F485202
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 902 | 394 | 1804 | 288 |
Family's Representative Sequence
| Representative Sequence | 3300010375|Ga0105239_10000798|Ga0105239_1000079838 |
| Length | 310 |
| Sequence | VLLLDCKTRVPQFGAIPSGEKNMLVNKAIFPVAGLGTRFLPATKAQPKEMLPVVDKPLIQYAVEEAYAAGVREMIFVTGRHKRPIEDHFDMTFELEVALEQAGKQELLDVVRTVKPNDMECVYVRQAQALGLGHAVLCGQRLIGNEPFAVLLADDLMVGSPPVLRQMVEQFEEWRASILAVQEVPAEQTRRYGIVDGTEVNDRMMDISRIVEKPAPEDAPSRLGVAGRYILTPGVFHEIASQQRGVGGEIQLTDGIAALLRREKVFAYRYEGKRYDCGSKEGFLEANVELALQHPQLGEGFRKYLSTLQF |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 2 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 3 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 4 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 5 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 6 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 7 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 8 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 9 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 10 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 11 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 12 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 13 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 14 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 15 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 16 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 17 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 20 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 21 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 24 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 26 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 27 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 29 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 30 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 40 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 44 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 45 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 46 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 47 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 49 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 50 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 53 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 55 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 56 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 57 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 59 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 60 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 61 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 62 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 63 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 64 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 65 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 66 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 67 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 68 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 69 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 70 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 71 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 72 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 73 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 74 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 75 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 77 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 78 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 79 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 80 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 81 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300006944 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW | Metagenome | Nodule |
| 83 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 84 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300012475 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.old.080610 | Metagenome | Rhizosphere |
| 95 | 3300012497 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 | Metagenome | Rhizosphere |
| 96 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 109 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 111 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 112 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 113 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 114 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 115 | 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 117 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 118 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 119 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 120 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 121 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 122 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 123 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 124 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 174 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 175 | 3300027395 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300027526 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300027614 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 180 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 185 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 186 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 187 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 188 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 189 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 190 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 191 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 192 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 193 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 194 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 195 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 196 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 197 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 198 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 199 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 200 | 3300031838 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM | Metagenome | Unclassified |
| 201 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 202 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 203 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 204 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 205 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 206 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 207 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 208 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 209 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 210 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 211 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 212 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 213 | 3300033524 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 214 | 3300033528 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 215 | 3300033541 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 216 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 217 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 218 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 219 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 220 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 221 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 222 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 223 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 224 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 225 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 226 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 227 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 228 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 229 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 230 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 231 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 232 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 233 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 234 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 235 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 236 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 237 | 3300041458 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG | Metagenome | Rhizoplane |
| 238 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 239 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 240 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 241 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 242 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 243 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 244 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 245 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 246 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 247 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 248 | 3300042127 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 | Metagenome | Rhizosphere |
| 249 | 3300042144 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 | Metagenome | Rhizosphere |
| 250 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 251 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 252 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 253 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 254 | 3300042530 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 | Metagenome | Rhizosphere |
| 255 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 256 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 257 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 258 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 259 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 260 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 261 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 262 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 263 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 264 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 265 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 266 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 267 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 268 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 269 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 270 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 271 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 297 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 298 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 299 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 300 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 301 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 302 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 303 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 304 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 305 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 306 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 307 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 308 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 309 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 310 | 3300049128 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 311 | 3300049160 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 312 | 3300049515 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought | Metagenome | Rhizosphere |
| 313 | 3300049523 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control | Metagenome | Rhizosphere |
| 314 | 3300049530 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 315 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 316 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 317 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 318 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 319 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 320 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 321 | 3300049649 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought | Metagenome | Rhizosphere |
| 322 | 3300049651 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought | Metagenome | Rhizosphere |
| 323 | 3300049653 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control | Metagenome | Rhizosphere |
| 324 | 3300049658 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought | Metagenome | Rhizosphere |
| 325 | 3300049662 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control | Metagenome | Rhizosphere |
| 326 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 327 | 3300049665 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought | Metagenome | Rhizosphere |
| 328 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 329 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 330 | 3300049670 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought | Metagenome | Rhizosphere |
| 331 | 3300049682 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought | Metagenome | Rhizosphere |
| 332 | 3300049683 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control | Metagenome | Rhizosphere |
| 333 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 334 | 3300049706 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control | Metagenome | Rhizosphere |
| 335 | 3300049759 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought | Metagenome | Rhizosphere |
| 336 | 3300049764 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control | Metagenome | Rhizosphere |
| 337 | 3300049765 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought | Metagenome | Rhizosphere |
| 338 | 3300049769 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought | Metagenome | Rhizosphere |
| 339 | 3300049778 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control | Metagenome | Rhizosphere |
| 340 | 3300049779 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought | Metagenome | Rhizosphere |
| 341 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 342 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 343 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 344 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 345 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 346 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 347 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 348 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 349 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 350 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 352 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 353 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 354 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 355 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 356 | 3300053127 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 endosphere | Metagenome | Endosphere |
| 357 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 358 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 359 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 360 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 361 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 362 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 363 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 364 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 365 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 366 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 367 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 368 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 369 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 370 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 371 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 372 | 2585428057 | Methylibium sp. YR605 | Isolate | Rhizosphere |
| 373 | 2585428058 | Methylibium sp. CF468 | Isolate | Rhizosphere |
| 374 | 2585428062 | Methylibium sp. CF059 | Isolate | Rhizosphere |
| 375 | 2588253510 | Rhizobacter sp. OV335 | Isolate | Rhizosphere |
| 376 | 2643221544 | Pelomonas sp. Root1444 | Isolate | Unclassified |
| 377 | 2643221585 | Pelomonas sp. Root662 | Isolate | Unclassified |
| 378 | 2643221592 | Rhizobacter sp. Root16D2 | Isolate | Unclassified |
| 379 | 2643221625 | Rhizobacter sp. Root29 | Isolate | Unclassified |
| 380 | 2643221639 | Pelomonas sp. Root1217 | Isolate | Unclassified |
| 381 | 2643221644 | Rhizobacter sp. Root1221 | Isolate | Unclassified |
| 382 | 2643221646 | Pelomonas sp. Root1237 | Isolate | Unclassified |
| 383 | 2643221648 | Rhizobacter sp. Root1238 | Isolate | Unclassified |
| 384 | 2643221654 | Rhizobacter sp. Root404 | Isolate | Unclassified |
| 385 | 2643221656 | Pelomonas sp. Root405 | Isolate | Unclassified |
| 386 | 2643221660 | Methylibium sp. Root1272 | Isolate | Unclassified |
| 387 | 2738541337 | Pelomonas sp. BT06 | Isolate | Unclassified |
| 388 | 2831864461 | Roseateles noduli HZ7 | Isolate | Nodule |
| 389 | 2842718218 | Acidovorax sp. R-73343 | Isolate | Unclassified |
| 390 | 2886848708 | Mitsuaria sp. TWR114 | Isolate | Rhizosphere |
| 391 | 2904479285 | Comamonas sediminis 4487 | Isolate | Rhizosphere |
| 392 | 2919704043 | Hydrogenophaga palleronii 4249 | Isolate | Unclassified |
| 393 | 2945945610 | Variovorax paradoxus W1I18 | Isolate | Rhizosphere |
| 394 | 2974320154 | Acidovorax wautersii SORGH_AS 335 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 96.45 |
| Metatranscriptomes | 1 |
| Isolates | 2.55 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 14.3 |
| Nodule | 0.55 |
| Rhizoplane | 2.44 |
| Rhizosphere | 75.39 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0105239_10000798 | 3300010375 | Bacteria | 44685 |
| 2 | JGI24744J21845_10009695 | 3300002077 | Bacteria | 1977 |
| 3 | JGI25153J46596_10010114 | 3300003215 | Bacteria | 4301 |
| 4 | rootH2_10003861 | 3300003320 | Bacteria | 10179 |
| 5 | rootL2_10008947 | 3300003322 | Bacteria | 3632 |
| 6 | rootL2_10011993 | 3300003322 | Bacteria | 4512 |
| 7 | rootH1_10027651 | 3300003323 | Bacteria | 6466 |
| 8 | Ga0055525_1000011 | 3300003759 | Bacteria | 503124 |
| 9 | Ga0055526_1002081 | 3300003771 | Bacteria | 13745 |
| 10 | Ga0055526_1009068 | 3300003771 | Bacteria | 4853 |
| 11 | Ga0055524_1000423 | 3300003775 | Bacteria | 35532 |
| 12 | Ga0055530_10026604 | 3300003791 | Bacteria | 1595 |
| 13 | Ga0055530_10032948 | 3300003791 | Bacteria | 1342 |
| 14 | Ga0055540_1000015 | 3300003792 | Bacteria | 232986 |
| 15 | Ga0055531_10000214 | 3300003794 | Bacteria | 63569 |
| 16 | Ga0055531_10012695 | 3300003794 | Bacteria | 3940 |
| 17 | Ga0055531_10012745 | 3300003794 | Bacteria | 3928 |
| 18 | Ga0055543_1002451 | 3300004625 | Bacteria | 6124 |
| 19 | Ga0055543_1018468 | 3300004625 | Bacteria | 1301 |
| 20 | Ga0065165_1000024 | 3300005262 | Bacteria | 247672 |
| 21 | Ga0065165_1000401 | 3300005262 | Bacteria | 69929 |
| 22 | Ga0065165_1007960 | 3300005262 | Bacteria | 5073 |
| 23 | Ga0065704_10115258 | 3300005289 | Bacteria | 1875 |
| 24 | Ga0065707_10086296 | 3300005295 | Bacteria | 5545 |
| 25 | Ga0070658_10442350 | 3300005327 | Bacteria | 1119 |
| 26 | Ga0070676_10002580 | 3300005328 | Bacteria | 9317 |
| 27 | Ga0070676_10003107 | 3300005328 | Bacteria | 8578 |
| 28 | Ga0070676_10176335 | 3300005328 | Bacteria | 1386 |
| 29 | Ga0070676_10182727 | 3300005328 | Bacteria | 1364 |
| 30 | Ga0070683_100001824 | 3300005329 | Bacteria | 16612 |
| 31 | Ga0070690_100015822 | 3300005330 | Bacteria | 4507 |
| 32 | Ga0070690_100027719 | 3300005330 | Bacteria | 3504 |
| 33 | Ga0070670_100000817 | 3300005331 | Bacteria | 24262 |
| 34 | Ga0070670_100030985 | 3300005331 | Bacteria | 4606 |
| 35 | Ga0070670_100113628 | 3300005331 | Bacteria | 2334 |
| 36 | Ga0070670_100120306 | 3300005331 | Bacteria | 2265 |
| 37 | Ga0070677_10011646 | 3300005333 | Bacteria | 3038 |
| 38 | Ga0070677_10108708 | 3300005333 | Bacteria | 1235 |
| 39 | Ga0070677_10119071 | 3300005333 | Bacteria | 1190 |
| 40 | Ga0070677_10128255 | 3300005333 | Bacteria | 1154 |
| 41 | Ga0068869_100008068 | 3300005334 | Bacteria | 6767 |
| 42 | Ga0068869_100011581 | 3300005334 | Bacteria | 5790 |
| 43 | Ga0068869_100049338 | 3300005334 | Bacteria | 3047 |
| 44 | Ga0068869_100315725 | 3300005334 | Bacteria | 1266 |
| 45 | Ga0070666_10000785 | 3300005335 | Bacteria | 19230 |
| 46 | Ga0070682_100195879 | 3300005337 | Bacteria | 1422 |
| 47 | Ga0068868_100007918 | 3300005338 | Bacteria | 7590 |
| 48 | Ga0068868_100047011 | 3300005338 | Bacteria | 3380 |
| 49 | Ga0068868_100063355 | 3300005338 | Bacteria | 2933 |
| 50 | Ga0068868_100095787 | 3300005338 | Bacteria | 2396 |
| 51 | Ga0068868_100345864 | 3300005338 | Bacteria | 1273 |
| 52 | Ga0070660_100285612 | 3300005339 | Bacteria | 1351 |
| 53 | Ga0070689_100036794 | 3300005340 | Bacteria | 3743 |
| 54 | Ga0070687_100024523 | 3300005343 | Bacteria | 2881 |
| 55 | Ga0070687_100035933 | 3300005343 | Bacteria | 2465 |
| 56 | Ga0070661_100001209 | 3300005344 | Bacteria | 18186 |
| 57 | Ga0070661_100044171 | 3300005344 | Bacteria | 3255 |
| 58 | Ga0070661_100236421 | 3300005344 | Bacteria | 1405 |
| 59 | Ga0070668_100020742 | 3300005347 | Bacteria | 4962 |
| 60 | Ga0070668_100024278 | 3300005347 | Bacteria | 4592 |
| 61 | Ga0070668_100028843 | 3300005347 | Bacteria | 4211 |
| 62 | Ga0070668_100039349 | 3300005347 | Bacteria | 3617 |
| 63 | Ga0070669_100031357 | 3300005353 | Bacteria | 3839 |
| 64 | Ga0070669_100072267 | 3300005353 | Bacteria | 2553 |
| 65 | Ga0070669_100082423 | 3300005353 | Bacteria | 2398 |
| 66 | Ga0070669_100130631 | 3300005353 | Bacteria | 1926 |
| 67 | Ga0070669_100153435 | 3300005353 | Bacteria | 1784 |
| 68 | Ga0070675_100000285 | 3300005354 | Bacteria | 33772 |
| 69 | Ga0070675_100003281 | 3300005354 | Bacteria | 12273 |
| 70 | Ga0070675_100035548 | 3300005354 | Bacteria | 4049 |
| 71 | Ga0070675_100045165 | 3300005354 | Bacteria | 3604 |
| 72 | Ga0070675_100172746 | 3300005354 | Bacteria | 1864 |
| 73 | Ga0070671_100002575 | 3300005355 | Bacteria | 14065 |
| 74 | Ga0070671_100011706 | 3300005355 | Bacteria | 7055 |
| 75 | Ga0070671_100015522 | 3300005355 | Bacteria | 6155 |
| 76 | Ga0070671_100019406 | 3300005355 | Bacteria | 5532 |
| 77 | Ga0070671_100049253 | 3300005355 | Bacteria | 3505 |
| 78 | Ga0070671_100074679 | 3300005355 | Bacteria | 2832 |
| 79 | Ga0070671_100083482 | 3300005355 | Bacteria | 2671 |
| 80 | Ga0070671_100090319 | 3300005355 | Bacteria | 2564 |
| 81 | Ga0070671_100134959 | 3300005355 | Bacteria | 2080 |
| 82 | Ga0070671_100349687 | 3300005355 | Bacteria | 1261 |
| 83 | Ga0070674_100032006 | 3300005356 | Bacteria | 3490 |
| 84 | Ga0070674_100046123 | 3300005356 | Bacteria | 2980 |
| 85 | Ga0070673_100001009 | 3300005364 | Bacteria | 15963 |
| 86 | Ga0070673_100013002 | 3300005364 | Bacteria | 5740 |
| 87 | Ga0070673_100058983 | 3300005364 | Bacteria | 3037 |
| 88 | Ga0070673_100159301 | 3300005364 | Bacteria | 1918 |
| 89 | Ga0070673_100178321 | 3300005364 | Bacteria | 1817 |
| 90 | Ga0070673_100230122 | 3300005364 | Bacteria | 1608 |
| 91 | Ga0070659_100005054 | 3300005366 | Bacteria | 9458 |
| 92 | Ga0070659_100014835 | 3300005366 | Bacteria | 5826 |
| 93 | Ga0070659_100097584 | 3300005366 | Bacteria | 2362 |
| 94 | Ga0070667_100002773 | 3300005367 | Bacteria | 15141 |
| 95 | Ga0070667_100003684 | 3300005367 | Bacteria | 13046 |
| 96 | Ga0070667_100004040 | 3300005367 | Bacteria | 12405 |
| 97 | Ga0070667_100028787 | 3300005367 | Bacteria | 4625 |
| 98 | Ga0070667_100052972 | 3300005367 | Bacteria | 3424 |
| 99 | Ga0070667_100105409 | 3300005367 | Bacteria | 2440 |
| 100 | Ga0070667_100236828 | 3300005367 | Bacteria | 1629 |
| 101 | Ga0070667_100306561 | 3300005367 | Bacteria | 1430 |
| 102 | Ga0070667_100459851 | 3300005367 | Bacteria | 1163 |
| 103 | Ga0070700_100018609 | 3300005441 | Bacteria | 3996 |
| 104 | Ga0070663_100000774 | 3300005455 | Bacteria | 17411 |
| 105 | Ga0070663_100004332 | 3300005455 | Bacteria | 8320 |
| 106 | Ga0070663_100180664 | 3300005455 | Bacteria | 1636 |
| 107 | Ga0070678_100013525 | 3300005456 | Bacteria | 5121 |
| 108 | Ga0070678_100027689 | 3300005456 | Bacteria | 3852 |
| 109 | Ga0070678_100119433 | 3300005456 | Bacteria | 2076 |
| 110 | Ga0070678_100322351 | 3300005456 | Bacteria | 1320 |
| 111 | Ga0070678_100409008 | 3300005456 | Bacteria | 1180 |
| 112 | Ga0070662_100069801 | 3300005457 | Bacteria | 2588 |
| 113 | Ga0070662_100164880 | 3300005457 | Bacteria | 1736 |
| 114 | Ga0068867_100000042 | 3300005459 | Bacteria | 77140 |
| 115 | Ga0068867_100002447 | 3300005459 | Bacteria | 13049 |
| 116 | Ga0068867_100004433 | 3300005459 | Bacteria | 9869 |
| 117 | Ga0068867_100007433 | 3300005459 | Bacteria | 7748 |
| 118 | Ga0068867_100023789 | 3300005459 | Bacteria | 4388 |
| 119 | Ga0068867_100038381 | 3300005459 | Bacteria | 3487 |
| 120 | Ga0068867_100050732 | 3300005459 | Bacteria | 3059 |
| 121 | Ga0068867_100193634 | 3300005459 | Bacteria | 1624 |
| 122 | Ga0070706_100006300 | 3300005467 | Bacteria | 11210 |
| 123 | Ga0070707_100365515 | 3300005468 | Bacteria | 1402 |
| 124 | Ga0070707_100626795 | 3300005468 | Bacteria | 1038 |
| 125 | Ga0070698_100136280 | 3300005471 | Bacteria | 2409 |
| 126 | Ga0070699_100565021 | 3300005518 | Bacteria | 1036 |
| 127 | Ga0070679_100006907 | 3300005530 | Bacteria | 10586 |
| 128 | Ga0068853_100043022 | 3300005539 | Bacteria | 3864 |
| 129 | Ga0068853_100146170 | 3300005539 | Bacteria | 2125 |
| 130 | Ga0070672_100001055 | 3300005543 | Bacteria | 16808 |
| 131 | Ga0070672_100003224 | 3300005543 | Bacteria | 10558 |
| 132 | Ga0070672_100005119 | 3300005543 | Bacteria | 8650 |
| 133 | Ga0070672_100037899 | 3300005543 | Bacteria | 3681 |
| 134 | Ga0070672_100060089 | 3300005543 | Bacteria | 2992 |
| 135 | Ga0070672_100069134 | 3300005543 | Bacteria | 2803 |
| 136 | Ga0070672_100088044 | 3300005543 | Bacteria | 2499 |
| 137 | Ga0070665_100189898 | 3300005548 | Bacteria | 2055 |
| 138 | Ga0070665_100243450 | 3300005548 | Bacteria | 1799 |
| 139 | Ga0068855_100056667 | 3300005563 | Bacteria | 4597 |
| 140 | Ga0070664_100018592 | 3300005564 | Bacteria | 5712 |
| 141 | Ga0070664_100049307 | 3300005564 | Bacteria | 3561 |
| 142 | Ga0070664_100097436 | 3300005564 | Bacteria | 2553 |
| 143 | Ga0070664_100691812 | 3300005564 | Bacteria | 949 |
| 144 | Ga0068857_100054241 | 3300005577 | Bacteria | 3556 |
| 145 | Ga0068857_100462992 | 3300005577 | Bacteria | 1187 |
| 146 | Ga0068854_100081182 | 3300005578 | Bacteria | 2394 |
| 147 | Ga0068854_100103875 | 3300005578 | Bacteria | 2134 |
| 148 | Ga0068856_100030381 | 3300005614 | Bacteria | 5282 |
| 149 | Ga0068856_100046644 | 3300005614 | Bacteria | 4267 |
| 150 | Ga0068856_100071622 | 3300005614 | Bacteria | 3431 |
| 151 | Ga0068856_100261102 | 3300005614 | Bacteria | 1747 |
| 152 | Ga0070702_100041875 | 3300005615 | Bacteria | 2572 |
| 153 | Ga0070702_100412145 | 3300005615 | Bacteria | 970 |
| 154 | Ga0068852_100005860 | 3300005616 | Bacteria | 8830 |
| 155 | Ga0068852_100042868 | 3300005616 | Bacteria | 3834 |
| 156 | Ga0068852_100059785 | 3300005616 | Bacteria | 3306 |
| 157 | Ga0068852_100094336 | 3300005616 | Bacteria | 2684 |
| 158 | Ga0068852_100102707 | 3300005616 | Bacteria | 2584 |
| 159 | Ga0068852_100103478 | 3300005616 | Bacteria | 2575 |
| 160 | Ga0068852_100177915 | 3300005616 | Bacteria | 1998 |
| 161 | Ga0068859_100006127 | 3300005617 | Bacteria | 12221 |
| 162 | Ga0068859_100046989 | 3300005617 | Bacteria | 4335 |
| 163 | Ga0068859_100055367 | 3300005617 | Bacteria | 3992 |
| 164 | Ga0068859_100076727 | 3300005617 | Bacteria | 3382 |
| 165 | Ga0068859_100263104 | 3300005617 | Bacteria | 1816 |
| 166 | Ga0068859_100453483 | 3300005617 | Bacteria | 1379 |
| 167 | Ga0068864_100008087 | 3300005618 | Bacteria | 8673 |
| 168 | Ga0068864_100016853 | 3300005618 | Bacteria | 6088 |
| 169 | Ga0068864_100023050 | 3300005618 | Bacteria | 5226 |
| 170 | Ga0068864_100079544 | 3300005618 | Bacteria | 2870 |
| 171 | Ga0068864_100273556 | 3300005618 | Bacteria | 1574 |
| 172 | Ga0068866_10009815 | 3300005718 | Bacteria | 4080 |
| 173 | Ga0068866_10218004 | 3300005718 | Bacteria | 1150 |
| 174 | Ga0068866_10240878 | 3300005718 | Bacteria | 1101 |
| 175 | Ga0068861_100003647 | 3300005719 | Bacteria | 10261 |
| 176 | Ga0068861_100004823 | 3300005719 | Bacteria | 9067 |
| 177 | Ga0068861_100092008 | 3300005719 | Bacteria | 2395 |
| 178 | Ga0068861_100115763 | 3300005719 | Bacteria | 2154 |
| 179 | Ga0068861_100425157 | 3300005719 | Bacteria | 1184 |
| 180 | Ga0068851_10021056 | 3300005834 | Bacteria | 3163 |
| 181 | Ga0068851_10033511 | 3300005834 | Bacteria | 2560 |
| 182 | Ga0068851_10055387 | 3300005834 | Bacteria | 2020 |
| 183 | Ga0068851_10134934 | 3300005834 | Bacteria | 1338 |
| 184 | Ga0068870_10085206 | 3300005840 | Bacteria | 1756 |
| 185 | Ga0068863_100003799 | 3300005841 | Bacteria | 14929 |
| 186 | Ga0068863_100004935 | 3300005841 | Bacteria | 13153 |
| 187 | Ga0068863_100024370 | 3300005841 | Bacteria | 5771 |
| 188 | Ga0068863_100124200 | 3300005841 | Bacteria | 2462 |
| 189 | Ga0068863_100174157 | 3300005841 | Bacteria | 2065 |
| 190 | Ga0068863_100225772 | 3300005841 | Bacteria | 1805 |
| 191 | Ga0068858_100002240 | 3300005842 | Bacteria | 19545 |
| 192 | Ga0068858_100018725 | 3300005842 | Bacteria | 6480 |
| 193 | Ga0068858_100030676 | 3300005842 | Bacteria | 4993 |
| 194 | Ga0068858_100100687 | 3300005842 | Bacteria | 2695 |
| 195 | Ga0068860_100000445 | 3300005843 | Bacteria | 52236 |
| 196 | Ga0068860_100011586 | 3300005843 | Bacteria | 8694 |
| 197 | Ga0068860_100104553 | 3300005843 | Bacteria | 2703 |
| 198 | Ga0068860_100116222 | 3300005843 | Bacteria | 2559 |
| 199 | Ga0068862_100007883 | 3300005844 | Bacteria | 8812 |
| 200 | Ga0068862_100283482 | 3300005844 | Bacteria | 1519 |
| 201 | Ga0075363_100007306 | 3300006048 | Bacteria | 5066 |
| 202 | Ga0075364_10159044 | 3300006051 | Bacteria | 1524 |
| 203 | Ga0075362_10012411 | 3300006177 | Bacteria | 3384 |
| 204 | Ga0075362_10024479 | 3300006177 | Bacteria | 2561 |
| 205 | Ga0075367_10003540 | 3300006178 | Bacteria | 7469 |
| 206 | Ga0075367_10010023 | 3300006178 | Bacteria | 4965 |
| 207 | Ga0075367_10020279 | 3300006178 | Bacteria | 3699 |
| 208 | Ga0075367_10100393 | 3300006178 | Bacteria | 1768 |
| 209 | Ga0075369_10006310 | 3300006186 | Bacteria | 4479 |
| 210 | Ga0075366_10004769 | 3300006195 | Bacteria | 7313 |
| 211 | Ga0075366_10006048 | 3300006195 | Bacteria | 6593 |
| 212 | Ga0075366_10008731 | 3300006195 | Bacteria | 5642 |
| 213 | Ga0075366_10012069 | 3300006195 | Bacteria | 4893 |
| 214 | Ga0075366_10027438 | 3300006195 | Bacteria | 3340 |
| 215 | Ga0075366_10072758 | 3300006195 | Bacteria | 2048 |
| 216 | Ga0075366_10087914 | 3300006195 | Bacteria | 1861 |
| 217 | Ga0075366_10095865 | 3300006195 | Bacteria | 1779 |
| 218 | Ga0075366_10111105 | 3300006195 | Bacteria | 1648 |
| 219 | Ga0075366_10142635 | 3300006195 | Bacteria | 1449 |
| 220 | Ga0075366_10145499 | 3300006195 | Bacteria | 1434 |
| 221 | Ga0075366_10162681 | 3300006195 | Bacteria | 1352 |
| 222 | Ga0097621_100010996 | 3300006237 | Bacteria | 6648 |
| 223 | Ga0097621_100011620 | 3300006237 | Bacteria | 6492 |
| 224 | Ga0097621_100035014 | 3300006237 | Bacteria | 4009 |
| 225 | Ga0097621_100065798 | 3300006237 | Bacteria | 2984 |
| 226 | Ga0097621_100125754 | 3300006237 | Bacteria | 2177 |
| 227 | Ga0097621_100138249 | 3300006237 | Bacteria | 2080 |
| 228 | Ga0075370_10000058 | 3300006353 | Bacteria | 32658 |
| 229 | Ga0075370_10000309 | 3300006353 | Bacteria | 17630 |
| 230 | Ga0075370_10001852 | 3300006353 | Bacteria | 9478 |
| 231 | Ga0075370_10005206 | 3300006353 | Bacteria | 6433 |
| 232 | Ga0075370_10028537 | 3300006353 | Bacteria | 3102 |
| 233 | Ga0075370_10049240 | 3300006353 | Bacteria | 2388 |
| 234 | Ga0075370_10067197 | 3300006353 | Bacteria | 2046 |
| 235 | Ga0075370_10094258 | 3300006353 | Bacteria | 1729 |
| 236 | Ga0068871_100019544 | 3300006358 | Bacteria | 5174 |
| 237 | Ga0068871_100030326 | 3300006358 | Bacteria | 4257 |
| 238 | Ga0068871_100165884 | 3300006358 | Bacteria | 1891 |
| 239 | Ga0068871_100252060 | 3300006358 | Bacteria | 1538 |
| 240 | Ga0068871_100429821 | 3300006358 | Bacteria | 1180 |
| 241 | Ga0075428_100638243 | 3300006844 | Bacteria | 1136 |
| 242 | Ga0075429_100022073 | 3300006880 | Bacteria | 5521 |
| 243 | Ga0068865_100016331 | 3300006881 | Bacteria | 4750 |
| 244 | Ga0097620_100006126 | 3300006931 | Bacteria | 12221 |
| 245 | Ga0097620_100046990 | 3300006931 | Bacteria | 4335 |
| 246 | Ga0097620_100055369 | 3300006931 | Bacteria | 3992 |
| 247 | Ga0097620_100076724 | 3300006931 | Bacteria | 3382 |
| 248 | Ga0097620_100263110 | 3300006931 | Bacteria | 1816 |
| 249 | Ga0097620_100453462 | 3300006931 | Bacteria | 1379 |
| 250 | Ga0099823_1013910 | 3300006944 | Bacteria | 8072 |
| 251 | Ga0079104_1000219 | 3300006946 | Bacteria | 79928 |
| 252 | Ga0105240_10056490 | 3300009093 | Bacteria | 4911 |
| 253 | Ga0105245_10019948 | 3300009098 | Bacteria | 5878 |
| 254 | Ga0105245_10086804 | 3300009098 | Bacteria | 2870 |
| 255 | Ga0105245_10177935 | 3300009098 | Bacteria | 2030 |
| 256 | Ga0114129_10225999 | 3300009147 | Bacteria | 2523 |
| 257 | Ga0105243_10005579 | 3300009148 | Bacteria | 9801 |
| 258 | Ga0105243_10027205 | 3300009148 | Bacteria | 4380 |
| 259 | Ga0105243_10075641 | 3300009148 | Bacteria | 2734 |
| 260 | Ga0105243_10076482 | 3300009148 | Bacteria | 2720 |
| 261 | Ga0105243_10183478 | 3300009148 | Bacteria | 1822 |
| 262 | Ga0105243_10254998 | 3300009148 | Bacteria | 1568 |
| 263 | Ga0105243_10425451 | 3300009148 | Bacteria | 1240 |
| 264 | Ga0105241_10392015 | 3300009174 | Bacteria | 1216 |
| 265 | Ga0105242_10093683 | 3300009176 | Bacteria | 2533 |
| 266 | Ga0105242_10108564 | 3300009176 | Bacteria | 2362 |
| 267 | Ga0105242_10252702 | 3300009176 | Bacteria | 1589 |
| 268 | Ga0105248_10059118 | 3300009177 | Bacteria | 4305 |
| 269 | Ga0105248_10094534 | 3300009177 | Bacteria | 3366 |
| 270 | Ga0105248_10102774 | 3300009177 | Bacteria | 3221 |
| 271 | Ga0105248_10129449 | 3300009177 | Bacteria | 2847 |
| 272 | Ga0105248_10143573 | 3300009177 | Bacteria | 2693 |
| 273 | Ga0105237_10001461 | 3300009545 | Bacteria | 31169 |
| 274 | Ga0105237_10015735 | 3300009545 | Bacteria | 7865 |
| 275 | Ga0105237_10029245 | 3300009545 | Bacteria | 5604 |
| 276 | Ga0105237_10100294 | 3300009545 | Bacteria | 2887 |
| 277 | Ga0105238_10041551 | 3300009551 | Bacteria | 4656 |
| 278 | Ga0105249_10005956 | 3300009553 | Bacteria | 10564 |
| 279 | Ga0105249_10441764 | 3300009553 | Bacteria | 1338 |
| 280 | Ga0105239_10389407 | 3300010375 | Bacteria | 1576 |
| 281 | Ga0105239_10701336 | 3300010375 | Bacteria | 1157 |
| 282 | Ga0105239_10776161 | 3300010375 | Bacteria | 1097 |
| 283 | Ga0157317_1001003 | 3300012475 | Bacteria | 1422 |
| 284 | Ga0157319_1000001 | 3300012497 | Bacteria | 423237 |
| 285 | Ga0157373_10044395 | 3300013100 | Bacteria | 3173 |
| 286 | Ga0157369_10246035 | 3300013105 | Bacteria | 1867 |
| 287 | Ga0157369_10689220 | 3300013105 | Bacteria | 1052 |
| 288 | Ga0157374_10034608 | 3300013296 | Bacteria | 4616 |
| 289 | Ga0157374_10169179 | 3300013296 | Bacteria | 2131 |
| 290 | Ga0157378_10026414 | 3300013297 | Bacteria | 5118 |
| 291 | Ga0157378_10099437 | 3300013297 | Bacteria | 2654 |
| 292 | Ga0157378_10343340 | 3300013297 | Bacteria | 1457 |
| 293 | Ga0157378_10595247 | 3300013297 | Bacteria | 1116 |
| 294 | Ga0163162_10002995 | 3300013306 | Bacteria | 16145 |
| 295 | Ga0163162_10034726 | 3300013306 | Bacteria | 5020 |
| 296 | Ga0163162_10052199 | 3300013306 | Bacteria | 4106 |
| 297 | Ga0163162_10112573 | 3300013306 | Bacteria | 2820 |
| 298 | Ga0157372_10988954 | 3300013307 | Bacteria | 974 |
| 299 | Ga0157375_10011447 | 3300013308 | Bacteria | 7833 |
| 300 | Ga0157375_10022022 | 3300013308 | Bacteria | 5860 |
| 301 | Ga0157375_10028630 | 3300013308 | Bacteria | 5227 |
| 302 | Ga0157375_10066886 | 3300013308 | Bacteria | 3589 |
| 303 | Ga0157375_10073701 | 3300013308 | Bacteria | 3433 |
| 304 | Ga0157375_10201742 | 3300013308 | Bacteria | 2145 |
| 305 | Ga0157375_10251130 | 3300013308 | Bacteria | 1929 |
| 306 | Ga0157375_10384036 | 3300013308 | Bacteria | 1571 |
| 307 | Ga0163163_10045264 | 3300014325 | Bacteria | 4319 |
| 308 | Ga0163163_10200494 | 3300014325 | Bacteria | 2044 |
| 309 | Ga0157380_10024747 | 3300014326 | Bacteria | 4547 |
| 310 | Ga0157380_10038429 | 3300014326 | Bacteria | 3716 |
| 311 | Ga0157380_10044937 | 3300014326 | Bacteria | 3464 |
| 312 | Ga0157380_10145152 | 3300014326 | Bacteria | 2044 |
| 313 | Ga0157380_10149420 | 3300014326 | Bacteria | 2018 |
| 314 | Ga0157380_10184452 | 3300014326 | Bacteria | 1836 |
| 315 | Ga0157377_10000038 | 3300014745 | Bacteria | 113777 |
| 316 | Ga0157377_10017418 | 3300014745 | Bacteria | 3715 |
| 317 | Ga0157379_10008098 | 3300014968 | Bacteria | 9127 |
| 318 | Ga0157379_10041068 | 3300014968 | Bacteria | 4129 |
| 319 | Ga0157379_10064914 | 3300014968 | Bacteria | 3263 |
| 320 | Ga0157379_10076979 | 3300014968 | Bacteria | 2987 |
| 321 | Ga0157379_10148959 | 3300014968 | Bacteria | 2111 |
| 322 | Ga0157376_10016516 | 3300014969 | Bacteria | 5607 |
| 323 | Ga0157376_10034451 | 3300014969 | Bacteria | 4089 |
| 324 | Ga0157376_10379927 | 3300014969 | Bacteria | 1360 |
| 325 | Ga0182007_10021855 | 3300015262 | Bacteria | 2266 |
| 326 | Ga0163161_10004047 | 3300017792 | Bacteria | 10254 |
| 327 | Ga0163161_10023239 | 3300017792 | Bacteria | 4372 |
| 328 | Ga0163161_10061561 | 3300017792 | Bacteria | 2732 |
| 329 | Ga0163161_10174345 | 3300017792 | Bacteria | 1646 |
| 330 | Ga0163161_10428099 | 3300017792 | Bacteria | 1066 |
| 331 | Ga0213872_10000003 | 3300021361 | Bacteria | 366948 |
| 332 | Ga0213872_10000046 | 3300021361 | Bacteria | 109934 |
| 333 | Ga0213872_10000124 | 3300021361 | Bacteria | 72197 |
| 334 | Ga0213872_10003125 | 3300021361 | Bacteria | 9306 |
| 335 | Ga0213872_10019223 | 3300021361 | Bacteria | 3147 |
| 336 | Ga0213872_10025664 | 3300021361 | Bacteria | 2708 |
| 337 | Ga0213872_10035777 | 3300021361 | Bacteria | 2270 |
| 338 | Ga0209563_100005 | 3300025230 | Bacteria | 1774893 |
| 339 | Ga0207425_1000135 | 3300025245 | Bacteria | 66450 |
| 340 | Ga0209129_1000043 | 3300025258 | Bacteria | 298978 |
| 341 | Ga0209565_1011977 | 3300025263 | Bacteria | 2086 |
| 342 | Ga0207666_1001401 | 3300025271 | Bacteria | 2841 |
| 343 | Ga0209673_1006841 | 3300025273 | Bacteria | 5407 |
| 344 | Ga0209673_1016786 | 3300025273 | Bacteria | 2724 |
| 345 | Ga0209675_1007084 | 3300025291 | Bacteria | 4369 |
| 346 | Ga0209564_1000005 | 3300025295 | Bacteria | 1147192 |
| 347 | Ga0209564_1000014 | 3300025295 | Bacteria | 621501 |
| 348 | Ga0209758_1000492 | 3300025297 | Bacteria | 64511 |
| 349 | Ga0209758_1005135 | 3300025297 | Bacteria | 10334 |
| 350 | Ga0209050_1000493 | 3300025298 | Bacteria | 67885 |
| 351 | Ga0209050_1000543 | 3300025298 | Bacteria | 62404 |
| 352 | Ga0209050_1003305 | 3300025298 | Bacteria | 12067 |
| 353 | Ga0209050_1033582 | 3300025298 | Bacteria | 1553 |
| 354 | Ga0209256_1000092 | 3300025299 | Bacteria | 210547 |
| 355 | Ga0209256_1000213 | 3300025299 | Bacteria | 108298 |
| 356 | Ga0209256_1005252 | 3300025299 | Bacteria | 7563 |
| 357 | Ga0209051_1000020 | 3300025303 | Bacteria | 508628 |
| 358 | Ga0209051_1005067 | 3300025303 | Bacteria | 7833 |
| 359 | Ga0209051_1010963 | 3300025303 | Bacteria | 4521 |
| 360 | Ga0209257_1000017 | 3300025304 | Bacteria | 866287 |
| 361 | Ga0209257_1000189 | 3300025304 | Bacteria | 153917 |
| 362 | Ga0209257_1000805 | 3300025304 | Bacteria | 45597 |
| 363 | Ga0209257_1000913 | 3300025304 | Bacteria | 41162 |
| 364 | Ga0209257_1024150 | 3300025304 | Bacteria | 2113 |
| 365 | Ga0209257_1031534 | 3300025304 | Bacteria | 1694 |
| 366 | Ga0207697_10027645 | 3300025315 | Bacteria | 2319 |
| 367 | Ga0207656_10061537 | 3300025321 | Bacteria | 1648 |
| 368 | Ga0207656_10063503 | 3300025321 | Bacteria | 1626 |
| 369 | Ga0207682_10001133 | 3300025893 | Bacteria | 12330 |
| 370 | Ga0207682_10002990 | 3300025893 | Bacteria | 7417 |
| 371 | Ga0207682_10013224 | 3300025893 | Bacteria | 3218 |
| 372 | Ga0207682_10023137 | 3300025893 | Bacteria | 2453 |
| 373 | Ga0207682_10038238 | 3300025893 | Bacteria | 1946 |
| 374 | Ga0207688_10123877 | 3300025901 | Bacteria | 1510 |
| 375 | Ga0207680_10020608 | 3300025903 | Bacteria | 3554 |
| 376 | Ga0207645_10001485 | 3300025907 | Bacteria | 19163 |
| 377 | Ga0207645_10003455 | 3300025907 | Bacteria | 11994 |
| 378 | Ga0207643_10043348 | 3300025908 | Bacteria | 2539 |
| 379 | Ga0207643_10105249 | 3300025908 | Bacteria | 1658 |
| 380 | Ga0207705_10035148 | 3300025909 | Bacteria | 3585 |
| 381 | Ga0207705_10177492 | 3300025909 | Bacteria | 1606 |
| 382 | Ga0207684_10018378 | 3300025910 | Bacteria | 5985 |
| 383 | Ga0207695_10042429 | 3300025913 | Bacteria | 4859 |
| 384 | Ga0207671_10010195 | 3300025914 | Bacteria | 7780 |
| 385 | Ga0207671_10253053 | 3300025914 | Bacteria | 1385 |
| 386 | Ga0207662_10033599 | 3300025918 | Bacteria | 2991 |
| 387 | Ga0207662_10058170 | 3300025918 | Bacteria | 2313 |
| 388 | Ga0207657_10056764 | 3300025919 | Bacteria | 3376 |
| 389 | Ga0207657_10109249 | 3300025919 | Bacteria | 2286 |
| 390 | Ga0207657_10151582 | 3300025919 | Bacteria | 1888 |
| 391 | Ga0207657_10506731 | 3300025919 | Bacteria | 945 |
| 392 | Ga0207649_10001821 | 3300025920 | Bacteria | 12174 |
| 393 | Ga0207649_10294009 | 3300025920 | Bacteria | 1185 |
| 394 | Ga0207646_10180410 | 3300025922 | Bacteria | 1907 |
| 395 | Ga0207681_10004618 | 3300025923 | Bacteria | 8465 |
| 396 | Ga0207681_10026584 | 3300025923 | Bacteria | 3734 |
| 397 | Ga0207681_10403638 | 3300025923 | Bacteria | 1104 |
| 398 | Ga0207694_10025174 | 3300025924 | Bacteria | 4521 |
| 399 | Ga0207694_10418624 | 3300025924 | Bacteria | 1116 |
| 400 | Ga0207650_10001149 | 3300025925 | Bacteria | 19437 |
| 401 | Ga0207650_10003908 | 3300025925 | Bacteria | 10189 |
| 402 | Ga0207650_10055912 | 3300025925 | Bacteria | 2931 |
| 403 | Ga0207650_10378100 | 3300025925 | Bacteria | 1169 |
| 404 | Ga0207659_10000477 | 3300025926 | Bacteria | 24093 |
| 405 | Ga0207659_10000691 | 3300025926 | Bacteria | 20035 |
| 406 | Ga0207659_10032109 | 3300025926 | Bacteria | 3600 |
| 407 | Ga0207659_10112447 | 3300025926 | Bacteria | 2072 |
| 408 | Ga0207687_10007233 | 3300025927 | Bacteria | 7321 |
| 409 | Ga0207687_10064103 | 3300025927 | Bacteria | 2604 |
| 410 | Ga0207687_10110502 | 3300025927 | Bacteria | 2039 |
| 411 | Ga0207644_10001362 | 3300025931 | Bacteria | 15719 |
| 412 | Ga0207644_10002098 | 3300025931 | Bacteria | 12916 |
| 413 | Ga0207644_10006058 | 3300025931 | Bacteria | 7888 |
| 414 | Ga0207644_10012856 | 3300025931 | Bacteria | 5568 |
| 415 | Ga0207644_10034811 | 3300025931 | Bacteria | 3525 |
| 416 | Ga0207644_10098074 | 3300025931 | Bacteria | 2196 |
| 417 | Ga0207690_10005130 | 3300025932 | Bacteria | 7732 |
| 418 | Ga0207706_10000756 | 3300025933 | Bacteria | 33603 |
| 419 | Ga0207706_10001466 | 3300025933 | Bacteria | 23574 |
| 420 | Ga0207706_10004450 | 3300025933 | Bacteria | 13166 |
| 421 | Ga0207706_10051089 | 3300025933 | Bacteria | 3651 |
| 422 | Ga0207706_10120264 | 3300025933 | Bacteria | 2309 |
| 423 | Ga0207706_10141138 | 3300025933 | Bacteria | 2119 |
| 424 | Ga0207706_10159532 | 3300025933 | Bacteria | 1983 |
| 425 | Ga0207686_10006958 | 3300025934 | Bacteria | 6088 |
| 426 | Ga0207686_10262698 | 3300025934 | Bacteria | 1266 |
| 427 | Ga0207686_10388882 | 3300025934 | Bacteria | 1060 |
| 428 | Ga0207709_10003694 | 3300025935 | Bacteria | 9012 |
| 429 | Ga0207709_10106040 | 3300025935 | Bacteria | 1869 |
| 430 | Ga0207709_10185783 | 3300025935 | Bacteria | 1472 |
| 431 | Ga0207670_10025777 | 3300025936 | Bacteria | 3696 |
| 432 | Ga0207670_10080473 | 3300025936 | Bacteria | 2277 |
| 433 | Ga0207669_10005292 | 3300025937 | Bacteria | 5773 |
| 434 | Ga0207669_10085614 | 3300025937 | Bacteria | 2035 |
| 435 | Ga0207669_10098013 | 3300025937 | Bacteria | 1929 |
| 436 | Ga0207704_10085429 | 3300025938 | Bacteria | 2054 |
| 437 | Ga0207704_10188428 | 3300025938 | Bacteria | 1498 |
| 438 | Ga0207691_10001243 | 3300025940 | Bacteria | 25438 |
| 439 | Ga0207691_10003923 | 3300025940 | Bacteria | 14453 |
| 440 | Ga0207691_10005630 | 3300025940 | Bacteria | 12112 |
| 441 | Ga0207691_10017263 | 3300025940 | Bacteria | 6846 |
| 442 | Ga0207691_10039879 | 3300025940 | Bacteria | 4343 |
| 443 | Ga0207691_10111776 | 3300025940 | Bacteria | 2429 |
| 444 | Ga0207691_10141115 | 3300025940 | Bacteria | 2123 |
| 445 | Ga0207691_10244532 | 3300025940 | Bacteria | 1550 |
| 446 | Ga0207711_10021174 | 3300025941 | Bacteria | 5431 |
| 447 | Ga0207711_10087955 | 3300025941 | Bacteria | 2727 |
| 448 | Ga0207711_10225169 | 3300025941 | Bacteria | 1716 |
| 449 | Ga0207711_10332043 | 3300025941 | Bacteria | 1406 |
| 450 | Ga0207689_10006829 | 3300025942 | Bacteria | 10035 |
| 451 | Ga0207689_10012976 | 3300025942 | Bacteria | 7115 |
| 452 | Ga0207689_10015924 | 3300025942 | Bacteria | 6366 |
| 453 | Ga0207689_10207502 | 3300025942 | Bacteria | 1618 |
| 454 | Ga0207689_10569822 | 3300025942 | Bacteria | 952 |
| 455 | Ga0207661_10109080 | 3300025944 | Bacteria | 2338 |
| 456 | Ga0207661_10214944 | 3300025944 | Bacteria | 1696 |
| 457 | Ga0207679_10000249 | 3300025945 | Bacteria | 41064 |
| 458 | Ga0207679_10024487 | 3300025945 | Bacteria | 4139 |
| 459 | Ga0207679_10083377 | 3300025945 | Bacteria | 2450 |
| 460 | Ga0207679_10130780 | 3300025945 | Bacteria | 2013 |
| 461 | Ga0207679_10554680 | 3300025945 | Bacteria | 1031 |
| 462 | Ga0207651_10001278 | 3300025960 | Bacteria | 11329 |
| 463 | Ga0207651_10016116 | 3300025960 | Bacteria | 4366 |
| 464 | Ga0207651_10175494 | 3300025960 | Bacteria | 1694 |
| 465 | Ga0207651_10198323 | 3300025960 | Bacteria | 1606 |
| 466 | Ga0207651_10249569 | 3300025960 | Bacteria | 1451 |
| 467 | Ga0207651_10268485 | 3300025960 | Bacteria | 1404 |
| 468 | Ga0207651_10325067 | 3300025960 | Bacteria | 1287 |
| 469 | Ga0207668_10004912 | 3300025972 | Bacteria | 7862 |
| 470 | Ga0207668_10215294 | 3300025972 | Bacteria | 1539 |
| 471 | Ga0207668_10294430 | 3300025972 | Bacteria | 1337 |
| 472 | Ga0207658_10001089 | 3300025986 | Bacteria | 21924 |
| 473 | Ga0207658_10018268 | 3300025986 | Bacteria | 4839 |
| 474 | Ga0207658_10027241 | 3300025986 | Bacteria | 4013 |
| 475 | Ga0207658_10064121 | 3300025986 | Bacteria | 2755 |
| 476 | Ga0207658_10205475 | 3300025986 | Bacteria | 1647 |
| 477 | Ga0207677_10003776 | 3300026023 | Bacteria | 8043 |
| 478 | Ga0207677_10008741 | 3300026023 | Bacteria | 5671 |
| 479 | Ga0207677_10032641 | 3300026023 | Bacteria | 3350 |
| 480 | Ga0207677_10063934 | 3300026023 | Bacteria | 2560 |
| 481 | Ga0207677_10069721 | 3300026023 | Bacteria | 2474 |
| 482 | Ga0207677_10081795 | 3300026023 | Bacteria | 2319 |
| 483 | Ga0207703_10000996 | 3300026035 | Bacteria | 27254 |
| 484 | Ga0207703_10011365 | 3300026035 | Bacteria | 6926 |
| 485 | Ga0207703_10041270 | 3300026035 | Bacteria | 3695 |
| 486 | Ga0207703_10085277 | 3300026035 | Bacteria | 2643 |
| 487 | Ga0207639_10014119 | 3300026041 | Bacteria | 5608 |
| 488 | Ga0207639_10026149 | 3300026041 | Bacteria | 4239 |
| 489 | Ga0207639_10213351 | 3300026041 | Bacteria | 1663 |
| 490 | Ga0207639_10599492 | 3300026041 | Bacteria | 1016 |
| 491 | Ga0207678_10000966 | 3300026067 | Bacteria | 26297 |
| 492 | Ga0207678_10022962 | 3300026067 | Bacteria | 5459 |
| 493 | Ga0207678_10170485 | 3300026067 | Bacteria | 1858 |
| 494 | Ga0207678_10182419 | 3300026067 | Bacteria | 1792 |
| 495 | Ga0207708_10012827 | 3300026075 | Bacteria | 6249 |
| 496 | Ga0207702_10039270 | 3300026078 | Bacteria | 3965 |
| 497 | Ga0207641_10007488 | 3300026088 | Bacteria | 9086 |
| 498 | Ga0207641_10014783 | 3300026088 | Bacteria | 6400 |
| 499 | Ga0207641_10017054 | 3300026088 | Bacteria | 5942 |
| 500 | Ga0207641_10387053 | 3300026088 | Bacteria | 1340 |
| 501 | Ga0207648_10000118 | 3300026089 | Bacteria | 77144 |
| 502 | Ga0207648_10002634 | 3300026089 | Bacteria | 19183 |
| 503 | Ga0207648_10003767 | 3300026089 | Bacteria | 15842 |
| 504 | Ga0207648_10028344 | 3300026089 | Bacteria | 4965 |
| 505 | Ga0207648_10034335 | 3300026089 | Bacteria | 4471 |
| 506 | Ga0207648_10048712 | 3300026089 | Bacteria | 3709 |
| 507 | Ga0207648_10086378 | 3300026089 | Bacteria | 2737 |
| 508 | Ga0207648_10144132 | 3300026089 | Bacteria | 2101 |
| 509 | Ga0207676_10002837 | 3300026095 | Bacteria | 12331 |
| 510 | Ga0207676_10008453 | 3300026095 | Bacteria | 7319 |
| 511 | Ga0207676_10024294 | 3300026095 | Bacteria | 4482 |
| 512 | Ga0207676_10075841 | 3300026095 | Bacteria | 2714 |
| 513 | Ga0207676_10171182 | 3300026095 | Bacteria | 1892 |
| 514 | Ga0207676_10197356 | 3300026095 | Bacteria | 1775 |
| 515 | Ga0207674_10053978 | 3300026116 | Bacteria | 4094 |
| 516 | Ga0207674_10310100 | 3300026116 | Bacteria | 1527 |
| 517 | Ga0207674_10346592 | 3300026116 | Bacteria | 1436 |
| 518 | Ga0207674_10488682 | 3300026116 | Bacteria | 1190 |
| 519 | Ga0207675_100002744 | 3300026118 | Bacteria | 17315 |
| 520 | Ga0207675_100003062 | 3300026118 | Bacteria | 16396 |
| 521 | Ga0207675_100003340 | 3300026118 | Bacteria | 15701 |
| 522 | Ga0207675_100054366 | 3300026118 | Bacteria | 3735 |
| 523 | Ga0207683_10004250 | 3300026121 | Bacteria | 12360 |
| 524 | Ga0207683_10040254 | 3300026121 | Bacteria | 4077 |
| 525 | Ga0207683_10070680 | 3300026121 | Bacteria | 3084 |
| 526 | Ga0207683_10098580 | 3300026121 | Bacteria | 2607 |
| 527 | Ga0207683_10123684 | 3300026121 | Bacteria | 2323 |
| 528 | Ga0207683_10216173 | 3300026121 | Bacteria | 1746 |
| 529 | Ga0207698_10002449 | 3300026142 | Bacteria | 11002 |
| 530 | Ga0207698_10028828 | 3300026142 | Bacteria | 3965 |
| 531 | Ga0207698_10044988 | 3300026142 | Bacteria | 3322 |
| 532 | Ga0207698_10067441 | 3300026142 | Bacteria | 2821 |
| 533 | Ga0207698_10080338 | 3300026142 | Bacteria | 2626 |
| 534 | Ga0209281_1000074 | 3300027111 | Bacteria | 267848 |
| 535 | Ga0209389_1029316 | 3300027296 | Bacteria | 4683 |
| 536 | Ga0209996_1001245 | 3300027395 | Bacteria | 3073 |
| 537 | Ga0209968_1000261 | 3300027526 | Bacteria | 8985 |
| 538 | Ga0209970_1001467 | 3300027614 | Bacteria | 4121 |
| 539 | Ga0209966_1000074 | 3300027695 | Bacteria | 43833 |
| 540 | Ga0209813_10046708 | 3300027866 | Bacteria | 1338 |
| 541 | Ga0209974_10038421 | 3300027876 | Bacteria | 1591 |
| 542 | Ga0209974_10110227 | 3300027876 | Bacteria | 968 |
| 543 | Ga0268266_10038784 | 3300028379 | Bacteria | 4055 |
| 544 | Ga0268266_10144301 | 3300028379 | Bacteria | 2139 |
| 545 | Ga0268265_10598748 | 3300028380 | Bacteria | 1053 |
| 546 | Ga0268264_10001857 | 3300028381 | Bacteria | 19207 |
| 547 | Ga0268264_10002570 | 3300028381 | Bacteria | 15905 |
| 548 | Ga0268264_10005397 | 3300028381 | Bacteria | 10824 |
| 549 | Ga0307517_10010725 | 3300028786 | Bacteria | 12781 |
| 550 | Ga0307517_10087776 | 3300028786 | Bacteria | 2580 |
| 551 | Ga0307515_10000165 | 3300028794 | Bacteria | 162589 |
| 552 | Ga0307515_10000188 | 3300028794 | Bacteria | 151439 |
| 553 | Ga0307515_10005461 | 3300028794 | Bacteria | 25733 |
| 554 | Ga0307515_10018969 | 3300028794 | Bacteria | 12413 |
| 555 | Ga0307515_10029938 | 3300028794 | Bacteria | 9173 |
| 556 | Ga0307515_10105203 | 3300028794 | Bacteria | 3363 |
| 557 | Ga0307515_10178168 | 3300028794 | Bacteria | 2087 |
| 558 | Ga0307512_10045736 | 3300030522 | Bacteria | 3579 |
| 559 | Ga0307512_10187295 | 3300030522 | Bacteria | 1149 |
| 560 | Ga0265328_10009090 | 3300031239 | Bacteria | 4059 |
| 561 | Ga0265331_10002493 | 3300031250 | Bacteria | 12446 |
| 562 | Ga0265327_10000144 | 3300031251 | Bacteria | 156779 |
| 563 | Ga0265327_10000210 | 3300031251 | Bacteria | 122385 |
| 564 | Ga0265316_10000005 | 3300031344 | Bacteria | 304442 |
| 565 | Ga0307513_10001902 | 3300031456 | Bacteria | 29673 |
| 566 | Ga0307513_10008355 | 3300031456 | Bacteria | 13260 |
| 567 | Ga0307513_10017436 | 3300031456 | Bacteria | 8610 |
| 568 | Ga0307513_10138011 | 3300031456 | Bacteria | 2370 |
| 569 | Ga0307513_10294259 | 3300031456 | Bacteria | 1393 |
| 570 | Ga0307513_10318897 | 3300031456 | Bacteria | 1313 |
| 571 | Ga0307509_10000234 | 3300031507 | Bacteria | 89398 |
| 572 | Ga0307509_10056928 | 3300031507 | Bacteria | 4147 |
| 573 | Ga0307509_10146314 | 3300031507 | Bacteria | 2288 |
| 574 | Ga0307408_100000038 | 3300031548 | Bacteria | 183170 |
| 575 | Ga0307408_100064886 | 3300031548 | Bacteria | 2676 |
| 576 | Ga0307408_100200356 | 3300031548 | Bacteria | 1615 |
| 577 | Ga0307408_100300530 | 3300031548 | Bacteria | 1344 |
| 578 | Ga0307508_10000169 | 3300031616 | Bacteria | 78769 |
| 579 | Ga0307508_10044094 | 3300031616 | Bacteria | 3991 |
| 580 | Ga0307514_10013831 | 3300031649 | Bacteria | 6687 |
| 581 | Ga0307514_10051134 | 3300031649 | Bacteria | 3204 |
| 582 | Ga0307514_10072288 | 3300031649 | Bacteria | 2583 |
| 583 | Ga0316576_10006300 | 3300031727 | Bacteria | 7373 |
| 584 | Ga0316576_10021087 | 3300031727 | Bacteria | 4500 |
| 585 | Ga0316578_10000172 | 3300031728 | Bacteria | 17665 |
| 586 | Ga0316578_10014111 | 3300031728 | Bacteria | 4257 |
| 587 | Ga0307516_10000311 | 3300031730 | Bacteria | 63197 |
| 588 | Ga0307516_10000326 | 3300031730 | Bacteria | 61941 |
| 589 | Ga0307516_10000897 | 3300031730 | Bacteria | 40914 |
| 590 | Ga0307516_10446494 | 3300031730 | Bacteria | 950 |
| 591 | Ga0307405_10011775 | 3300031731 | Bacteria | 4603 |
| 592 | Ga0307405_10014690 | 3300031731 | Bacteria | 4219 |
| 593 | Ga0307405_10109461 | 3300031731 | Bacteria | 1869 |
| 594 | Ga0307405_10303706 | 3300031731 | Bacteria | 1212 |
| 595 | Ga0307518_10292677 | 3300031838 | Bacteria | 997 |
| 596 | Ga0307410_10020161 | 3300031852 | Bacteria | 4072 |
| 597 | Ga0307410_10031911 | 3300031852 | Bacteria | 3385 |
| 598 | Ga0307410_10052069 | 3300031852 | Bacteria | 2763 |
| 599 | Ga0307406_10028541 | 3300031901 | Bacteria | 3372 |
| 600 | Ga0307406_10361782 | 3300031901 | Bacteria | 1138 |
| 601 | Ga0307407_10078395 | 3300031903 | Bacteria | 1990 |
| 602 | Ga0307412_10006968 | 3300031911 | Bacteria | 6418 |
| 603 | Ga0307412_10017136 | 3300031911 | Bacteria | 4332 |
| 604 | Ga0307412_10028415 | 3300031911 | Bacteria | 3498 |
| 605 | Ga0307412_10140247 | 3300031911 | Bacteria | 1769 |
| 606 | Ga0307412_10315739 | 3300031911 | Bacteria | 1241 |
| 607 | Ga0307409_100002191 | 3300031995 | Bacteria | 10092 |
| 608 | Ga0307409_100007440 | 3300031995 | Bacteria | 6550 |
| 609 | Ga0307416_100002040 | 3300032002 | Bacteria | 11368 |
| 610 | Ga0307416_100030437 | 3300032002 | Bacteria | 4050 |
| 611 | Ga0307416_100035298 | 3300032002 | Bacteria | 3817 |
| 612 | Ga0307416_100532570 | 3300032002 | Bacteria | 1245 |
| 613 | Ga0307416_100658449 | 3300032002 | Bacteria | 1133 |
| 614 | Ga0307414_10062189 | 3300032004 | Bacteria | 2648 |
| 615 | Ga0307411_10000111 | 3300032005 | Bacteria | 25501 |
| 616 | Ga0307411_10005718 | 3300032005 | Bacteria | 6145 |
| 617 | Ga0307411_10219080 | 3300032005 | Bacteria | 1475 |
| 618 | Ga0307415_100012627 | 3300032126 | Bacteria | 4891 |
| 619 | Ga0316593_10007882 | 3300032168 | Bacteria | 2945 |
| 620 | Ga0307507_10053173 | 3300033179 | Bacteria | 3873 |
| 621 | Ga0307507_10087111 | 3300033179 | Bacteria | 2702 |
| 622 | Ga0307510_10003147 | 3300033180 | Bacteria | 19133 |
| 623 | Ga0307510_10022531 | 3300033180 | Bacteria | 7314 |
| 624 | Ga0316592_1008210 | 3300033524 | Bacteria | 2057 |
| 625 | Ga0316592_1047859 | 3300033524 | Bacteria | 953 |
| 626 | Ga0316588_1017053 | 3300033528 | Bacteria | 1616 |
| 627 | Ga0316596_1005666 | 3300033541 | Bacteria | 2864 |
| 628 | Ga0316596_1050199 | 3300033541 | Bacteria | 1103 |
| 629 | Ga0373930_0018783 | 3300034816 | Bacteria | 1333 |
| 630 | Ga0373940_0011703 | 3300035088 | Bacteria | 2089 |
| 631 | Ga0373951_0015495 | 3300035091 | Bacteria | 1717 |
| 632 | Ga0373939_0000004 | 3300035114 | Bacteria | 106519 |
| 633 | Ga0373939_0060531 | 3300035114 | Bacteria | 1204 |
| 634 | Ga0373956_0059059 | 3300035119 | Bacteria | 1735 |
| 635 | Ga0373960_0006274 | 3300035121 | Bacteria | 2784 |
| 636 | Ga0373943_0050329 | 3300035170 | Bacteria | 2047 |
| 637 | Ga0373946_0040358 | 3300035171 | Bacteria | 1909 |
| 638 | Ga0373962_0006239 | 3300035242 | Bacteria | 2885 |
| 639 | Ga0373924_0034927 | 3300035410 | Bacteria | 2038 |
| 640 | Ga0373931_0000546 | 3300035691 | Bacteria | 15448 |
| 641 | Ga0373931_0009953 | 3300035691 | Bacteria | 4557 |
| 642 | Ga0373935_0031345 | 3300035692 | Bacteria | 3299 |
| 643 | Ga0373927_0039242 | 3300035695 | Bacteria | 3073 |
| 644 | Ga0373937_0019374 | 3300036401 | Bacteria | 6091 |
| 645 | Ga0373937_0097556 | 3300036401 | Bacteria | 2726 |
| 646 | Ga0316584_0028137 | 3300036712 | Bacteria | 4142 |
| 647 | Ga0316584_0091968 | 3300036712 | Bacteria | 2271 |
| 648 | Ga0373925_0035960 | 3300037068 | Bacteria | 3656 |
| 649 | Ga0373925_0094578 | 3300037068 | Bacteria | 2288 |
| 650 | Ga0373925_0210626 | 3300037068 | Bacteria | 1548 |
| 651 | Ga0373925_0267503 | 3300037068 | Bacteria | 1374 |
| 652 | Ga0395900_0000355 | 3300037418 | Bacteria | 66598 |
| 653 | Ga0395900_0508785 | 3300037418 | Bacteria | 1154 |
| 654 | Ga0395905_0000777 | 3300037471 | Bacteria | 41933 |
| 655 | Ga0395905_0003411 | 3300037471 | Bacteria | 17002 |
| 656 | Ga0395905_0004659 | 3300037471 | Bacteria | 14178 |
| 657 | Ga0395905_0008552 | 3300037471 | Bacteria | 10093 |
| 658 | Ga0395905_0009989 | 3300037471 | Bacteria | 9251 |
| 659 | Ga0395905_0023405 | 3300037471 | Bacteria | 5837 |
| 660 | Ga0395905_0178674 | 3300037471 | Bacteria | 1992 |
| 661 | Ga0395905_0328566 | 3300037471 | Bacteria | 1419 |
| 662 | Ga0436365_0561202 | 3300039437 | Bacteria | 1329 |
| 663 | Ga0436365_0936688 | 3300039437 | Bacteria | 1470 |
| 664 | Ga0436361_0003822 | 3300039447 | Bacteria | 65675 |
| 665 | Ga0436361_0633280 | 3300039447 | Bacteria | 103480 |
| 666 | Ga0436361_0638016 | 3300039447 | Bacteria | 61418 |
| 667 | Ga0436361_0895746 | 3300039447 | Bacteria | 1379 |
| 668 | Ga0436361_0916159 | 3300039447 | Bacteria | 49060 |
| 669 | Ga0436361_1079715 | 3300039447 | Bacteria | 4877 |
| 670 | Ga0439461_0045495 | 3300041410 | Bacteria | 960 |
| 671 | Ga0451798_0696078 | 3300041458 | Bacteria | 2059 |
| 672 | Ga0451802_0574082 | 3300041460 | Bacteria | 1954 |
| 673 | Ga0451807_1744250 | 3300041486 | Bacteria | 1149 |
| 674 | Ga0451833_1159483 | 3300041491 | Bacteria | 1441 |
| 675 | Ga0451841_0774662 | 3300041498 | Bacteria | 1035 |
| 676 | Ga0451843_1695661 | 3300041509 | Bacteria | 1307 |
| 677 | Ga0451853_2209517 | 3300041512 | Bacteria | 1102 |
| 678 | Ga0439431_0001589 | 3300041997 | Bacteria | 5033 |
| 679 | Ga0439449_0083375 | 3300042007 | Bacteria | 1179 |
| 680 | Ga0439450_021953 | 3300042008 | Bacteria | 1374 |
| 681 | Ga0439455_0000995 | 3300042012 | Bacteria | 4450 |
| 682 | Ga0450890_001964 | 3300042127 | Bacteria | 2906 |
| 683 | Ga0450889_001429 | 3300042144 | Bacteria | 2461 |
| 684 | Ga0439446_0008764 | 3300042156 | Bacteria | 2695 |
| 685 | Ga0439458_0047443 | 3300042157 | Bacteria | 1054 |
| 686 | Ga0439459_0000191 | 3300042438 | Bacteria | 6711 |
| 687 | Ga0439460_0010600 | 3300042461 | Bacteria | 2364 |
| 688 | Ga0450916_000815 | 3300042530 | Bacteria | 2921 |
| 689 | Ga0450918_001043 | 3300042531 | Bacteria | 5715 |
| 690 | Ga0451577_0000641 | 3300042876 | Bacteria | 55722 |
| 691 | Ga0451577_0008482 | 3300042876 | Bacteria | 10003 |
| 692 | Ga0451577_0011912 | 3300042876 | Bacteria | 8199 |
| 693 | Ga0451577_0015837 | 3300042876 | Bacteria | 6997 |
| 694 | Ga0451577_0038688 | 3300042876 | Bacteria | 4289 |
| 695 | Ga0451577_0077908 | 3300042876 | Bacteria | 2956 |
| 696 | Ga0451577_0318412 | 3300042876 | Bacteria | 1410 |
| 697 | Ga0451577_0415163 | 3300042876 | Bacteria | 1222 |
| 698 | Ga0451577_0592286 | 3300042876 | Bacteria | 1006 |
| 699 | Ga0466969_0000028 | 3300044656 | Bacteria | 92394 |
| 700 | Ga0466972_0001085 | 3300044658 | Bacteria | 13048 |
| 701 | Ga0466972_0029875 | 3300044658 | Bacteria | 2683 |
| 702 | Ga0466966_0008387 | 3300044684 | Bacteria | 6843 |
| 703 | Ga0466966_0020086 | 3300044684 | Bacteria | 4395 |
| 704 | Ga0466961_0018744 | 3300044693 | Bacteria | 4452 |
| 705 | Ga0466963_0000306 | 3300044694 | Bacteria | 22103 |
| 706 | Ga0466964_0010048 | 3300044706 | Bacteria | 3565 |
| 707 | Ga0466964_0178118 | 3300044706 | Bacteria | 1006 |
| 708 | Ga0453684_0001818 | 3300044712 | Bacteria | 56168 |
| 709 | Ga0453684_0009747 | 3300044712 | Bacteria | 16684 |
| 710 | Ga0453684_0137499 | 3300044712 | Bacteria | 2922 |
| 711 | Ga0453684_0157052 | 3300044712 | Bacteria | 2695 |
| 712 | Ga0453684_0195762 | 3300044712 | Bacteria | 2361 |
| 713 | Ga0453684_0314595 | 3300044712 | Bacteria | 1775 |
| 714 | Ga0466971_0028647 | 3300044719 | Bacteria | 2491 |
| 715 | Ga0466968_0050105 | 3300044735 | Bacteria | 1780 |
| 716 | Ga0466970_0038282 | 3300044765 | Bacteria | 2543 |
| 717 | Ga0466970_0111191 | 3300044765 | Bacteria | 1496 |
| 718 | Ga0466957_0053737 | 3300044842 | Bacteria | 2456 |
| 719 | Ga0466959_0001676 | 3300045049 | Bacteria | 13723 |
| 720 | Ga0466959_0082802 | 3300045049 | Bacteria | 2311 |
| 721 | Ga0451576_0002104 | 3300045051 | Bacteria | 31012 |
| 722 | Ga0451576_0015228 | 3300045051 | Bacteria | 8526 |
| 723 | Ga0451576_0019110 | 3300045051 | Bacteria | 7487 |
| 724 | Ga0451576_0039970 | 3300045051 | Bacteria | 4966 |
| 725 | Ga0451576_0237748 | 3300045051 | Bacteria | 1902 |
| 726 | Ga0451576_0432301 | 3300045051 | Bacteria | 1381 |
| 727 | Ga0466958_0159955 | 3300045836 | Bacteria | 1422 |
| 728 | Ga0495592_0012833 | 3300046454 | Bacteria | 6370 |
| 729 | Ga0495590_0016223 | 3300046457 | Bacteria | 2692 |
| 730 | Ga0495590_0039265 | 3300046457 | Bacteria | 1651 |
| 731 | Ga0495629_0025312 | 3300046459 | Bacteria | 4220 |
| 732 | Ga0495629_0219417 | 3300046459 | Bacteria | 1312 |
| 733 | Ga0495638_0127217 | 3300046460 | Bacteria | 1501 |
| 734 | Ga0495638_0216196 | 3300046460 | Bacteria | 1074 |
| 735 | Ga0495650_0000976 | 3300046471 | Bacteria | 32712 |
| 736 | Ga0495580_0125242 | 3300046472 | Bacteria | 1783 |
| 737 | Ga0495583_0042459 | 3300046506 | Bacteria | 2124 |
| 738 | Ga0495606_0184383 | 3300046507 | Bacteria | 1201 |
| 739 | Ga0495628_0301160 | 3300046516 | Bacteria | 1187 |
| 740 | Ga0495632_0003074 | 3300046519 | Bacteria | 12127 |
| 741 | Ga0495632_0006463 | 3300046519 | Bacteria | 7529 |
| 742 | Ga0495642_0039547 | 3300046528 | Bacteria | 1914 |
| 743 | Ga0495586_0064987 | 3300046535 | Bacteria | 1989 |
| 744 | Ga0495621_0002740 | 3300046539 | Bacteria | 4781 |
| 745 | Ga0495597_0022439 | 3300046542 | Bacteria | 2928 |
| 746 | Ga0495625_0053069 | 3300046660 | Bacteria | 2901 |
| 747 | Ga0495625_0079548 | 3300046660 | Bacteria | 2285 |
| 748 | Ga0495658_0016429 | 3300046683 | Bacteria | 3810 |
| 749 | Ga0495613_0060723 | 3300046689 | Bacteria | 2768 |
| 750 | Ga0495670_0020117 | 3300046691 | Bacteria | 3290 |
| 751 | Ga0495649_0001852 | 3300046694 | Bacteria | 15512 |
| 752 | Ga0495674_0168034 | 3300047319 | Bacteria | 1832 |
| 753 | Ga0495676_0054670 | 3300047321 | Bacteria | 3172 |
| 754 | Ga0495687_000367 | 3300047443 | Bacteria | 56387 |
| 755 | Ga0495687_006395 | 3300047443 | Bacteria | 7229 |
| 756 | Ga0495684_0078731 | 3300047471 | Bacteria | 2502 |
| 757 | Ga0495686_0006531 | 3300047472 | Bacteria | 8906 |
| 758 | Ga0495593_0093103 | 3300047673 | Bacteria | 1551 |
| 759 | Ga0496102_0003534 | 3300048905 | Bacteria | 13246 |
| 760 | Ga0496102_0005742 | 3300048905 | Bacteria | 10544 |
| 761 | Ga0496104_0106712 | 3300048907 | Bacteria | 2684 |
| 762 | Ga0496104_0593837 | 3300048907 | Bacteria | 1018 |
| 763 | Ga0496106_0012481 | 3300048909 | Bacteria | 6274 |
| 764 | Ga0496106_0074237 | 3300048909 | Bacteria | 2603 |
| 765 | Ga0496106_0121074 | 3300048909 | Bacteria | 2045 |
| 766 | Ga0496108_0037095 | 3300048911 | Bacteria | 4059 |
| 767 | Ga0496108_0115085 | 3300048911 | Bacteria | 2303 |
| 768 | Ga0496109_0258525 | 3300048912 | Bacteria | 1640 |
| 769 | Ga0496110_0096611 | 3300048913 | Bacteria | 2648 |
| 770 | Ga0496110_0100048 | 3300048913 | Bacteria | 2599 |
| 771 | Ga0496110_0258867 | 3300048913 | Bacteria | 1584 |
| 772 | Ga0496110_0542526 | 3300048913 | Bacteria | 1057 |
| 773 | Ga0496111_0016712 | 3300048914 | Bacteria | 5062 |
| 774 | Ga0496112_0043915 | 3300048915 | Bacteria | 4376 |
| 775 | Ga0496113_0006211 | 3300048916 | Bacteria | 7549 |
| 776 | Ga0496113_0203823 | 3300048916 | Bacteria | 1573 |
| 777 | Ga0496114_0007670 | 3300048917 | Bacteria | 8534 |
| 778 | Ga0496121_0022834 | 3300048924 | Bacteria | 6048 |
| 779 | Ga0496122_0074566 | 3300048925 | Bacteria | 2400 |
| 780 | Ga0496124_0000138 | 3300048927 | Bacteria | 150311 |
| 781 | Ga0496124_0063527 | 3300048927 | Bacteria | 3084 |
| 782 | Ga0496124_0123263 | 3300048927 | Bacteria | 2068 |
| 783 | Ga0496125_0001189 | 3300048928 | Bacteria | 39370 |
| 784 | Ga0496125_0197833 | 3300048928 | Bacteria | 1320 |
| 785 | Ga0501308_004681 | 3300049128 | Bacteria | 1331 |
| 786 | Ga0501304_002933 | 3300049160 | Bacteria | 1220 |
| 787 | Ga0501292_015918 | 3300049515 | Bacteria | 1179 |
| 788 | Ga0501300_008168 | 3300049523 | Bacteria | 1533 |
| 789 | Ga0501314_003951 | 3300049530 | Bacteria | 1213 |
| 790 | Ga0501034_0375546 | 3300049571 | Bacteria | 1347 |
| 791 | Ga0501039_0362830 | 3300049575 | Bacteria | 1138 |
| 792 | Ga0501041_0088284 | 3300049577 | Bacteria | 1914 |
| 793 | Ga0501043_0000002 | 3300049579 | Bacteria | 351081 |
| 794 | Ga0501046_0000008 | 3300049580 | Bacteria | 351167 |
| 795 | Ga0501047_0000003 | 3300049581 | Bacteria | 508375 |
| 796 | Ga0501198_000014 | 3300049649 | Bacteria | 106940 |
| 797 | Ga0501201_004887 | 3300049651 | Bacteria | 1248 |
| 798 | Ga0501206_008312 | 3300049653 | Bacteria | 1370 |
| 799 | Ga0501211_001618 | 3300049658 | Bacteria | 2411 |
| 800 | Ga0501222_000008 | 3300049662 | Bacteria | 120904 |
| 801 | Ga0501222_001642 | 3300049662 | Bacteria | 3107 |
| 802 | Ga0501223_004639 | 3300049663 | Bacteria | 2924 |
| 803 | Ga0501227_002798 | 3300049665 | Bacteria | 3831 |
| 804 | Ga0501233_018737 | 3300049668 | Bacteria | 1459 |
| 805 | Ga0501235_008379 | 3300049669 | Bacteria | 2256 |
| 806 | Ga0501236_013541 | 3300049670 | Bacteria | 1117 |
| 807 | Ga0501252_003010 | 3300049682 | Bacteria | 1713 |
| 808 | Ga0501253_008366 | 3300049683 | Bacteria | 1486 |
| 809 | Ga0501221_002992 | 3300049704 | Bacteria | 2785 |
| 810 | Ga0501229_000954 | 3300049706 | Bacteria | 3272 |
| 811 | Ga0501262_003682 | 3300049759 | Bacteria | 1766 |
| 812 | Ga0501267_001793 | 3300049764 | Bacteria | 1876 |
| 813 | Ga0501268_004583 | 3300049765 | Bacteria | 1954 |
| 814 | Ga0501272_001041 | 3300049769 | Bacteria | 2558 |
| 815 | Ga0501282_004903 | 3300049778 | Bacteria | 1430 |
| 816 | Ga0501283_001477 | 3300049779 | Bacteria | 3042 |
| 817 | Ga0501045_0012726 | 3300049824 | Bacteria | 5927 |
| 818 | nmdc:mga00v17_19912_c1 | 3300050491 | Bacteria | 3837 |
| 819 | nmdc:mga00v17_36384_c1 | 3300050491 | Bacteria | 2933 |
| 820 | nmdc:mga00v17_90001_c1 | 3300050491 | Bacteria | 1926 |
| 821 | nmdc:mga0k408_101548_c1 | 3300050493 | Bacteria | 1696 |
| 822 | nmdc:mga0k408_104944_c1 | 3300050493 | Bacteria | 1668 |
| 823 | nmdc:mga0k408_111673_c1 | 3300050493 | Bacteria | 1616 |
| 824 | nmdc:mga0k408_137584_c1 | 3300050493 | Bacteria | 1452 |
| 825 | nmdc:mga0k408_17696_c1 | 3300050493 | Bacteria | 3972 |
| 826 | nmdc:mga0k408_23013_c1 | 3300050493 | Bacteria | 3512 |
| 827 | nmdc:mga0k408_24559_c1 | 3300050493 | Bacteria | 3408 |
| 828 | nmdc:mga0k408_24684_c1 | 3300050493 | Bacteria | 3399 |
| 829 | nmdc:mga0k408_24760_c1 | 3300050493 | Bacteria | 3395 |
| 830 | nmdc:mga0k408_26432_c1 | 3300050493 | Bacteria | 3291 |
| 831 | nmdc:mga0k408_4347_c1 | 3300050493 | Bacteria | 7526 |
| 832 | nmdc:mga0k408_5357_c1 | 3300050493 | Bacteria | 4614 |
| 833 | nmdc:mga0k408_67349_c1 | 3300050493 | Bacteria | 2087 |
| 834 | nmdc:mga0k408_734_c1 | 3300050493 | Bacteria | 16164 |
| 835 | nmdc:mga0k408_7706_c1 | 3300050493 | Bacteria | 5754 |
| 836 | nmdc:mga06z11_32273_c1 | 3300050494 | Bacteria | 2553 |
| 837 | nmdc:mga06z11_33419_c1 | 3300050494 | Bacteria | 2516 |
| 838 | nmdc:mga04h51_71035_c1 | 3300050495 | Bacteria | 1215 |
| 839 | nmdc:mga07m45_14178_c1 | 3300050496 | Bacteria | 4240 |
| 840 | nmdc:mga07m45_19348_c1 | 3300050496 | Bacteria | 3689 |
| 841 | nmdc:mga07m45_194694_c1 | 3300050496 | Bacteria | 1179 |
| 842 | nmdc:mga07m45_25391_c1 | 3300050496 | Bacteria | 3249 |
| 843 | nmdc:mga07m45_57_c1 | 3300050496 | Bacteria | 46544 |
| 844 | nmdc:mga07m45_7428_c1 | 3300050496 | Bacteria | 5601 |
| 845 | nmdc:mga07m45_79116_c1 | 3300050496 | Bacteria | 1876 |
| 846 | nmdc:mga07m45_8433_c1 | 3300050496 | Bacteria | 5300 |
| 847 | nmdc:mga05p37_351329_c1 | 3300050507 | Bacteria | 1736 |
| 848 | nmdc:mga09592_5629_c1 | 3300050508 | Bacteria | 10213 |
| 849 | nmdc:mga0sz30_29883_c1 | 3300050516 | Bacteria | 2249 |
| 850 | Ga0495619_0028690 | 3300053085 | Bacteria | 3591 |
| 851 | Ga0500578_0000058 | 3300053086 | Bacteria | 119650 |
| 852 | Ga0500578_0054149 | 3300053086 | Bacteria | 2569 |
| 853 | Ga0500646_0025159 | 3300053090 | Bacteria | 1606 |
| 854 | Ga0500583_0043952 | 3300053092 | Bacteria | 2043 |
| 855 | Ga0500651_0009126 | 3300053093 | Bacteria | 5876 |
| 856 | Ga0500651_0019235 | 3300053093 | Bacteria | 4240 |
| 857 | Ga0500651_0059450 | 3300053093 | Bacteria | 2389 |
| 858 | Ga0500593_001065 | 3300053117 | Bacteria | 9913 |
| 859 | Ga0500623_051234 | 3300053127 | Bacteria | 2075 |
| 860 | Ga0500642_0003464 | 3300053130 | Bacteria | 4773 |
| 861 | Ga0500652_000027 | 3300053131 | Bacteria | 98912 |
| 862 | Ga0500655_004171 | 3300053133 | Bacteria | 2602 |
| 863 | Ga0500658_0091271 | 3300053134 | Bacteria | 1317 |
| 864 | Ga0500658_0115906 | 3300053134 | Bacteria | 1184 |
| 865 | Ga0500559_0000119 | 3300053136 | Bacteria | 62358 |
| 866 | Ga0500568_0014139 | 3300053139 | Bacteria | 3614 |
| 867 | Ga0500568_0049683 | 3300053139 | Bacteria | 1654 |
| 868 | Ga0500573_0133676 | 3300053140 | Bacteria | 1372 |
| 869 | Ga0500590_011236 | 3300053148 | Bacteria | 4534 |
| 870 | Ga0500616_0050411 | 3300053153 | Bacteria | 2199 |
| 871 | Ga0500619_000611 | 3300053154 | Bacteria | 6094 |
| 872 | Ga0500622_0000221 | 3300053156 | Bacteria | 59833 |
| 873 | Ga0500622_0004359 | 3300053156 | Bacteria | 8936 |
| 874 | Ga0500622_0005218 | 3300053156 | Bacteria | 7857 |
| 875 | Ga0500645_006045 | 3300053730 | Bacteria | 4369 |
| 876 | Ga0500645_059627 | 3300053730 | Bacteria | 1105 |
| 877 | Ga0590071_000370 | 3300059421 | Bacteria | 13155 |
| 878 | Ga0501082_0139543 | 3300060353 | Bacteria | 2104 |
| 879 | Ga0466962_0026119 | 3300061719 | Bacteria | 2804 |
| 880 | 2587728879 | 2585428057 | Bacteria | 6737412 |
| 881 | 2587736480 | 2585428058 | Bacteria | 6853932 |
| 882 | 2587758582 | 2585428062 | Bacteria | 6842168 |
| 883 | 2588294661 | 2588253510 | Bacteria | 6901809 |
| 884 | 2643745689 | 2643221544 | Bacteria | 5886209 |
| 885 | 2643936756 | 2643221585 | Bacteria | 5812563 |
| 886 | 2643970512 | 2643221592 | Bacteria | 6608788 |
| 887 | 2644142751 | 2643221625 | Bacteria | 6512927 |
| 888 | 2644221584 | 2643221639 | Bacteria | 6649903 |
| 889 | 2644246335 | 2643221644 | Bacteria | 6865017 |
| 890 | 2644257651 | 2643221646 | Bacteria | 6433402 |
| 891 | 2644272688 | 2643221648 | Bacteria | 6521465 |
| 892 | 2644303951 | 2643221654 | Bacteria | 5273570 |
| 893 | 2644318655 | 2643221656 | Bacteria | 5809961 |
| 894 | 2644340396 | 2643221660 | Bacteria | 4208257 |
| 895 | 2739058635 | 2738541337 | Bacteria | 6183410 |
| 896 | 2831869470 | 2831864461 | Bacteria | 6502356 |
| 897 | 2842721181 | 2842718218 | Bacteria | 4560148 |
| 898 | 2886853728 | 2886848708 | Bacteria | 5632523 |
| 899 | 2904479591 | 2904479285 | Bacteria | 5073931 |
| 900 | 2919707233 | 2919704043 | Bacteria | 5560311 |
| 901 | 2945949363 | 2945945610 | Bacteria | 5951079 |
| 902 | 2974324069 | 2974320154 | Bacteria | 4571377 |
| 903 | Ga0105239_10000798 | |||
| 904 | JGI24744J21845_10009695 | |||
| 905 | JGI25153J46596_10010114 | |||
| 906 | rootH2_10003861 | |||
| 907 | rootL2_10008947 | |||
| 908 | rootL2_10011993 | |||
| 909 | rootH1_10027651 | |||
| 910 | Ga0055525_1000011 | |||
| 911 | Ga0055526_1002081 | |||
| 912 | Ga0055526_1009068 | |||
| 913 | Ga0055524_1000423 | |||
| 914 | Ga0055530_10026604 | |||
| 915 | Ga0055530_10032948 | |||
| 916 | Ga0055540_1000015 | |||
| 917 | Ga0055531_10000214 | |||
| 918 | Ga0055531_10012695 | |||
| 919 | Ga0055531_10012745 | |||
| 920 | Ga0055543_1002451 | |||
| 921 | Ga0055543_1018468 | |||
| 922 | Ga0065165_1000024 | |||
| 923 | Ga0065165_1000401 | |||
| 924 | Ga0065165_1007960 | |||
| 925 | Ga0065704_10115258 | |||
| 926 | Ga0065707_10086296 | |||
| 927 | Ga0070658_10442350 | |||
| 928 | Ga0070676_10002580 | |||
| 929 | Ga0070676_10003107 | |||
| 930 | Ga0070676_10176335 | |||
| 931 | Ga0070676_10182727 | |||
| 932 | Ga0070683_100001824 | |||
| 933 | Ga0070690_100015822 | |||
| 934 | Ga0070690_100027719 | |||
| 935 | Ga0070670_100000817 | |||
| 936 | Ga0070670_100030985 | |||
| 937 | Ga0070670_100113628 | |||
| 938 | Ga0070670_100120306 | |||
| 939 | Ga0070677_10011646 | |||
| 940 | Ga0070677_10108708 | |||
| 941 | Ga0070677_10119071 | |||
| 942 | Ga0070677_10128255 | |||
| 943 | Ga0068869_100008068 | |||
| 944 | Ga0068869_100011581 | |||
| 945 | Ga0068869_100049338 | |||
| 946 | Ga0068869_100315725 | |||
| 947 | Ga0070666_10000785 | |||
| 948 | Ga0070682_100195879 | |||
| 949 | Ga0068868_100007918 | |||
| 950 | Ga0068868_100047011 | |||
| 951 | Ga0068868_100063355 | |||
| 952 | Ga0068868_100095787 | |||
| 953 | Ga0068868_100345864 | |||
| 954 | Ga0070660_100285612 | |||
| 955 | Ga0070689_100036794 | |||
| 956 | Ga0070687_100024523 | |||
| 957 | Ga0070687_100035933 | |||
| 958 | Ga0070661_100001209 | |||
| 959 | Ga0070661_100044171 | |||
| 960 | Ga0070661_100236421 | |||
| 961 | Ga0070668_100020742 | |||
| 962 | Ga0070668_100024278 | |||
| 963 | Ga0070668_100028843 | |||
| 964 | Ga0070668_100039349 | |||
| 965 | Ga0070669_100031357 | |||
| 966 | Ga0070669_100072267 | |||
| 967 | Ga0070669_100082423 | |||
| 968 | Ga0070669_100130631 | |||
| 969 | Ga0070669_100153435 | |||
| 970 | Ga0070675_100000285 | |||
| 971 | Ga0070675_100003281 | |||
| 972 | Ga0070675_100035548 | |||
| 973 | Ga0070675_100045165 | |||
| 974 | Ga0070675_100172746 | |||
| 975 | Ga0070671_100002575 | |||
| 976 | Ga0070671_100011706 | |||
| 977 | Ga0070671_100015522 | |||
| 978 | Ga0070671_100019406 | |||
| 979 | Ga0070671_100049253 | |||
| 980 | Ga0070671_100074679 | |||
| 981 | Ga0070671_100083482 | |||
| 982 | Ga0070671_100090319 | |||
| 983 | Ga0070671_100134959 | |||
| 984 | Ga0070671_100349687 | |||
| 985 | Ga0070674_100032006 | |||
| 986 | Ga0070674_100046123 | |||
| 987 | Ga0070673_100001009 | |||
| 988 | Ga0070673_100013002 | |||
| 989 | Ga0070673_100058983 | |||
| 990 | Ga0070673_100159301 | |||
| 991 | Ga0070673_100178321 | |||
| 992 | Ga0070673_100230122 | |||
| 993 | Ga0070659_100005054 | |||
| 994 | Ga0070659_100014835 | |||
| 995 | Ga0070659_100097584 | |||
| 996 | Ga0070667_100002773 | |||
| 997 | Ga0070667_100003684 | |||
| 998 | Ga0070667_100004040 | |||
| 999 | Ga0070667_100028787 | |||
| 1000 | Ga0070667_100052972 | |||
| 1001 | Ga0070667_100105409 | |||
| 1002 | Ga0070667_100236828 | |||
| 1003 | Ga0070667_100306561 | |||
| 1004 | Ga0070667_100459851 | |||
| 1005 | Ga0070700_100018609 | |||
| 1006 | Ga0070663_100000774 | |||
| 1007 | Ga0070663_100004332 | |||
| 1008 | Ga0070663_100180664 | |||
| 1009 | Ga0070678_100013525 | |||
| 1010 | Ga0070678_100027689 | |||
| 1011 | Ga0070678_100119433 | |||
| 1012 | Ga0070678_100322351 | |||
| 1013 | Ga0070678_100409008 | |||
| 1014 | Ga0070662_100069801 | |||
| 1015 | Ga0070662_100164880 | |||
| 1016 | Ga0068867_100000042 | |||
| 1017 | Ga0068867_100002447 | |||
| 1018 | Ga0068867_100004433 | |||
| 1019 | Ga0068867_100007433 | |||
| 1020 | Ga0068867_100023789 | |||
| 1021 | Ga0068867_100038381 | |||
| 1022 | Ga0068867_100050732 | |||
| 1023 | Ga0068867_100193634 | |||
| 1024 | Ga0070706_100006300 | |||
| 1025 | Ga0070707_100365515 | |||
| 1026 | Ga0070707_100626795 | |||
| 1027 | Ga0070698_100136280 | |||
| 1028 | Ga0070699_100565021 | |||
| 1029 | Ga0070679_100006907 | |||
| 1030 | Ga0068853_100043022 | |||
| 1031 | Ga0068853_100146170 | |||
| 1032 | Ga0070672_100001055 | |||
| 1033 | Ga0070672_100003224 | |||
| 1034 | Ga0070672_100005119 | |||
| 1035 | Ga0070672_100037899 | |||
| 1036 | Ga0070672_100060089 | |||
| 1037 | Ga0070672_100069134 | |||
| 1038 | Ga0070672_100088044 | |||
| 1039 | Ga0070665_100189898 | |||
| 1040 | Ga0070665_100243450 | |||
| 1041 | Ga0068855_100056667 | |||
| 1042 | Ga0070664_100018592 | |||
| 1043 | Ga0070664_100049307 | |||
| 1044 | Ga0070664_100097436 | |||
| 1045 | Ga0070664_100691812 | |||
| 1046 | Ga0068857_100054241 | |||
| 1047 | Ga0068857_100462992 | |||
| 1048 | Ga0068854_100081182 | |||
| 1049 | Ga0068854_100103875 | |||
| 1050 | Ga0068856_100030381 | |||
| 1051 | Ga0068856_100046644 | |||
| 1052 | Ga0068856_100071622 | |||
| 1053 | Ga0068856_100261102 | |||
| 1054 | Ga0070702_100041875 | |||
| 1055 | Ga0070702_100412145 | |||
| 1056 | Ga0068852_100005860 | |||
| 1057 | Ga0068852_100042868 | |||
| 1058 | Ga0068852_100059785 | |||
| 1059 | Ga0068852_100094336 | |||
| 1060 | Ga0068852_100102707 | |||
| 1061 | Ga0068852_100103478 | |||
| 1062 | Ga0068852_100177915 | |||
| 1063 | Ga0068859_100006127 | |||
| 1064 | Ga0068859_100046989 | |||
| 1065 | Ga0068859_100055367 | |||
| 1066 | Ga0068859_100076727 | |||
| 1067 | Ga0068859_100263104 | |||
| 1068 | Ga0068859_100453483 | |||
| 1069 | Ga0068864_100008087 | |||
| 1070 | Ga0068864_100016853 | |||
| 1071 | Ga0068864_100023050 | |||
| 1072 | Ga0068864_100079544 | |||
| 1073 | Ga0068864_100273556 | |||
| 1074 | Ga0068866_10009815 | |||
| 1075 | Ga0068866_10218004 | |||
| 1076 | Ga0068866_10240878 | |||
| 1077 | Ga0068861_100003647 | |||
| 1078 | Ga0068861_100004823 | |||
| 1079 | Ga0068861_100092008 | |||
| 1080 | Ga0068861_100115763 | |||
| 1081 | Ga0068861_100425157 | |||
| 1082 | Ga0068851_10021056 | |||
| 1083 | Ga0068851_10033511 | |||
| 1084 | Ga0068851_10055387 | |||
| 1085 | Ga0068851_10134934 | |||
| 1086 | Ga0068870_10085206 | |||
| 1087 | Ga0068863_100003799 | |||
| 1088 | Ga0068863_100004935 | |||
| 1089 | Ga0068863_100024370 | |||
| 1090 | Ga0068863_100124200 | |||
| 1091 | Ga0068863_100174157 | |||
| 1092 | Ga0068863_100225772 | |||
| 1093 | Ga0068858_100002240 | |||
| 1094 | Ga0068858_100018725 | |||
| 1095 | Ga0068858_100030676 | |||
| 1096 | Ga0068858_100100687 | |||
| 1097 | Ga0068860_100000445 | |||
| 1098 | Ga0068860_100011586 | |||
| 1099 | Ga0068860_100104553 | |||
| 1100 | Ga0068860_100116222 | |||
| 1101 | Ga0068862_100007883 | |||
| 1102 | Ga0068862_100283482 | |||
| 1103 | Ga0075363_100007306 | |||
| 1104 | Ga0075364_10159044 | |||
| 1105 | Ga0075362_10012411 | |||
| 1106 | Ga0075362_10024479 | |||
| 1107 | Ga0075367_10003540 | |||
| 1108 | Ga0075367_10010023 | |||
| 1109 | Ga0075367_10020279 | |||
| 1110 | Ga0075367_10100393 | |||
| 1111 | Ga0075369_10006310 | |||
| 1112 | Ga0075366_10004769 | |||
| 1113 | Ga0075366_10006048 | |||
| 1114 | Ga0075366_10008731 | |||
| 1115 | Ga0075366_10012069 | |||
| 1116 | Ga0075366_10027438 | |||
| 1117 | Ga0075366_10072758 | |||
| 1118 | Ga0075366_10087914 | |||
| 1119 | Ga0075366_10095865 | |||
| 1120 | Ga0075366_10111105 | |||
| 1121 | Ga0075366_10142635 | |||
| 1122 | Ga0075366_10145499 | |||
| 1123 | Ga0075366_10162681 | |||
| 1124 | Ga0097621_100010996 | |||
| 1125 | Ga0097621_100011620 | |||
| 1126 | Ga0097621_100035014 | |||
| 1127 | Ga0097621_100065798 | |||
| 1128 | Ga0097621_100125754 | |||
| 1129 | Ga0097621_100138249 | |||
| 1130 | Ga0075370_10000058 | |||
| 1131 | Ga0075370_10000309 | |||
| 1132 | Ga0075370_10001852 | |||
| 1133 | Ga0075370_10005206 | |||
| 1134 | Ga0075370_10028537 | |||
| 1135 | Ga0075370_10049240 | |||
| 1136 | Ga0075370_10067197 | |||
| 1137 | Ga0075370_10094258 | |||
| 1138 | Ga0068871_100019544 | |||
| 1139 | Ga0068871_100030326 | |||
| 1140 | Ga0068871_100165884 | |||
| 1141 | Ga0068871_100252060 | |||
| 1142 | Ga0068871_100429821 | |||
| 1143 | Ga0075428_100638243 | |||
| 1144 | Ga0075429_100022073 | |||
| 1145 | Ga0068865_100016331 | |||
| 1146 | Ga0097620_100006126 | |||
| 1147 | Ga0097620_100046990 | |||
| 1148 | Ga0097620_100055369 | |||
| 1149 | Ga0097620_100076724 | |||
| 1150 | Ga0097620_100263110 | |||
| 1151 | Ga0097620_100453462 | |||
| 1152 | Ga0099823_1013910 | |||
| 1153 | Ga0079104_1000219 | |||
| 1154 | Ga0105240_10056490 | |||
| 1155 | Ga0105245_10019948 | |||
| 1156 | Ga0105245_10086804 | |||
| 1157 | Ga0105245_10177935 | |||
| 1158 | Ga0114129_10225999 | |||
| 1159 | Ga0105243_10005579 | |||
| 1160 | Ga0105243_10027205 | |||
| 1161 | Ga0105243_10075641 | |||
| 1162 | Ga0105243_10076482 | |||
| 1163 | Ga0105243_10183478 | |||
| 1164 | Ga0105243_10254998 | |||
| 1165 | Ga0105243_10425451 | |||
| 1166 | Ga0105241_10392015 | |||
| 1167 | Ga0105242_10093683 | |||
| 1168 | Ga0105242_10108564 | |||
| 1169 | Ga0105242_10252702 | |||
| 1170 | Ga0105248_10059118 | |||
| 1171 | Ga0105248_10094534 | |||
| 1172 | Ga0105248_10102774 | |||
| 1173 | Ga0105248_10129449 | |||
| 1174 | Ga0105248_10143573 | |||
| 1175 | Ga0105237_10001461 | |||
| 1176 | Ga0105237_10015735 | |||
| 1177 | Ga0105237_10029245 | |||
| 1178 | Ga0105237_10100294 | |||
| 1179 | Ga0105238_10041551 | |||
| 1180 | Ga0105249_10005956 | |||
| 1181 | Ga0105249_10441764 | |||
| 1182 | Ga0105239_10389407 | |||
| 1183 | Ga0105239_10701336 | |||
| 1184 | Ga0105239_10776161 | |||
| 1185 | Ga0157317_1001003 | |||
| 1186 | Ga0157319_1000001 | |||
| 1187 | Ga0157373_10044395 | |||
| 1188 | Ga0157369_10246035 | |||
| 1189 | Ga0157369_10689220 | |||
| 1190 | Ga0157374_10034608 | |||
| 1191 | Ga0157374_10169179 | |||
| 1192 | Ga0157378_10026414 | |||
| 1193 | Ga0157378_10099437 | |||
| 1194 | Ga0157378_10343340 | |||
| 1195 | Ga0157378_10595247 | |||
| 1196 | Ga0163162_10002995 | |||
| 1197 | Ga0163162_10034726 | |||
| 1198 | Ga0163162_10052199 | |||
| 1199 | Ga0163162_10112573 | |||
| 1200 | Ga0157372_10988954 | |||
| 1201 | Ga0157375_10011447 | |||
| 1202 | Ga0157375_10022022 | |||
| 1203 | Ga0157375_10028630 | |||
| 1204 | Ga0157375_10066886 | |||
| 1205 | Ga0157375_10073701 | |||
| 1206 | Ga0157375_10201742 | |||
| 1207 | Ga0157375_10251130 | |||
| 1208 | Ga0157375_10384036 | |||
| 1209 | Ga0163163_10045264 | |||
| 1210 | Ga0163163_10200494 | |||
| 1211 | Ga0157380_10024747 | |||
| 1212 | Ga0157380_10038429 | |||
| 1213 | Ga0157380_10044937 | |||
| 1214 | Ga0157380_10145152 | |||
| 1215 | Ga0157380_10149420 | |||
| 1216 | Ga0157380_10184452 | |||
| 1217 | Ga0157377_10000038 | |||
| 1218 | Ga0157377_10017418 | |||
| 1219 | Ga0157379_10008098 | |||
| 1220 | Ga0157379_10041068 | |||
| 1221 | Ga0157379_10064914 | |||
| 1222 | Ga0157379_10076979 | |||
| 1223 | Ga0157379_10148959 | |||
| 1224 | Ga0157376_10016516 | |||
| 1225 | Ga0157376_10034451 | |||
| 1226 | Ga0157376_10379927 | |||
| 1227 | Ga0182007_10021855 | |||
| 1228 | Ga0163161_10004047 | |||
| 1229 | Ga0163161_10023239 | |||
| 1230 | Ga0163161_10061561 | |||
| 1231 | Ga0163161_10174345 | |||
| 1232 | Ga0163161_10428099 | |||
| 1233 | Ga0213872_10000003 | |||
| 1234 | Ga0213872_10000046 | |||
| 1235 | Ga0213872_10000124 | |||
| 1236 | Ga0213872_10003125 | |||
| 1237 | Ga0213872_10019223 | |||
| 1238 | Ga0213872_10025664 | |||
| 1239 | Ga0213872_10035777 | |||
| 1240 | Ga0209563_100005 | |||
| 1241 | Ga0207425_1000135 | |||
| 1242 | Ga0209129_1000043 | |||
| 1243 | Ga0209565_1011977 | |||
| 1244 | Ga0207666_1001401 | |||
| 1245 | Ga0209673_1006841 | |||
| 1246 | Ga0209673_1016786 | |||
| 1247 | Ga0209675_1007084 | |||
| 1248 | Ga0209564_1000005 | |||
| 1249 | Ga0209564_1000014 | |||
| 1250 | Ga0209758_1000492 | |||
| 1251 | Ga0209758_1005135 | |||
| 1252 | Ga0209050_1000493 | |||
| 1253 | Ga0209050_1000543 | |||
| 1254 | Ga0209050_1003305 | |||
| 1255 | Ga0209050_1033582 | |||
| 1256 | Ga0209256_1000092 | |||
| 1257 | Ga0209256_1000213 | |||
| 1258 | Ga0209256_1005252 | |||
| 1259 | Ga0209051_1000020 | |||
| 1260 | Ga0209051_1005067 | |||
| 1261 | Ga0209051_1010963 | |||
| 1262 | Ga0209257_1000017 | |||
| 1263 | Ga0209257_1000189 | |||
| 1264 | Ga0209257_1000805 | |||
| 1265 | Ga0209257_1000913 | |||
| 1266 | Ga0209257_1024150 | |||
| 1267 | Ga0209257_1031534 | |||
| 1268 | Ga0207697_10027645 | |||
| 1269 | Ga0207656_10061537 | |||
| 1270 | Ga0207656_10063503 | |||
| 1271 | Ga0207682_10001133 | |||
| 1272 | Ga0207682_10002990 | |||
| 1273 | Ga0207682_10013224 | |||
| 1274 | Ga0207682_10023137 | |||
| 1275 | Ga0207682_10038238 | |||
| 1276 | Ga0207688_10123877 | |||
| 1277 | Ga0207680_10020608 | |||
| 1278 | Ga0207645_10001485 | |||
| 1279 | Ga0207645_10003455 | |||
| 1280 | Ga0207643_10043348 | |||
| 1281 | Ga0207643_10105249 | |||
| 1282 | Ga0207705_10035148 | |||
| 1283 | Ga0207705_10177492 | |||
| 1284 | Ga0207684_10018378 | |||
| 1285 | Ga0207695_10042429 | |||
| 1286 | Ga0207671_10010195 | |||
| 1287 | Ga0207671_10253053 | |||
| 1288 | Ga0207662_10033599 | |||
| 1289 | Ga0207662_10058170 | |||
| 1290 | Ga0207657_10056764 | |||
| 1291 | Ga0207657_10109249 | |||
| 1292 | Ga0207657_10151582 | |||
| 1293 | Ga0207657_10506731 | |||
| 1294 | Ga0207649_10001821 | |||
| 1295 | Ga0207649_10294009 | |||
| 1296 | Ga0207646_10180410 | |||
| 1297 | Ga0207681_10004618 | |||
| 1298 | Ga0207681_10026584 | |||
| 1299 | Ga0207681_10403638 | |||
| 1300 | Ga0207694_10025174 | |||
| 1301 | Ga0207694_10418624 | |||
| 1302 | Ga0207650_10001149 | |||
| 1303 | Ga0207650_10003908 | |||
| 1304 | Ga0207650_10055912 | |||
| 1305 | Ga0207650_10378100 | |||
| 1306 | Ga0207659_10000477 | |||
| 1307 | Ga0207659_10000691 | |||
| 1308 | Ga0207659_10032109 | |||
| 1309 | Ga0207659_10112447 | |||
| 1310 | Ga0207687_10007233 | |||
| 1311 | Ga0207687_10064103 | |||
| 1312 | Ga0207687_10110502 | |||
| 1313 | Ga0207644_10001362 | |||
| 1314 | Ga0207644_10002098 | |||
| 1315 | Ga0207644_10006058 | |||
| 1316 | Ga0207644_10012856 | |||
| 1317 | Ga0207644_10034811 | |||
| 1318 | Ga0207644_10098074 | |||
| 1319 | Ga0207690_10005130 | |||
| 1320 | Ga0207706_10000756 | |||
| 1321 | Ga0207706_10001466 | |||
| 1322 | Ga0207706_10004450 | |||
| 1323 | Ga0207706_10051089 | |||
| 1324 | Ga0207706_10120264 | |||
| 1325 | Ga0207706_10141138 | |||
| 1326 | Ga0207706_10159532 | |||
| 1327 | Ga0207686_10006958 | |||
| 1328 | Ga0207686_10262698 | |||
| 1329 | Ga0207686_10388882 | |||
| 1330 | Ga0207709_10003694 | |||
| 1331 | Ga0207709_10106040 | |||
| 1332 | Ga0207709_10185783 | |||
| 1333 | Ga0207670_10025777 | |||
| 1334 | Ga0207670_10080473 | |||
| 1335 | Ga0207669_10005292 | |||
| 1336 | Ga0207669_10085614 | |||
| 1337 | Ga0207669_10098013 | |||
| 1338 | Ga0207704_10085429 | |||
| 1339 | Ga0207704_10188428 | |||
| 1340 | Ga0207691_10001243 | |||
| 1341 | Ga0207691_10003923 | |||
| 1342 | Ga0207691_10005630 | |||
| 1343 | Ga0207691_10017263 | |||
| 1344 | Ga0207691_10039879 | |||
| 1345 | Ga0207691_10111776 | |||
| 1346 | Ga0207691_10141115 | |||
| 1347 | Ga0207691_10244532 | |||
| 1348 | Ga0207711_10021174 | |||
| 1349 | Ga0207711_10087955 | |||
| 1350 | Ga0207711_10225169 | |||
| 1351 | Ga0207711_10332043 | |||
| 1352 | Ga0207689_10006829 | |||
| 1353 | Ga0207689_10012976 | |||
| 1354 | Ga0207689_10015924 | |||
| 1355 | Ga0207689_10207502 | |||
| 1356 | Ga0207689_10569822 | |||
| 1357 | Ga0207661_10109080 | |||
| 1358 | Ga0207661_10214944 | |||
| 1359 | Ga0207679_10000249 | |||
| 1360 | Ga0207679_10024487 | |||
| 1361 | Ga0207679_10083377 | |||
| 1362 | Ga0207679_10130780 | |||
| 1363 | Ga0207679_10554680 | |||
| 1364 | Ga0207651_10001278 | |||
| 1365 | Ga0207651_10016116 | |||
| 1366 | Ga0207651_10175494 | |||
| 1367 | Ga0207651_10198323 | |||
| 1368 | Ga0207651_10249569 | |||
| 1369 | Ga0207651_10268485 | |||
| 1370 | Ga0207651_10325067 | |||
| 1371 | Ga0207668_10004912 | |||
| 1372 | Ga0207668_10215294 | |||
| 1373 | Ga0207668_10294430 | |||
| 1374 | Ga0207658_10001089 | |||
| 1375 | Ga0207658_10018268 | |||
| 1376 | Ga0207658_10027241 | |||
| 1377 | Ga0207658_10064121 | |||
| 1378 | Ga0207658_10205475 | |||
| 1379 | Ga0207677_10003776 | |||
| 1380 | Ga0207677_10008741 | |||
| 1381 | Ga0207677_10032641 | |||
| 1382 | Ga0207677_10063934 | |||
| 1383 | Ga0207677_10069721 | |||
| 1384 | Ga0207677_10081795 | |||
| 1385 | Ga0207703_10000996 | |||
| 1386 | Ga0207703_10011365 | |||
| 1387 | Ga0207703_10041270 | |||
| 1388 | Ga0207703_10085277 | |||
| 1389 | Ga0207639_10014119 | |||
| 1390 | Ga0207639_10026149 | |||
| 1391 | Ga0207639_10213351 | |||
| 1392 | Ga0207639_10599492 | |||
| 1393 | Ga0207678_10000966 | |||
| 1394 | Ga0207678_10022962 | |||
| 1395 | Ga0207678_10170485 | |||
| 1396 | Ga0207678_10182419 | |||
| 1397 | Ga0207708_10012827 | |||
| 1398 | Ga0207702_10039270 | |||
| 1399 | Ga0207641_10007488 | |||
| 1400 | Ga0207641_10014783 | |||
| 1401 | Ga0207641_10017054 | |||
| 1402 | Ga0207641_10387053 | |||
| 1403 | Ga0207648_10000118 | |||
| 1404 | Ga0207648_10002634 | |||
| 1405 | Ga0207648_10003767 | |||
| 1406 | Ga0207648_10028344 | |||
| 1407 | Ga0207648_10034335 | |||
| 1408 | Ga0207648_10048712 | |||
| 1409 | Ga0207648_10086378 | |||
| 1410 | Ga0207648_10144132 | |||
| 1411 | Ga0207676_10002837 | |||
| 1412 | Ga0207676_10008453 | |||
| 1413 | Ga0207676_10024294 | |||
| 1414 | Ga0207676_10075841 | |||
| 1415 | Ga0207676_10171182 | |||
| 1416 | Ga0207676_10197356 | |||
| 1417 | Ga0207674_10053978 | |||
| 1418 | Ga0207674_10310100 | |||
| 1419 | Ga0207674_10346592 | |||
| 1420 | Ga0207674_10488682 | |||
| 1421 | Ga0207675_100002744 | |||
| 1422 | Ga0207675_100003062 | |||
| 1423 | Ga0207675_100003340 | |||
| 1424 | Ga0207675_100054366 | |||
| 1425 | Ga0207683_10004250 | |||
| 1426 | Ga0207683_10040254 | |||
| 1427 | Ga0207683_10070680 | |||
| 1428 | Ga0207683_10098580 | |||
| 1429 | Ga0207683_10123684 | |||
| 1430 | Ga0207683_10216173 | |||
| 1431 | Ga0207698_10002449 | |||
| 1432 | Ga0207698_10028828 | |||
| 1433 | Ga0207698_10044988 | |||
| 1434 | Ga0207698_10067441 | |||
| 1435 | Ga0207698_10080338 | |||
| 1436 | Ga0209281_1000074 | |||
| 1437 | Ga0209389_1029316 | |||
| 1438 | Ga0209996_1001245 | |||
| 1439 | Ga0209968_1000261 | |||
| 1440 | Ga0209970_1001467 | |||
| 1441 | Ga0209966_1000074 | |||
| 1442 | Ga0209813_10046708 | |||
| 1443 | Ga0209974_10038421 | |||
| 1444 | Ga0209974_10110227 | |||
| 1445 | Ga0268266_10038784 | |||
| 1446 | Ga0268266_10144301 | |||
| 1447 | Ga0268265_10598748 | |||
| 1448 | Ga0268264_10001857 | |||
| 1449 | Ga0268264_10002570 | |||
| 1450 | Ga0268264_10005397 | |||
| 1451 | Ga0307517_10010725 | |||
| 1452 | Ga0307517_10087776 | |||
| 1453 | Ga0307515_10000165 | |||
| 1454 | Ga0307515_10000188 | |||
| 1455 | Ga0307515_10005461 | |||
| 1456 | Ga0307515_10018969 | |||
| 1457 | Ga0307515_10029938 | |||
| 1458 | Ga0307515_10105203 | |||
| 1459 | Ga0307515_10178168 | |||
| 1460 | Ga0307512_10045736 | |||
| 1461 | Ga0307512_10187295 | |||
| 1462 | Ga0265328_10009090 | |||
| 1463 | Ga0265331_10002493 | |||
| 1464 | Ga0265327_10000144 | |||
| 1465 | Ga0265327_10000210 | |||
| 1466 | Ga0265316_10000005 | |||
| 1467 | Ga0307513_10001902 | |||
| 1468 | Ga0307513_10008355 | |||
| 1469 | Ga0307513_10017436 | |||
| 1470 | Ga0307513_10138011 | |||
| 1471 | Ga0307513_10294259 | |||
| 1472 | Ga0307513_10318897 | |||
| 1473 | Ga0307509_10000234 | |||
| 1474 | Ga0307509_10056928 | |||
| 1475 | Ga0307509_10146314 | |||
| 1476 | Ga0307408_100000038 | |||
| 1477 | Ga0307408_100064886 | |||
| 1478 | Ga0307408_100200356 | |||
| 1479 | Ga0307408_100300530 | |||
| 1480 | Ga0307508_10000169 | |||
| 1481 | Ga0307508_10044094 | |||
| 1482 | Ga0307514_10013831 | |||
| 1483 | Ga0307514_10051134 | |||
| 1484 | Ga0307514_10072288 | |||
| 1485 | Ga0316576_10006300 | |||
| 1486 | Ga0316576_10021087 | |||
| 1487 | Ga0316578_10000172 | |||
| 1488 | Ga0316578_10014111 | |||
| 1489 | Ga0307516_10000311 | |||
| 1490 | Ga0307516_10000326 | |||
| 1491 | Ga0307516_10000897 | |||
| 1492 | Ga0307516_10446494 | |||
| 1493 | Ga0307405_10011775 | |||
| 1494 | Ga0307405_10014690 | |||
| 1495 | Ga0307405_10109461 | |||
| 1496 | Ga0307405_10303706 | |||
| 1497 | Ga0307518_10292677 | |||
| 1498 | Ga0307410_10020161 | |||
| 1499 | Ga0307410_10031911 | |||
| 1500 | Ga0307410_10052069 | |||
| 1501 | Ga0307406_10028541 | |||
| 1502 | Ga0307406_10361782 | |||
| 1503 | Ga0307407_10078395 | |||
| 1504 | Ga0307412_10006968 | |||
| 1505 | Ga0307412_10017136 | |||
| 1506 | Ga0307412_10028415 | |||
| 1507 | Ga0307412_10140247 | |||
| 1508 | Ga0307412_10315739 | |||
| 1509 | Ga0307409_100002191 | |||
| 1510 | Ga0307409_100007440 | |||
| 1511 | Ga0307416_100002040 | |||
| 1512 | Ga0307416_100030437 | |||
| 1513 | Ga0307416_100035298 | |||
| 1514 | Ga0307416_100532570 | |||
| 1515 | Ga0307416_100658449 | |||
| 1516 | Ga0307414_10062189 | |||
| 1517 | Ga0307411_10000111 | |||
| 1518 | Ga0307411_10005718 | |||
| 1519 | Ga0307411_10219080 | |||
| 1520 | Ga0307415_100012627 | |||
| 1521 | Ga0316593_10007882 | |||
| 1522 | Ga0307507_10053173 | |||
| 1523 | Ga0307507_10087111 | |||
| 1524 | Ga0307510_10003147 | |||
| 1525 | Ga0307510_10022531 | |||
| 1526 | Ga0316592_1008210 | |||
| 1527 | Ga0316592_1047859 | |||
| 1528 | Ga0316588_1017053 | |||
| 1529 | Ga0316596_1005666 | |||
| 1530 | Ga0316596_1050199 | |||
| 1531 | Ga0373930_0018783 | |||
| 1532 | Ga0373940_0011703 | |||
| 1533 | Ga0373951_0015495 | |||
| 1534 | Ga0373939_0000004 | |||
| 1535 | Ga0373939_0060531 | |||
| 1536 | Ga0373956_0059059 | |||
| 1537 | Ga0373960_0006274 | |||
| 1538 | Ga0373943_0050329 | |||
| 1539 | Ga0373946_0040358 | |||
| 1540 | Ga0373962_0006239 | |||
| 1541 | Ga0373924_0034927 | |||
| 1542 | Ga0373931_0000546 | |||
| 1543 | Ga0373931_0009953 | |||
| 1544 | Ga0373935_0031345 | |||
| 1545 | Ga0373927_0039242 | |||
| 1546 | Ga0373937_0019374 | |||
| 1547 | Ga0373937_0097556 | |||
| 1548 | Ga0316584_0028137 | |||
| 1549 | Ga0316584_0091968 | |||
| 1550 | Ga0373925_0035960 | |||
| 1551 | Ga0373925_0094578 | |||
| 1552 | Ga0373925_0210626 | |||
| 1553 | Ga0373925_0267503 | |||
| 1554 | Ga0395900_0000355 | |||
| 1555 | Ga0395900_0508785 | |||
| 1556 | Ga0395905_0000777 | |||
| 1557 | Ga0395905_0003411 | |||
| 1558 | Ga0395905_0004659 | |||
| 1559 | Ga0395905_0008552 | |||
| 1560 | Ga0395905_0009989 | |||
| 1561 | Ga0395905_0023405 | |||
| 1562 | Ga0395905_0178674 | |||
| 1563 | Ga0395905_0328566 | |||
| 1564 | Ga0436365_0561202 | |||
| 1565 | Ga0436365_0936688 | |||
| 1566 | Ga0436361_0003822 | |||
| 1567 | Ga0436361_0633280 | |||
| 1568 | Ga0436361_0638016 | |||
| 1569 | Ga0436361_0895746 | |||
| 1570 | Ga0436361_0916159 | |||
| 1571 | Ga0436361_1079715 | |||
| 1572 | Ga0439461_0045495 | |||
| 1573 | Ga0451798_0696078 | |||
| 1574 | Ga0451802_0574082 | |||
| 1575 | Ga0451807_1744250 | |||
| 1576 | Ga0451833_1159483 | |||
| 1577 | Ga0451841_0774662 | |||
| 1578 | Ga0451843_1695661 | |||
| 1579 | Ga0451853_2209517 | |||
| 1580 | Ga0439431_0001589 | |||
| 1581 | Ga0439449_0083375 | |||
| 1582 | Ga0439450_021953 | |||
| 1583 | Ga0439455_0000995 | |||
| 1584 | Ga0450890_001964 | |||
| 1585 | Ga0450889_001429 | |||
| 1586 | Ga0439446_0008764 | |||
| 1587 | Ga0439458_0047443 | |||
| 1588 | Ga0439459_0000191 | |||
| 1589 | Ga0439460_0010600 | |||
| 1590 | Ga0450916_000815 | |||
| 1591 | Ga0450918_001043 | |||
| 1592 | Ga0451577_0000641 | |||
| 1593 | Ga0451577_0008482 | |||
| 1594 | Ga0451577_0011912 | |||
| 1595 | Ga0451577_0015837 | |||
| 1596 | Ga0451577_0038688 | |||
| 1597 | Ga0451577_0077908 | |||
| 1598 | Ga0451577_0318412 | |||
| 1599 | Ga0451577_0415163 | |||
| 1600 | Ga0451577_0592286 | |||
| 1601 | Ga0466969_0000028 | |||
| 1602 | Ga0466972_0001085 | |||
| 1603 | Ga0466972_0029875 | |||
| 1604 | Ga0466966_0008387 | |||
| 1605 | Ga0466966_0020086 | |||
| 1606 | Ga0466961_0018744 | |||
| 1607 | Ga0466963_0000306 | |||
| 1608 | Ga0466964_0010048 | |||
| 1609 | Ga0466964_0178118 | |||
| 1610 | Ga0453684_0001818 | |||
| 1611 | Ga0453684_0009747 | |||
| 1612 | Ga0453684_0137499 | |||
| 1613 | Ga0453684_0157052 | |||
| 1614 | Ga0453684_0195762 | |||
| 1615 | Ga0453684_0314595 | |||
| 1616 | Ga0466971_0028647 | |||
| 1617 | Ga0466968_0050105 | |||
| 1618 | Ga0466970_0038282 | |||
| 1619 | Ga0466970_0111191 | |||
| 1620 | Ga0466957_0053737 | |||
| 1621 | Ga0466959_0001676 | |||
| 1622 | Ga0466959_0082802 | |||
| 1623 | Ga0451576_0002104 | |||
| 1624 | Ga0451576_0015228 | |||
| 1625 | Ga0451576_0019110 | |||
| 1626 | Ga0451576_0039970 | |||
| 1627 | Ga0451576_0237748 | |||
| 1628 | Ga0451576_0432301 | |||
| 1629 | Ga0466958_0159955 | |||
| 1630 | Ga0495592_0012833 | |||
| 1631 | Ga0495590_0016223 | |||
| 1632 | Ga0495590_0039265 | |||
| 1633 | Ga0495629_0025312 | |||
| 1634 | Ga0495629_0219417 | |||
| 1635 | Ga0495638_0127217 | |||
| 1636 | Ga0495638_0216196 | |||
| 1637 | Ga0495650_0000976 | |||
| 1638 | Ga0495580_0125242 | |||
| 1639 | Ga0495583_0042459 | |||
| 1640 | Ga0495606_0184383 | |||
| 1641 | Ga0495628_0301160 | |||
| 1642 | Ga0495632_0003074 | |||
| 1643 | Ga0495632_0006463 | |||
| 1644 | Ga0495642_0039547 | |||
| 1645 | Ga0495586_0064987 | |||
| 1646 | Ga0495621_0002740 | |||
| 1647 | Ga0495597_0022439 | |||
| 1648 | Ga0495625_0053069 | |||
| 1649 | Ga0495625_0079548 | |||
| 1650 | Ga0495658_0016429 | |||
| 1651 | Ga0495613_0060723 | |||
| 1652 | Ga0495670_0020117 | |||
| 1653 | Ga0495649_0001852 | |||
| 1654 | Ga0495674_0168034 | |||
| 1655 | Ga0495676_0054670 | |||
| 1656 | Ga0495687_000367 | |||
| 1657 | Ga0495687_006395 | |||
| 1658 | Ga0495684_0078731 | |||
| 1659 | Ga0495686_0006531 | |||
| 1660 | Ga0495593_0093103 | |||
| 1661 | Ga0496102_0003534 | |||
| 1662 | Ga0496102_0005742 | |||
| 1663 | Ga0496104_0106712 | |||
| 1664 | Ga0496104_0593837 | |||
| 1665 | Ga0496106_0012481 | |||
| 1666 | Ga0496106_0074237 | |||
| 1667 | Ga0496106_0121074 | |||
| 1668 | Ga0496108_0037095 | |||
| 1669 | Ga0496108_0115085 | |||
| 1670 | Ga0496109_0258525 | |||
| 1671 | Ga0496110_0096611 | |||
| 1672 | Ga0496110_0100048 | |||
| 1673 | Ga0496110_0258867 | |||
| 1674 | Ga0496110_0542526 | |||
| 1675 | Ga0496111_0016712 | |||
| 1676 | Ga0496112_0043915 | |||
| 1677 | Ga0496113_0006211 | |||
| 1678 | Ga0496113_0203823 | |||
| 1679 | Ga0496114_0007670 | |||
| 1680 | Ga0496121_0022834 | |||
| 1681 | Ga0496122_0074566 | |||
| 1682 | Ga0496124_0000138 | |||
| 1683 | Ga0496124_0063527 | |||
| 1684 | Ga0496124_0123263 | |||
| 1685 | Ga0496125_0001189 | |||
| 1686 | Ga0496125_0197833 | |||
| 1687 | Ga0501308_004681 | |||
| 1688 | Ga0501304_002933 | |||
| 1689 | Ga0501292_015918 | |||
| 1690 | Ga0501300_008168 | |||
| 1691 | Ga0501314_003951 | |||
| 1692 | Ga0501034_0375546 | |||
| 1693 | Ga0501039_0362830 | |||
| 1694 | Ga0501041_0088284 | |||
| 1695 | Ga0501043_0000002 | |||
| 1696 | Ga0501046_0000008 | |||
| 1697 | Ga0501047_0000003 | |||
| 1698 | Ga0501198_000014 | |||
| 1699 | Ga0501201_004887 | |||
| 1700 | Ga0501206_008312 | |||
| 1701 | Ga0501211_001618 | |||
| 1702 | Ga0501222_000008 | |||
| 1703 | Ga0501222_001642 | |||
| 1704 | Ga0501223_004639 | |||
| 1705 | Ga0501227_002798 | |||
| 1706 | Ga0501233_018737 | |||
| 1707 | Ga0501235_008379 | |||
| 1708 | Ga0501236_013541 | |||
| 1709 | Ga0501252_003010 | |||
| 1710 | Ga0501253_008366 | |||
| 1711 | Ga0501221_002992 | |||
| 1712 | Ga0501229_000954 | |||
| 1713 | Ga0501262_003682 | |||
| 1714 | Ga0501267_001793 | |||
| 1715 | Ga0501268_004583 | |||
| 1716 | Ga0501272_001041 | |||
| 1717 | Ga0501282_004903 | |||
| 1718 | Ga0501283_001477 | |||
| 1719 | Ga0501045_0012726 | |||
| 1720 | nmdc:mga00v17_19912_c1 | |||
| 1721 | nmdc:mga00v17_36384_c1 | |||
| 1722 | nmdc:mga00v17_90001_c1 | |||
| 1723 | nmdc:mga0k408_101548_c1 | |||
| 1724 | nmdc:mga0k408_104944_c1 | |||
| 1725 | nmdc:mga0k408_111673_c1 | |||
| 1726 | nmdc:mga0k408_137584_c1 | |||
| 1727 | nmdc:mga0k408_17696_c1 | |||
| 1728 | nmdc:mga0k408_23013_c1 | |||
| 1729 | nmdc:mga0k408_24559_c1 | |||
| 1730 | nmdc:mga0k408_24684_c1 | |||
| 1731 | nmdc:mga0k408_24760_c1 | |||
| 1732 | nmdc:mga0k408_26432_c1 | |||
| 1733 | nmdc:mga0k408_4347_c1 | |||
| 1734 | nmdc:mga0k408_5357_c1 | |||
| 1735 | nmdc:mga0k408_67349_c1 | |||
| 1736 | nmdc:mga0k408_734_c1 | |||
| 1737 | nmdc:mga0k408_7706_c1 | |||
| 1738 | nmdc:mga06z11_32273_c1 | |||
| 1739 | nmdc:mga06z11_33419_c1 | |||
| 1740 | nmdc:mga04h51_71035_c1 | |||
| 1741 | nmdc:mga07m45_14178_c1 | |||
| 1742 | nmdc:mga07m45_19348_c1 | |||
| 1743 | nmdc:mga07m45_194694_c1 | |||
| 1744 | nmdc:mga07m45_25391_c1 | |||
| 1745 | nmdc:mga07m45_57_c1 | |||
| 1746 | nmdc:mga07m45_7428_c1 | |||
| 1747 | nmdc:mga07m45_79116_c1 | |||
| 1748 | nmdc:mga07m45_8433_c1 | |||
| 1749 | nmdc:mga05p37_351329_c1 | |||
| 1750 | nmdc:mga09592_5629_c1 | |||
| 1751 | nmdc:mga0sz30_29883_c1 | |||
| 1752 | Ga0495619_0028690 | |||
| 1753 | Ga0500578_0000058 | |||
| 1754 | Ga0500578_0054149 | |||
| 1755 | Ga0500646_0025159 | |||
| 1756 | Ga0500583_0043952 | |||
| 1757 | Ga0500651_0009126 | |||
| 1758 | Ga0500651_0019235 | |||
| 1759 | Ga0500651_0059450 | |||
| 1760 | Ga0500593_001065 | |||
| 1761 | Ga0500623_051234 | |||
| 1762 | Ga0500642_0003464 | |||
| 1763 | Ga0500652_000027 | |||
| 1764 | Ga0500655_004171 | |||
| 1765 | Ga0500658_0091271 | |||
| 1766 | Ga0500658_0115906 | |||
| 1767 | Ga0500559_0000119 | |||
| 1768 | Ga0500568_0014139 | |||
| 1769 | Ga0500568_0049683 | |||
| 1770 | Ga0500573_0133676 | |||
| 1771 | Ga0500590_011236 | |||
| 1772 | Ga0500616_0050411 | |||
| 1773 | Ga0500619_000611 | |||
| 1774 | Ga0500622_0000221 | |||
| 1775 | Ga0500622_0004359 | |||
| 1776 | Ga0500622_0005218 | |||
| 1777 | Ga0500645_006045 | |||
| 1778 | Ga0500645_059627 | |||
| 1779 | Ga0590071_000370 | |||
| 1780 | Ga0501082_0139543 | |||
| 1781 | Ga0466962_0026119 | |||
| 1782 | 2587728879 | |||
| 1783 | 2587736480 | |||
| 1784 | 2587758582 | |||
| 1785 | 2588294661 | |||
| 1786 | 2643745689 | |||
| 1787 | 2643936756 | |||
| 1788 | 2643970512 | |||
| 1789 | 2644142751 | |||
| 1790 | 2644221584 | |||
| 1791 | 2644246335 | |||
| 1792 | 2644257651 | |||
| 1793 | 2644272688 | |||
| 1794 | 2644303951 | |||
| 1795 | 2644318655 | |||
| 1796 | 2644340396 | |||
| 1797 | 2739058635 | |||
| 1798 | 2831869470 | |||
| 1799 | 2842721181 | |||
| 1800 | 2886853728 | |||
| 1801 | 2904479591 | |||
| 1802 | 2919707233 | |||
| 1803 | 2945949363 | |||
| 1804 | 2974324069 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5i1f-assembly1.cif.gz_A-2 | crystal structure of utp-glucose-1-phosphate uridylyltransferase from burkholderia vietnamiensis in complex with uridine-5'-diphosphate-glucose | 0.9625 | 1 | 285 |
| 5ve7-assembly1.cif.gz_A | crystal structure of utp-glucose-1-phosphate uridylyltransferase from burkholderia ambifaria in complex with utp | 0.9586 | 1 | 286 |
| 5ve7-assembly1.cif.gz_A | crystal structure of utp-glucose-1-phosphate uridylyltransferase from burkholderia ambifaria in complex with utp | 0.9553 | 1 | 286 |
| 5j49-assembly1.cif.gz_A | crystal structure of udp-glucose pyrophosporylase / utp-glucose-1-phosphate uridylyltransferase from burkholderia xenovorans | 0.9496 | 1 | 287 |
| 5i1f-assembly1.cif.gz_A-2 | crystal structure of utp-glucose-1-phosphate uridylyltransferase from burkholderia vietnamiensis in complex with uridine-5'-diphosphate-glucose | 0.9495 | 1 | 285 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q2G1T6_1_286_3.90.550.10 | Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A | 0.9553 | 1 | 286 | 3.90.550.10 |
| af_Q2G1T6_1_286_3.90.550.10 | Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A | 0.9488 | 1 | 286 | 3.90.550.10 |
| af_Q58730_1_282_3.90.550.10 | Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A | 0.9464 | 3 | 285 | 3.90.550.10 |
| af_Q58730_1_282_3.90.550.10 | Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A | 0.9399 | 3 | 285 | 3.90.550.10 |
| 2ux8B00 | Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A | 0.9371 | 3 | 284 | 3.90.550.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2S5LAR8-F1-model_v4 | UTP--glucose-1-phosphate uridylyltransferase (EC 2.7.7.9) (Alpha-D-glucosyl-1-phosphate uridylyltransferase) (UDP-glucose pyrophosphorylase) (Uridine diphosphoglucose pyrophosphorylase) | 0.9913 | 126 | 288 |
GO:0003983
GO:0006011 GO:0009058 |
| AF-A0A3D4LJV5-F1-model_v4 | UTP--glucose-1-phosphate uridylyltransferase (EC 2.7.7.9) | 0.9895 | 106 | 258 |
GO:0003983
GO:0006011 GO:0009058 |
| AF-A0A4Q3QDS7-F1-model_v4 | deleted | 0.9888 | 103 | 288 |
|
| AF-A0A353Y6T5-F1-model_v4 | UTP--glucose-1-phosphate uridylyltransferase (EC 2.7.7.9) (Alpha-D-glucosyl-1-phosphate uridylyltransferase) (UDP-glucose pyrophosphorylase) (Uridine diphosphoglucose pyrophosphorylase) | 0.9884 | 172 | 288 |
GO:0003983
GO:0006011 GO:0009058 |
| AF-T0XS77-F1-model_v4 | UTP--glucose-1-phosphate uridylyltransferase (EC 2.7.7.9) | 0.9868 | 98 | 286 |
GO:0003983
GO:0006011 GO:0009058 |