F485202

General Info

Members Datasets Scaffolds Average Seq Length
902 394 1804 288

Family's Representative Sequence

Representative Sequence 3300010375|Ga0105239_10000798|Ga0105239_1000079838
Length 310
Sequence VLLLDCKTRVPQFGAIPSGEKNMLVNKAIFPVAGLGTRFLPATKAQPKEMLPVVDKPLIQYAVEEAYAAGVREMIFVTGRHKRPIEDHFDMTFELEVALEQAGKQELLDVVRTVKPNDMECVYVRQAQALGLGHAVLCGQRLIGNEPFAVLLADDLMVGSPPVLRQMVEQFEEWRASILAVQEVPAEQTRRYGIVDGTEVNDRMMDISRIVEKPAPEDAPSRLGVAGRYILTPGVFHEIASQQRGVGGEIQLTDGIAALLRREKVFAYRYEGKRYDCGSKEGFLEANVELALQHPQLGEGFRKYLSTLQF

Samples

Sample ID Description Type Environment
1 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
2 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
3 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
4 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
5 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
6 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
7 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
8 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
9 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
10 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
11 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
12 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
13 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
14 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
15 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
16 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
17 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
18 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
19 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
20 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
21 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
22 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
23 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
24 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
25 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
26 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
27 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
28 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
29 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
30 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
31 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
32 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
33 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
34 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
35 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
36 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
37 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
38 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
39 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
40 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
41 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
42 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
43 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
44 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
45 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
46 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
47 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
48 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
49 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
50 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
51 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
52 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
53 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
54 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
55 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
56 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
57 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
58 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
59 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
60 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
61 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
62 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
63 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
64 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
65 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
66 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
67 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
68 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
69 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
70 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
71 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
72 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
73 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
74 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
75 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
76 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
77 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
78 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
79 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
80 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
81 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
82 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
83 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
84 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
85 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
86 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
87 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
88 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
89 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
90 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
91 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
92 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
93 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
94 3300012475 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.old.080610 Metagenome Rhizosphere
95 3300012497 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 Metagenome Rhizosphere
96 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
97 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
98 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
99 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
100 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
101 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
102 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
103 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
104 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
105 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
106 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
107 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
108 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
109 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
110 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
111 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
112 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
113 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
114 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
115 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
117 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
118 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
119 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
120 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
121 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
122 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
123 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
124 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
174 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
175 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
176 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
177 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
178 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
179 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
180 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
181 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
185 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
186 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
187 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
188 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
189 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
190 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
191 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
192 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
193 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
194 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
195 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
196 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
197 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
198 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
199 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
200 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
201 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
202 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
203 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
204 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
205 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
206 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
207 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
208 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
209 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
210 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
211 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
212 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
213 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
214 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
215 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
216 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
217 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
218 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
219 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
220 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
221 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
222 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
223 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
224 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
225 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
226 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
227 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
228 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
229 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
230 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
231 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
232 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
233 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
234 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
235 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
236 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
237 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
238 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
239 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
240 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
241 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
242 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
243 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
244 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
245 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
246 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
247 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
248 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
249 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
250 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
251 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
252 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
253 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
254 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
255 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
256 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
257 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
258 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
259 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
260 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
261 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
262 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
263 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
264 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
265 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
266 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
267 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
268 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
269 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
270 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
271 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
272 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
273 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
274 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
275 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
276 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
277 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
278 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
279 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
280 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
281 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
282 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
283 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
284 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
285 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
286 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
287 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
288 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
289 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
290 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
291 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
292 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
293 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
294 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
295 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
296 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
297 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
298 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
299 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
300 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
301 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
302 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
303 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
304 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
305 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
306 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
307 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
308 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
309 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
310 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
311 3300049160 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
312 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
313 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
314 3300049530 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
315 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
316 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
317 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
318 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
319 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
320 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
321 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
322 3300049651 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought Metagenome Rhizosphere
323 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
324 3300049658 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought Metagenome Rhizosphere
325 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
326 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
327 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
328 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
329 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
330 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
331 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
332 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
333 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
334 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
335 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
336 3300049764 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control Metagenome Rhizosphere
337 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
338 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
339 3300049778 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control Metagenome Rhizosphere
340 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
341 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
342 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
343 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
344 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
345 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
346 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
347 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
348 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
349 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
350 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
351 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
352 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
353 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
354 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
355 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
356 3300053127 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 endosphere Metagenome Endosphere
357 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
358 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
359 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
360 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
361 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
362 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
363 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
364 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
365 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
366 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
367 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
368 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
369 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
370 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
371 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
372 2585428057 Methylibium sp. YR605 Isolate Rhizosphere
373 2585428058 Methylibium sp. CF468 Isolate Rhizosphere
374 2585428062 Methylibium sp. CF059 Isolate Rhizosphere
375 2588253510 Rhizobacter sp. OV335 Isolate Rhizosphere
376 2643221544 Pelomonas sp. Root1444 Isolate Unclassified
377 2643221585 Pelomonas sp. Root662 Isolate Unclassified
378 2643221592 Rhizobacter sp. Root16D2 Isolate Unclassified
379 2643221625 Rhizobacter sp. Root29 Isolate Unclassified
380 2643221639 Pelomonas sp. Root1217 Isolate Unclassified
381 2643221644 Rhizobacter sp. Root1221 Isolate Unclassified
382 2643221646 Pelomonas sp. Root1237 Isolate Unclassified
383 2643221648 Rhizobacter sp. Root1238 Isolate Unclassified
384 2643221654 Rhizobacter sp. Root404 Isolate Unclassified
385 2643221656 Pelomonas sp. Root405 Isolate Unclassified
386 2643221660 Methylibium sp. Root1272 Isolate Unclassified
387 2738541337 Pelomonas sp. BT06 Isolate Unclassified
388 2831864461 Roseateles noduli HZ7 Isolate Nodule
389 2842718218 Acidovorax sp. R-73343 Isolate Unclassified
390 2886848708 Mitsuaria sp. TWR114 Isolate Rhizosphere
391 2904479285 Comamonas sediminis 4487 Isolate Rhizosphere
392 2919704043 Hydrogenophaga palleronii 4249 Isolate Unclassified
393 2945945610 Variovorax paradoxus W1I18 Isolate Rhizosphere
394 2974320154 Acidovorax wautersii SORGH_AS 335 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 96.45
Metatranscriptomes 1
Isolates 2.55

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 14.3
Nodule 0.55
Rhizoplane 2.44
Rhizosphere 75.39
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105239_10000798 3300010375 Bacteria 44685
2 JGI24744J21845_10009695 3300002077 Bacteria 1977
3 JGI25153J46596_10010114 3300003215 Bacteria 4301
4 rootH2_10003861 3300003320 Bacteria 10179
5 rootL2_10008947 3300003322 Bacteria 3632
6 rootL2_10011993 3300003322 Bacteria 4512
7 rootH1_10027651 3300003323 Bacteria 6466
8 Ga0055525_1000011 3300003759 Bacteria 503124
9 Ga0055526_1002081 3300003771 Bacteria 13745
10 Ga0055526_1009068 3300003771 Bacteria 4853
11 Ga0055524_1000423 3300003775 Bacteria 35532
12 Ga0055530_10026604 3300003791 Bacteria 1595
13 Ga0055530_10032948 3300003791 Bacteria 1342
14 Ga0055540_1000015 3300003792 Bacteria 232986
15 Ga0055531_10000214 3300003794 Bacteria 63569
16 Ga0055531_10012695 3300003794 Bacteria 3940
17 Ga0055531_10012745 3300003794 Bacteria 3928
18 Ga0055543_1002451 3300004625 Bacteria 6124
19 Ga0055543_1018468 3300004625 Bacteria 1301
20 Ga0065165_1000024 3300005262 Bacteria 247672
21 Ga0065165_1000401 3300005262 Bacteria 69929
22 Ga0065165_1007960 3300005262 Bacteria 5073
23 Ga0065704_10115258 3300005289 Bacteria 1875
24 Ga0065707_10086296 3300005295 Bacteria 5545
25 Ga0070658_10442350 3300005327 Bacteria 1119
26 Ga0070676_10002580 3300005328 Bacteria 9317
27 Ga0070676_10003107 3300005328 Bacteria 8578
28 Ga0070676_10176335 3300005328 Bacteria 1386
29 Ga0070676_10182727 3300005328 Bacteria 1364
30 Ga0070683_100001824 3300005329 Bacteria 16612
31 Ga0070690_100015822 3300005330 Bacteria 4507
32 Ga0070690_100027719 3300005330 Bacteria 3504
33 Ga0070670_100000817 3300005331 Bacteria 24262
34 Ga0070670_100030985 3300005331 Bacteria 4606
35 Ga0070670_100113628 3300005331 Bacteria 2334
36 Ga0070670_100120306 3300005331 Bacteria 2265
37 Ga0070677_10011646 3300005333 Bacteria 3038
38 Ga0070677_10108708 3300005333 Bacteria 1235
39 Ga0070677_10119071 3300005333 Bacteria 1190
40 Ga0070677_10128255 3300005333 Bacteria 1154
41 Ga0068869_100008068 3300005334 Bacteria 6767
42 Ga0068869_100011581 3300005334 Bacteria 5790
43 Ga0068869_100049338 3300005334 Bacteria 3047
44 Ga0068869_100315725 3300005334 Bacteria 1266
45 Ga0070666_10000785 3300005335 Bacteria 19230
46 Ga0070682_100195879 3300005337 Bacteria 1422
47 Ga0068868_100007918 3300005338 Bacteria 7590
48 Ga0068868_100047011 3300005338 Bacteria 3380
49 Ga0068868_100063355 3300005338 Bacteria 2933
50 Ga0068868_100095787 3300005338 Bacteria 2396
51 Ga0068868_100345864 3300005338 Bacteria 1273
52 Ga0070660_100285612 3300005339 Bacteria 1351
53 Ga0070689_100036794 3300005340 Bacteria 3743
54 Ga0070687_100024523 3300005343 Bacteria 2881
55 Ga0070687_100035933 3300005343 Bacteria 2465
56 Ga0070661_100001209 3300005344 Bacteria 18186
57 Ga0070661_100044171 3300005344 Bacteria 3255
58 Ga0070661_100236421 3300005344 Bacteria 1405
59 Ga0070668_100020742 3300005347 Bacteria 4962
60 Ga0070668_100024278 3300005347 Bacteria 4592
61 Ga0070668_100028843 3300005347 Bacteria 4211
62 Ga0070668_100039349 3300005347 Bacteria 3617
63 Ga0070669_100031357 3300005353 Bacteria 3839
64 Ga0070669_100072267 3300005353 Bacteria 2553
65 Ga0070669_100082423 3300005353 Bacteria 2398
66 Ga0070669_100130631 3300005353 Bacteria 1926
67 Ga0070669_100153435 3300005353 Bacteria 1784
68 Ga0070675_100000285 3300005354 Bacteria 33772
69 Ga0070675_100003281 3300005354 Bacteria 12273
70 Ga0070675_100035548 3300005354 Bacteria 4049
71 Ga0070675_100045165 3300005354 Bacteria 3604
72 Ga0070675_100172746 3300005354 Bacteria 1864
73 Ga0070671_100002575 3300005355 Bacteria 14065
74 Ga0070671_100011706 3300005355 Bacteria 7055
75 Ga0070671_100015522 3300005355 Bacteria 6155
76 Ga0070671_100019406 3300005355 Bacteria 5532
77 Ga0070671_100049253 3300005355 Bacteria 3505
78 Ga0070671_100074679 3300005355 Bacteria 2832
79 Ga0070671_100083482 3300005355 Bacteria 2671
80 Ga0070671_100090319 3300005355 Bacteria 2564
81 Ga0070671_100134959 3300005355 Bacteria 2080
82 Ga0070671_100349687 3300005355 Bacteria 1261
83 Ga0070674_100032006 3300005356 Bacteria 3490
84 Ga0070674_100046123 3300005356 Bacteria 2980
85 Ga0070673_100001009 3300005364 Bacteria 15963
86 Ga0070673_100013002 3300005364 Bacteria 5740
87 Ga0070673_100058983 3300005364 Bacteria 3037
88 Ga0070673_100159301 3300005364 Bacteria 1918
89 Ga0070673_100178321 3300005364 Bacteria 1817
90 Ga0070673_100230122 3300005364 Bacteria 1608
91 Ga0070659_100005054 3300005366 Bacteria 9458
92 Ga0070659_100014835 3300005366 Bacteria 5826
93 Ga0070659_100097584 3300005366 Bacteria 2362
94 Ga0070667_100002773 3300005367 Bacteria 15141
95 Ga0070667_100003684 3300005367 Bacteria 13046
96 Ga0070667_100004040 3300005367 Bacteria 12405
97 Ga0070667_100028787 3300005367 Bacteria 4625
98 Ga0070667_100052972 3300005367 Bacteria 3424
99 Ga0070667_100105409 3300005367 Bacteria 2440
100 Ga0070667_100236828 3300005367 Bacteria 1629
101 Ga0070667_100306561 3300005367 Bacteria 1430
102 Ga0070667_100459851 3300005367 Bacteria 1163
103 Ga0070700_100018609 3300005441 Bacteria 3996
104 Ga0070663_100000774 3300005455 Bacteria 17411
105 Ga0070663_100004332 3300005455 Bacteria 8320
106 Ga0070663_100180664 3300005455 Bacteria 1636
107 Ga0070678_100013525 3300005456 Bacteria 5121
108 Ga0070678_100027689 3300005456 Bacteria 3852
109 Ga0070678_100119433 3300005456 Bacteria 2076
110 Ga0070678_100322351 3300005456 Bacteria 1320
111 Ga0070678_100409008 3300005456 Bacteria 1180
112 Ga0070662_100069801 3300005457 Bacteria 2588
113 Ga0070662_100164880 3300005457 Bacteria 1736
114 Ga0068867_100000042 3300005459 Bacteria 77140
115 Ga0068867_100002447 3300005459 Bacteria 13049
116 Ga0068867_100004433 3300005459 Bacteria 9869
117 Ga0068867_100007433 3300005459 Bacteria 7748
118 Ga0068867_100023789 3300005459 Bacteria 4388
119 Ga0068867_100038381 3300005459 Bacteria 3487
120 Ga0068867_100050732 3300005459 Bacteria 3059
121 Ga0068867_100193634 3300005459 Bacteria 1624
122 Ga0070706_100006300 3300005467 Bacteria 11210
123 Ga0070707_100365515 3300005468 Bacteria 1402
124 Ga0070707_100626795 3300005468 Bacteria 1038
125 Ga0070698_100136280 3300005471 Bacteria 2409
126 Ga0070699_100565021 3300005518 Bacteria 1036
127 Ga0070679_100006907 3300005530 Bacteria 10586
128 Ga0068853_100043022 3300005539 Bacteria 3864
129 Ga0068853_100146170 3300005539 Bacteria 2125
130 Ga0070672_100001055 3300005543 Bacteria 16808
131 Ga0070672_100003224 3300005543 Bacteria 10558
132 Ga0070672_100005119 3300005543 Bacteria 8650
133 Ga0070672_100037899 3300005543 Bacteria 3681
134 Ga0070672_100060089 3300005543 Bacteria 2992
135 Ga0070672_100069134 3300005543 Bacteria 2803
136 Ga0070672_100088044 3300005543 Bacteria 2499
137 Ga0070665_100189898 3300005548 Bacteria 2055
138 Ga0070665_100243450 3300005548 Bacteria 1799
139 Ga0068855_100056667 3300005563 Bacteria 4597
140 Ga0070664_100018592 3300005564 Bacteria 5712
141 Ga0070664_100049307 3300005564 Bacteria 3561
142 Ga0070664_100097436 3300005564 Bacteria 2553
143 Ga0070664_100691812 3300005564 Bacteria 949
144 Ga0068857_100054241 3300005577 Bacteria 3556
145 Ga0068857_100462992 3300005577 Bacteria 1187
146 Ga0068854_100081182 3300005578 Bacteria 2394
147 Ga0068854_100103875 3300005578 Bacteria 2134
148 Ga0068856_100030381 3300005614 Bacteria 5282
149 Ga0068856_100046644 3300005614 Bacteria 4267
150 Ga0068856_100071622 3300005614 Bacteria 3431
151 Ga0068856_100261102 3300005614 Bacteria 1747
152 Ga0070702_100041875 3300005615 Bacteria 2572
153 Ga0070702_100412145 3300005615 Bacteria 970
154 Ga0068852_100005860 3300005616 Bacteria 8830
155 Ga0068852_100042868 3300005616 Bacteria 3834
156 Ga0068852_100059785 3300005616 Bacteria 3306
157 Ga0068852_100094336 3300005616 Bacteria 2684
158 Ga0068852_100102707 3300005616 Bacteria 2584
159 Ga0068852_100103478 3300005616 Bacteria 2575
160 Ga0068852_100177915 3300005616 Bacteria 1998
161 Ga0068859_100006127 3300005617 Bacteria 12221
162 Ga0068859_100046989 3300005617 Bacteria 4335
163 Ga0068859_100055367 3300005617 Bacteria 3992
164 Ga0068859_100076727 3300005617 Bacteria 3382
165 Ga0068859_100263104 3300005617 Bacteria 1816
166 Ga0068859_100453483 3300005617 Bacteria 1379
167 Ga0068864_100008087 3300005618 Bacteria 8673
168 Ga0068864_100016853 3300005618 Bacteria 6088
169 Ga0068864_100023050 3300005618 Bacteria 5226
170 Ga0068864_100079544 3300005618 Bacteria 2870
171 Ga0068864_100273556 3300005618 Bacteria 1574
172 Ga0068866_10009815 3300005718 Bacteria 4080
173 Ga0068866_10218004 3300005718 Bacteria 1150
174 Ga0068866_10240878 3300005718 Bacteria 1101
175 Ga0068861_100003647 3300005719 Bacteria 10261
176 Ga0068861_100004823 3300005719 Bacteria 9067
177 Ga0068861_100092008 3300005719 Bacteria 2395
178 Ga0068861_100115763 3300005719 Bacteria 2154
179 Ga0068861_100425157 3300005719 Bacteria 1184
180 Ga0068851_10021056 3300005834 Bacteria 3163
181 Ga0068851_10033511 3300005834 Bacteria 2560
182 Ga0068851_10055387 3300005834 Bacteria 2020
183 Ga0068851_10134934 3300005834 Bacteria 1338
184 Ga0068870_10085206 3300005840 Bacteria 1756
185 Ga0068863_100003799 3300005841 Bacteria 14929
186 Ga0068863_100004935 3300005841 Bacteria 13153
187 Ga0068863_100024370 3300005841 Bacteria 5771
188 Ga0068863_100124200 3300005841 Bacteria 2462
189 Ga0068863_100174157 3300005841 Bacteria 2065
190 Ga0068863_100225772 3300005841 Bacteria 1805
191 Ga0068858_100002240 3300005842 Bacteria 19545
192 Ga0068858_100018725 3300005842 Bacteria 6480
193 Ga0068858_100030676 3300005842 Bacteria 4993
194 Ga0068858_100100687 3300005842 Bacteria 2695
195 Ga0068860_100000445 3300005843 Bacteria 52236
196 Ga0068860_100011586 3300005843 Bacteria 8694
197 Ga0068860_100104553 3300005843 Bacteria 2703
198 Ga0068860_100116222 3300005843 Bacteria 2559
199 Ga0068862_100007883 3300005844 Bacteria 8812
200 Ga0068862_100283482 3300005844 Bacteria 1519
201 Ga0075363_100007306 3300006048 Bacteria 5066
202 Ga0075364_10159044 3300006051 Bacteria 1524
203 Ga0075362_10012411 3300006177 Bacteria 3384
204 Ga0075362_10024479 3300006177 Bacteria 2561
205 Ga0075367_10003540 3300006178 Bacteria 7469
206 Ga0075367_10010023 3300006178 Bacteria 4965
207 Ga0075367_10020279 3300006178 Bacteria 3699
208 Ga0075367_10100393 3300006178 Bacteria 1768
209 Ga0075369_10006310 3300006186 Bacteria 4479
210 Ga0075366_10004769 3300006195 Bacteria 7313
211 Ga0075366_10006048 3300006195 Bacteria 6593
212 Ga0075366_10008731 3300006195 Bacteria 5642
213 Ga0075366_10012069 3300006195 Bacteria 4893
214 Ga0075366_10027438 3300006195 Bacteria 3340
215 Ga0075366_10072758 3300006195 Bacteria 2048
216 Ga0075366_10087914 3300006195 Bacteria 1861
217 Ga0075366_10095865 3300006195 Bacteria 1779
218 Ga0075366_10111105 3300006195 Bacteria 1648
219 Ga0075366_10142635 3300006195 Bacteria 1449
220 Ga0075366_10145499 3300006195 Bacteria 1434
221 Ga0075366_10162681 3300006195 Bacteria 1352
222 Ga0097621_100010996 3300006237 Bacteria 6648
223 Ga0097621_100011620 3300006237 Bacteria 6492
224 Ga0097621_100035014 3300006237 Bacteria 4009
225 Ga0097621_100065798 3300006237 Bacteria 2984
226 Ga0097621_100125754 3300006237 Bacteria 2177
227 Ga0097621_100138249 3300006237 Bacteria 2080
228 Ga0075370_10000058 3300006353 Bacteria 32658
229 Ga0075370_10000309 3300006353 Bacteria 17630
230 Ga0075370_10001852 3300006353 Bacteria 9478
231 Ga0075370_10005206 3300006353 Bacteria 6433
232 Ga0075370_10028537 3300006353 Bacteria 3102
233 Ga0075370_10049240 3300006353 Bacteria 2388
234 Ga0075370_10067197 3300006353 Bacteria 2046
235 Ga0075370_10094258 3300006353 Bacteria 1729
236 Ga0068871_100019544 3300006358 Bacteria 5174
237 Ga0068871_100030326 3300006358 Bacteria 4257
238 Ga0068871_100165884 3300006358 Bacteria 1891
239 Ga0068871_100252060 3300006358 Bacteria 1538
240 Ga0068871_100429821 3300006358 Bacteria 1180
241 Ga0075428_100638243 3300006844 Bacteria 1136
242 Ga0075429_100022073 3300006880 Bacteria 5521
243 Ga0068865_100016331 3300006881 Bacteria 4750
244 Ga0097620_100006126 3300006931 Bacteria 12221
245 Ga0097620_100046990 3300006931 Bacteria 4335
246 Ga0097620_100055369 3300006931 Bacteria 3992
247 Ga0097620_100076724 3300006931 Bacteria 3382
248 Ga0097620_100263110 3300006931 Bacteria 1816
249 Ga0097620_100453462 3300006931 Bacteria 1379
250 Ga0099823_1013910 3300006944 Bacteria 8072
251 Ga0079104_1000219 3300006946 Bacteria 79928
252 Ga0105240_10056490 3300009093 Bacteria 4911
253 Ga0105245_10019948 3300009098 Bacteria 5878
254 Ga0105245_10086804 3300009098 Bacteria 2870
255 Ga0105245_10177935 3300009098 Bacteria 2030
256 Ga0114129_10225999 3300009147 Bacteria 2523
257 Ga0105243_10005579 3300009148 Bacteria 9801
258 Ga0105243_10027205 3300009148 Bacteria 4380
259 Ga0105243_10075641 3300009148 Bacteria 2734
260 Ga0105243_10076482 3300009148 Bacteria 2720
261 Ga0105243_10183478 3300009148 Bacteria 1822
262 Ga0105243_10254998 3300009148 Bacteria 1568
263 Ga0105243_10425451 3300009148 Bacteria 1240
264 Ga0105241_10392015 3300009174 Bacteria 1216
265 Ga0105242_10093683 3300009176 Bacteria 2533
266 Ga0105242_10108564 3300009176 Bacteria 2362
267 Ga0105242_10252702 3300009176 Bacteria 1589
268 Ga0105248_10059118 3300009177 Bacteria 4305
269 Ga0105248_10094534 3300009177 Bacteria 3366
270 Ga0105248_10102774 3300009177 Bacteria 3221
271 Ga0105248_10129449 3300009177 Bacteria 2847
272 Ga0105248_10143573 3300009177 Bacteria 2693
273 Ga0105237_10001461 3300009545 Bacteria 31169
274 Ga0105237_10015735 3300009545 Bacteria 7865
275 Ga0105237_10029245 3300009545 Bacteria 5604
276 Ga0105237_10100294 3300009545 Bacteria 2887
277 Ga0105238_10041551 3300009551 Bacteria 4656
278 Ga0105249_10005956 3300009553 Bacteria 10564
279 Ga0105249_10441764 3300009553 Bacteria 1338
280 Ga0105239_10389407 3300010375 Bacteria 1576
281 Ga0105239_10701336 3300010375 Bacteria 1157
282 Ga0105239_10776161 3300010375 Bacteria 1097
283 Ga0157317_1001003 3300012475 Bacteria 1422
284 Ga0157319_1000001 3300012497 Bacteria 423237
285 Ga0157373_10044395 3300013100 Bacteria 3173
286 Ga0157369_10246035 3300013105 Bacteria 1867
287 Ga0157369_10689220 3300013105 Bacteria 1052
288 Ga0157374_10034608 3300013296 Bacteria 4616
289 Ga0157374_10169179 3300013296 Bacteria 2131
290 Ga0157378_10026414 3300013297 Bacteria 5118
291 Ga0157378_10099437 3300013297 Bacteria 2654
292 Ga0157378_10343340 3300013297 Bacteria 1457
293 Ga0157378_10595247 3300013297 Bacteria 1116
294 Ga0163162_10002995 3300013306 Bacteria 16145
295 Ga0163162_10034726 3300013306 Bacteria 5020
296 Ga0163162_10052199 3300013306 Bacteria 4106
297 Ga0163162_10112573 3300013306 Bacteria 2820
298 Ga0157372_10988954 3300013307 Bacteria 974
299 Ga0157375_10011447 3300013308 Bacteria 7833
300 Ga0157375_10022022 3300013308 Bacteria 5860
301 Ga0157375_10028630 3300013308 Bacteria 5227
302 Ga0157375_10066886 3300013308 Bacteria 3589
303 Ga0157375_10073701 3300013308 Bacteria 3433
304 Ga0157375_10201742 3300013308 Bacteria 2145
305 Ga0157375_10251130 3300013308 Bacteria 1929
306 Ga0157375_10384036 3300013308 Bacteria 1571
307 Ga0163163_10045264 3300014325 Bacteria 4319
308 Ga0163163_10200494 3300014325 Bacteria 2044
309 Ga0157380_10024747 3300014326 Bacteria 4547
310 Ga0157380_10038429 3300014326 Bacteria 3716
311 Ga0157380_10044937 3300014326 Bacteria 3464
312 Ga0157380_10145152 3300014326 Bacteria 2044
313 Ga0157380_10149420 3300014326 Bacteria 2018
314 Ga0157380_10184452 3300014326 Bacteria 1836
315 Ga0157377_10000038 3300014745 Bacteria 113777
316 Ga0157377_10017418 3300014745 Bacteria 3715
317 Ga0157379_10008098 3300014968 Bacteria 9127
318 Ga0157379_10041068 3300014968 Bacteria 4129
319 Ga0157379_10064914 3300014968 Bacteria 3263
320 Ga0157379_10076979 3300014968 Bacteria 2987
321 Ga0157379_10148959 3300014968 Bacteria 2111
322 Ga0157376_10016516 3300014969 Bacteria 5607
323 Ga0157376_10034451 3300014969 Bacteria 4089
324 Ga0157376_10379927 3300014969 Bacteria 1360
325 Ga0182007_10021855 3300015262 Bacteria 2266
326 Ga0163161_10004047 3300017792 Bacteria 10254
327 Ga0163161_10023239 3300017792 Bacteria 4372
328 Ga0163161_10061561 3300017792 Bacteria 2732
329 Ga0163161_10174345 3300017792 Bacteria 1646
330 Ga0163161_10428099 3300017792 Bacteria 1066
331 Ga0213872_10000003 3300021361 Bacteria 366948
332 Ga0213872_10000046 3300021361 Bacteria 109934
333 Ga0213872_10000124 3300021361 Bacteria 72197
334 Ga0213872_10003125 3300021361 Bacteria 9306
335 Ga0213872_10019223 3300021361 Bacteria 3147
336 Ga0213872_10025664 3300021361 Bacteria 2708
337 Ga0213872_10035777 3300021361 Bacteria 2270
338 Ga0209563_100005 3300025230 Bacteria 1774893
339 Ga0207425_1000135 3300025245 Bacteria 66450
340 Ga0209129_1000043 3300025258 Bacteria 298978
341 Ga0209565_1011977 3300025263 Bacteria 2086
342 Ga0207666_1001401 3300025271 Bacteria 2841
343 Ga0209673_1006841 3300025273 Bacteria 5407
344 Ga0209673_1016786 3300025273 Bacteria 2724
345 Ga0209675_1007084 3300025291 Bacteria 4369
346 Ga0209564_1000005 3300025295 Bacteria 1147192
347 Ga0209564_1000014 3300025295 Bacteria 621501
348 Ga0209758_1000492 3300025297 Bacteria 64511
349 Ga0209758_1005135 3300025297 Bacteria 10334
350 Ga0209050_1000493 3300025298 Bacteria 67885
351 Ga0209050_1000543 3300025298 Bacteria 62404
352 Ga0209050_1003305 3300025298 Bacteria 12067
353 Ga0209050_1033582 3300025298 Bacteria 1553
354 Ga0209256_1000092 3300025299 Bacteria 210547
355 Ga0209256_1000213 3300025299 Bacteria 108298
356 Ga0209256_1005252 3300025299 Bacteria 7563
357 Ga0209051_1000020 3300025303 Bacteria 508628
358 Ga0209051_1005067 3300025303 Bacteria 7833
359 Ga0209051_1010963 3300025303 Bacteria 4521
360 Ga0209257_1000017 3300025304 Bacteria 866287
361 Ga0209257_1000189 3300025304 Bacteria 153917
362 Ga0209257_1000805 3300025304 Bacteria 45597
363 Ga0209257_1000913 3300025304 Bacteria 41162
364 Ga0209257_1024150 3300025304 Bacteria 2113
365 Ga0209257_1031534 3300025304 Bacteria 1694
366 Ga0207697_10027645 3300025315 Bacteria 2319
367 Ga0207656_10061537 3300025321 Bacteria 1648
368 Ga0207656_10063503 3300025321 Bacteria 1626
369 Ga0207682_10001133 3300025893 Bacteria 12330
370 Ga0207682_10002990 3300025893 Bacteria 7417
371 Ga0207682_10013224 3300025893 Bacteria 3218
372 Ga0207682_10023137 3300025893 Bacteria 2453
373 Ga0207682_10038238 3300025893 Bacteria 1946
374 Ga0207688_10123877 3300025901 Bacteria 1510
375 Ga0207680_10020608 3300025903 Bacteria 3554
376 Ga0207645_10001485 3300025907 Bacteria 19163
377 Ga0207645_10003455 3300025907 Bacteria 11994
378 Ga0207643_10043348 3300025908 Bacteria 2539
379 Ga0207643_10105249 3300025908 Bacteria 1658
380 Ga0207705_10035148 3300025909 Bacteria 3585
381 Ga0207705_10177492 3300025909 Bacteria 1606
382 Ga0207684_10018378 3300025910 Bacteria 5985
383 Ga0207695_10042429 3300025913 Bacteria 4859
384 Ga0207671_10010195 3300025914 Bacteria 7780
385 Ga0207671_10253053 3300025914 Bacteria 1385
386 Ga0207662_10033599 3300025918 Bacteria 2991
387 Ga0207662_10058170 3300025918 Bacteria 2313
388 Ga0207657_10056764 3300025919 Bacteria 3376
389 Ga0207657_10109249 3300025919 Bacteria 2286
390 Ga0207657_10151582 3300025919 Bacteria 1888
391 Ga0207657_10506731 3300025919 Bacteria 945
392 Ga0207649_10001821 3300025920 Bacteria 12174
393 Ga0207649_10294009 3300025920 Bacteria 1185
394 Ga0207646_10180410 3300025922 Bacteria 1907
395 Ga0207681_10004618 3300025923 Bacteria 8465
396 Ga0207681_10026584 3300025923 Bacteria 3734
397 Ga0207681_10403638 3300025923 Bacteria 1104
398 Ga0207694_10025174 3300025924 Bacteria 4521
399 Ga0207694_10418624 3300025924 Bacteria 1116
400 Ga0207650_10001149 3300025925 Bacteria 19437
401 Ga0207650_10003908 3300025925 Bacteria 10189
402 Ga0207650_10055912 3300025925 Bacteria 2931
403 Ga0207650_10378100 3300025925 Bacteria 1169
404 Ga0207659_10000477 3300025926 Bacteria 24093
405 Ga0207659_10000691 3300025926 Bacteria 20035
406 Ga0207659_10032109 3300025926 Bacteria 3600
407 Ga0207659_10112447 3300025926 Bacteria 2072
408 Ga0207687_10007233 3300025927 Bacteria 7321
409 Ga0207687_10064103 3300025927 Bacteria 2604
410 Ga0207687_10110502 3300025927 Bacteria 2039
411 Ga0207644_10001362 3300025931 Bacteria 15719
412 Ga0207644_10002098 3300025931 Bacteria 12916
413 Ga0207644_10006058 3300025931 Bacteria 7888
414 Ga0207644_10012856 3300025931 Bacteria 5568
415 Ga0207644_10034811 3300025931 Bacteria 3525
416 Ga0207644_10098074 3300025931 Bacteria 2196
417 Ga0207690_10005130 3300025932 Bacteria 7732
418 Ga0207706_10000756 3300025933 Bacteria 33603
419 Ga0207706_10001466 3300025933 Bacteria 23574
420 Ga0207706_10004450 3300025933 Bacteria 13166
421 Ga0207706_10051089 3300025933 Bacteria 3651
422 Ga0207706_10120264 3300025933 Bacteria 2309
423 Ga0207706_10141138 3300025933 Bacteria 2119
424 Ga0207706_10159532 3300025933 Bacteria 1983
425 Ga0207686_10006958 3300025934 Bacteria 6088
426 Ga0207686_10262698 3300025934 Bacteria 1266
427 Ga0207686_10388882 3300025934 Bacteria 1060
428 Ga0207709_10003694 3300025935 Bacteria 9012
429 Ga0207709_10106040 3300025935 Bacteria 1869
430 Ga0207709_10185783 3300025935 Bacteria 1472
431 Ga0207670_10025777 3300025936 Bacteria 3696
432 Ga0207670_10080473 3300025936 Bacteria 2277
433 Ga0207669_10005292 3300025937 Bacteria 5773
434 Ga0207669_10085614 3300025937 Bacteria 2035
435 Ga0207669_10098013 3300025937 Bacteria 1929
436 Ga0207704_10085429 3300025938 Bacteria 2054
437 Ga0207704_10188428 3300025938 Bacteria 1498
438 Ga0207691_10001243 3300025940 Bacteria 25438
439 Ga0207691_10003923 3300025940 Bacteria 14453
440 Ga0207691_10005630 3300025940 Bacteria 12112
441 Ga0207691_10017263 3300025940 Bacteria 6846
442 Ga0207691_10039879 3300025940 Bacteria 4343
443 Ga0207691_10111776 3300025940 Bacteria 2429
444 Ga0207691_10141115 3300025940 Bacteria 2123
445 Ga0207691_10244532 3300025940 Bacteria 1550
446 Ga0207711_10021174 3300025941 Bacteria 5431
447 Ga0207711_10087955 3300025941 Bacteria 2727
448 Ga0207711_10225169 3300025941 Bacteria 1716
449 Ga0207711_10332043 3300025941 Bacteria 1406
450 Ga0207689_10006829 3300025942 Bacteria 10035
451 Ga0207689_10012976 3300025942 Bacteria 7115
452 Ga0207689_10015924 3300025942 Bacteria 6366
453 Ga0207689_10207502 3300025942 Bacteria 1618
454 Ga0207689_10569822 3300025942 Bacteria 952
455 Ga0207661_10109080 3300025944 Bacteria 2338
456 Ga0207661_10214944 3300025944 Bacteria 1696
457 Ga0207679_10000249 3300025945 Bacteria 41064
458 Ga0207679_10024487 3300025945 Bacteria 4139
459 Ga0207679_10083377 3300025945 Bacteria 2450
460 Ga0207679_10130780 3300025945 Bacteria 2013
461 Ga0207679_10554680 3300025945 Bacteria 1031
462 Ga0207651_10001278 3300025960 Bacteria 11329
463 Ga0207651_10016116 3300025960 Bacteria 4366
464 Ga0207651_10175494 3300025960 Bacteria 1694
465 Ga0207651_10198323 3300025960 Bacteria 1606
466 Ga0207651_10249569 3300025960 Bacteria 1451
467 Ga0207651_10268485 3300025960 Bacteria 1404
468 Ga0207651_10325067 3300025960 Bacteria 1287
469 Ga0207668_10004912 3300025972 Bacteria 7862
470 Ga0207668_10215294 3300025972 Bacteria 1539
471 Ga0207668_10294430 3300025972 Bacteria 1337
472 Ga0207658_10001089 3300025986 Bacteria 21924
473 Ga0207658_10018268 3300025986 Bacteria 4839
474 Ga0207658_10027241 3300025986 Bacteria 4013
475 Ga0207658_10064121 3300025986 Bacteria 2755
476 Ga0207658_10205475 3300025986 Bacteria 1647
477 Ga0207677_10003776 3300026023 Bacteria 8043
478 Ga0207677_10008741 3300026023 Bacteria 5671
479 Ga0207677_10032641 3300026023 Bacteria 3350
480 Ga0207677_10063934 3300026023 Bacteria 2560
481 Ga0207677_10069721 3300026023 Bacteria 2474
482 Ga0207677_10081795 3300026023 Bacteria 2319
483 Ga0207703_10000996 3300026035 Bacteria 27254
484 Ga0207703_10011365 3300026035 Bacteria 6926
485 Ga0207703_10041270 3300026035 Bacteria 3695
486 Ga0207703_10085277 3300026035 Bacteria 2643
487 Ga0207639_10014119 3300026041 Bacteria 5608
488 Ga0207639_10026149 3300026041 Bacteria 4239
489 Ga0207639_10213351 3300026041 Bacteria 1663
490 Ga0207639_10599492 3300026041 Bacteria 1016
491 Ga0207678_10000966 3300026067 Bacteria 26297
492 Ga0207678_10022962 3300026067 Bacteria 5459
493 Ga0207678_10170485 3300026067 Bacteria 1858
494 Ga0207678_10182419 3300026067 Bacteria 1792
495 Ga0207708_10012827 3300026075 Bacteria 6249
496 Ga0207702_10039270 3300026078 Bacteria 3965
497 Ga0207641_10007488 3300026088 Bacteria 9086
498 Ga0207641_10014783 3300026088 Bacteria 6400
499 Ga0207641_10017054 3300026088 Bacteria 5942
500 Ga0207641_10387053 3300026088 Bacteria 1340
501 Ga0207648_10000118 3300026089 Bacteria 77144
502 Ga0207648_10002634 3300026089 Bacteria 19183
503 Ga0207648_10003767 3300026089 Bacteria 15842
504 Ga0207648_10028344 3300026089 Bacteria 4965
505 Ga0207648_10034335 3300026089 Bacteria 4471
506 Ga0207648_10048712 3300026089 Bacteria 3709
507 Ga0207648_10086378 3300026089 Bacteria 2737
508 Ga0207648_10144132 3300026089 Bacteria 2101
509 Ga0207676_10002837 3300026095 Bacteria 12331
510 Ga0207676_10008453 3300026095 Bacteria 7319
511 Ga0207676_10024294 3300026095 Bacteria 4482
512 Ga0207676_10075841 3300026095 Bacteria 2714
513 Ga0207676_10171182 3300026095 Bacteria 1892
514 Ga0207676_10197356 3300026095 Bacteria 1775
515 Ga0207674_10053978 3300026116 Bacteria 4094
516 Ga0207674_10310100 3300026116 Bacteria 1527
517 Ga0207674_10346592 3300026116 Bacteria 1436
518 Ga0207674_10488682 3300026116 Bacteria 1190
519 Ga0207675_100002744 3300026118 Bacteria 17315
520 Ga0207675_100003062 3300026118 Bacteria 16396
521 Ga0207675_100003340 3300026118 Bacteria 15701
522 Ga0207675_100054366 3300026118 Bacteria 3735
523 Ga0207683_10004250 3300026121 Bacteria 12360
524 Ga0207683_10040254 3300026121 Bacteria 4077
525 Ga0207683_10070680 3300026121 Bacteria 3084
526 Ga0207683_10098580 3300026121 Bacteria 2607
527 Ga0207683_10123684 3300026121 Bacteria 2323
528 Ga0207683_10216173 3300026121 Bacteria 1746
529 Ga0207698_10002449 3300026142 Bacteria 11002
530 Ga0207698_10028828 3300026142 Bacteria 3965
531 Ga0207698_10044988 3300026142 Bacteria 3322
532 Ga0207698_10067441 3300026142 Bacteria 2821
533 Ga0207698_10080338 3300026142 Bacteria 2626
534 Ga0209281_1000074 3300027111 Bacteria 267848
535 Ga0209389_1029316 3300027296 Bacteria 4683
536 Ga0209996_1001245 3300027395 Bacteria 3073
537 Ga0209968_1000261 3300027526 Bacteria 8985
538 Ga0209970_1001467 3300027614 Bacteria 4121
539 Ga0209966_1000074 3300027695 Bacteria 43833
540 Ga0209813_10046708 3300027866 Bacteria 1338
541 Ga0209974_10038421 3300027876 Bacteria 1591
542 Ga0209974_10110227 3300027876 Bacteria 968
543 Ga0268266_10038784 3300028379 Bacteria 4055
544 Ga0268266_10144301 3300028379 Bacteria 2139
545 Ga0268265_10598748 3300028380 Bacteria 1053
546 Ga0268264_10001857 3300028381 Bacteria 19207
547 Ga0268264_10002570 3300028381 Bacteria 15905
548 Ga0268264_10005397 3300028381 Bacteria 10824
549 Ga0307517_10010725 3300028786 Bacteria 12781
550 Ga0307517_10087776 3300028786 Bacteria 2580
551 Ga0307515_10000165 3300028794 Bacteria 162589
552 Ga0307515_10000188 3300028794 Bacteria 151439
553 Ga0307515_10005461 3300028794 Bacteria 25733
554 Ga0307515_10018969 3300028794 Bacteria 12413
555 Ga0307515_10029938 3300028794 Bacteria 9173
556 Ga0307515_10105203 3300028794 Bacteria 3363
557 Ga0307515_10178168 3300028794 Bacteria 2087
558 Ga0307512_10045736 3300030522 Bacteria 3579
559 Ga0307512_10187295 3300030522 Bacteria 1149
560 Ga0265328_10009090 3300031239 Bacteria 4059
561 Ga0265331_10002493 3300031250 Bacteria 12446
562 Ga0265327_10000144 3300031251 Bacteria 156779
563 Ga0265327_10000210 3300031251 Bacteria 122385
564 Ga0265316_10000005 3300031344 Bacteria 304442
565 Ga0307513_10001902 3300031456 Bacteria 29673
566 Ga0307513_10008355 3300031456 Bacteria 13260
567 Ga0307513_10017436 3300031456 Bacteria 8610
568 Ga0307513_10138011 3300031456 Bacteria 2370
569 Ga0307513_10294259 3300031456 Bacteria 1393
570 Ga0307513_10318897 3300031456 Bacteria 1313
571 Ga0307509_10000234 3300031507 Bacteria 89398
572 Ga0307509_10056928 3300031507 Bacteria 4147
573 Ga0307509_10146314 3300031507 Bacteria 2288
574 Ga0307408_100000038 3300031548 Bacteria 183170
575 Ga0307408_100064886 3300031548 Bacteria 2676
576 Ga0307408_100200356 3300031548 Bacteria 1615
577 Ga0307408_100300530 3300031548 Bacteria 1344
578 Ga0307508_10000169 3300031616 Bacteria 78769
579 Ga0307508_10044094 3300031616 Bacteria 3991
580 Ga0307514_10013831 3300031649 Bacteria 6687
581 Ga0307514_10051134 3300031649 Bacteria 3204
582 Ga0307514_10072288 3300031649 Bacteria 2583
583 Ga0316576_10006300 3300031727 Bacteria 7373
584 Ga0316576_10021087 3300031727 Bacteria 4500
585 Ga0316578_10000172 3300031728 Bacteria 17665
586 Ga0316578_10014111 3300031728 Bacteria 4257
587 Ga0307516_10000311 3300031730 Bacteria 63197
588 Ga0307516_10000326 3300031730 Bacteria 61941
589 Ga0307516_10000897 3300031730 Bacteria 40914
590 Ga0307516_10446494 3300031730 Bacteria 950
591 Ga0307405_10011775 3300031731 Bacteria 4603
592 Ga0307405_10014690 3300031731 Bacteria 4219
593 Ga0307405_10109461 3300031731 Bacteria 1869
594 Ga0307405_10303706 3300031731 Bacteria 1212
595 Ga0307518_10292677 3300031838 Bacteria 997
596 Ga0307410_10020161 3300031852 Bacteria 4072
597 Ga0307410_10031911 3300031852 Bacteria 3385
598 Ga0307410_10052069 3300031852 Bacteria 2763
599 Ga0307406_10028541 3300031901 Bacteria 3372
600 Ga0307406_10361782 3300031901 Bacteria 1138
601 Ga0307407_10078395 3300031903 Bacteria 1990
602 Ga0307412_10006968 3300031911 Bacteria 6418
603 Ga0307412_10017136 3300031911 Bacteria 4332
604 Ga0307412_10028415 3300031911 Bacteria 3498
605 Ga0307412_10140247 3300031911 Bacteria 1769
606 Ga0307412_10315739 3300031911 Bacteria 1241
607 Ga0307409_100002191 3300031995 Bacteria 10092
608 Ga0307409_100007440 3300031995 Bacteria 6550
609 Ga0307416_100002040 3300032002 Bacteria 11368
610 Ga0307416_100030437 3300032002 Bacteria 4050
611 Ga0307416_100035298 3300032002 Bacteria 3817
612 Ga0307416_100532570 3300032002 Bacteria 1245
613 Ga0307416_100658449 3300032002 Bacteria 1133
614 Ga0307414_10062189 3300032004 Bacteria 2648
615 Ga0307411_10000111 3300032005 Bacteria 25501
616 Ga0307411_10005718 3300032005 Bacteria 6145
617 Ga0307411_10219080 3300032005 Bacteria 1475
618 Ga0307415_100012627 3300032126 Bacteria 4891
619 Ga0316593_10007882 3300032168 Bacteria 2945
620 Ga0307507_10053173 3300033179 Bacteria 3873
621 Ga0307507_10087111 3300033179 Bacteria 2702
622 Ga0307510_10003147 3300033180 Bacteria 19133
623 Ga0307510_10022531 3300033180 Bacteria 7314
624 Ga0316592_1008210 3300033524 Bacteria 2057
625 Ga0316592_1047859 3300033524 Bacteria 953
626 Ga0316588_1017053 3300033528 Bacteria 1616
627 Ga0316596_1005666 3300033541 Bacteria 2864
628 Ga0316596_1050199 3300033541 Bacteria 1103
629 Ga0373930_0018783 3300034816 Bacteria 1333
630 Ga0373940_0011703 3300035088 Bacteria 2089
631 Ga0373951_0015495 3300035091 Bacteria 1717
632 Ga0373939_0000004 3300035114 Bacteria 106519
633 Ga0373939_0060531 3300035114 Bacteria 1204
634 Ga0373956_0059059 3300035119 Bacteria 1735
635 Ga0373960_0006274 3300035121 Bacteria 2784
636 Ga0373943_0050329 3300035170 Bacteria 2047
637 Ga0373946_0040358 3300035171 Bacteria 1909
638 Ga0373962_0006239 3300035242 Bacteria 2885
639 Ga0373924_0034927 3300035410 Bacteria 2038
640 Ga0373931_0000546 3300035691 Bacteria 15448
641 Ga0373931_0009953 3300035691 Bacteria 4557
642 Ga0373935_0031345 3300035692 Bacteria 3299
643 Ga0373927_0039242 3300035695 Bacteria 3073
644 Ga0373937_0019374 3300036401 Bacteria 6091
645 Ga0373937_0097556 3300036401 Bacteria 2726
646 Ga0316584_0028137 3300036712 Bacteria 4142
647 Ga0316584_0091968 3300036712 Bacteria 2271
648 Ga0373925_0035960 3300037068 Bacteria 3656
649 Ga0373925_0094578 3300037068 Bacteria 2288
650 Ga0373925_0210626 3300037068 Bacteria 1548
651 Ga0373925_0267503 3300037068 Bacteria 1374
652 Ga0395900_0000355 3300037418 Bacteria 66598
653 Ga0395900_0508785 3300037418 Bacteria 1154
654 Ga0395905_0000777 3300037471 Bacteria 41933
655 Ga0395905_0003411 3300037471 Bacteria 17002
656 Ga0395905_0004659 3300037471 Bacteria 14178
657 Ga0395905_0008552 3300037471 Bacteria 10093
658 Ga0395905_0009989 3300037471 Bacteria 9251
659 Ga0395905_0023405 3300037471 Bacteria 5837
660 Ga0395905_0178674 3300037471 Bacteria 1992
661 Ga0395905_0328566 3300037471 Bacteria 1419
662 Ga0436365_0561202 3300039437 Bacteria 1329
663 Ga0436365_0936688 3300039437 Bacteria 1470
664 Ga0436361_0003822 3300039447 Bacteria 65675
665 Ga0436361_0633280 3300039447 Bacteria 103480
666 Ga0436361_0638016 3300039447 Bacteria 61418
667 Ga0436361_0895746 3300039447 Bacteria 1379
668 Ga0436361_0916159 3300039447 Bacteria 49060
669 Ga0436361_1079715 3300039447 Bacteria 4877
670 Ga0439461_0045495 3300041410 Bacteria 960
671 Ga0451798_0696078 3300041458 Bacteria 2059
672 Ga0451802_0574082 3300041460 Bacteria 1954
673 Ga0451807_1744250 3300041486 Bacteria 1149
674 Ga0451833_1159483 3300041491 Bacteria 1441
675 Ga0451841_0774662 3300041498 Bacteria 1035
676 Ga0451843_1695661 3300041509 Bacteria 1307
677 Ga0451853_2209517 3300041512 Bacteria 1102
678 Ga0439431_0001589 3300041997 Bacteria 5033
679 Ga0439449_0083375 3300042007 Bacteria 1179
680 Ga0439450_021953 3300042008 Bacteria 1374
681 Ga0439455_0000995 3300042012 Bacteria 4450
682 Ga0450890_001964 3300042127 Bacteria 2906
683 Ga0450889_001429 3300042144 Bacteria 2461
684 Ga0439446_0008764 3300042156 Bacteria 2695
685 Ga0439458_0047443 3300042157 Bacteria 1054
686 Ga0439459_0000191 3300042438 Bacteria 6711
687 Ga0439460_0010600 3300042461 Bacteria 2364
688 Ga0450916_000815 3300042530 Bacteria 2921
689 Ga0450918_001043 3300042531 Bacteria 5715
690 Ga0451577_0000641 3300042876 Bacteria 55722
691 Ga0451577_0008482 3300042876 Bacteria 10003
692 Ga0451577_0011912 3300042876 Bacteria 8199
693 Ga0451577_0015837 3300042876 Bacteria 6997
694 Ga0451577_0038688 3300042876 Bacteria 4289
695 Ga0451577_0077908 3300042876 Bacteria 2956
696 Ga0451577_0318412 3300042876 Bacteria 1410
697 Ga0451577_0415163 3300042876 Bacteria 1222
698 Ga0451577_0592286 3300042876 Bacteria 1006
699 Ga0466969_0000028 3300044656 Bacteria 92394
700 Ga0466972_0001085 3300044658 Bacteria 13048
701 Ga0466972_0029875 3300044658 Bacteria 2683
702 Ga0466966_0008387 3300044684 Bacteria 6843
703 Ga0466966_0020086 3300044684 Bacteria 4395
704 Ga0466961_0018744 3300044693 Bacteria 4452
705 Ga0466963_0000306 3300044694 Bacteria 22103
706 Ga0466964_0010048 3300044706 Bacteria 3565
707 Ga0466964_0178118 3300044706 Bacteria 1006
708 Ga0453684_0001818 3300044712 Bacteria 56168
709 Ga0453684_0009747 3300044712 Bacteria 16684
710 Ga0453684_0137499 3300044712 Bacteria 2922
711 Ga0453684_0157052 3300044712 Bacteria 2695
712 Ga0453684_0195762 3300044712 Bacteria 2361
713 Ga0453684_0314595 3300044712 Bacteria 1775
714 Ga0466971_0028647 3300044719 Bacteria 2491
715 Ga0466968_0050105 3300044735 Bacteria 1780
716 Ga0466970_0038282 3300044765 Bacteria 2543
717 Ga0466970_0111191 3300044765 Bacteria 1496
718 Ga0466957_0053737 3300044842 Bacteria 2456
719 Ga0466959_0001676 3300045049 Bacteria 13723
720 Ga0466959_0082802 3300045049 Bacteria 2311
721 Ga0451576_0002104 3300045051 Bacteria 31012
722 Ga0451576_0015228 3300045051 Bacteria 8526
723 Ga0451576_0019110 3300045051 Bacteria 7487
724 Ga0451576_0039970 3300045051 Bacteria 4966
725 Ga0451576_0237748 3300045051 Bacteria 1902
726 Ga0451576_0432301 3300045051 Bacteria 1381
727 Ga0466958_0159955 3300045836 Bacteria 1422
728 Ga0495592_0012833 3300046454 Bacteria 6370
729 Ga0495590_0016223 3300046457 Bacteria 2692
730 Ga0495590_0039265 3300046457 Bacteria 1651
731 Ga0495629_0025312 3300046459 Bacteria 4220
732 Ga0495629_0219417 3300046459 Bacteria 1312
733 Ga0495638_0127217 3300046460 Bacteria 1501
734 Ga0495638_0216196 3300046460 Bacteria 1074
735 Ga0495650_0000976 3300046471 Bacteria 32712
736 Ga0495580_0125242 3300046472 Bacteria 1783
737 Ga0495583_0042459 3300046506 Bacteria 2124
738 Ga0495606_0184383 3300046507 Bacteria 1201
739 Ga0495628_0301160 3300046516 Bacteria 1187
740 Ga0495632_0003074 3300046519 Bacteria 12127
741 Ga0495632_0006463 3300046519 Bacteria 7529
742 Ga0495642_0039547 3300046528 Bacteria 1914
743 Ga0495586_0064987 3300046535 Bacteria 1989
744 Ga0495621_0002740 3300046539 Bacteria 4781
745 Ga0495597_0022439 3300046542 Bacteria 2928
746 Ga0495625_0053069 3300046660 Bacteria 2901
747 Ga0495625_0079548 3300046660 Bacteria 2285
748 Ga0495658_0016429 3300046683 Bacteria 3810
749 Ga0495613_0060723 3300046689 Bacteria 2768
750 Ga0495670_0020117 3300046691 Bacteria 3290
751 Ga0495649_0001852 3300046694 Bacteria 15512
752 Ga0495674_0168034 3300047319 Bacteria 1832
753 Ga0495676_0054670 3300047321 Bacteria 3172
754 Ga0495687_000367 3300047443 Bacteria 56387
755 Ga0495687_006395 3300047443 Bacteria 7229
756 Ga0495684_0078731 3300047471 Bacteria 2502
757 Ga0495686_0006531 3300047472 Bacteria 8906
758 Ga0495593_0093103 3300047673 Bacteria 1551
759 Ga0496102_0003534 3300048905 Bacteria 13246
760 Ga0496102_0005742 3300048905 Bacteria 10544
761 Ga0496104_0106712 3300048907 Bacteria 2684
762 Ga0496104_0593837 3300048907 Bacteria 1018
763 Ga0496106_0012481 3300048909 Bacteria 6274
764 Ga0496106_0074237 3300048909 Bacteria 2603
765 Ga0496106_0121074 3300048909 Bacteria 2045
766 Ga0496108_0037095 3300048911 Bacteria 4059
767 Ga0496108_0115085 3300048911 Bacteria 2303
768 Ga0496109_0258525 3300048912 Bacteria 1640
769 Ga0496110_0096611 3300048913 Bacteria 2648
770 Ga0496110_0100048 3300048913 Bacteria 2599
771 Ga0496110_0258867 3300048913 Bacteria 1584
772 Ga0496110_0542526 3300048913 Bacteria 1057
773 Ga0496111_0016712 3300048914 Bacteria 5062
774 Ga0496112_0043915 3300048915 Bacteria 4376
775 Ga0496113_0006211 3300048916 Bacteria 7549
776 Ga0496113_0203823 3300048916 Bacteria 1573
777 Ga0496114_0007670 3300048917 Bacteria 8534
778 Ga0496121_0022834 3300048924 Bacteria 6048
779 Ga0496122_0074566 3300048925 Bacteria 2400
780 Ga0496124_0000138 3300048927 Bacteria 150311
781 Ga0496124_0063527 3300048927 Bacteria 3084
782 Ga0496124_0123263 3300048927 Bacteria 2068
783 Ga0496125_0001189 3300048928 Bacteria 39370
784 Ga0496125_0197833 3300048928 Bacteria 1320
785 Ga0501308_004681 3300049128 Bacteria 1331
786 Ga0501304_002933 3300049160 Bacteria 1220
787 Ga0501292_015918 3300049515 Bacteria 1179
788 Ga0501300_008168 3300049523 Bacteria 1533
789 Ga0501314_003951 3300049530 Bacteria 1213
790 Ga0501034_0375546 3300049571 Bacteria 1347
791 Ga0501039_0362830 3300049575 Bacteria 1138
792 Ga0501041_0088284 3300049577 Bacteria 1914
793 Ga0501043_0000002 3300049579 Bacteria 351081
794 Ga0501046_0000008 3300049580 Bacteria 351167
795 Ga0501047_0000003 3300049581 Bacteria 508375
796 Ga0501198_000014 3300049649 Bacteria 106940
797 Ga0501201_004887 3300049651 Bacteria 1248
798 Ga0501206_008312 3300049653 Bacteria 1370
799 Ga0501211_001618 3300049658 Bacteria 2411
800 Ga0501222_000008 3300049662 Bacteria 120904
801 Ga0501222_001642 3300049662 Bacteria 3107
802 Ga0501223_004639 3300049663 Bacteria 2924
803 Ga0501227_002798 3300049665 Bacteria 3831
804 Ga0501233_018737 3300049668 Bacteria 1459
805 Ga0501235_008379 3300049669 Bacteria 2256
806 Ga0501236_013541 3300049670 Bacteria 1117
807 Ga0501252_003010 3300049682 Bacteria 1713
808 Ga0501253_008366 3300049683 Bacteria 1486
809 Ga0501221_002992 3300049704 Bacteria 2785
810 Ga0501229_000954 3300049706 Bacteria 3272
811 Ga0501262_003682 3300049759 Bacteria 1766
812 Ga0501267_001793 3300049764 Bacteria 1876
813 Ga0501268_004583 3300049765 Bacteria 1954
814 Ga0501272_001041 3300049769 Bacteria 2558
815 Ga0501282_004903 3300049778 Bacteria 1430
816 Ga0501283_001477 3300049779 Bacteria 3042
817 Ga0501045_0012726 3300049824 Bacteria 5927
818 nmdc:mga00v17_19912_c1 3300050491 Bacteria 3837
819 nmdc:mga00v17_36384_c1 3300050491 Bacteria 2933
820 nmdc:mga00v17_90001_c1 3300050491 Bacteria 1926
821 nmdc:mga0k408_101548_c1 3300050493 Bacteria 1696
822 nmdc:mga0k408_104944_c1 3300050493 Bacteria 1668
823 nmdc:mga0k408_111673_c1 3300050493 Bacteria 1616
824 nmdc:mga0k408_137584_c1 3300050493 Bacteria 1452
825 nmdc:mga0k408_17696_c1 3300050493 Bacteria 3972
826 nmdc:mga0k408_23013_c1 3300050493 Bacteria 3512
827 nmdc:mga0k408_24559_c1 3300050493 Bacteria 3408
828 nmdc:mga0k408_24684_c1 3300050493 Bacteria 3399
829 nmdc:mga0k408_24760_c1 3300050493 Bacteria 3395
830 nmdc:mga0k408_26432_c1 3300050493 Bacteria 3291
831 nmdc:mga0k408_4347_c1 3300050493 Bacteria 7526
832 nmdc:mga0k408_5357_c1 3300050493 Bacteria 4614
833 nmdc:mga0k408_67349_c1 3300050493 Bacteria 2087
834 nmdc:mga0k408_734_c1 3300050493 Bacteria 16164
835 nmdc:mga0k408_7706_c1 3300050493 Bacteria 5754
836 nmdc:mga06z11_32273_c1 3300050494 Bacteria 2553
837 nmdc:mga06z11_33419_c1 3300050494 Bacteria 2516
838 nmdc:mga04h51_71035_c1 3300050495 Bacteria 1215
839 nmdc:mga07m45_14178_c1 3300050496 Bacteria 4240
840 nmdc:mga07m45_19348_c1 3300050496 Bacteria 3689
841 nmdc:mga07m45_194694_c1 3300050496 Bacteria 1179
842 nmdc:mga07m45_25391_c1 3300050496 Bacteria 3249
843 nmdc:mga07m45_57_c1 3300050496 Bacteria 46544
844 nmdc:mga07m45_7428_c1 3300050496 Bacteria 5601
845 nmdc:mga07m45_79116_c1 3300050496 Bacteria 1876
846 nmdc:mga07m45_8433_c1 3300050496 Bacteria 5300
847 nmdc:mga05p37_351329_c1 3300050507 Bacteria 1736
848 nmdc:mga09592_5629_c1 3300050508 Bacteria 10213
849 nmdc:mga0sz30_29883_c1 3300050516 Bacteria 2249
850 Ga0495619_0028690 3300053085 Bacteria 3591
851 Ga0500578_0000058 3300053086 Bacteria 119650
852 Ga0500578_0054149 3300053086 Bacteria 2569
853 Ga0500646_0025159 3300053090 Bacteria 1606
854 Ga0500583_0043952 3300053092 Bacteria 2043
855 Ga0500651_0009126 3300053093 Bacteria 5876
856 Ga0500651_0019235 3300053093 Bacteria 4240
857 Ga0500651_0059450 3300053093 Bacteria 2389
858 Ga0500593_001065 3300053117 Bacteria 9913
859 Ga0500623_051234 3300053127 Bacteria 2075
860 Ga0500642_0003464 3300053130 Bacteria 4773
861 Ga0500652_000027 3300053131 Bacteria 98912
862 Ga0500655_004171 3300053133 Bacteria 2602
863 Ga0500658_0091271 3300053134 Bacteria 1317
864 Ga0500658_0115906 3300053134 Bacteria 1184
865 Ga0500559_0000119 3300053136 Bacteria 62358
866 Ga0500568_0014139 3300053139 Bacteria 3614
867 Ga0500568_0049683 3300053139 Bacteria 1654
868 Ga0500573_0133676 3300053140 Bacteria 1372
869 Ga0500590_011236 3300053148 Bacteria 4534
870 Ga0500616_0050411 3300053153 Bacteria 2199
871 Ga0500619_000611 3300053154 Bacteria 6094
872 Ga0500622_0000221 3300053156 Bacteria 59833
873 Ga0500622_0004359 3300053156 Bacteria 8936
874 Ga0500622_0005218 3300053156 Bacteria 7857
875 Ga0500645_006045 3300053730 Bacteria 4369
876 Ga0500645_059627 3300053730 Bacteria 1105
877 Ga0590071_000370 3300059421 Bacteria 13155
878 Ga0501082_0139543 3300060353 Bacteria 2104
879 Ga0466962_0026119 3300061719 Bacteria 2804
880 2587728879 2585428057 Bacteria 6737412
881 2587736480 2585428058 Bacteria 6853932
882 2587758582 2585428062 Bacteria 6842168
883 2588294661 2588253510 Bacteria 6901809
884 2643745689 2643221544 Bacteria 5886209
885 2643936756 2643221585 Bacteria 5812563
886 2643970512 2643221592 Bacteria 6608788
887 2644142751 2643221625 Bacteria 6512927
888 2644221584 2643221639 Bacteria 6649903
889 2644246335 2643221644 Bacteria 6865017
890 2644257651 2643221646 Bacteria 6433402
891 2644272688 2643221648 Bacteria 6521465
892 2644303951 2643221654 Bacteria 5273570
893 2644318655 2643221656 Bacteria 5809961
894 2644340396 2643221660 Bacteria 4208257
895 2739058635 2738541337 Bacteria 6183410
896 2831869470 2831864461 Bacteria 6502356
897 2842721181 2842718218 Bacteria 4560148
898 2886853728 2886848708 Bacteria 5632523
899 2904479591 2904479285 Bacteria 5073931
900 2919707233 2919704043 Bacteria 5560311
901 2945949363 2945945610 Bacteria 5951079
902 2974324069 2974320154 Bacteria 4571377
903 Ga0105239_10000798
904 JGI24744J21845_10009695
905 JGI25153J46596_10010114
906 rootH2_10003861
907 rootL2_10008947
908 rootL2_10011993
909 rootH1_10027651
910 Ga0055525_1000011
911 Ga0055526_1002081
912 Ga0055526_1009068
913 Ga0055524_1000423
914 Ga0055530_10026604
915 Ga0055530_10032948
916 Ga0055540_1000015
917 Ga0055531_10000214
918 Ga0055531_10012695
919 Ga0055531_10012745
920 Ga0055543_1002451
921 Ga0055543_1018468
922 Ga0065165_1000024
923 Ga0065165_1000401
924 Ga0065165_1007960
925 Ga0065704_10115258
926 Ga0065707_10086296
927 Ga0070658_10442350
928 Ga0070676_10002580
929 Ga0070676_10003107
930 Ga0070676_10176335
931 Ga0070676_10182727
932 Ga0070683_100001824
933 Ga0070690_100015822
934 Ga0070690_100027719
935 Ga0070670_100000817
936 Ga0070670_100030985
937 Ga0070670_100113628
938 Ga0070670_100120306
939 Ga0070677_10011646
940 Ga0070677_10108708
941 Ga0070677_10119071
942 Ga0070677_10128255
943 Ga0068869_100008068
944 Ga0068869_100011581
945 Ga0068869_100049338
946 Ga0068869_100315725
947 Ga0070666_10000785
948 Ga0070682_100195879
949 Ga0068868_100007918
950 Ga0068868_100047011
951 Ga0068868_100063355
952 Ga0068868_100095787
953 Ga0068868_100345864
954 Ga0070660_100285612
955 Ga0070689_100036794
956 Ga0070687_100024523
957 Ga0070687_100035933
958 Ga0070661_100001209
959 Ga0070661_100044171
960 Ga0070661_100236421
961 Ga0070668_100020742
962 Ga0070668_100024278
963 Ga0070668_100028843
964 Ga0070668_100039349
965 Ga0070669_100031357
966 Ga0070669_100072267
967 Ga0070669_100082423
968 Ga0070669_100130631
969 Ga0070669_100153435
970 Ga0070675_100000285
971 Ga0070675_100003281
972 Ga0070675_100035548
973 Ga0070675_100045165
974 Ga0070675_100172746
975 Ga0070671_100002575
976 Ga0070671_100011706
977 Ga0070671_100015522
978 Ga0070671_100019406
979 Ga0070671_100049253
980 Ga0070671_100074679
981 Ga0070671_100083482
982 Ga0070671_100090319
983 Ga0070671_100134959
984 Ga0070671_100349687
985 Ga0070674_100032006
986 Ga0070674_100046123
987 Ga0070673_100001009
988 Ga0070673_100013002
989 Ga0070673_100058983
990 Ga0070673_100159301
991 Ga0070673_100178321
992 Ga0070673_100230122
993 Ga0070659_100005054
994 Ga0070659_100014835
995 Ga0070659_100097584
996 Ga0070667_100002773
997 Ga0070667_100003684
998 Ga0070667_100004040
999 Ga0070667_100028787
1000 Ga0070667_100052972
1001 Ga0070667_100105409
1002 Ga0070667_100236828
1003 Ga0070667_100306561
1004 Ga0070667_100459851
1005 Ga0070700_100018609
1006 Ga0070663_100000774
1007 Ga0070663_100004332
1008 Ga0070663_100180664
1009 Ga0070678_100013525
1010 Ga0070678_100027689
1011 Ga0070678_100119433
1012 Ga0070678_100322351
1013 Ga0070678_100409008
1014 Ga0070662_100069801
1015 Ga0070662_100164880
1016 Ga0068867_100000042
1017 Ga0068867_100002447
1018 Ga0068867_100004433
1019 Ga0068867_100007433
1020 Ga0068867_100023789
1021 Ga0068867_100038381
1022 Ga0068867_100050732
1023 Ga0068867_100193634
1024 Ga0070706_100006300
1025 Ga0070707_100365515
1026 Ga0070707_100626795
1027 Ga0070698_100136280
1028 Ga0070699_100565021
1029 Ga0070679_100006907
1030 Ga0068853_100043022
1031 Ga0068853_100146170
1032 Ga0070672_100001055
1033 Ga0070672_100003224
1034 Ga0070672_100005119
1035 Ga0070672_100037899
1036 Ga0070672_100060089
1037 Ga0070672_100069134
1038 Ga0070672_100088044
1039 Ga0070665_100189898
1040 Ga0070665_100243450
1041 Ga0068855_100056667
1042 Ga0070664_100018592
1043 Ga0070664_100049307
1044 Ga0070664_100097436
1045 Ga0070664_100691812
1046 Ga0068857_100054241
1047 Ga0068857_100462992
1048 Ga0068854_100081182
1049 Ga0068854_100103875
1050 Ga0068856_100030381
1051 Ga0068856_100046644
1052 Ga0068856_100071622
1053 Ga0068856_100261102
1054 Ga0070702_100041875
1055 Ga0070702_100412145
1056 Ga0068852_100005860
1057 Ga0068852_100042868
1058 Ga0068852_100059785
1059 Ga0068852_100094336
1060 Ga0068852_100102707
1061 Ga0068852_100103478
1062 Ga0068852_100177915
1063 Ga0068859_100006127
1064 Ga0068859_100046989
1065 Ga0068859_100055367
1066 Ga0068859_100076727
1067 Ga0068859_100263104
1068 Ga0068859_100453483
1069 Ga0068864_100008087
1070 Ga0068864_100016853
1071 Ga0068864_100023050
1072 Ga0068864_100079544
1073 Ga0068864_100273556
1074 Ga0068866_10009815
1075 Ga0068866_10218004
1076 Ga0068866_10240878
1077 Ga0068861_100003647
1078 Ga0068861_100004823
1079 Ga0068861_100092008
1080 Ga0068861_100115763
1081 Ga0068861_100425157
1082 Ga0068851_10021056
1083 Ga0068851_10033511
1084 Ga0068851_10055387
1085 Ga0068851_10134934
1086 Ga0068870_10085206
1087 Ga0068863_100003799
1088 Ga0068863_100004935
1089 Ga0068863_100024370
1090 Ga0068863_100124200
1091 Ga0068863_100174157
1092 Ga0068863_100225772
1093 Ga0068858_100002240
1094 Ga0068858_100018725
1095 Ga0068858_100030676
1096 Ga0068858_100100687
1097 Ga0068860_100000445
1098 Ga0068860_100011586
1099 Ga0068860_100104553
1100 Ga0068860_100116222
1101 Ga0068862_100007883
1102 Ga0068862_100283482
1103 Ga0075363_100007306
1104 Ga0075364_10159044
1105 Ga0075362_10012411
1106 Ga0075362_10024479
1107 Ga0075367_10003540
1108 Ga0075367_10010023
1109 Ga0075367_10020279
1110 Ga0075367_10100393
1111 Ga0075369_10006310
1112 Ga0075366_10004769
1113 Ga0075366_10006048
1114 Ga0075366_10008731
1115 Ga0075366_10012069
1116 Ga0075366_10027438
1117 Ga0075366_10072758
1118 Ga0075366_10087914
1119 Ga0075366_10095865
1120 Ga0075366_10111105
1121 Ga0075366_10142635
1122 Ga0075366_10145499
1123 Ga0075366_10162681
1124 Ga0097621_100010996
1125 Ga0097621_100011620
1126 Ga0097621_100035014
1127 Ga0097621_100065798
1128 Ga0097621_100125754
1129 Ga0097621_100138249
1130 Ga0075370_10000058
1131 Ga0075370_10000309
1132 Ga0075370_10001852
1133 Ga0075370_10005206
1134 Ga0075370_10028537
1135 Ga0075370_10049240
1136 Ga0075370_10067197
1137 Ga0075370_10094258
1138 Ga0068871_100019544
1139 Ga0068871_100030326
1140 Ga0068871_100165884
1141 Ga0068871_100252060
1142 Ga0068871_100429821
1143 Ga0075428_100638243
1144 Ga0075429_100022073
1145 Ga0068865_100016331
1146 Ga0097620_100006126
1147 Ga0097620_100046990
1148 Ga0097620_100055369
1149 Ga0097620_100076724
1150 Ga0097620_100263110
1151 Ga0097620_100453462
1152 Ga0099823_1013910
1153 Ga0079104_1000219
1154 Ga0105240_10056490
1155 Ga0105245_10019948
1156 Ga0105245_10086804
1157 Ga0105245_10177935
1158 Ga0114129_10225999
1159 Ga0105243_10005579
1160 Ga0105243_10027205
1161 Ga0105243_10075641
1162 Ga0105243_10076482
1163 Ga0105243_10183478
1164 Ga0105243_10254998
1165 Ga0105243_10425451
1166 Ga0105241_10392015
1167 Ga0105242_10093683
1168 Ga0105242_10108564
1169 Ga0105242_10252702
1170 Ga0105248_10059118
1171 Ga0105248_10094534
1172 Ga0105248_10102774
1173 Ga0105248_10129449
1174 Ga0105248_10143573
1175 Ga0105237_10001461
1176 Ga0105237_10015735
1177 Ga0105237_10029245
1178 Ga0105237_10100294
1179 Ga0105238_10041551
1180 Ga0105249_10005956
1181 Ga0105249_10441764
1182 Ga0105239_10389407
1183 Ga0105239_10701336
1184 Ga0105239_10776161
1185 Ga0157317_1001003
1186 Ga0157319_1000001
1187 Ga0157373_10044395
1188 Ga0157369_10246035
1189 Ga0157369_10689220
1190 Ga0157374_10034608
1191 Ga0157374_10169179
1192 Ga0157378_10026414
1193 Ga0157378_10099437
1194 Ga0157378_10343340
1195 Ga0157378_10595247
1196 Ga0163162_10002995
1197 Ga0163162_10034726
1198 Ga0163162_10052199
1199 Ga0163162_10112573
1200 Ga0157372_10988954
1201 Ga0157375_10011447
1202 Ga0157375_10022022
1203 Ga0157375_10028630
1204 Ga0157375_10066886
1205 Ga0157375_10073701
1206 Ga0157375_10201742
1207 Ga0157375_10251130
1208 Ga0157375_10384036
1209 Ga0163163_10045264
1210 Ga0163163_10200494
1211 Ga0157380_10024747
1212 Ga0157380_10038429
1213 Ga0157380_10044937
1214 Ga0157380_10145152
1215 Ga0157380_10149420
1216 Ga0157380_10184452
1217 Ga0157377_10000038
1218 Ga0157377_10017418
1219 Ga0157379_10008098
1220 Ga0157379_10041068
1221 Ga0157379_10064914
1222 Ga0157379_10076979
1223 Ga0157379_10148959
1224 Ga0157376_10016516
1225 Ga0157376_10034451
1226 Ga0157376_10379927
1227 Ga0182007_10021855
1228 Ga0163161_10004047
1229 Ga0163161_10023239
1230 Ga0163161_10061561
1231 Ga0163161_10174345
1232 Ga0163161_10428099
1233 Ga0213872_10000003
1234 Ga0213872_10000046
1235 Ga0213872_10000124
1236 Ga0213872_10003125
1237 Ga0213872_10019223
1238 Ga0213872_10025664
1239 Ga0213872_10035777
1240 Ga0209563_100005
1241 Ga0207425_1000135
1242 Ga0209129_1000043
1243 Ga0209565_1011977
1244 Ga0207666_1001401
1245 Ga0209673_1006841
1246 Ga0209673_1016786
1247 Ga0209675_1007084
1248 Ga0209564_1000005
1249 Ga0209564_1000014
1250 Ga0209758_1000492
1251 Ga0209758_1005135
1252 Ga0209050_1000493
1253 Ga0209050_1000543
1254 Ga0209050_1003305
1255 Ga0209050_1033582
1256 Ga0209256_1000092
1257 Ga0209256_1000213
1258 Ga0209256_1005252
1259 Ga0209051_1000020
1260 Ga0209051_1005067
1261 Ga0209051_1010963
1262 Ga0209257_1000017
1263 Ga0209257_1000189
1264 Ga0209257_1000805
1265 Ga0209257_1000913
1266 Ga0209257_1024150
1267 Ga0209257_1031534
1268 Ga0207697_10027645
1269 Ga0207656_10061537
1270 Ga0207656_10063503
1271 Ga0207682_10001133
1272 Ga0207682_10002990
1273 Ga0207682_10013224
1274 Ga0207682_10023137
1275 Ga0207682_10038238
1276 Ga0207688_10123877
1277 Ga0207680_10020608
1278 Ga0207645_10001485
1279 Ga0207645_10003455
1280 Ga0207643_10043348
1281 Ga0207643_10105249
1282 Ga0207705_10035148
1283 Ga0207705_10177492
1284 Ga0207684_10018378
1285 Ga0207695_10042429
1286 Ga0207671_10010195
1287 Ga0207671_10253053
1288 Ga0207662_10033599
1289 Ga0207662_10058170
1290 Ga0207657_10056764
1291 Ga0207657_10109249
1292 Ga0207657_10151582
1293 Ga0207657_10506731
1294 Ga0207649_10001821
1295 Ga0207649_10294009
1296 Ga0207646_10180410
1297 Ga0207681_10004618
1298 Ga0207681_10026584
1299 Ga0207681_10403638
1300 Ga0207694_10025174
1301 Ga0207694_10418624
1302 Ga0207650_10001149
1303 Ga0207650_10003908
1304 Ga0207650_10055912
1305 Ga0207650_10378100
1306 Ga0207659_10000477
1307 Ga0207659_10000691
1308 Ga0207659_10032109
1309 Ga0207659_10112447
1310 Ga0207687_10007233
1311 Ga0207687_10064103
1312 Ga0207687_10110502
1313 Ga0207644_10001362
1314 Ga0207644_10002098
1315 Ga0207644_10006058
1316 Ga0207644_10012856
1317 Ga0207644_10034811
1318 Ga0207644_10098074
1319 Ga0207690_10005130
1320 Ga0207706_10000756
1321 Ga0207706_10001466
1322 Ga0207706_10004450
1323 Ga0207706_10051089
1324 Ga0207706_10120264
1325 Ga0207706_10141138
1326 Ga0207706_10159532
1327 Ga0207686_10006958
1328 Ga0207686_10262698
1329 Ga0207686_10388882
1330 Ga0207709_10003694
1331 Ga0207709_10106040
1332 Ga0207709_10185783
1333 Ga0207670_10025777
1334 Ga0207670_10080473
1335 Ga0207669_10005292
1336 Ga0207669_10085614
1337 Ga0207669_10098013
1338 Ga0207704_10085429
1339 Ga0207704_10188428
1340 Ga0207691_10001243
1341 Ga0207691_10003923
1342 Ga0207691_10005630
1343 Ga0207691_10017263
1344 Ga0207691_10039879
1345 Ga0207691_10111776
1346 Ga0207691_10141115
1347 Ga0207691_10244532
1348 Ga0207711_10021174
1349 Ga0207711_10087955
1350 Ga0207711_10225169
1351 Ga0207711_10332043
1352 Ga0207689_10006829
1353 Ga0207689_10012976
1354 Ga0207689_10015924
1355 Ga0207689_10207502
1356 Ga0207689_10569822
1357 Ga0207661_10109080
1358 Ga0207661_10214944
1359 Ga0207679_10000249
1360 Ga0207679_10024487
1361 Ga0207679_10083377
1362 Ga0207679_10130780
1363 Ga0207679_10554680
1364 Ga0207651_10001278
1365 Ga0207651_10016116
1366 Ga0207651_10175494
1367 Ga0207651_10198323
1368 Ga0207651_10249569
1369 Ga0207651_10268485
1370 Ga0207651_10325067
1371 Ga0207668_10004912
1372 Ga0207668_10215294
1373 Ga0207668_10294430
1374 Ga0207658_10001089
1375 Ga0207658_10018268
1376 Ga0207658_10027241
1377 Ga0207658_10064121
1378 Ga0207658_10205475
1379 Ga0207677_10003776
1380 Ga0207677_10008741
1381 Ga0207677_10032641
1382 Ga0207677_10063934
1383 Ga0207677_10069721
1384 Ga0207677_10081795
1385 Ga0207703_10000996
1386 Ga0207703_10011365
1387 Ga0207703_10041270
1388 Ga0207703_10085277
1389 Ga0207639_10014119
1390 Ga0207639_10026149
1391 Ga0207639_10213351
1392 Ga0207639_10599492
1393 Ga0207678_10000966
1394 Ga0207678_10022962
1395 Ga0207678_10170485
1396 Ga0207678_10182419
1397 Ga0207708_10012827
1398 Ga0207702_10039270
1399 Ga0207641_10007488
1400 Ga0207641_10014783
1401 Ga0207641_10017054
1402 Ga0207641_10387053
1403 Ga0207648_10000118
1404 Ga0207648_10002634
1405 Ga0207648_10003767
1406 Ga0207648_10028344
1407 Ga0207648_10034335
1408 Ga0207648_10048712
1409 Ga0207648_10086378
1410 Ga0207648_10144132
1411 Ga0207676_10002837
1412 Ga0207676_10008453
1413 Ga0207676_10024294
1414 Ga0207676_10075841
1415 Ga0207676_10171182
1416 Ga0207676_10197356
1417 Ga0207674_10053978
1418 Ga0207674_10310100
1419 Ga0207674_10346592
1420 Ga0207674_10488682
1421 Ga0207675_100002744
1422 Ga0207675_100003062
1423 Ga0207675_100003340
1424 Ga0207675_100054366
1425 Ga0207683_10004250
1426 Ga0207683_10040254
1427 Ga0207683_10070680
1428 Ga0207683_10098580
1429 Ga0207683_10123684
1430 Ga0207683_10216173
1431 Ga0207698_10002449
1432 Ga0207698_10028828
1433 Ga0207698_10044988
1434 Ga0207698_10067441
1435 Ga0207698_10080338
1436 Ga0209281_1000074
1437 Ga0209389_1029316
1438 Ga0209996_1001245
1439 Ga0209968_1000261
1440 Ga0209970_1001467
1441 Ga0209966_1000074
1442 Ga0209813_10046708
1443 Ga0209974_10038421
1444 Ga0209974_10110227
1445 Ga0268266_10038784
1446 Ga0268266_10144301
1447 Ga0268265_10598748
1448 Ga0268264_10001857
1449 Ga0268264_10002570
1450 Ga0268264_10005397
1451 Ga0307517_10010725
1452 Ga0307517_10087776
1453 Ga0307515_10000165
1454 Ga0307515_10000188
1455 Ga0307515_10005461
1456 Ga0307515_10018969
1457 Ga0307515_10029938
1458 Ga0307515_10105203
1459 Ga0307515_10178168
1460 Ga0307512_10045736
1461 Ga0307512_10187295
1462 Ga0265328_10009090
1463 Ga0265331_10002493
1464 Ga0265327_10000144
1465 Ga0265327_10000210
1466 Ga0265316_10000005
1467 Ga0307513_10001902
1468 Ga0307513_10008355
1469 Ga0307513_10017436
1470 Ga0307513_10138011
1471 Ga0307513_10294259
1472 Ga0307513_10318897
1473 Ga0307509_10000234
1474 Ga0307509_10056928
1475 Ga0307509_10146314
1476 Ga0307408_100000038
1477 Ga0307408_100064886
1478 Ga0307408_100200356
1479 Ga0307408_100300530
1480 Ga0307508_10000169
1481 Ga0307508_10044094
1482 Ga0307514_10013831
1483 Ga0307514_10051134
1484 Ga0307514_10072288
1485 Ga0316576_10006300
1486 Ga0316576_10021087
1487 Ga0316578_10000172
1488 Ga0316578_10014111
1489 Ga0307516_10000311
1490 Ga0307516_10000326
1491 Ga0307516_10000897
1492 Ga0307516_10446494
1493 Ga0307405_10011775
1494 Ga0307405_10014690
1495 Ga0307405_10109461
1496 Ga0307405_10303706
1497 Ga0307518_10292677
1498 Ga0307410_10020161
1499 Ga0307410_10031911
1500 Ga0307410_10052069
1501 Ga0307406_10028541
1502 Ga0307406_10361782
1503 Ga0307407_10078395
1504 Ga0307412_10006968
1505 Ga0307412_10017136
1506 Ga0307412_10028415
1507 Ga0307412_10140247
1508 Ga0307412_10315739
1509 Ga0307409_100002191
1510 Ga0307409_100007440
1511 Ga0307416_100002040
1512 Ga0307416_100030437
1513 Ga0307416_100035298
1514 Ga0307416_100532570
1515 Ga0307416_100658449
1516 Ga0307414_10062189
1517 Ga0307411_10000111
1518 Ga0307411_10005718
1519 Ga0307411_10219080
1520 Ga0307415_100012627
1521 Ga0316593_10007882
1522 Ga0307507_10053173
1523 Ga0307507_10087111
1524 Ga0307510_10003147
1525 Ga0307510_10022531
1526 Ga0316592_1008210
1527 Ga0316592_1047859
1528 Ga0316588_1017053
1529 Ga0316596_1005666
1530 Ga0316596_1050199
1531 Ga0373930_0018783
1532 Ga0373940_0011703
1533 Ga0373951_0015495
1534 Ga0373939_0000004
1535 Ga0373939_0060531
1536 Ga0373956_0059059
1537 Ga0373960_0006274
1538 Ga0373943_0050329
1539 Ga0373946_0040358
1540 Ga0373962_0006239
1541 Ga0373924_0034927
1542 Ga0373931_0000546
1543 Ga0373931_0009953
1544 Ga0373935_0031345
1545 Ga0373927_0039242
1546 Ga0373937_0019374
1547 Ga0373937_0097556
1548 Ga0316584_0028137
1549 Ga0316584_0091968
1550 Ga0373925_0035960
1551 Ga0373925_0094578
1552 Ga0373925_0210626
1553 Ga0373925_0267503
1554 Ga0395900_0000355
1555 Ga0395900_0508785
1556 Ga0395905_0000777
1557 Ga0395905_0003411
1558 Ga0395905_0004659
1559 Ga0395905_0008552
1560 Ga0395905_0009989
1561 Ga0395905_0023405
1562 Ga0395905_0178674
1563 Ga0395905_0328566
1564 Ga0436365_0561202
1565 Ga0436365_0936688
1566 Ga0436361_0003822
1567 Ga0436361_0633280
1568 Ga0436361_0638016
1569 Ga0436361_0895746
1570 Ga0436361_0916159
1571 Ga0436361_1079715
1572 Ga0439461_0045495
1573 Ga0451798_0696078
1574 Ga0451802_0574082
1575 Ga0451807_1744250
1576 Ga0451833_1159483
1577 Ga0451841_0774662
1578 Ga0451843_1695661
1579 Ga0451853_2209517
1580 Ga0439431_0001589
1581 Ga0439449_0083375
1582 Ga0439450_021953
1583 Ga0439455_0000995
1584 Ga0450890_001964
1585 Ga0450889_001429
1586 Ga0439446_0008764
1587 Ga0439458_0047443
1588 Ga0439459_0000191
1589 Ga0439460_0010600
1590 Ga0450916_000815
1591 Ga0450918_001043
1592 Ga0451577_0000641
1593 Ga0451577_0008482
1594 Ga0451577_0011912
1595 Ga0451577_0015837
1596 Ga0451577_0038688
1597 Ga0451577_0077908
1598 Ga0451577_0318412
1599 Ga0451577_0415163
1600 Ga0451577_0592286
1601 Ga0466969_0000028
1602 Ga0466972_0001085
1603 Ga0466972_0029875
1604 Ga0466966_0008387
1605 Ga0466966_0020086
1606 Ga0466961_0018744
1607 Ga0466963_0000306
1608 Ga0466964_0010048
1609 Ga0466964_0178118
1610 Ga0453684_0001818
1611 Ga0453684_0009747
1612 Ga0453684_0137499
1613 Ga0453684_0157052
1614 Ga0453684_0195762
1615 Ga0453684_0314595
1616 Ga0466971_0028647
1617 Ga0466968_0050105
1618 Ga0466970_0038282
1619 Ga0466970_0111191
1620 Ga0466957_0053737
1621 Ga0466959_0001676
1622 Ga0466959_0082802
1623 Ga0451576_0002104
1624 Ga0451576_0015228
1625 Ga0451576_0019110
1626 Ga0451576_0039970
1627 Ga0451576_0237748
1628 Ga0451576_0432301
1629 Ga0466958_0159955
1630 Ga0495592_0012833
1631 Ga0495590_0016223
1632 Ga0495590_0039265
1633 Ga0495629_0025312
1634 Ga0495629_0219417
1635 Ga0495638_0127217
1636 Ga0495638_0216196
1637 Ga0495650_0000976
1638 Ga0495580_0125242
1639 Ga0495583_0042459
1640 Ga0495606_0184383
1641 Ga0495628_0301160
1642 Ga0495632_0003074
1643 Ga0495632_0006463
1644 Ga0495642_0039547
1645 Ga0495586_0064987
1646 Ga0495621_0002740
1647 Ga0495597_0022439
1648 Ga0495625_0053069
1649 Ga0495625_0079548
1650 Ga0495658_0016429
1651 Ga0495613_0060723
1652 Ga0495670_0020117
1653 Ga0495649_0001852
1654 Ga0495674_0168034
1655 Ga0495676_0054670
1656 Ga0495687_000367
1657 Ga0495687_006395
1658 Ga0495684_0078731
1659 Ga0495686_0006531
1660 Ga0495593_0093103
1661 Ga0496102_0003534
1662 Ga0496102_0005742
1663 Ga0496104_0106712
1664 Ga0496104_0593837
1665 Ga0496106_0012481
1666 Ga0496106_0074237
1667 Ga0496106_0121074
1668 Ga0496108_0037095
1669 Ga0496108_0115085
1670 Ga0496109_0258525
1671 Ga0496110_0096611
1672 Ga0496110_0100048
1673 Ga0496110_0258867
1674 Ga0496110_0542526
1675 Ga0496111_0016712
1676 Ga0496112_0043915
1677 Ga0496113_0006211
1678 Ga0496113_0203823
1679 Ga0496114_0007670
1680 Ga0496121_0022834
1681 Ga0496122_0074566
1682 Ga0496124_0000138
1683 Ga0496124_0063527
1684 Ga0496124_0123263
1685 Ga0496125_0001189
1686 Ga0496125_0197833
1687 Ga0501308_004681
1688 Ga0501304_002933
1689 Ga0501292_015918
1690 Ga0501300_008168
1691 Ga0501314_003951
1692 Ga0501034_0375546
1693 Ga0501039_0362830
1694 Ga0501041_0088284
1695 Ga0501043_0000002
1696 Ga0501046_0000008
1697 Ga0501047_0000003
1698 Ga0501198_000014
1699 Ga0501201_004887
1700 Ga0501206_008312
1701 Ga0501211_001618
1702 Ga0501222_000008
1703 Ga0501222_001642
1704 Ga0501223_004639
1705 Ga0501227_002798
1706 Ga0501233_018737
1707 Ga0501235_008379
1708 Ga0501236_013541
1709 Ga0501252_003010
1710 Ga0501253_008366
1711 Ga0501221_002992
1712 Ga0501229_000954
1713 Ga0501262_003682
1714 Ga0501267_001793
1715 Ga0501268_004583
1716 Ga0501272_001041
1717 Ga0501282_004903
1718 Ga0501283_001477
1719 Ga0501045_0012726
1720 nmdc:mga00v17_19912_c1
1721 nmdc:mga00v17_36384_c1
1722 nmdc:mga00v17_90001_c1
1723 nmdc:mga0k408_101548_c1
1724 nmdc:mga0k408_104944_c1
1725 nmdc:mga0k408_111673_c1
1726 nmdc:mga0k408_137584_c1
1727 nmdc:mga0k408_17696_c1
1728 nmdc:mga0k408_23013_c1
1729 nmdc:mga0k408_24559_c1
1730 nmdc:mga0k408_24684_c1
1731 nmdc:mga0k408_24760_c1
1732 nmdc:mga0k408_26432_c1
1733 nmdc:mga0k408_4347_c1
1734 nmdc:mga0k408_5357_c1
1735 nmdc:mga0k408_67349_c1
1736 nmdc:mga0k408_734_c1
1737 nmdc:mga0k408_7706_c1
1738 nmdc:mga06z11_32273_c1
1739 nmdc:mga06z11_33419_c1
1740 nmdc:mga04h51_71035_c1
1741 nmdc:mga07m45_14178_c1
1742 nmdc:mga07m45_19348_c1
1743 nmdc:mga07m45_194694_c1
1744 nmdc:mga07m45_25391_c1
1745 nmdc:mga07m45_57_c1
1746 nmdc:mga07m45_7428_c1
1747 nmdc:mga07m45_79116_c1
1748 nmdc:mga07m45_8433_c1
1749 nmdc:mga05p37_351329_c1
1750 nmdc:mga09592_5629_c1
1751 nmdc:mga0sz30_29883_c1
1752 Ga0495619_0028690
1753 Ga0500578_0000058
1754 Ga0500578_0054149
1755 Ga0500646_0025159
1756 Ga0500583_0043952
1757 Ga0500651_0009126
1758 Ga0500651_0019235
1759 Ga0500651_0059450
1760 Ga0500593_001065
1761 Ga0500623_051234
1762 Ga0500642_0003464
1763 Ga0500652_000027
1764 Ga0500655_004171
1765 Ga0500658_0091271
1766 Ga0500658_0115906
1767 Ga0500559_0000119
1768 Ga0500568_0014139
1769 Ga0500568_0049683
1770 Ga0500573_0133676
1771 Ga0500590_011236
1772 Ga0500616_0050411
1773 Ga0500619_000611
1774 Ga0500622_0000221
1775 Ga0500622_0004359
1776 Ga0500622_0005218
1777 Ga0500645_006045
1778 Ga0500645_059627
1779 Ga0590071_000370
1780 Ga0501082_0139543
1781 Ga0466962_0026119
1782 2587728879
1783 2587736480
1784 2587758582
1785 2588294661
1786 2643745689
1787 2643936756
1788 2643970512
1789 2644142751
1790 2644221584
1791 2644246335
1792 2644257651
1793 2644272688
1794 2644303951
1795 2644318655
1796 2644340396
1797 2739058635
1798 2831869470
1799 2842721181
1800 2886853728
1801 2904479591
1802 2919707233
1803 2945949363
1804 2974324069

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00483

NTP_transferase

Nucleotidyl transferase

27

293

0.88

PF12804

NTP_transf_3

MobA-like NTP transferase domain

28

191

0.79

Structural Annotation

Top 5 Hits

ID Description Score Start End
5i1f-assembly1.cif.gz_A-2 crystal structure of utp-glucose-1-phosphate uridylyltransferase from burkholderia vietnamiensis in complex with uridine-5'-diphosphate-glucose 0.9625 1 285
5ve7-assembly1.cif.gz_A crystal structure of utp-glucose-1-phosphate uridylyltransferase from burkholderia ambifaria in complex with utp 0.9586 1 286
5ve7-assembly1.cif.gz_A crystal structure of utp-glucose-1-phosphate uridylyltransferase from burkholderia ambifaria in complex with utp 0.9553 1 286
5j49-assembly1.cif.gz_A crystal structure of udp-glucose pyrophosporylase / utp-glucose-1-phosphate uridylyltransferase from burkholderia xenovorans 0.9496 1 287
5i1f-assembly1.cif.gz_A-2 crystal structure of utp-glucose-1-phosphate uridylyltransferase from burkholderia vietnamiensis in complex with uridine-5'-diphosphate-glucose 0.9495 1 285
ID Description Score Start End Superfamily
af_Q2G1T6_1_286_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.9553 1 286 3.90.550.10
af_Q2G1T6_1_286_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.9488 1 286 3.90.550.10
af_Q58730_1_282_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.9464 3 285 3.90.550.10
af_Q58730_1_282_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.9399 3 285 3.90.550.10
2ux8B00 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.9371 3 284 3.90.550.10
ID Description Score Start End GO Terms
AF-A0A2S5LAR8-F1-model_v4 UTP--glucose-1-phosphate uridylyltransferase (EC 2.7.7.9) (Alpha-D-glucosyl-1-phosphate uridylyltransferase) (UDP-glucose pyrophosphorylase) (Uridine diphosphoglucose pyrophosphorylase) 0.9913 126 288 GO:0003983
GO:0006011
GO:0009058
AF-A0A3D4LJV5-F1-model_v4 UTP--glucose-1-phosphate uridylyltransferase (EC 2.7.7.9) 0.9895 106 258 GO:0003983
GO:0006011
GO:0009058
AF-A0A4Q3QDS7-F1-model_v4 deleted 0.9888 103 288
AF-A0A353Y6T5-F1-model_v4 UTP--glucose-1-phosphate uridylyltransferase (EC 2.7.7.9) (Alpha-D-glucosyl-1-phosphate uridylyltransferase) (UDP-glucose pyrophosphorylase) (Uridine diphosphoglucose pyrophosphorylase) 0.9884 172 288 GO:0003983
GO:0006011
GO:0009058
AF-T0XS77-F1-model_v4 UTP--glucose-1-phosphate uridylyltransferase (EC 2.7.7.9) 0.9868 98 286 GO:0003983
GO:0006011
GO:0009058

Map