 3300032126 | Bacteria | 1136 |
| 582 | Ga0307415_100498756 | 3300032126 | Bacteria | 1064 |
| 583 | Ga0316583_10114392 | 3300032133 | Bacteria | 941 |
| 584 | Ga0316593_10007319 | 3300032168 | Bacteria | 3026 |
| 585 | Ga0316586_1014057 | 3300033527 | Bacteria | 1260 |
| 586 | Ga0316587_1062345 | 3300033529 | Bacteria | 692 |
| 587 | Ga0316596_1076268 | 3300033541 | Bacteria | 899 |
| 588 | Ga0373940_0251984 | 3300035088 | Bacteria | 595 |
| 589 | Ga0373952_0169780 | 3300035092 | Bacteria | 623 |
| 590 | Ga0373932_0011563 | 3300035112 | Bacteria | 2159 |
| 591 | Ga0373939_0159872 | 3300035114 | Bacteria | 826 |
| 592 | Ga0373953_0005571 | 3300035117 | Bacteria | 4095 |
| 593 | Ga0373953_0407045 | 3300035117 | Bacteria | 599 |
| 594 | Ga0373954_0010182 | 3300035118 | Bacteria | 4144 |
| 595 | Ga0373956_0011874 | 3300035119 | Bacteria | 3598 |
| 596 | Ga0373957_0176131 | 3300035120 | Bacteria | 885 |
| 597 | Ga0373957_0417527 | 3300035120 | Bacteria | 578 |
| 598 | Ga0373955_0018329 | 3300035172 | Bacteria | 3480 |
| 599 | Ga0373955_0078130 | 3300035172 | Bacteria | 1865 |
| 600 | Ga0373942_0194021 | 3300035207 | Bacteria | 671 |
| 601 | Ga0373962_0016027 | 3300035242 | Bacteria | 1928 |
| 602 | Ga0373962_0204756 | 3300035242 | Bacteria | 669 |
| 603 | Ga0316574_0007133 | 3300035398 | Bacteria | 6107 |
| 604 | Ga0373924_0014182 | 3300035410 | Bacteria | 3009 |
| 605 | Ga0373931_0258353 | 3300035691 | Bacteria | 1062 |
| 606 | Ga0373933_0003076 | 3300035724 | Bacteria | 9302 |
| 607 | Ga0373937_0011980 | 3300036401 | Bacteria | 7612 |
| 608 | Ga0316582_0016585 | 3300036647 | Bacteria | 4239 |
| 609 | Ga0316582_0195668 | 3300036647 | Bacteria | 1378 |
| 610 | Ga0316582_0353159 | 3300036647 | Bacteria | 1011 |
| 611 | Ga0316584_0002064 | 3300036712 | Bacteria | 12572 |
| 612 | Ga0316584_0057306 | 3300036712 | Bacteria | 2916 |
| 613 | Ga0395900_0356212 | 3300037418 | Bacteria | 1436 |
| 614 | Ga0395900_1217516 | 3300037418 | Bacteria | 668 |
| 615 | Ga0395900_1656355 | 3300037418 | Bacteria | 551 |
| 616 | Ga0395898_0163578 | 3300037466 | Bacteria | 2129 |
| 617 | Ga0395901_0264956 | 3300038443 | Bacteria | 1788 |
| 618 | Ga0436362_1073426 | 3300039453 | Bacteria | 533 |
| 619 | Ga0439465_0024249 | 3300041413 | Bacteria | 1911 |
| 620 | Ga0439465_0197368 | 3300041413 | Bacteria | 732 |
| 621 | Ga0451795_0846601 | 3300041456 | Bacteria | 785 |
| 622 | Ga0451807_2331222 | 3300041486 | Bacteria | 625 |
| 623 | Ga0451807_2660586 | 3300041486 | Bacteria | 816 |
| 624 | Ga0439448_0229132 | 3300042005 | Bacteria | 654 |
| 625 | Ga0439448_0287680 | 3300042005 | Bacteria | 583 |
| 626 | Ga0439450_012941 | 3300042008 | Bacteria | 1666 |
| 627 | Ga0450923_044577 | 3300042125 | Bacteria | 940 |
| 628 | Ga0439435_0057780 | 3300042436 | Bacteria | 1124 |
| 629 | Ga0439459_0004614 | 3300042438 | Bacteria | 2224 |
| 630 | Ga0439464_0054081 | 3300042439 | Bacteria | 1166 |
| 631 | Ga0439440_0009970 | 3300042993 | Bacteria | 1976 |
| 632 | Ga0466969_0081090 | 3300044656 | Bacteria | 1549 |
| 633 | Ga0466965_0227077 | 3300044683 | Bacteria | 996 |
| 634 | Ga0466966_0138851 | 3300044684 | Bacteria | 1486 |
| 635 | Ga0466961_0519695 | 3300044693 | Bacteria | 718 |
| 636 | Ga0466961_0635230 | 3300044693 | Bacteria | 641 |
| 637 | Ga0466963_0591109 | 3300044694 | Bacteria | 784 |
| 638 | Ga0466963_1109621 | 3300044694 | Bacteria | 556 |
| 639 | Ga0466971_0587126 | 3300044719 | Bacteria | 555 |
| 640 | Ga0466970_0396247 | 3300044765 | Bacteria | 787 |
| 641 | Ga0466970_0592951 | 3300044765 | Bacteria | 642 |
| 642 | Ga0466957_0082035 | 3300044842 | Bacteria | 2009 |
| 643 | Ga0466957_0313114 | 3300044842 | Bacteria | 1057 |
| 644 | Ga0466960_0007662 | 3300044901 | Bacteria | 4395 |
| 645 | Ga0466958_0166076 | 3300045836 | Bacteria | 1396 |
| 646 | Ga0466958_0504308 | 3300045836 | Bacteria | 785 |
| 647 | Ga0466967_0000739 | 3300045976 | Bacteria | 16761 |
| 648 | Ga0466967_0454479 | 3300045976 | Bacteria | 1252 |
| 649 | Ga0466967_0645276 | 3300045976 | Bacteria | 1047 |
| 650 | Ga0466967_1230676 | 3300045976 | Bacteria | 746 |
| 651 | Ga0466967_2194709 | 3300045976 | Bacteria | 548 |
| 652 | Ga0466967_2563465 | 3300045976 | Bacteria | 505 |
| 653 | Ga0495590_0001438 | 3300046457 | Bacteria | 10274 |
| 654 | Ga0495641_0095566 | 3300046461 | Bacteria | 1327 |
| 655 | Ga0495584_0214622 | 3300046491 | Bacteria | 978 |
| 656 | Ga0495606_0002983 | 3300046507 | Bacteria | 18608 |
| 657 | Ga0495642_0034777 | 3300046528 | Bacteria | 2031 |
| 658 | Ga0495640_0086467 | 3300046533 | Bacteria | 2076 |
| 659 | Ga0495640_0104777 | 3300046533 | Bacteria | 1853 |
| 660 | Ga0495587_0743784 | 3300046536 | Bacteria | 537 |
| 661 | Ga0495598_0040556 | 3300046537 | Bacteria | 1358 |
| 662 | Ga0495667_0102790 | 3300046559 | Bacteria | 1848 |
| 663 | Ga0495656_0406633 | 3300046615 | Bacteria | 713 |
| 664 | Ga0495656_0581439 | 3300046615 | Bacteria | 598 |
| 665 | Ga0495668_0002487 | 3300046616 | Bacteria | 15099 |
| 666 | Ga0495625_0014245 | 3300046660 | Bacteria | 6357 |
| 667 | Ga0495625_0324273 | 3300046660 | Bacteria | 980 |
| 668 | Ga0495635_0081532 | 3300046663 | Bacteria | 2214 |
| 669 | Ga0495659_0072648 | 3300046664 | Bacteria | 1291 |
| 670 | Ga0495659_0132995 | 3300046664 | Bacteria | 987 |
| 671 | Ga0495647_0045876 | 3300046681 | Bacteria | 1681 |
| 672 | Ga0495669_0221135 | 3300046684 | Bacteria | 908 |
| 673 | Ga0495581_0321925 | 3300047315 | Bacteria | 903 |
| 674 | Ga0495636_0471550 | 3300047318 | Bacteria | 604 |
| 675 | Ga0495636_0633288 | 3300047318 | Bacteria | 524 |
| 676 | Ga0495636_0697513 | 3300047318 | Bacteria | 501 |
| 677 | Ga0495676_0132259 | 3300047321 | Bacteria | 1799 |
| 678 | Ga0495680_0233594 | 3300047322 | Bacteria | 1308 |
| 679 | Ga0495683_0101187 | 3300047323 | Bacteria | 1385 |
| 680 | Ga0495686_0261887 | 3300047472 | Bacteria | 968 |
| 681 | Ga0495602_0191483 | 3300048088 | Bacteria | 1568 |
| 682 | Ga0495614_0539767 | 3300048089 | Bacteria | 557 |
| 683 | Ga0495626_0001210 | 3300048091 | Bacteria | 21305 |
| 684 | Ga0496102_0115362 | 3300048905 | Bacteria | 2506 |
| 685 | Ga0496102_0204800 | 3300048905 | Bacteria | 1860 |
| 686 | Ga0496104_0000086 | 3300048907 | Bacteria | 89916 |
| 687 | Ga0496104_0027869 | 3300048907 | Bacteria | 5230 |
| 688 | Ga0496104_0251154 | 3300048907 | Bacteria | 1681 |
| 689 | Ga0496104_1007604 | 3300048907 | Bacteria | 737 |
| 690 | Ga0496104_1425882 | 3300048907 | Bacteria | 596 |
| 691 | Ga0496105_0000126 | 3300048908 | Bacteria | 51169 |
| 692 | Ga0496105_0116726 | 3300048908 | Bacteria | 2202 |
| 693 | Ga0496105_0187311 | 3300048908 | Bacteria | 1693 |
| 694 | Ga0496106_1250834 | 3300048909 | Bacteria | 578 |
| 695 | Ga0496107_0762153 | 3300048910 | Bacteria | 710 |
| 696 | Ga0496108_0093186 | 3300048911 | Bacteria | 2562 |
| 697 | Ga0496108_0255872 | 3300048911 | Bacteria | 1523 |
| 698 | Ga0496109_0002834 | 3300048912 | Bacteria | 14531 |
| 699 | Ga0496109_0682699 | 3300048912 | Bacteria | 964 |
| 700 | Ga0496109_0822649 | 3300048912 | Bacteria | 867 |
| 701 | Ga0496109_0853634 | 3300048912 | Bacteria | 848 |
| 702 | Ga0496110_0018428 | 3300048913 | Bacteria | 5854 |
| 703 | Ga0496110_0160757 | 3300048913 | Bacteria | 2036 |
| 704 | Ga0496110_0399204 | 3300048913 | Bacteria | 1253 |
| 705 | Ga0496111_0262548 | 3300048914 | Bacteria | 1281 |
| 706 | Ga0496111_0600121 | 3300048914 | Bacteria | 806 |
| 707 | Ga0496112_0056822 | 3300048915 | Bacteria | 3852 |
| 708 | Ga0496112_0078054 | 3300048915 | Bacteria | 3275 |
| 709 | Ga0496113_0009600 | 3300048916 | Bacteria | 6351 |
| 710 | Ga0496113_0110508 | 3300048916 | Bacteria | 2139 |
| 711 | Ga0496114_0126356 | 3300048917 | Bacteria | 2205 |
| 712 | Ga0496114_0353088 | 3300048917 | Bacteria | 1300 |
| 713 | Ga0496114_1237384 | 3300048917 | Bacteria | 633 |
| 714 | Ga0496115_0095992 | 3300048918 | Bacteria | 2427 |
| 715 | Ga0496115_0847580 | 3300048918 | Bacteria | 708 |
| 716 | Ga0496117_0277177 | 3300048920 | Bacteria | 900 |
| 717 | Ga0496118_0046316 | 3300048921 | Bacteria | 3385 |
| 718 | Ga0496118_0502711 | 3300048921 | Bacteria | 602 |
| 719 | Ga0496119_0007381 | 3300048922 | Bacteria | 9924 |
| 720 | Ga0496119_0024772 | 3300048922 | Bacteria | 4210 |
| 721 | Ga0496119_0060350 | 3300048922 | Bacteria | 2271 |
| 722 | Ga0496120_0000929 | 3300048923 | Bacteria | 40563 |
| 723 | Ga0496120_0002952 | 3300048923 | Bacteria | 16205 |
| 724 | Ga0496120_0018072 | 3300048923 | Bacteria | 4554 |
| 725 | Ga0496125_0120419 | 3300048928 | Bacteria | 1874 |
| 726 | Ga0496126_0372998 | 3300048929 | Bacteria | 1163 |
| 727 | Ga0496126_0678838 | 3300048929 | Bacteria | 803 |
| 728 | Ga0501031_0252010 | 3300049568 | Bacteria | 1147 |
| 729 | Ga0501032_0200840 | 3300049569 | Bacteria | 1301 |
| 730 | Ga0501032_0707410 | 3300049569 | Bacteria | 638 |
| 731 | Ga0501033_0021283 | 3300049570 | Bacteria | 4892 |
| 732 | Ga0501033_0108029 | 3300049570 | Bacteria | 2027 |
| 733 | Ga0501033_0117903 | 3300049570 | Bacteria | 1928 |
| 734 | Ga0501033_0319448 | 3300049570 | Bacteria | 1091 |
| 735 | Ga0501033_0367901 | 3300049570 | Bacteria | 1005 |
| 736 | Ga0501033_0660233 | 3300049570 | Bacteria | 714 |
| 737 | Ga0501034_0006121 | 3300049571 | Bacteria | 12981 |
| 738 | Ga0501034_0085168 | 3300049571 | Bacteria | 3162 |
| 739 | Ga0501034_0271558 | 3300049571 | Bacteria | 1636 |
| 740 | Ga0501036_0012840 | 3300049572 | Bacteria | 6952 |
| 741 | Ga0501036_0148278 | 3300049572 | Bacteria | 1979 |
| 742 | Ga0501036_0154879 | 3300049572 | Bacteria | 1933 |
| 743 | Ga0501036_0859529 | 3300049572 | Bacteria | 745 |
| 744 | Ga0501036_0893982 | 3300049572 | Bacteria | 729 |
| 745 | Ga0501037_0028904 | 3300049573 | Bacteria | 4096 |
| 746 | Ga0501037_0064654 | 3300049573 | Bacteria | 2666 |
| 747 | Ga0501038_0054733 | 3300049574 | Bacteria | 3430 |
| 748 | Ga0501038_0064680 | 3300049574 | Bacteria | 3118 |
| 749 | Ga0501038_0168500 | 3300049574 | Bacteria | 1775 |
| 750 | Ga0501038_0358256 | 3300049574 | Bacteria | 1135 |
| 751 | Ga0501038_0845179 | 3300049574 | Bacteria | 678 |
| 752 | Ga0501039_0037099 | 3300049575 | Bacteria | 3762 |
| 753 | Ga0501039_1105477 | 3300049575 | Bacteria | 614 |
| 754 | Ga0501040_0053540 | 3300049576 | Bacteria | 2764 |
| 755 | Ga0501040_0187258 | 3300049576 | Bacteria | 1468 |
| 756 | Ga0501040_0386731 | 3300049576 | Bacteria | 1004 |
| 757 | Ga0501040_1286106 | 3300049576 | Bacteria | 531 |
| 758 | Ga0501042_0007990 | 3300049578 | Bacteria | 6964 |
| 759 | Ga0501042_0109698 | 3300049578 | Bacteria | 1987 |
| 760 | Ga0501042_0198013 | 3300049578 | Bacteria | 1449 |
| 761 | Ga0501043_0093461 | 3300049579 | Bacteria | 2364 |
| 762 | Ga0501043_0098355 | 3300049579 | Bacteria | 2300 |
| 763 | Ga0501043_0243849 | 3300049579 | Bacteria | 1385 |
| 764 | Ga0501043_0753321 | 3300049579 | Bacteria | 708 |
| 765 | Ga0501046_0022138 | 3300049580 | Bacteria | 5238 |
| 766 | Ga0501046_0373368 | 3300049580 | Bacteria | 1033 |
| 767 | Ga0501046_0529657 | 3300049580 | Bacteria | 841 |
| 768 | Ga0501046_0875744 | 3300049580 | Unclassified | 627 |
| 769 | Ga0501047_0074959 | 3300049581 | Bacteria | 3256 |
| 770 | Ga0501047_0080728 | 3300049581 | Bacteria | 3126 |
| 771 | Ga0501047_0111398 | 3300049581 | Bacteria | 2619 |
| 772 | Ga0501047_0121925 | 3300049581 | Bacteria | 2488 |
| 773 | Ga0501048_0094392 | 3300049582 | Bacteria | 2110 |
| 774 | Ga0501048_0495978 | 3300049582 | Bacteria | 875 |
| 775 | Ga0501048_0829302 | 3300049582 | Bacteria | 665 |
| 776 | Ga0501068_0607586 | 3300049584 | Bacteria | 713 |
| 777 | Ga0501068_0611256 | 3300049584 | Bacteria | 711 |
| 778 | Ga0501069_0302026 | 3300049585 | Bacteria | 939 |
| 779 | Ga0501070_0131590 | 3300049586 | Bacteria | 2066 |
| 780 | Ga0501070_0264456 | 3300049586 | Bacteria | 1406 |
| 781 | Ga0501070_0474318 | 3300049586 | Bacteria | 1007 |
| 782 | Ga0501070_0823189 | 3300049586 | Bacteria | 728 |
| 783 | Ga0501070_0827838 | 3300049586 | Bacteria | 725 |
| 784 | Ga0501072_0024908 | 3300049588 | Bacteria | 4659 |
| 785 | Ga0501072_0288915 | 3300049588 | Bacteria | 1304 |
| 786 | Ga0501072_0424607 | 3300049588 | Bacteria | 1054 |
| 787 | Ga0501072_1179167 | 3300049588 | Bacteria | 595 |
| 788 | Ga0501073_0095252 | 3300049589 | Bacteria | 2067 |
| 789 | Ga0501074_0031707 | 3300049590 | Bacteria | 3829 |
| 790 | Ga0501074_0147029 | 3300049590 | Bacteria | 1685 |
| 791 | Ga0501075_0014503 | 3300049591 | Bacteria | 5648 |
| 792 | Ga0501075_0242739 | 3300049591 | Bacteria | 1373 |
| 793 | Ga0501075_0574857 | 3300049591 | Bacteria | 860 |
| 794 | Ga0501075_0660678 | 3300049591 | Bacteria | 797 |
| 795 | Ga0501075_1016725 | 3300049591 | Bacteria | 630 |
| 796 | Ga0501076_0056232 | 3300049592 | Bacteria | 3122 |
| 797 | Ga0501079_0116617 | 3300049741 | Bacteria | 2076 |
| 798 | Ga0501079_0128982 | 3300049741 | Bacteria | 1968 |
| 799 | Ga0501079_0651691 | 3300049741 | Bacteria | 829 |
| 800 | Ga0501079_0917777 | 3300049741 | Bacteria | 690 |
| 801 | Ga0501079_0941400 | 3300049741 | Bacteria | 680 |
| 802 | Ga0501079_1472496 | 3300049741 | Bacteria | 536 |
| 803 | Ga0501080_0078366 | 3300049742 | Bacteria | 3073 |
| 804 | Ga0501080_0168721 | 3300049742 | Bacteria | 2019 |
| 805 | Ga0501081_0004930 | 3300049743 | Bacteria | 8582 |
| 806 | Ga0501035_0004214 | 3300049822 | Bacteria | 13666 |
| 807 | Ga0501035_0016512 | 3300049822 | Bacteria | 6807 |
| 808 | Ga0501035_0022802 | 3300049822 | Bacteria | 5750 |
| 809 | Ga0501035_0032464 | 3300049822 | Bacteria | 4749 |
| 810 | Ga0501035_0066675 | 3300049822 | Bacteria | 3194 |
| 811 | Ga0501035_0134017 | 3300049822 | Bacteria | 2158 |
| 812 | Ga0501044_0002891 | 3300049823 | Bacteria | 19562 |
| 813 | Ga0501044_0014143 | 3300049823 | Bacteria | 8616 |
| 814 | Ga0501045_0036012 | 3300049824 | Bacteria | 3594 |
| 815 | Ga0501045_0044865 | 3300049824 | Bacteria | 3220 |
| 816 | Ga0501045_0056807 | 3300049824 | Bacteria | 2863 |
| 817 | Ga0501045_0135195 | 3300049824 | Bacteria | 1833 |
| 818 | Ga0501045_0471056 | 3300049824 | Bacteria | 933 |
| 819 | Ga0501045_0795859 | 3300049824 | Bacteria | 696 |
| 820 | nmdc:mga03683_582541_c1 | 3300050489 | Bacteria | 547 |
| 821 | nmdc:mga06z11_463191_c1 | 3300050494 | Bacteria | 766 |
| 822 | nmdc:mga04h51_126597_c1 | 3300050495 | Bacteria | 956 |
| 823 | nmdc:mga05p37_52206_c1 | 3300050507 | Bacteria | 4083 |
| 824 | nmdc:mga05p37_528457_c1 | 3300050507 | Bacteria | 1348 |
| 825 | nmdc:mga05p37_903526_c1 | 3300050507 | Bacteria | 952 |
| 826 | nmdc:mga09592_378_c1 | 3300050508 | Bacteria | 32615 |
| 827 | nmdc:mga09592_40034_c1 | 3300050508 | Bacteria | 3937 |
| 828 | nmdc:mga09592_508379_c1 | 3300050508 | Bacteria | 1037 |
| 829 | nmdc:mga09592_714634_c1 | 3300050508 | Bacteria | 852 |
| 830 | nmdc:mga0qj67_126_c1 | 3300050509 | Bacteria | 50369 |
| 831 | nmdc:mga0qj67_142815_c1 | 3300050509 | Bacteria | 1941 |
| 832 | nmdc:mga0qj67_219647_c1 | 3300050509 | Bacteria | 1543 |
| 833 | nmdc:mga0qj67_456379_c1 | 3300050509 | Bacteria | 1029 |
| 834 | nmdc:mga06r32_182_c1 | 3300050510 | Bacteria | 49502 |
| 835 | nmdc:mga06r32_8009_c1 | 3300050510 | Bacteria | 9501 |
| 836 | nmdc:mga06r32_929958_c1 | 3300050510 | Bacteria | 825 |
| 837 | nmdc:mga08y16_1114338_c1 | 3300050511 | Bacteria | 764 |
| 838 | nmdc:mga08y16_123231_c1 | 3300050511 | Unclassified | 2697 |
| 839 | nmdc:mga08y16_186300_c1 | 3300050511 | Bacteria | 2154 |
| 840 | nmdc:mga08y16_235306_c1 | 3300050511 | Bacteria | 1894 |
| 841 | nmdc:mga08y16_326206_c1 | 3300050511 | Bacteria | 1580 |
| 842 | nmdc:mga08y16_97144_c1 | 3300050511 | Bacteria | 3067 |
| 843 | nmdc:mga0n895_131099_c1 | 3300050512 | Bacteria | 2532 |
| 844 | nmdc:mga0n895_1535195_c1 | 3300050512 | Bacteria | 632 |
| 845 | nmdc:mga0n895_228791_c1 | 3300050512 | Bacteria | 1888 |
| 846 | nmdc:mga0n895_378445_c1 | 3300050512 | Bacteria | 1433 |
| 847 | nmdc:mga0n895_986799_c1 | 3300050512 | Bacteria | 824 |
| 848 | nmdc:mga0n895_992800_c1 | 3300050512 | Bacteria | 821 |
| 849 | nmdc:mga0rr50_337482_c1 | 3300050513 | Bacteria | 1266 |
| 850 | nmdc:mga0rr50_930899_c1 | 3300050513 | Bacteria | 741 |
| 851 | nmdc:mga0a205_1473668_c1 | 3300050515 | Bacteria | 529 |
| 852 | nmdc:mga0a205_154952_c1 | 3300050515 | Bacteria | 2190 |
| 853 | nmdc:mga0a205_22886_c1 | 3300050515 | Bacteria | 5925 |
| 854 | nmdc:mga0a205_598576_c1 | 3300050515 | Bacteria | 956 |
| 855 | Ga0495601_0037186 | 3300053077 | Bacteria | 3043 |
| 856 | Ga0500635_0028151 | 3300053080 | Bacteria | 1792 |
| 857 | Ga0495595_0032151 | 3300053084 | Bacteria | 2362 |
| 858 | Ga0495619_0002780 | 3300053085 | Bacteria | 11418 |
| 859 | Ga0500651_0005924 | 3300053093 | Bacteria | 7012 |
| 860 | Ga0500560_003627 | 3300053107 | Bacteria | 3153 |
| 861 | Ga0500572_078659 | 3300053111 | Bacteria | 1030 |
| 862 | Ga0500559_0014784 | 3300053136 | Bacteria | 3297 |
| 863 | Ga0500564_287622 | 3300053138 | Bacteria | 636 |
| 864 | Ga0500590_000842 | 3300053148 | Bacteria | 11534 |
| 865 | Ga0500616_0000183 | 3300053153 | Bacteria | 103074 |
| 866 | Ga0500616_0002208 | 3300053153 | Bacteria | 16677 |
| 867 | Ga0500616_0149350 | 3300053153 | Bacteria | 1083 |
| 868 | Ga0500620_000536 | 3300053155 | Bacteria | 6611 |
| 869 | Ga0500645_015972 | 3300053730 | Bacteria | 2372 |
| 870 | Ga0501084_0303688 | 3300054114 | Bacteria | 1348 |
| 871 | Ga0501084_0642123 | 3300054114 | Bacteria | 896 |
| 872 | Ga0590075_011698 | 3300059424 | Bacteria | 2125 |
| 873 | Ga0590077_104633 | 3300059426 | Bacteria | 663 |
| 874 | Ga0501082_0110640 | 3300060353 | Bacteria | 2378 |
| 875 | Ga0466962_0085882 | 3300061719 | Bacteria | 1506 |
| 876 | Ga0466962_0164101 | 3300061719 | Bacteria | 1080 |
| 877 | Ga0466962_0624659 | 3300061719 | Bacteria | 550 |
| 878 | Ga0530510_0008102 | 3300061734 | Bacteria | 7325 |
| 879 | 2831937025 | 2831935698 | Bacteria | 5963223 |
| 880 | 2855675010 | 2855670206 | Bacteria | 7120389 |
| 881 | 2855679973 | 2855676851 | Bacteria | 7063653 |
| 882 | 2857289992 | 2857288857 | Bacteria | 7189066 |
| 883 | 2858849483 | 2858848962 | Bacteria | 6963058 |
| 884 | 2858882372 | 2858882152 | Bacteria | 7230291 |
| 885 | 2858892786 | 2858888857 | Bacteria | 7060307 |
| 886 | 2867507342 | 2867507094 | Bacteria | 6506033 |
| 887 | 2869050593 | 2869048445 | Bacteria | 6875584 |
| 888 | 2869066345 | 2869061728 | Bacteria | 7112407 |
| 889 | 2869074240 | 2869068681 | Bacteria | 7205615 |
| 890 | 2880490990 | 2880489317 | Bacteria | 7096270 |
| 891 | 2880501525 | 2880495981 | Bacteria | 7340502 |
| 892 | 2887480962 | 2887478801 | Bacteria | 8972725 |
| 893 | 2929223648 | 2929219909 | Bacteria | 6984360 |
| 894 | 2929230004 | 2929226422 | Bacteria | 7248583 |
| 895 | 2954009797 | 2954002825 | Bacteria | 9173742 |
| 896 | 2996225229 | 2996221748 | Bacteria | 6799777 |
| 897 | 3006427501 | 3006425503 | Bacteria | 6491253 |
| 898 | 8003836806 | 8003830390 | Bacteria | 6541657 |
| 899 | 8045834107 | 8045830549 | Bacteria | 4444727 |
| 900 | 8054709881 | 8054704163 | Bacteria | 7247792 |
| 901 | 8056061431 | 8056060235 | Bacteria | 7259403 |
| 902 | Ga0501045_0131245 | |||
| 903 | SwRhRL3b_contig_3460783 | |||
| 904 | JGI24743J22301_10107733 | |||
| 905 | JGI24035J26624_1009098 | |||
| 906 | JGI24034J26672_10053415 | |||
| 907 | JGI24751J29686_10060933 | |||
| 908 | JGI25405J52794_10061110 | |||
| 909 | JGI25405J52794_10100024 | |||
| 910 | Ga0065704_10343157 | |||
| 911 | Ga0065712_10136214 | |||
| 912 | Ga0065712_10245180 | |||
| 913 | Ga0065715_10213745 | |||
| 914 | Ga0065707_10097402 | |||
| 915 | Ga0065707_10154738 | |||
| 916 | Ga0070658_10367241 | |||
| 917 | Ga0070658_10373820 | |||
| 918 | Ga0070658_10586158 | |||
| 919 | Ga0070658_10845987 | |||
| 920 | Ga0070676_10150239 | |||
| 921 | Ga0070676_10217824 | |||
| 922 | Ga0070683_100009018 | |||
| 923 | Ga0070683_100340788 | |||
| 924 | Ga0070683_100913565 | |||
| 925 | Ga0070690_100017828 | |||
| 926 | Ga0070690_100191427 | |||
| 927 | Ga0070670_100029747 | |||
| 928 | Ga0070670_100847248 | |||
| 929 | Ga0070677_10004811 | |||
| 930 | Ga0070677_10045918 | |||
| 931 | Ga0070677_10069375 | |||
| 932 | Ga0070677_10158051 | |||
| 933 | Ga0068869_100002221 | |||
| 934 | Ga0068869_100071156 | |||
| 935 | Ga0068869_100110311 | |||
| 936 | Ga0068869_101018754 | |||
| 937 | Ga0070666_10032828 | |||
| 938 | Ga0070666_10418801 | |||
| 939 | Ga0070666_10521855 | |||
| 940 | Ga0070682_100433314 | |||
| 941 | Ga0070682_100776759 | |||
| 942 | Ga0068868_100038641 | |||
| 943 | Ga0068868_100278107 | |||
| 944 | Ga0068868_100287642 | |||
| 945 | Ga0068868_100549378 | |||
| 946 | Ga0068868_100632765 | |||
| 947 | Ga0068868_100673874 | |||
| 948 | Ga0068868_101189418 | |||
| 949 | Ga0068868_101992326 | |||
| 950 | Ga0070660_100038449 | |||
| 951 | Ga0070660_100273953 | |||
| 952 | Ga0070660_100289994 | |||
| 953 | Ga0070660_100319429 | |||
| 954 | Ga0070660_100523295 | |||
| 955 | Ga0070660_100540999 | |||
| 956 | Ga0070689_100659626 | |||
| 957 | Ga0070691_10479183 | |||
| 958 | Ga0070691_10534184 | |||
| 959 | Ga0070687_100472298 | |||
| 960 | Ga0070661_100084028 | |||
| 961 | Ga0070661_101117545 | |||
| 962 | Ga0070692_10041858 | |||
| 963 | Ga0070692_10122283 | |||
| 964 | Ga0070692_10145507 | |||
| 965 | Ga0070692_10177713 | |||
| 966 | Ga0070692_10224424 | |||
| 967 | Ga0070668_100279897 | |||
| 968 | Ga0070668_100616145 | |||
| 969 | Ga0070669_100013184 | |||
| 970 | Ga0070669_100515594 | |||
| 971 | Ga0070675_100006132 | |||
| 972 | Ga0070675_100033370 | |||
| 973 | Ga0070675_100420627 | |||
| 974 | Ga0070675_100537655 | |||
| 975 | Ga0070675_100721451 | |||
| 976 | Ga0070671_100097228 | |||
| 977 | Ga0070671_100202232 | |||
| 978 | Ga0070671_100352062 | |||
| 979 | Ga0070671_100699861 | |||
| 980 | Ga0070671_100746074 | |||
| 981 | Ga0070674_100000544 | |||
| 982 | Ga0070674_100167708 | |||
| 983 | Ga0070673_100145181 | |||
| 984 | Ga0070673_100158082 | |||
| 985 | Ga0070673_102144682 | |||
| 986 | Ga0070688_100199593 | |||
| 987 | Ga0070659_100000749 | |||
| 988 | Ga0070659_100129103 | |||
| 989 | Ga0070659_100461731 | |||
| 990 | Ga0070659_100579527 | |||
| 991 | Ga0070667_100025125 | |||
| 992 | Ga0070667_100106006 | |||
| 993 | Ga0070714_100095290 | |||
| 994 | Ga0070701_10077193 | |||
| 995 | Ga0070701_10207908 | |||
| 996 | Ga0070701_10501528 | |||
| 997 | Ga0070705_100596208 | |||
| 998 | Ga0070700_100030218 | |||
| 999 | Ga0070700_100115966 | |||
| 1000 | Ga0070700_100907334 | |||
| 1001 | Ga0070700_101024352 | |||
| 1002 | Ga0070694_100023115 | |||
| 1003 | Ga0070694_100161379 | |||
| 1004 | Ga0070663_100411390 | |||
| 1005 | Ga0070663_100448640 | |||
| 1006 | Ga0070663_100499031 | |||
| 1007 | Ga0070663_100922495 | |||
| 1008 | Ga0070678_100042329 | |||
| 1009 | Ga0070678_100366712 | |||
| 1010 | Ga0070678_100691760 | |||
| 1011 | Ga0070678_100746672 | |||
| 1012 | Ga0070662_100563455 | |||
| 1013 | Ga0070681_10008128 | |||
| 1014 | Ga0068867_100090993 | |||
| 1015 | Ga0068867_100485513 | |||
| 1016 | Ga0068867_100659766 | |||
| 1017 | Ga0068867_101631604 | |||
| 1018 | Ga0070685_10057253 | |||
| 1019 | Ga0070685_10393956 | |||
| 1020 | Ga0070685_10800463 | |||
| 1021 | Ga0070707_101177509 | |||
| 1022 | Ga0070698_100009538 | |||
| 1023 | Ga0070698_100062331 | |||
| 1024 | Ga0070699_100007694 | |||
| 1025 | Ga0070699_100026880 | |||
| 1026 | Ga0070699_100361136 | |||
| 1027 | Ga0070699_101013187 | |||
| 1028 | Ga0070679_100095891 | |||
| 1029 | Ga0070679_100235223 | |||
| 1030 | Ga0070679_101307657 | |||
| 1031 | Ga0070684_100245691 | |||
| 1032 | Ga0068853_100001645 | |||
| 1033 | Ga0068853_100104448 | |||
| 1034 | Ga0068853_100442630 | |||
| 1035 | Ga0070672_100017354 | |||
| 1036 | Ga0070672_100055953 | |||
| 1037 | Ga0070672_100082058 | |||
| 1038 | Ga0070672_100195555 | |||
| 1039 | Ga0070686_100077221 | |||
| 1040 | Ga0070686_100120558 | |||
| 1041 | Ga0070686_100140415 | |||
| 1042 | Ga0070695_100060607 | |||
| 1043 | Ga0070695_100256262 | |||
| 1044 | Ga0070696_100004294 | |||
| 1045 | Ga0070696_100018940 | |||
| 1046 | Ga0070696_100039359 | |||
| 1047 | Ga0070696_100556411 | |||
| 1048 | Ga0070696_100792142 | |||
| 1049 | Ga0070696_101471694 | |||
| 1050 | Ga0070693_100898021 | |||
| 1051 | Ga0070693_101204669 | |||
| 1052 | Ga0070665_100109938 | |||
| 1053 | Ga0070665_101093863 | |||
| 1054 | Ga0070704_100132523 | |||
| 1055 | Ga0068855_100003924 | |||
| 1056 | Ga0068855_100009335 | |||
| 1057 | Ga0068855_100360694 | |||
| 1058 | Ga0068855_100557175 | |||
| 1059 | Ga0068855_100880545 | |||
| 1060 | Ga0070664_100158710 | |||
| 1061 | Ga0070664_101134681 | |||
| 1062 | Ga0070664_101296912 | |||
| 1063 | Ga0068857_100001028 | |||
| 1064 | Ga0068857_100042691 | |||
| 1065 | Ga0068857_100087638 | |||
| 1066 | Ga0068857_100643105 | |||
| 1067 | Ga0068857_101119469 | |||
| 1068 | Ga0068857_101780350 | |||
| 1069 | Ga0068854_100138311 | |||
| 1070 | Ga0068854_100209574 | |||
| 1071 | Ga0068854_100379410 | |||
| 1072 | Ga0068854_101144725 | |||
| 1073 | Ga0068856_100007464 | |||
| 1074 | Ga0068856_100253488 | |||
| 1075 | Ga0068856_100326297 | |||
| 1076 | Ga0068856_100398562 | |||
| 1077 | Ga0068856_100460188 | |||
| 1078 | Ga0068856_100982191 | |||
| 1079 | Ga0068856_101008091 | |||
| 1080 | Ga0070702_100280465 | |||
| 1081 | Ga0070702_100515960 | |||
| 1082 | Ga0068852_100000501 | |||
| 1083 | Ga0068852_100003952 | |||
| 1084 | Ga0068852_100327024 | |||
| 1085 | Ga0068852_100758852 | |||
| 1086 | Ga0068852_100934819 | |||
| 1087 | Ga0068852_101025884 | |||
| 1088 | Ga0068859_100059842 | |||
| 1089 | Ga0068859_100081703 | |||
| 1090 | Ga0068859_100094875 | |||
| 1091 | Ga0068859_100112913 | |||
| 1092 | Ga0068859_100171965 | |||
| 1093 | Ga0068864_100061604 | |||
| 1094 | Ga0068864_100233712 | |||
| 1095 | Ga0068864_100299165 | |||
| 1096 | Ga0068864_100762940 | |||
| 1097 | Ga0068864_100797927 | |||
| 1098 | Ga0068864_101451172 | |||
| 1099 | Ga0068861_100205632 | |||
| 1100 | Ga0068861_100842939 | |||
| 1101 | Ga0068851_10000008 | |||
| 1102 | Ga0068870_10091451 | |||
| 1103 | Ga0068863_100149326 | |||
| 1104 | Ga0068863_101914873 | |||
| 1105 | Ga0068858_100000096 | |||
| 1106 | Ga0068860_100039330 | |||
| 1107 | Ga0068860_101012029 | |||
| 1108 | Ga0068860_101133563 | |||
| 1109 | Ga0068862_100024900 | |||
| 1110 | Ga0068862_100168038 | |||
| 1111 | Ga0068862_100277670 | |||
| 1112 | Ga0081455_10006304 | |||
| 1113 | Ga0081455_10013986 | |||
| 1114 | Ga0081455_10040847 | |||
| 1115 | Ga0081455_10096008 | |||
| 1116 | Ga0081455_10105002 | |||
| 1117 | Ga0081455_10809970 | |||
| 1118 | Ga0081538_10000373 | |||
| 1119 | Ga0081538_10017097 | |||
| 1120 | Ga0081538_10019586 | |||
| 1121 | Ga0081538_10067575 | |||
| 1122 | Ga0081538_10235638 | |||
| 1123 | Ga0081540_1209222 | |||
| 1124 | Ga0070717_10243916 | |||
| 1125 | Ga0075368_10361241 | |||
| 1126 | Ga0075432_10007952 | |||
| 1127 | Ga0075367_10246392 | |||
| 1128 | Ga0097621_100561334 | |||
| 1129 | Ga0097621_100846297 | |||
| 1130 | Ga0075370_10151045 | |||
| 1131 | Ga0075428_100000241 | |||
| 1132 | Ga0075428_100054973 | |||
| 1133 | Ga0075428_100060000 | |||
| 1134 | Ga0075428_100339706 | |||
| 1135 | Ga0075428_101188755 | |||
| 1136 | Ga0075430_100000048 | |||
| 1137 | Ga0075430_100219158 | |||
| 1138 | Ga0075430_100484127 | |||
| 1139 | Ga0075431_100000208 | |||
| 1140 | Ga0075431_100038131 | |||
| 1141 | Ga0075431_100831966 | |||
| 1142 | Ga0075433_10000736 | |||
| 1143 | Ga0075433_10077745 | |||
| 1144 | Ga0075433_10474300 | |||
| 1145 | Ga0075434_100087794 | |||
| 1146 | Ga0075434_100134988 | |||
| 1147 | Ga0075434_100348743 | |||
| 1148 | Ga0075434_100673161 | |||
| 1149 | Ga0075434_100740557 | |||
| 1150 | Ga0075429_100000967 | |||
| 1151 | Ga0075429_100105292 | |||
| 1152 | Ga0075429_100114285 | |||
| 1153 | Ga0068865_100093875 | |||
| 1154 | Ga0068865_100638252 | |||
| 1155 | Ga0075436_100800275 | |||
| 1156 | Ga0097620_100059840 | |||
| 1157 | Ga0097620_100081701 | |||
| 1158 | Ga0097620_100094876 | |||
| 1159 | Ga0097620_100112911 | |||
| 1160 | Ga0097620_100171978 | |||
| 1161 | Ga0105240_10021974 | |||
| 1162 | Ga0105240_10027961 | |||
| 1163 | Ga0105240_10779281 | |||
| 1164 | Ga0111539_10041498 | |||
| 1165 | Ga0111539_10052732 | |||
| 1166 | Ga0111539_10349205 | |||
| 1167 | Ga0111539_10723624 | |||
| 1168 | Ga0111539_10857997 | |||
| 1169 | Ga0111539_10869734 | |||
| 1170 | Ga0111539_10964560 | |||
| 1171 | Ga0105245_10038504 | |||
| 1172 | Ga0105245_10281609 | |||
| 1173 | Ga0105245_10346400 | |||
| 1174 | Ga0105245_10394612 | |||
| 1175 | Ga0105245_10513343 | |||
| 1176 | Ga0105245_10544958 | |||
| 1177 | Ga0105245_10603910 | |||
| 1178 | Ga0105245_11868469 | |||
| 1179 | Ga0105245_12515130 | |||
| 1180 | Ga0105247_10548317 | |||
| 1181 | Ga0114129_10018879 | |||
| 1182 | Ga0114129_10065623 | |||
| 1183 | Ga0114129_10100818 | |||
| 1184 | Ga0114129_10315805 | |||
| 1185 | Ga0114129_10382098 | |||
| 1186 | Ga0114129_11396036 | |||
| 1187 | Ga0105243_10305119 | |||
| 1188 | Ga0105243_10925634 | |||
| 1189 | Ga0105243_11313961 | |||
| 1190 | Ga0105241_10225464 | |||
| 1191 | Ga0105248_10000713 | |||
| 1192 | Ga0105248_10077338 | |||
| 1193 | Ga0105248_10662210 | |||
| 1194 | Ga0105237_10000688 | |||
| 1195 | Ga0105237_10004883 | |||
| 1196 | Ga0105237_11214233 | |||
| 1197 | Ga0105237_11510539 | |||
| 1198 | Ga0105238_10006959 | |||
| 1199 | Ga0105238_10161194 | |||
| 1200 | Ga0105238_10465246 | |||
| 1201 | Ga0105238_11933722 | |||
| 1202 | Ga0105249_10001062 | |||
| 1203 | Ga0105249_10261594 | |||
| 1204 | Ga0105249_10442756 | |||
| 1205 | Ga0105249_10543417 | |||
| 1206 | Ga0105249_11537618 | |||
| 1207 | Ga0105239_10147347 | |||
| 1208 | Ga0105239_10155042 | |||
| 1209 | Ga0105239_10464557 | |||
| 1210 | Ga0105239_10802157 | |||
| 1211 | Ga0105239_11724564 | |||
| 1212 | Ga0105239_11892425 | |||
| 1213 | Ga0105246_10074532 | |||
| 1214 | Ga0105246_10220356 | |||
| 1215 | Ga0105246_11208256 | |||
| 1216 | Ga0157344_1023062 | |||
| 1217 | Ga0157337_1004159 | |||
| 1218 | Ga0157329_1004243 | |||
| 1219 | Ga0157319_1008431 | |||
| 1220 | Ga0157338_1022790 | |||
| 1221 | Ga0157371_10075353 | |||
| 1222 | Ga0157371_10173744 | |||
| 1223 | Ga0157371_10509930 | |||
| 1224 | Ga0157370_10043788 | |||
| 1225 | Ga0157370_10397559 | |||
| 1226 | Ga0157370_10648815 | |||
| 1227 | Ga0157369_10146550 | |||
| 1228 | Ga0157369_10383825 | |||
| 1229 | Ga0157374_10174753 | |||
| 1230 | Ga0157374_10351983 | |||
| 1231 | Ga0157374_11291659 | |||
| 1232 | Ga0157374_12725080 | |||
| 1233 | Ga0157378_10235559 | |||
| 1234 | Ga0163162_10001014 | |||
| 1235 | Ga0163162_10247613 | |||
| 1236 | Ga0163162_10753827 | |||
| 1237 | Ga0163162_10909142 | |||
| 1238 | Ga0163162_12669277 | |||
| 1239 | Ga0157372_10000303 | |||
| 1240 | Ga0157372_10286550 | |||
| 1241 | Ga0157372_10293629 | |||
| 1242 | Ga0157372_11785184 | |||
| 1243 | Ga0157375_10017739 | |||
| 1244 | Ga0157375_10073830 | |||
| 1245 | Ga0157375_11431133 | |||
| 1246 | Ga0157375_11672543 | |||
| 1247 | Ga0163163_10113196 | |||
| 1248 | Ga0163163_10315846 | |||
| 1249 | Ga0157380_10008742 | |||
| 1250 | Ga0157380_10027580 | |||
| 1251 | Ga0157380_10173203 | |||
| 1252 | Ga0157380_10503459 | |||
| 1253 | Ga0157380_11438659 | |||
| 1254 | Ga0182008_10306201 | |||
| 1255 | Ga0157377_10317183 | |||
| 1256 | Ga0157377_10334535 | |||
| 1257 | Ga0157377_10506590 | |||
| 1258 | Ga0157379_10172327 | |||
| 1259 | Ga0157379_10856821 | |||
| 1260 | Ga0157376_10094004 | |||
| 1261 | Ga0157376_11067894 | |||
| 1262 | Ga0157376_11515382 | |||
| 1263 | Ga0163161_10027815 | |||
| 1264 | Ga0163161_10245228 | |||
| 1265 | Ga0197907_10030690 | |||
| 1266 | Ga0206354_10719424 | |||
| 1267 | Ga0224712_10064155 | |||
| 1268 | Ga0209148_1001379 | |||
| 1269 | Ga0207426_1092055 | |||
| 1270 | Ga0207697_10000517 | |||
| 1271 | Ga0207697_10062739 | |||
| 1272 | Ga0207656_10000005 | |||
| 1273 | Ga0207682_10007235 | |||
| 1274 | Ga0207682_10011183 | |||
| 1275 | Ga0207682_10011919 | |||
| 1276 | Ga0207642_10121635 | |||
| 1277 | Ga0207710_10131947 | |||
| 1278 | Ga0207688_10019212 | |||
| 1279 | Ga0207688_10027679 | |||
| 1280 | Ga0207688_10137359 | |||
| 1281 | Ga0207688_10684024 | |||
| 1282 | Ga0207680_10060351 | |||
| 1283 | Ga0207680_10134592 | |||
| 1284 | Ga0207680_10449127 | |||
| 1285 | Ga0207699_11218863 | |||
| 1286 | Ga0207645_10000648 | |||
| 1287 | Ga0207645_10080681 | |||
| 1288 | Ga0207645_10180081 | |||
| 1289 | Ga0207643_10000535 | |||
| 1290 | Ga0207643_10030163 | |||
| 1291 | Ga0207643_10034341 | |||
| 1292 | Ga0207643_10339261 | |||
| 1293 | Ga0207705_10019591 | |||
| 1294 | Ga0207705_10036147 | |||
| 1295 | Ga0207705_10125425 | |||
| 1296 | Ga0207705_10355435 | |||
| 1297 | Ga0207705_10591444 | |||
| 1298 | Ga0207705_11092228 | |||
| 1299 | Ga0207654_10000001 | |||
| 1300 | Ga0207707_10104231 | |||
| 1301 | Ga0207695_10005054 | |||
| 1302 | Ga0207695_10075339 | |||
| 1303 | Ga0207695_10591249 | |||
| 1304 | Ga0207671_10000016 | |||
| 1305 | Ga0207671_10026676 | |||
| 1306 | Ga0207660_10151925 | |||
| 1307 | Ga0207662_10008294 | |||
| 1308 | Ga0207662_10178674 | |||
| 1309 | Ga0207657_10017089 | |||
| 1310 | Ga0207657_10045205 | |||
| 1311 | Ga0207657_10309354 | |||
| 1312 | Ga0207657_10828047 | |||
| 1313 | Ga0207649_10079211 | |||
| 1314 | Ga0207649_10673257 | |||
| 1315 | Ga0207652_10067301 | |||
| 1316 | Ga0207646_10290620 | |||
| 1317 | Ga0207681_10019493 | |||
| 1318 | Ga0207681_10199790 | |||
| 1319 | Ga0207694_10000196 | |||
| 1320 | Ga0207650_10518227 | |||
| 1321 | Ga0207659_10004355 | |||
| 1322 | Ga0207659_10136974 | |||
| 1323 | Ga0207659_10619886 | |||
| 1324 | Ga0207659_10716075 | |||
| 1325 | Ga0207659_11052460 | |||
| 1326 | Ga0207687_10016104 | |||
| 1327 | Ga0207687_10169791 | |||
| 1328 | Ga0207687_10262691 | |||
| 1329 | Ga0207687_10471563 | |||
| 1330 | Ga0207687_11179682 | |||
| 1331 | Ga0207664_10412600 | |||
| 1332 | Ga0207664_10417670 | |||
| 1333 | Ga0207644_10218069 | |||
| 1334 | Ga0207644_10260810 | |||
| 1335 | Ga0207644_10282557 | |||
| 1336 | Ga0207690_10135811 | |||
| 1337 | Ga0207706_10043147 | |||
| 1338 | Ga0207706_10140431 | |||
| 1339 | Ga0207706_10307749 | |||
| 1340 | Ga0207670_10359036 | |||
| 1341 | Ga0207669_10032629 | |||
| 1342 | Ga0207704_10469516 | |||
| 1343 | Ga0207665_10133132 | |||
| 1344 | Ga0207665_10272599 | |||
| 1345 | Ga0207691_10005699 | |||
| 1346 | Ga0207691_10008272 | |||
| 1347 | Ga0207691_10043448 | |||
| 1348 | Ga0207691_11065462 | |||
| 1349 | Ga0207711_10004705 | |||
| 1350 | Ga0207711_10044903 | |||
| 1351 | Ga0207689_10009006 | |||
| 1352 | Ga0207689_10069451 | |||
| 1353 | Ga0207689_10090331 | |||
| 1354 | Ga0207689_10106985 | |||
| 1355 | Ga0207679_12000900 | |||
| 1356 | Ga0207667_10000437 | |||
| 1357 | Ga0207667_10001482 | |||
| 1358 | Ga0207667_10008673 | |||
| 1359 | Ga0207667_10072070 | |||
| 1360 | Ga0207667_10253870 | |||
| 1361 | Ga0207667_10346354 | |||
| 1362 | Ga0207667_10617899 | |||
| 1363 | Ga0207667_10619589 | |||
| 1364 | Ga0207651_10282454 | |||
| 1365 | Ga0207651_11430641 | |||
| 1366 | Ga0207712_10004201 | |||
| 1367 | Ga0207712_10253215 | |||
| 1368 | Ga0207712_10357744 | |||
| 1369 | Ga0207712_11788531 | |||
| 1370 | Ga0207668_10060983 | |||
| 1371 | Ga0207668_11665739 | |||
| 1372 | Ga0207640_10178867 | |||
| 1373 | Ga0207640_10207338 | |||
| 1374 | Ga0207640_10910209 | |||
| 1375 | Ga0207640_10925196 | |||
| 1376 | Ga0207658_10026447 | |||
| 1377 | Ga0207658_10106792 | |||
| 1378 | Ga0207677_10142275 | |||
| 1379 | Ga0207677_10284429 | |||
| 1380 | Ga0207677_10369522 | |||
| 1381 | Ga0207677_10422969 | |||
| 1382 | Ga0207677_10487532 | |||
| 1383 | Ga0207677_10656431 | |||
| 1384 | Ga0207677_10756108 | |||
| 1385 | Ga0207677_11167194 | |||
| 1386 | Ga0207677_11496225 | |||
| 1387 | Ga0207703_10001625 | |||
| 1388 | Ga0207703_10423802 | |||
| 1389 | Ga0207703_10910396 | |||
| 1390 | Ga0207639_10024131 | |||
| 1391 | Ga0207639_10040933 | |||
| 1392 | Ga0207639_11653178 | |||
| 1393 | Ga0207678_10170373 | |||
| 1394 | Ga0207678_10441042 | |||
| 1395 | Ga0207678_10578198 | |||
| 1396 | Ga0207708_10030195 | |||
| 1397 | Ga0207708_10215985 | |||
| 1398 | Ga0207708_10547439 | |||
| 1399 | Ga0207702_10012173 | |||
| 1400 | Ga0207702_10129325 | |||
| 1401 | Ga0207702_10434827 | |||
| 1402 | Ga0207702_10740140 | |||
| 1403 | Ga0207702_11323409 | |||
| 1404 | Ga0207702_11394922 | |||
| 1405 | Ga0207702_12194378 | |||
| 1406 | Ga0207641_10007623 | |||
| 1407 | Ga0207641_10203174 | |||
| 1408 | Ga0207641_10379506 | |||
| 1409 | Ga0207648_10139502 | |||
| 1410 | Ga0207648_10169731 | |||
| 1411 | Ga0207648_11020160 | |||
| 1412 | Ga0207676_10012542 | |||
| 1413 | Ga0207676_10082449 | |||
| 1414 | Ga0207676_10090865 | |||
| 1415 | Ga0207676_11073057 | |||
| 1416 | Ga0207674_10000405 | |||
| 1417 | Ga0207674_10052476 | |||
| 1418 | Ga0207674_10059478 | |||
| 1419 | Ga0207674_10229526 | |||
| 1420 | Ga0207674_11500722 | |||
| 1421 | Ga0207674_12141616 | |||
| 1422 | Ga0207675_100004393 | |||
| 1423 | Ga0207675_100007784 | |||
| 1424 | Ga0207675_100071349 | |||
| 1425 | Ga0207683_10010725 | |||
| 1426 | Ga0207683_10026823 | |||
| 1427 | Ga0207683_10199495 | |||
| 1428 | Ga0207683_10507555 | |||
| 1429 | Ga0207698_10000078 | |||
| 1430 | Ga0207698_10002196 | |||
| 1431 | Ga0207698_10088340 | |||
| 1432 | Ga0207698_10284769 | |||
| 1433 | Ga0209971_1120311 | |||
| 1434 | Ga0209813_10107658 | |||
| 1435 | Ga0209974_10164236 | |||
| 1436 | Ga0207428_10024405 | |||
| 1437 | Ga0207428_10233919 | |||
| 1438 | Ga0207428_10807162 | |||
| 1439 | Ga0268266_10133401 | |||
| 1440 | Ga0268266_10238596 | |||
| 1441 | Ga0268265_10024124 | |||
| 1442 | Ga0268265_10032259 | |||
| 1443 | Ga0268265_10140220 | |||
| 1444 | Ga0268265_12285336 | |||
| 1445 | Ga0268264_10130699 | |||
| 1446 | Ga0268264_10624537 | |||
| 1447 | Ga0268264_11437897 | |||
| 1448 | Ga0307408_100439923 | |||
| 1449 | Ga0307408_100839797 | |||
| 1450 | Ga0307408_101157656 | |||
| 1451 | Ga0316575_10001600 | |||
| 1452 | Ga0316579_10011276 | |||
| 1453 | Ga0316576_10050031 | |||
| 1454 | Ga0316576_10171686 | |||
| 1455 | Ga0316578_10004010 | |||
| 1456 | Ga0316578_10208559 | |||
| 1457 | Ga0307405_10297494 | |||
| 1458 | Ga0307405_11226242 | |||
| 1459 | Ga0316577_10021111 | |||
| 1460 | Ga0316577_10235428 | |||
| 1461 | Ga0307413_10029884 | |||
| 1462 | Ga0307413_10113399 | |||
| 1463 | Ga0307413_10326403 | |||
| 1464 | Ga0307410_11131806 | |||
| 1465 | Ga0307406_10058838 | |||
| 1466 | Ga0307406_10395189 | |||
| 1467 | Ga0307406_10722552 | |||
| 1468 | Ga0307406_10728478 | |||
| 1469 | Ga0307406_11080728 | |||
| 1470 | Ga0307406_11540519 | |||
| 1471 | Ga0307412_10365308 | |||
| 1472 | Ga0307409_100727410 | |||
| 1473 | Ga0307416_100177135 | |||
| 1474 | Ga0307416_100531847 | |||
| 1475 | Ga0307416_103788366 | |||
| 1476 | Ga0307414_10122243 | |||
| 1477 | Ga0307414_10511001 | |||
| 1478 | Ga0307414_11144964 | |||
| 1479 | Ga0307411_10926525 | |||
| 1480 | Ga0307411_11015558 | |||
| 1481 | Ga0307411_11158205 | |||
| 1482 | Ga0307415_100429465 | |||
| 1483 | Ga0307415_100498756 | |||
| 1484 | Ga0316583_10114392 | |||
| 1485 | Ga0316593_10007319 | |||
| 1486 | Ga0316586_1014057 | |||
| 1487 | Ga0316587_1062345 | |||
| 1488 | Ga0316596_1076268 | |||
| 1489 | Ga0373940_0251984 | |||
| 1490 | Ga0373952_0169780 | |||
| 1491 | Ga0373932_0011563 | |||
| 1492 | Ga0373939_0159872 | |||
| 1493 | Ga0373953_0005571 | |||
| 1494 | Ga0373953_0407045 | |||
| 1495 | Ga0373954_0010182 | |||
| 1496 | Ga0373956_0011874 | |||
| 1497 | Ga0373957_0176131 | |||
| 1498 | Ga0373957_0417527 | |||
| 1499 | Ga0373955_0018329 | |||
| 1500 | Ga0373955_0078130 | |||
| 1501 | Ga0373942_0194021 | |||
| 1502 | Ga0373962_0016027 | |||
| 1503 | Ga0373962_0204756 | |||
| 1504 | Ga0316574_0007133 | |||
| 1505 | Ga0373924_0014182 | |||
| 1506 | Ga0373931_0258353 | |||
| 1507 | Ga0373933_0003076 | |||
| 1508 | Ga0373937_0011980 | |||
| 1509 | Ga0316582_0016585 | |||
| 1510 | Ga0316582_0195668 | |||
| 1511 | Ga0316582_0353159 | |||
| 1512 | Ga0316584_0002064 | |||
| 1513 | Ga0316584_0057306 | |||
| 1514 | Ga0395900_0356212 | |||
| 1515 | Ga0395900_1217516 | |||
| 1516 | Ga0395900_1656355 | |||
| 1517 | Ga0395898_0163578 | |||
| 1518 | Ga0395901_0264956 | |||
| 1519 | Ga0436362_1073426 | |||
| 1520 | Ga0439465_0024249 | |||
| 1521 | Ga0439465_0197368 | |||
| 1522 | Ga0451795_0846601 | |||
| 1523 | Ga0451807_2331222 | |||
| 1524 | Ga0451807_2660586 | |||
| 1525 | Ga0439448_0229132 | |||
| 1526 | Ga0439448_0287680 | |||
| 1527 | Ga0439450_012941 | |||
| 1528 | Ga0450923_044577 | |||
| 1529 | Ga0439435_0057780 | |||
| 1530 | Ga0439459_0004614 | |||
| 1531 | Ga0439464_0054081 | |||
| 1532 | Ga0439440_0009970 | |||
| 1533 | Ga0466969_0081090 | |||
| 1534 | Ga0466965_0227077 | |||
| 1535 | Ga0466966_0138851 | |||
| 1536 | Ga0466961_0519695 | |||
| 1537 | Ga0466961_0635230 | |||
| 1538 | Ga0466963_0591109 | |||
| 1539 | Ga0466963_1109621 | |||
| 1540 | Ga0466971_0587126 | |||
| 1541 | Ga0466970_0396247 | |||
| 1542 | Ga0466970_0592951 | |||
| 1543 | Ga0466957_0082035 | |||
| 1544 | Ga0466957_0313114 | |||
| 1545 | Ga0466960_0007662 | |||
| 1546 | Ga0466958_0166076 | |||
| 1547 | Ga0466958_0504308 | |||
| 1548 | Ga0466967_0000739 | |||
| 1549 | Ga0466967_0454479 | |||
| 1550 | Ga0466967_0645276 | |||
| 1551 | Ga0466967_1230676 | |||
| 1552 | Ga0466967_2194709 | |||
| 1553 | Ga0466967_2563465 | |||
| 1554 | Ga0495590_0001438 | |||
| 1555 | Ga0495641_0095566 | |||
| 1556 | Ga0495584_0214622 | |||
| 1557 | Ga0495606_0002983 | |||
| 1558 | Ga0495642_0034777 | |||
| 1559 | Ga0495640_0086467 | |||
| 1560 | Ga0495640_0104777 | |||
| 1561 | Ga0495587_0743784 | |||
| 1562 | Ga0495598_0040556 | |||
| 1563 | Ga0495667_0102790 | |||
| 1564 | Ga0495656_0406633 | |||
| 1565 | Ga0495656_0581439 | |||
| 1566 | Ga0495668_0002487 | |||
| 1567 | Ga0495625_0014245 | |||
| 1568 | Ga0495625_0324273 | |||
| 1569 | Ga0495635_0081532 | |||
| 1570 | Ga0495659_0072648 | |||
| 1571 | Ga0495659_0132995 | |||
| 1572 | Ga0495647_0045876 | |||
| 1573 | Ga0495669_0221135 | |||
| 1574 | Ga0495581_0321925 | |||
| 1575 | Ga0495636_0471550 | |||
| 1576 | Ga0495636_0633288 | |||
| 1577 | Ga0495636_0697513 | |||
| 1578 | Ga0495676_0132259 | |||
| 1579 | Ga0495680_0233594 | |||
| 1580 | Ga0495683_0101187 | |||
| 1581 | Ga0495686_0261887 | |||
| 1582 | Ga0495602_0191483 | |||
| 1583 | Ga0495614_0539767 | |||
| 1584 | Ga0495626_0001210 | |||
| 1585 | Ga0496102_0115362 | |||
| 1586 | Ga0496102_0204800 | |||
| 1587 | Ga0496104_0000086 | |||
| 1588 | Ga0496104_0027869 | |||
| 1589 | Ga0496104_0251154 | |||
| 1590 | Ga0496104_1007604 | |||
| 1591 | Ga0496104_1425882 | |||
| 1592 | Ga0496105_0000126 | |||
| 1593 | Ga0496105_0116726 | |||
| 1594 | Ga0496105_0187311 | |||
| 1595 | Ga0496106_1250834 | |||
| 1596 | Ga0496107_0762153 | |||
| 1597 | Ga0496108_0093186 | |||
| 1598 | Ga0496108_0255872 | |||
| 1599 | Ga0496109_0002834 | |||
| 1600 | Ga0496109_0682699 | |||
| 1601 | Ga0496109_0822649 | |||
| 1602 | Ga0496109_0853634 | |||
| 1603 | Ga0496110_0018428 | |||
| 1604 | Ga0496110_0160757 | |||
| 1605 | Ga0496110_0399204 | |||
| 1606 | Ga0496111_0262548 | |||
| 1607 | Ga0496111_0600121 | |||
| 1608 | Ga0496112_0056822 | |||
| 1609 | Ga0496112_0078054 | |||
| 1610 | Ga0496113_0009600 | |||
| 1611 | Ga0496113_0110508 | |||
| 1612 | Ga0496114_0126356 | |||
| 1613 | Ga0496114_0353088 | |||
| 1614 | Ga0496114_1237384 | |||
| 1615 | Ga0496115_0095992 | |||
| 1616 | Ga0496115_0847580 | |||
| 1617 | Ga0496117_0277177 | |||
| 1618 | Ga0496118_0046316 | |||
| 1619 | Ga0496118_0502711 | |||
| 1620 | Ga0496119_0007381 | |||
| 1621 | Ga0496119_0024772 | |||
| 1622 | Ga0496119_0060350 | |||
| 1623 | Ga0496120_0000929 | |||
| 1624 | Ga0496120_0002952 | |||
| 1625 | Ga0496120_0018072 | |||
| 1626 | Ga0496125_0120419 | |||
| 1627 | Ga0496126_0372998 | |||
| 1628 | Ga0496126_0678838 | |||
| 1629 | Ga0501031_0252010 | |||
| 1630 | Ga0501032_0200840 | |||
| 1631 | Ga0501032_0707410 | |||
| 1632 | Ga0501033_0021283 | |||
| 1633 | Ga0501033_0108029 | |||
| 1634 | Ga0501033_0117903 | |||
| 1635 | Ga0501033_0319448 | |||
| 1636 | Ga0501033_0367901 | |||
| 1637 | Ga0501033_0660233 | |||
| 1638 | Ga0501034_0006121 | |||
| 1639 | Ga0501034_0085168 | |||
| 1640 | Ga0501034_0271558 | |||
| 1641 | Ga0501036_0012840 | |||
| 1642 | Ga0501036_0148278 | |||
| 1643 | Ga0501036_0154879 | |||
| 1644 | Ga0501036_0859529 | |||
| 1645 | Ga0501036_0893982 | |||
| 1646 | Ga0501037_0028904 | |||
| 1647 | Ga0501037_0064654 | |||
| 1648 | Ga0501038_0054733 | |||
| 1649 | Ga0501038_0064680 | |||
| 1650 | Ga0501038_0168500 | |||
| 1651 | Ga0501038_0358256 | |||
| 1652 | Ga0501038_0845179 | |||
| 1653 | Ga0501039_0037099 | |||
| 1654 | Ga0501039_1105477 | |||
| 1655 | Ga0501040_0053540 | |||
| 1656 | Ga0501040_0187258 | |||
| 1657 | Ga0501040_0386731 | |||
| 1658 | Ga0501040_1286106 | |||
| 1659 | Ga0501042_0007990 | |||
| 1660 | Ga0501042_0109698 | |||
| 1661 | Ga0501042_0198013 | |||
| 1662 | Ga0501043_0093461 | |||
| 1663 | Ga0501043_0098355 | |||
| 1664 | Ga0501043_0243849 | |||
| 1665 | Ga0501043_0753321 | |||
| 1666 | Ga0501046_0022138 | |||
| 1667 | Ga0501046_0373368 | |||
| 1668 | Ga0501046_0529657 | |||
| 1669 | Ga0501046_0875744 | |||
| 1670 | Ga0501047_0074959 | |||
| 1671 | Ga0501047_0080728 | |||
| 1672 | Ga0501047_0111398 | |||
| 1673 | Ga0501047_0121925 | |||
| 1674 | Ga0501048_0094392 | |||
| 1675 | Ga0501048_0495978 | |||
| 1676 | Ga0501048_0829302 | |||
| 1677 | Ga0501068_0607586 | |||
| 1678 | Ga0501068_0611256 | |||
| 1679 | Ga0501069_0302026 | |||
| 1680 | Ga0501070_0131590 | |||
| 1681 | Ga0501070_0264456 | |||
| 1682 | Ga0501070_0474318 | |||
| 1683 | Ga0501070_0823189 | |||
| 1684 | Ga0501070_0827838 | |||
| 1685 | Ga0501072_0024908 | |||
| 1686 | Ga0501072_0288915 | |||
| 1687 | Ga0501072_0424607 | |||
| 1688 | Ga0501072_1179167 | |||
| 1689 | Ga0501073_0095252 | |||
| 1690 | Ga0501074_0031707 | |||
| 1691 | Ga0501074_0147029 | |||
| 1692 | Ga0501075_0014503 | |||
| 1693 | Ga0501075_0242739 | |||
| 1694 | Ga0501075_0574857 | |||
| 1695 | Ga0501075_0660678 | |||
| 1696 | Ga0501075_1016725 | |||
| 1697 | Ga0501076_0056232 | |||
| 1698 | Ga0501079_0116617 | |||
| 1699 | Ga0501079_0128982 | |||
| 1700 | Ga0501079_0651691 | |||
| 1701 | Ga0501079_0917777 | |||
| 1702 | Ga0501079_0941400 | |||
| 1703 | Ga0501079_1472496 | |||
| 1704 | Ga0501080_0078366 | |||
| 1705 | Ga0501080_0168721 | |||
| 1706 | Ga0501081_0004930 | |||
| 1707 | Ga0501035_0004214 | |||
| 1708 | Ga0501035_0016512 | |||
| 1709 | Ga0501035_0022802 | |||
| 1710 | Ga0501035_0032464 | |||
| 1711 | Ga0501035_0066675 | |||
| 1712 | Ga0501035_0134017 | |||
| 1713 | Ga0501044_0002891 | |||
| 1714 | Ga0501044_0014143 | |||
| 1715 | Ga0501045_0036012 | |||
| 1716 | Ga0501045_0044865 | |||
| 1717 | Ga0501045_0056807 | |||
| 1718 | Ga0501045_0135195 | |||
| 1719 | Ga0501045_0471056 | |||
| 1720 | Ga0501045_0795859 | |||
| 1721 | nmdc:mga03683_582541_c1 | |||
| 1722 | nmdc:mga06z11_463191_c1 | |||
| 1723 | nmdc:mga04h51_126597_c1 | |||
| 1724 | nmdc:mga05p37_52206_c1 | |||
| 1725 | nmdc:mga05p37_528457_c1 | |||
| 1726 | nmdc:mga05p37_903526_c1 | |||
| 1727 | nmdc:mga09592_378_c1 | |||
| 1728 | nmdc:mga09592_40034_c1 | |||
| 1729 | nmdc:mga09592_508379_c1 | |||
| 1730 | nmdc:mga09592_714634_c1 | |||
| 1731 | nmdc:mga0qj67_126_c1 | |||
| 1732 | nmdc:mga0qj67_142815_c1 | |||
| 1733 | nmdc:mga0qj67_219647_c1 | |||
| 1734 | nmdc:mga0qj67_456379_c1 | |||
| 1735 | nmdc:mga06r32_182_c1 | |||
| 1736 | nmdc:mga06r32_8009_c1 | |||
| 1737 | nmdc:mga06r32_929958_c1 | |||
| 1738 | nmdc:mga08y16_1114338_c1 | |||
| 1739 | nmdc:mga08y16_123231_c1 | |||
| 1740 | nmdc:mga08y16_186300_c1 | |||
| 1741 | nmdc:mga08y16_235306_c1 | |||
| 1742 | nmdc:mga08y16_326206_c1 | |||
| 1743 | nmdc:mga08y16_97144_c1 | |||
| 1744 | nmdc:mga0n895_131099_c1 | |||
| 1745 | nmdc:mga0n895_1535195_c1 | |||
| 1746 | nmdc:mga0n895_228791_c1 | |||
| 1747 | nmdc:mga0n895_378445_c1 | |||
| 1748 | nmdc:mga0n895_986799_c1 | |||
| 1749 | nmdc:mga0n895_992800_c1 | |||
| 1750 | nmdc:mga0rr50_337482_c1 | |||
| 1751 | nmdc:mga0rr50_930899_c1 | |||
| 1752 | nmdc:mga0a205_1473668_c1 | |||
| 1753 | nmdc:mga0a205_154952_c1 | |||
| 1754 | nmdc:mga0a205_22886_c1 | |||
| 1755 | nmdc:mga0a205_598576_c1 | |||
| 1756 | Ga0495601_0037186 | |||
| 1757 | Ga0500635_0028151 | |||
| 1758 | Ga0495595_0032151 | |||
| 1759 | Ga0495619_0002780 | |||
| 1760 | Ga0500651_0005924 | |||
| 1761 | Ga0500560_003627 | |||
| 1762 | Ga0500572_078659 | |||
| 1763 | Ga0500559_0014784 | |||
| 1764 | Ga0500564_287622 | |||
| 1765 | Ga0500590_000842 | |||
| 1766 | Ga0500616_0000183 | |||
| 1767 | Ga0500616_0002208 | |||
| 1768 | Ga0500616_0149350 | |||
| 1769 | Ga0500620_000536 | |||
| 1770 | Ga0500645_015972 | |||
| 1771 | Ga0501084_0303688 | |||
| 1772 | Ga0501084_0642123 | |||
| 1773 | Ga0590075_011698 | |||
| 1774 | Ga0590077_104633 | |||
| 1775 | Ga0501082_0110640 | |||
| 1776 | Ga0466962_0085882 | |||
| 1777 | Ga0466962_0164101 | |||
| 1778 | Ga0466962_0624659 | |||
| 1779 | Ga0530510_0008102 | |||
| 1780 | 2831937025 | |||
| 1781 | 2855675010 | |||
| 1782 | 2855679973 | |||
| 1783 | 2857289992 | |||
| 1784 | 2858849483 | |||
| 1785 | 2858882372 | |||
| 1786 | 2858892786 | |||
| 1787 | 2867507342 | |||
| 1788 | 2869050593 | |||
| 1789 | 2869066345 | |||
| 1790 | 2869074240 | |||
| 1791 | 2880490990 | |||
| 1792 | 2880501525 | |||
| 1793 | 2887480962 | |||
| 1794 | 2929223648 | |||
| 1795 | 2929230004 | |||
| 1796 | 2954009797 | |||
| 1797 | 2996225229 | |||
| 1798 | 3006427501 | |||
| 1799 | 8003836806 | |||
| 1800 | 8045834107 | |||
| 1801 | 8054709881 | |||
| 1802 | 8056061431 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3d7j-assembly1.cif.gz_D | sco6650, a 6-pyruvoyltetrahydropterin synthase homolog from streptomyces coelicolor | 0.9887 | 2 | 131 |
| 3d7j-assembly1.cif.gz_D | sco6650, a 6-pyruvoyltetrahydropterin synthase homolog from streptomyces coelicolor | 0.9524 | 2 | 131 |
| 3qn9-assembly1.cif.gz_A | crystal structure of a 6-pyruvoyltetrahydropterin synthase homologue from esherichia coli | 0.8334 | 2 | 128 |
| 2dtt-assembly2.cif.gz_E | crystal structure of 6-pyruvoyl tetrahydrobiopterin synthase from pyrococcus horikoshii ot3 complexed with (1'r,2's)-biopterin | 0.8193 | 2 | 130 |
| 3m0n-assembly1.cif.gz_A | plasmodium vivax 6-pyruvoyltetrahydropterin synthase (ptps), e37a catalytic residue mutant | 0.8142 | 2 | 131 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3d7jC00 | Alpha Beta;2-Layer Sandwich;Tetrahydropterin Synthase; Chain A;6-pyruvoyl tetrahydropterin synthase/QueD | 0.9912 | 2 | 131 | 3.30.479.10 |
| 3d7jC00 | Alpha Beta;2-Layer Sandwich;Tetrahydropterin Synthase; Chain A;6-pyruvoyl tetrahydropterin synthase/QueD | 0.9545 | 2 | 131 | 3.30.479.10 |
| 4ntmA00 | Alpha Beta;2-Layer Sandwich;Tetrahydropterin Synthase; Chain A;6-pyruvoyl tetrahydropterin synthase/QueD | 0.8185 | 1 | 130 | 3.30.479.10 |
| 4ntmA00 | Alpha Beta;2-Layer Sandwich;Tetrahydropterin Synthase; Chain A;6-pyruvoyl tetrahydropterin synthase/QueD | 0.8118 | 1 | 130 | 3.30.479.10 |
| af_Q2G1X5_11_135_3.30.479.10 | Alpha Beta;2-Layer Sandwich;Tetrahydropterin Synthase; Chain A;6-pyruvoyl tetrahydropterin synthase/QueD | 0.8087 | 2 | 130 | 3.30.479.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A4U6R347-F1-model_v4 | 6-carboxy-5,6,7,8-tetrahydropterin synthase (EC 4.1.2.50) (Queuosine biosynthesis protein QueD) | 0.996 | 1 | 131 |
GO:0046872
GO:0070497 |
| AF-A0A537RE69-F1-model_v4 | 6-carboxy-5,6,7,8-tetrahydropterin synthase (EC 4.1.2.50) (Queuosine biosynthesis protein QueD) | 0.9954 | 2 | 132 |
GO:0070497
|
| AF-A0A2N2S8J1-F1-model_v4 | 6-carboxy-5,6,7,8-tetrahydropterin synthase (EC 4.1.2.50) (Queuosine biosynthesis protein QueD) | 0.995 | 1 | 119 |
GO:0046872
GO:0070497 |
| AF-A0A2S5ZBC8-F1-model_v4 | 6-carboxy-5,6,7,8-tetrahydropterin synthase (EC 4.1.2.50) (Queuosine biosynthesis protein QueD) | 0.9941 | 1 | 131 |
GO:0046872
GO:0070497 |
| AF-A0A7K2MGU2-F1-model_v4 | 6-carboxy-5,6,7,8-tetrahydropterin synthase (EC 4.1.2.50) (Queuosine biosynthesis protein QueD) | 0.994 | 1 | 89 |
GO:0046872
GO:0070497 |