F485208
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 902 | 395 | 1804 | 131 |
Family's Representative Sequence
| Representative Sequence | 3300025304|Ga0209257_1000170|Ga0209257_100017020 |
| Length | 131 |
| Sequence | MERFDGGCLCGKVRLVAQGQPNRVGLCHCMDCRKHHGALFHASAVFPEQAVKVSGETREYAKRYFCPNCGSSVFGRSDIEEIEVNLGCLDAPDQFKPTYELWTVRRESWLPPFPLTGYERDRESTSRYENP |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 2 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 3 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 4 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 5 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 6 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 7 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 8 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 9 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 10 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 11 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 12 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 13 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 14 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 15 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 19 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 20 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 22 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 23 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 25 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 32 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 37 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 38 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 40 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 41 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 43 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 44 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 47 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 48 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 50 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 51 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 52 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 53 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 54 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 55 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 56 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 57 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 58 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 59 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 61 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 62 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 63 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 64 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 65 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 66 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 67 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 68 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 70 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 71 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 72 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 73 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 74 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 75 | 3300006944 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW | Metagenome | Nodule |
| 76 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 77 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 78 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300012498 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 | Metagenome | Rhizosphere |
| 93 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 104 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 105 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 106 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 107 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 109 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 110 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 111 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 112 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 113 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 114 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 115 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 116 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 117 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 118 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 119 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 120 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 171 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300027360 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 174 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 175 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 178 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 179 | 3300030733 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 | Metagenome | Rhizosphere |
| 180 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 181 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 182 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 183 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 184 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 185 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 186 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 187 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 188 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 189 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 190 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 191 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 192 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 193 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 194 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 195 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 196 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 197 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 198 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 199 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 200 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 201 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 202 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 203 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 204 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 205 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 206 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 207 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 208 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 209 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 210 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 211 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 212 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 213 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 214 | 3300041458 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG | Metagenome | Rhizoplane |
| 215 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 216 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 217 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 218 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 219 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 220 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 221 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 222 | 3300042118 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_082316_2156 | Metagenome | Rhizosphere |
| 223 | 3300042128 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123 | Metagenome | Rhizosphere |
| 224 | 3300042131 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 | Metagenome | Rhizosphere |
| 225 | 3300042142 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 | Metagenome | Rhizosphere |
| 226 | 3300042144 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 | Metagenome | Rhizosphere |
| 227 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 228 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 229 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 230 | 3300042185 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 | Metagenome | Rhizosphere |
| 231 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 232 | 3300042530 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 | Metagenome | Rhizosphere |
| 233 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 234 | 3300042532 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 | Metagenome | Rhizosphere |
| 235 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 236 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 237 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 238 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 239 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 240 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 241 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 242 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 243 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 244 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 245 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 246 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 247 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 248 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 314 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 315 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 316 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 317 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 318 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 319 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 320 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 321 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 322 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 323 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 324 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 325 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 326 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 327 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 328 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 329 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 330 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 331 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 332 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 333 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 334 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 335 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 336 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 337 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 338 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 339 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 342 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 343 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 344 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 345 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 346 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 347 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 348 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 349 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 350 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 351 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 352 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 353 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 354 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 355 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 356 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 357 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 358 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 359 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 360 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 361 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 362 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 363 | 3300049652 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought | Metagenome | Rhizosphere |
| 364 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 365 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 366 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 367 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 368 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 369 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 370 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 371 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 372 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 373 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 374 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 375 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 376 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 377 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 378 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 379 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 380 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 381 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 382 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 383 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 384 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 385 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 386 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 387 | 3300053145 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere | Metagenome | Endosphere |
| 388 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 389 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 390 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 391 | 3300059426 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 392 | 3300059642 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 393 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 394 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 395 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.89 |
| Metatranscriptomes | 0.11 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 10.53 |
| Nodule | 0.33 |
| Rhizoplane | 3.33 |
| Rhizosphere | 80.04 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0209257_1000170 | 3300025304 | Bacteria | 169384 |
| 2 | JGI24735J21928_10011016 | 3300002067 | Bacteria | 2873 |
| 3 | JGI24735J21928_10073659 | 3300002067 | Bacteria | 978 |
| 4 | JGI25152J39213_1002426 | 3300002773 | Bacteria | 7098 |
| 5 | JGI25151J46595_10091505 | 3300003187 | Bacteria | 845 |
| 6 | rootH2_10060589 | 3300003320 | Bacteria | 3443 |
| 7 | rootH1_10005225 | 3300003323 | Bacteria | 17841 |
| 8 | rootH1_10014341 | 3300003323 | Bacteria | 3538 |
| 9 | rootH1_10029371 | 3300003323 | Bacteria | 3252 |
| 10 | rootH1_10043722 | 3300003323 | Bacteria | 9212 |
| 11 | JGI25160J50197_1015076 | 3300003354 | Bacteria | 2554 |
| 12 | Ga0055526_1020884 | 3300003771 | Bacteria | 2304 |
| 13 | Ga0055524_1003534 | 3300003775 | Bacteria | 7557 |
| 14 | Ga0055524_1008747 | 3300003775 | Bacteria | 4181 |
| 15 | Ga0055524_1014639 | 3300003775 | Bacteria | 2898 |
| 16 | Ga0055524_1019646 | 3300003775 | Bacteria | 2302 |
| 17 | Ga0055524_1084418 | 3300003775 | Bacteria | 568 |
| 18 | Ga0055528_1000475 | 3300003790 | Bacteria | 32037 |
| 19 | Ga0055528_1003617 | 3300003790 | Bacteria | 7687 |
| 20 | Ga0055528_1011147 | 3300003790 | Bacteria | 3597 |
| 21 | Ga0055528_1090489 | 3300003790 | Bacteria | 526 |
| 22 | Ga0055531_10000002 | 3300003794 | Bacteria | 421971 |
| 23 | Ga0055531_10001058 | 3300003794 | Bacteria | 21682 |
| 24 | Ga0055531_10008411 | 3300003794 | Bacteria | 5448 |
| 25 | Ga0065165_1004191 | 3300005262 | Bacteria | 9187 |
| 26 | Ga0065165_1011457 | 3300005262 | Bacteria | 3696 |
| 27 | Ga0065704_10168884 | 3300005289 | Bacteria | 1304 |
| 28 | Ga0065707_10087132 | 3300005295 | Bacteria | 5150 |
| 29 | Ga0070658_10017036 | 3300005327 | Bacteria | 5815 |
| 30 | Ga0070658_10057334 | 3300005327 | Bacteria | 3168 |
| 31 | Ga0070670_100117899 | 3300005331 | Bacteria | 2289 |
| 32 | Ga0070666_10208579 | 3300005335 | Bacteria | 1376 |
| 33 | Ga0070682_100472831 | 3300005337 | Bacteria | 965 |
| 34 | Ga0068868_100020866 | 3300005338 | Bacteria | 4931 |
| 35 | Ga0070660_100008686 | 3300005339 | Bacteria | 7113 |
| 36 | Ga0070660_100068646 | 3300005339 | Bacteria | 2763 |
| 37 | Ga0070660_100708682 | 3300005339 | Bacteria | 844 |
| 38 | Ga0070660_101069361 | 3300005339 | Bacteria | 682 |
| 39 | Ga0070689_100457419 | 3300005340 | Bacteria | 1087 |
| 40 | Ga0070687_100057783 | 3300005343 | Bacteria | 2036 |
| 41 | Ga0070661_100050772 | 3300005344 | Bacteria | 3035 |
| 42 | Ga0070661_100169133 | 3300005344 | Bacteria | 1659 |
| 43 | Ga0070661_100183810 | 3300005344 | Bacteria | 1591 |
| 44 | Ga0070661_100430351 | 3300005344 | Bacteria | 1047 |
| 45 | Ga0070661_100670641 | 3300005344 | Bacteria | 843 |
| 46 | Ga0070661_100720653 | 3300005344 | Bacteria | 814 |
| 47 | Ga0070692_10874066 | 3300005345 | Bacteria | 619 |
| 48 | Ga0070668_101262275 | 3300005347 | Bacteria | 671 |
| 49 | Ga0070668_101671731 | 3300005347 | Bacteria | 584 |
| 50 | Ga0070669_100056577 | 3300005353 | Bacteria | 2876 |
| 51 | Ga0070669_100168372 | 3300005353 | Bacteria | 1707 |
| 52 | Ga0070669_100191230 | 3300005353 | Bacteria | 1606 |
| 53 | Ga0070669_101048602 | 3300005353 | Bacteria | 701 |
| 54 | Ga0070671_100008751 | 3300005355 | Bacteria | 8121 |
| 55 | Ga0070671_100087030 | 3300005355 | Bacteria | 2614 |
| 56 | Ga0070671_100445573 | 3300005355 | Bacteria | 1111 |
| 57 | Ga0070673_100110750 | 3300005364 | Bacteria | 2276 |
| 58 | Ga0070673_100498116 | 3300005364 | Bacteria | 1102 |
| 59 | Ga0070659_100264336 | 3300005366 | Bacteria | 1428 |
| 60 | Ga0070659_101313775 | 3300005366 | Bacteria | 641 |
| 61 | Ga0070667_100153388 | 3300005367 | Bacteria | 2025 |
| 62 | Ga0070667_100201231 | 3300005367 | Bacteria | 1767 |
| 63 | Ga0070667_100312753 | 3300005367 | Bacteria | 1416 |
| 64 | Ga0070713_100467204 | 3300005436 | Bacteria | 1187 |
| 65 | Ga0070710_10913216 | 3300005437 | Bacteria | 635 |
| 66 | Ga0070708_101618107 | 3300005445 | Bacteria | 603 |
| 67 | Ga0070663_100334556 | 3300005455 | Bacteria | 1221 |
| 68 | Ga0070662_100939768 | 3300005457 | Bacteria | 739 |
| 69 | Ga0070662_100977375 | 3300005457 | Bacteria | 724 |
| 70 | Ga0070681_11281180 | 3300005458 | Bacteria | 655 |
| 71 | Ga0070685_10001187 | 3300005466 | Bacteria | 13922 |
| 72 | Ga0070706_100170084 | 3300005467 | Bacteria | 2035 |
| 73 | Ga0070679_100075528 | 3300005530 | Bacteria | 3359 |
| 74 | Ga0070679_100474960 | 3300005530 | Bacteria | 1195 |
| 75 | Ga0070679_101384469 | 3300005530 | Bacteria | 649 |
| 76 | Ga0068853_102116744 | 3300005539 | Bacteria | 545 |
| 77 | Ga0070672_100646831 | 3300005543 | Bacteria | 923 |
| 78 | Ga0070672_101965724 | 3300005543 | Bacteria | 527 |
| 79 | Ga0070686_100759300 | 3300005544 | Bacteria | 778 |
| 80 | Ga0070695_100062209 | 3300005545 | Bacteria | 2423 |
| 81 | Ga0070696_100013709 | 3300005546 | Bacteria | 5443 |
| 82 | Ga0070665_100979034 | 3300005548 | Bacteria | 858 |
| 83 | Ga0070704_100525375 | 3300005549 | Bacteria | 1031 |
| 84 | Ga0068855_100210671 | 3300005563 | Bacteria | 2184 |
| 85 | Ga0068855_100454263 | 3300005563 | Bacteria | 1397 |
| 86 | Ga0068855_100742786 | 3300005563 | Bacteria | 1047 |
| 87 | Ga0068855_102211242 | 3300005563 | Bacteria | 552 |
| 88 | Ga0070664_100105907 | 3300005564 | Bacteria | 2449 |
| 89 | Ga0070664_100164382 | 3300005564 | Bacteria | 1966 |
| 90 | Ga0070664_100291307 | 3300005564 | Bacteria | 1474 |
| 91 | Ga0070664_100654928 | 3300005564 | Bacteria | 976 |
| 92 | Ga0068857_100044117 | 3300005577 | Bacteria | 3954 |
| 93 | Ga0068857_100123702 | 3300005577 | Bacteria | 2330 |
| 94 | Ga0068857_100735999 | 3300005577 | Bacteria | 939 |
| 95 | Ga0068857_100744445 | 3300005577 | Bacteria | 933 |
| 96 | Ga0068857_101015093 | 3300005577 | Bacteria | 799 |
| 97 | Ga0068854_100006731 | 3300005578 | Bacteria | 7324 |
| 98 | Ga0068854_100355935 | 3300005578 | Bacteria | 1200 |
| 99 | Ga0068854_100890762 | 3300005578 | Bacteria | 781 |
| 100 | Ga0068856_100682688 | 3300005614 | Bacteria | 1047 |
| 101 | Ga0068856_101289433 | 3300005614 | Bacteria | 746 |
| 102 | Ga0068852_100002742 | 3300005616 | Bacteria | 12191 |
| 103 | Ga0068852_100018079 | 3300005616 | Bacteria | 5546 |
| 104 | Ga0068852_100266785 | 3300005616 | Bacteria | 1646 |
| 105 | Ga0068864_100495147 | 3300005618 | Bacteria | 1175 |
| 106 | Ga0068864_100868716 | 3300005618 | Bacteria | 889 |
| 107 | Ga0068863_100024383 | 3300005841 | Bacteria | 5769 |
| 108 | Ga0068863_100115167 | 3300005841 | Bacteria | 2561 |
| 109 | Ga0068858_100063774 | 3300005842 | Bacteria | 3409 |
| 110 | Ga0068858_100131894 | 3300005842 | Bacteria | 2343 |
| 111 | Ga0068860_100341450 | 3300005843 | Bacteria | 1472 |
| 112 | Ga0068862_100002492 | 3300005844 | Bacteria | 16289 |
| 113 | Ga0068862_100102772 | 3300005844 | Bacteria | 2502 |
| 114 | Ga0068862_100153873 | 3300005844 | Bacteria | 2048 |
| 115 | Ga0068862_100260289 | 3300005844 | Bacteria | 1583 |
| 116 | Ga0081540_1107817 | 3300005983 | Bacteria | 1185 |
| 117 | Ga0070717_10088091 | 3300006028 | Bacteria | 2616 |
| 118 | Ga0075365_10021778 | 3300006038 | Bacteria | 4004 |
| 119 | Ga0075365_10054022 | 3300006038 | Bacteria | 2662 |
| 120 | Ga0075365_10583498 | 3300006038 | Bacteria | 791 |
| 121 | Ga0075368_10381293 | 3300006042 | Bacteria | 617 |
| 122 | Ga0075363_100107209 | 3300006048 | Bacteria | 1550 |
| 123 | Ga0075363_100143057 | 3300006048 | Bacteria | 1348 |
| 124 | Ga0075364_10265618 | 3300006051 | Bacteria | 1167 |
| 125 | Ga0070716_100384072 | 3300006173 | Bacteria | 1005 |
| 126 | Ga0075367_10009681 | 3300006178 | Bacteria | 5047 |
| 127 | Ga0075367_10094217 | 3300006178 | Bacteria | 1825 |
| 128 | Ga0075369_10117962 | 3300006186 | Bacteria | 1200 |
| 129 | Ga0075366_10103623 | 3300006195 | Bacteria | 1709 |
| 130 | Ga0075366_10319573 | 3300006195 | Bacteria | 951 |
| 131 | Ga0097621_100175276 | 3300006237 | Bacteria | 1851 |
| 132 | Ga0097621_100889258 | 3300006237 | Bacteria | 829 |
| 133 | Ga0075370_10003381 | 3300006353 | Bacteria | 7580 |
| 134 | Ga0075370_10529970 | 3300006353 | Bacteria | 712 |
| 135 | Ga0075370_10910602 | 3300006353 | Bacteria | 538 |
| 136 | Ga0075428_100003477 | 3300006844 | Bacteria | 17232 |
| 137 | Ga0075428_100036137 | 3300006844 | Bacteria | 5443 |
| 138 | Ga0075428_101280148 | 3300006844 | Bacteria | 771 |
| 139 | Ga0075430_100046455 | 3300006846 | Bacteria | 3667 |
| 140 | Ga0075431_100001075 | 3300006847 | Bacteria | 24442 |
| 141 | Ga0075429_100000334 | 3300006880 | Bacteria | 34171 |
| 142 | Ga0068865_100082918 | 3300006881 | Bacteria | 2306 |
| 143 | Ga0099823_1000009 | 3300006944 | Bacteria | 99451 |
| 144 | Ga0099826_10395219 | 3300006948 | Bacteria | 673 |
| 145 | Ga0075435_100611812 | 3300007076 | Bacteria | 945 |
| 146 | Ga0105251_10134733 | 3300009011 | Bacteria | 1119 |
| 147 | Ga0105244_10070577 | 3300009036 | Bacteria | 1743 |
| 148 | Ga0105244_10084035 | 3300009036 | Bacteria | 1572 |
| 149 | Ga0105244_10151978 | 3300009036 | Bacteria | 1109 |
| 150 | Ga0105250_10005683 | 3300009092 | Bacteria | 5568 |
| 151 | Ga0105250_10057962 | 3300009092 | Bacteria | 1554 |
| 152 | Ga0105240_10015147 | 3300009093 | Bacteria | 10494 |
| 153 | Ga0105240_10016001 | 3300009093 | Bacteria | 10168 |
| 154 | Ga0105240_10019692 | 3300009093 | Bacteria | 9014 |
| 155 | Ga0105240_11221325 | 3300009093 | Bacteria | 795 |
| 156 | Ga0111539_10247370 | 3300009094 | Bacteria | 2076 |
| 157 | Ga0114129_10014757 | 3300009147 | Bacteria | 11132 |
| 158 | Ga0114129_10468654 | 3300009147 | Bacteria | 1650 |
| 159 | Ga0105243_10097354 | 3300009148 | Bacteria | 2435 |
| 160 | Ga0105243_10972223 | 3300009148 | Bacteria | 850 |
| 161 | Ga0105241_11448946 | 3300009174 | Bacteria | 659 |
| 162 | Ga0105242_10036321 | 3300009176 | Bacteria | 3952 |
| 163 | Ga0105248_10191910 | 3300009177 | Bacteria | 2302 |
| 164 | Ga0105248_10417179 | 3300009177 | Bacteria | 1511 |
| 165 | Ga0105248_10820906 | 3300009177 | Bacteria | 1049 |
| 166 | Ga0105238_10014401 | 3300009551 | Bacteria | 7994 |
| 167 | Ga0105238_10352917 | 3300009551 | Bacteria | 1460 |
| 168 | Ga0105238_11685639 | 3300009551 | Bacteria | 665 |
| 169 | Ga0105249_10085952 | 3300009553 | Bacteria | 2932 |
| 170 | Ga0105239_10950159 | 3300010375 | Bacteria | 987 |
| 171 | Ga0105239_11169829 | 3300010375 | Bacteria | 886 |
| 172 | Ga0105239_11955748 | 3300010375 | Bacteria | 680 |
| 173 | Ga0105246_10189567 | 3300011119 | Bacteria | 1590 |
| 174 | Ga0157345_1000052 | 3300012498 | Bacteria | 25093 |
| 175 | Ga0157373_10024005 | 3300013100 | Bacteria | 4419 |
| 176 | Ga0157373_10031653 | 3300013100 | Bacteria | 3807 |
| 177 | Ga0157373_10047416 | 3300013100 | Bacteria | 3065 |
| 178 | Ga0157373_10272510 | 3300013100 | Bacteria | 1198 |
| 179 | Ga0157373_10635751 | 3300013100 | Bacteria | 778 |
| 180 | Ga0157371_10072136 | 3300013102 | Bacteria | 2445 |
| 181 | Ga0157371_11220883 | 3300013102 | Bacteria | 580 |
| 182 | Ga0157371_11377705 | 3300013102 | Bacteria | 547 |
| 183 | Ga0157370_10204812 | 3300013104 | Bacteria | 1830 |
| 184 | Ga0157369_10000310 | 3300013105 | Bacteria | 65383 |
| 185 | Ga0157369_10002441 | 3300013105 | Bacteria | 22331 |
| 186 | Ga0157369_10027082 | 3300013105 | Bacteria | 6356 |
| 187 | Ga0157369_10196894 | 3300013105 | Bacteria | 2116 |
| 188 | Ga0157369_10285813 | 3300013105 | Bacteria | 1717 |
| 189 | Ga0157369_10355770 | 3300013105 | Bacteria | 1521 |
| 190 | Ga0157369_10539991 | 3300013105 | Bacteria | 1205 |
| 191 | Ga0157369_11322390 | 3300013105 | Bacteria | 734 |
| 192 | Ga0157374_10200668 | 3300013296 | Bacteria | 1953 |
| 193 | Ga0163162_10003202 | 3300013306 | Bacteria | 15655 |
| 194 | Ga0163162_12241803 | 3300013306 | Bacteria | 627 |
| 195 | Ga0157372_10012201 | 3300013307 | Bacteria | 9153 |
| 196 | Ga0157372_10015919 | 3300013307 | Bacteria | 8065 |
| 197 | Ga0157372_10530283 | 3300013307 | Bacteria | 1373 |
| 198 | Ga0157372_11788816 | 3300013307 | Bacteria | 707 |
| 199 | Ga0157375_10610790 | 3300013308 | Bacteria | 1249 |
| 200 | Ga0163163_11439095 | 3300014325 | Bacteria | 751 |
| 201 | Ga0163163_11894911 | 3300014325 | Bacteria | 656 |
| 202 | Ga0157380_10074367 | 3300014326 | Bacteria | 2758 |
| 203 | Ga0157380_10130045 | 3300014326 | Bacteria | 2146 |
| 204 | Ga0157380_10452739 | 3300014326 | Bacteria | 1233 |
| 205 | Ga0157380_11702254 | 3300014326 | Bacteria | 688 |
| 206 | Ga0182008_10489313 | 3300014497 | Bacteria | 675 |
| 207 | Ga0182006_1001284 | 3300015261 | Bacteria | 15487 |
| 208 | Ga0182007_10120587 | 3300015262 | Bacteria | 877 |
| 209 | Ga0182005_1013156 | 3300015265 | Bacteria | 2329 |
| 210 | Ga0163161_10320220 | 3300017792 | Bacteria | 1226 |
| 211 | Ga0163161_10643660 | 3300017792 | Bacteria | 878 |
| 212 | Ga0209563_101280 | 3300025230 | Bacteria | 6865 |
| 213 | Ga0209148_1002133 | 3300025254 | Bacteria | 7386 |
| 214 | Ga0209129_1000080 | 3300025258 | Bacteria | 186416 |
| 215 | Ga0209455_1000467 | 3300025272 | Bacteria | 30363 |
| 216 | Ga0209673_1000037 | 3300025273 | Bacteria | 313804 |
| 217 | Ga0209673_1000117 | 3300025273 | Bacteria | 172081 |
| 218 | Ga0209673_1003273 | 3300025273 | Bacteria | 9771 |
| 219 | Ga0209673_1005570 | 3300025273 | Bacteria | 6296 |
| 220 | Ga0209673_1025818 | 3300025273 | Bacteria | 1945 |
| 221 | Ga0209025_1003312 | 3300025294 | Bacteria | 15491 |
| 222 | Ga0209025_1010330 | 3300025294 | Bacteria | 6338 |
| 223 | Ga0209025_1021478 | 3300025294 | Bacteria | 3474 |
| 224 | Ga0209025_1084115 | 3300025294 | Bacteria | 1067 |
| 225 | Ga0209564_1000581 | 3300025295 | Bacteria | 57912 |
| 226 | Ga0209564_1005748 | 3300025295 | Bacteria | 6924 |
| 227 | Ga0209564_1007900 | 3300025295 | Bacteria | 5375 |
| 228 | Ga0209758_1002963 | 3300025297 | Bacteria | 16285 |
| 229 | Ga0209758_1024155 | 3300025297 | Bacteria | 2719 |
| 230 | Ga0209050_1001983 | 3300025298 | Bacteria | 19191 |
| 231 | Ga0209050_1002868 | 3300025298 | Bacteria | 13648 |
| 232 | Ga0209256_1000109 | 3300025299 | Bacteria | 184928 |
| 233 | Ga0209256_1000656 | 3300025299 | Bacteria | 47104 |
| 234 | Ga0209256_1001157 | 3300025299 | Bacteria | 29830 |
| 235 | Ga0209256_1001879 | 3300025299 | Bacteria | 19359 |
| 236 | Ga0209256_1004966 | 3300025299 | Bacteria | 7968 |
| 237 | Ga0209256_1022913 | 3300025299 | Bacteria | 1878 |
| 238 | Ga0209256_1082178 | 3300025299 | Bacteria | 702 |
| 239 | Ga0207426_1002469 | 3300025302 | Bacteria | 11759 |
| 240 | Ga0207426_1076373 | 3300025302 | Bacteria | 920 |
| 241 | Ga0209051_1000845 | 3300025303 | Bacteria | 31409 |
| 242 | Ga0209051_1001940 | 3300025303 | Bacteria | 15964 |
| 243 | Ga0209051_1106521 | 3300025303 | Bacteria | 741 |
| 244 | Ga0209257_1000049 | 3300025304 | Bacteria | 441224 |
| 245 | Ga0209257_1001347 | 3300025304 | Bacteria | 29785 |
| 246 | Ga0207696_1000051 | 3300025711 | Bacteria | 276833 |
| 247 | Ga0207696_1010723 | 3300025711 | Bacteria | 3342 |
| 248 | Ga0207696_1076987 | 3300025711 | Bacteria | 924 |
| 249 | Ga0207655_1005367 | 3300025728 | Bacteria | 8733 |
| 250 | Ga0207655_1010748 | 3300025728 | Bacteria | 5523 |
| 251 | Ga0207655_1041915 | 3300025728 | Bacteria | 1956 |
| 252 | Ga0207655_1051374 | 3300025728 | Bacteria | 1667 |
| 253 | Ga0207655_1063013 | 3300025728 | Bacteria | 1423 |
| 254 | Ga0207713_1061247 | 3300025735 | Bacteria | 1433 |
| 255 | Ga0207713_1131662 | 3300025735 | Bacteria | 827 |
| 256 | Ga0207680_10119456 | 3300025903 | Bacteria | 1722 |
| 257 | Ga0207647_10018127 | 3300025904 | Bacteria | 4771 |
| 258 | Ga0207647_10277415 | 3300025904 | Bacteria | 957 |
| 259 | Ga0207647_10398338 | 3300025904 | Bacteria | 776 |
| 260 | Ga0207647_10768965 | 3300025904 | Bacteria | 520 |
| 261 | Ga0207705_10003365 | 3300025909 | Bacteria | 12153 |
| 262 | Ga0207705_10004105 | 3300025909 | Bacteria | 11042 |
| 263 | Ga0207705_10216753 | 3300025909 | Bacteria | 1453 |
| 264 | Ga0207684_10078604 | 3300025910 | Bacteria | 2806 |
| 265 | Ga0207654_11310197 | 3300025911 | Bacteria | 528 |
| 266 | Ga0207707_10100779 | 3300025912 | Bacteria | 2524 |
| 267 | Ga0207707_11004307 | 3300025912 | Bacteria | 684 |
| 268 | Ga0207695_10022781 | 3300025913 | Bacteria | 7096 |
| 269 | Ga0207695_10024131 | 3300025913 | Bacteria | 6851 |
| 270 | Ga0207660_10514934 | 3300025917 | Bacteria | 971 |
| 271 | Ga0207662_10357186 | 3300025918 | Bacteria | 982 |
| 272 | Ga0207657_10003486 | 3300025919 | Bacteria | 16785 |
| 273 | Ga0207657_10014426 | 3300025919 | Bacteria | 7718 |
| 274 | Ga0207657_10151371 | 3300025919 | Bacteria | 1889 |
| 275 | Ga0207657_10275109 | 3300025919 | Bacteria | 1338 |
| 276 | Ga0207657_11135466 | 3300025919 | Bacteria | 596 |
| 277 | Ga0207649_10135118 | 3300025920 | Bacteria | 1680 |
| 278 | Ga0207649_10237898 | 3300025920 | Bacteria | 1306 |
| 279 | Ga0207649_10243668 | 3300025920 | Bacteria | 1292 |
| 280 | Ga0207649_10927974 | 3300025920 | Bacteria | 683 |
| 281 | Ga0207652_10036592 | 3300025921 | Bacteria | 4150 |
| 282 | Ga0207652_10131672 | 3300025921 | Bacteria | 2231 |
| 283 | Ga0207652_10609517 | 3300025921 | Bacteria | 979 |
| 284 | Ga0207681_10343268 | 3300025923 | Bacteria | 1193 |
| 285 | Ga0207694_10001010 | 3300025924 | Bacteria | 24549 |
| 286 | Ga0207694_10009321 | 3300025924 | Bacteria | 7406 |
| 287 | Ga0207650_10060161 | 3300025925 | Bacteria | 2834 |
| 288 | Ga0207659_10713977 | 3300025926 | Bacteria | 859 |
| 289 | Ga0207700_10409874 | 3300025928 | Bacteria | 1189 |
| 290 | Ga0207644_10000978 | 3300025931 | Bacteria | 18260 |
| 291 | Ga0207644_10010905 | 3300025931 | Bacteria | 6003 |
| 292 | Ga0207644_10094876 | 3300025931 | Bacteria | 2230 |
| 293 | Ga0207690_10004900 | 3300025932 | Bacteria | 7896 |
| 294 | Ga0207690_10290452 | 3300025932 | Bacteria | 1276 |
| 295 | Ga0207706_10054320 | 3300025933 | Bacteria | 3535 |
| 296 | Ga0207706_10299829 | 3300025933 | Bacteria | 1400 |
| 297 | Ga0207706_10708198 | 3300025933 | Bacteria | 860 |
| 298 | Ga0207706_11348630 | 3300025933 | Bacteria | 588 |
| 299 | Ga0207686_10104538 | 3300025934 | Bacteria | 1897 |
| 300 | Ga0207709_10023143 | 3300025935 | Bacteria | 3532 |
| 301 | Ga0207670_10142129 | 3300025936 | Bacteria | 1771 |
| 302 | Ga0207704_10536042 | 3300025938 | Bacteria | 949 |
| 303 | Ga0207665_11252541 | 3300025939 | Bacteria | 592 |
| 304 | Ga0207691_10887847 | 3300025940 | Bacteria | 747 |
| 305 | Ga0207711_10205223 | 3300025941 | Bacteria | 1799 |
| 306 | Ga0207689_10031290 | 3300025942 | Bacteria | 4432 |
| 307 | Ga0207689_10849296 | 3300025942 | Bacteria | 770 |
| 308 | Ga0207689_11379721 | 3300025942 | Bacteria | 591 |
| 309 | Ga0207661_10490448 | 3300025944 | Bacteria | 1122 |
| 310 | Ga0207661_10713737 | 3300025944 | Bacteria | 922 |
| 311 | Ga0207679_10079279 | 3300025945 | Bacteria | 2504 |
| 312 | Ga0207679_10124489 | 3300025945 | Bacteria | 2058 |
| 313 | Ga0207679_10260037 | 3300025945 | Bacteria | 1480 |
| 314 | Ga0207679_10368066 | 3300025945 | Bacteria | 1257 |
| 315 | Ga0207679_10940376 | 3300025945 | Bacteria | 791 |
| 316 | Ga0207667_10007513 | 3300025949 | Bacteria | 13084 |
| 317 | Ga0207667_10936219 | 3300025949 | Bacteria | 856 |
| 318 | Ga0207667_11030892 | 3300025949 | Bacteria | 809 |
| 319 | Ga0207651_10027541 | 3300025960 | Bacteria | 3571 |
| 320 | Ga0207651_10570638 | 3300025960 | Bacteria | 986 |
| 321 | Ga0207712_10121493 | 3300025961 | Bacteria | 1977 |
| 322 | Ga0207712_10617420 | 3300025961 | Bacteria | 939 |
| 323 | Ga0207712_12003517 | 3300025961 | Bacteria | 518 |
| 324 | Ga0207668_10275753 | 3300025972 | Bacteria | 1377 |
| 325 | Ga0207668_10850331 | 3300025972 | Bacteria | 810 |
| 326 | Ga0207668_10945240 | 3300025972 | Bacteria | 769 |
| 327 | Ga0207668_11178046 | 3300025972 | Bacteria | 688 |
| 328 | Ga0207640_10000633 | 3300025981 | Bacteria | 20639 |
| 329 | Ga0207640_10028998 | 3300025981 | Bacteria | 3391 |
| 330 | Ga0207658_10137548 | 3300025986 | Bacteria | 1972 |
| 331 | Ga0207658_11099536 | 3300025986 | Bacteria | 726 |
| 332 | Ga0207658_11161856 | 3300025986 | Bacteria | 705 |
| 333 | Ga0207677_10568772 | 3300026023 | Bacteria | 990 |
| 334 | Ga0207703_10220470 | 3300026035 | Bacteria | 1696 |
| 335 | Ga0207639_10000181 | 3300026041 | Bacteria | 49444 |
| 336 | Ga0207639_10118646 | 3300026041 | Bacteria | 2170 |
| 337 | Ga0207639_12190506 | 3300026041 | Bacteria | 514 |
| 338 | Ga0207678_10191150 | 3300026067 | Bacteria | 1749 |
| 339 | Ga0207702_10047197 | 3300026078 | Bacteria | 3628 |
| 340 | Ga0207702_10439494 | 3300026078 | Bacteria | 1264 |
| 341 | Ga0207702_10542610 | 3300026078 | Bacteria | 1137 |
| 342 | Ga0207641_10055494 | 3300026088 | Bacteria | 3364 |
| 343 | Ga0207641_10070353 | 3300026088 | Bacteria | 3006 |
| 344 | Ga0207641_11081325 | 3300026088 | Bacteria | 800 |
| 345 | Ga0207676_10007783 | 3300026095 | Bacteria | 7620 |
| 346 | Ga0207674_10016271 | 3300026116 | Bacteria | 8146 |
| 347 | Ga0207674_10040272 | 3300026116 | Bacteria | 4841 |
| 348 | Ga0207674_10621483 | 3300026116 | Bacteria | 1043 |
| 349 | Ga0207675_100268274 | 3300026118 | Bacteria | 1656 |
| 350 | Ga0207683_10009677 | 3300026121 | Bacteria | 8216 |
| 351 | Ga0207698_10442013 | 3300026142 | Bacteria | 1253 |
| 352 | Ga0207698_10484437 | 3300026142 | Bacteria | 1200 |
| 353 | Ga0209389_1014263 | 3300027296 | Bacteria | 7218 |
| 354 | Ga0209371_1010320 | 3300027312 | Bacteria | 2886 |
| 355 | Ga0209969_1027187 | 3300027360 | Bacteria | 867 |
| 356 | Ga0209813_10415125 | 3300027866 | Bacteria | 545 |
| 357 | Ga0207428_10003328 | 3300027907 | Bacteria | 15627 |
| 358 | Ga0268266_10843802 | 3300028379 | Bacteria | 885 |
| 359 | Ga0268265_10019146 | 3300028380 | Bacteria | 4752 |
| 360 | Ga0268265_10046894 | 3300028380 | Bacteria | 3233 |
| 361 | Ga0268265_10982329 | 3300028380 | Bacteria | 833 |
| 362 | Ga0307515_10527058 | 3300028794 | Bacteria | 791 |
| 363 | Ga0307515_10745371 | 3300028794 | Bacteria | 598 |
| 364 | Ga0268256_1011069 | 3300030500 | Bacteria | 2886 |
| 365 | Ga0314311_1050680 | 3300030733 | Bacteria | 568 |
| 366 | Ga0265325_10171569 | 3300031241 | Bacteria | 1015 |
| 367 | Ga0307513_10241022 | 3300031456 | Bacteria | 1613 |
| 368 | Ga0307509_10052108 | 3300031507 | Bacteria | 4370 |
| 369 | Ga0307509_10692791 | 3300031507 | Bacteria | 686 |
| 370 | Ga0307408_100133083 | 3300031548 | Bacteria | 1942 |
| 371 | Ga0307408_100536519 | 3300031548 | Bacteria | 1030 |
| 372 | Ga0307408_101184443 | 3300031548 | Bacteria | 712 |
| 373 | Ga0307508_10403104 | 3300031616 | Bacteria | 959 |
| 374 | Ga0316579_10313441 | 3300031691 | Bacteria | 759 |
| 375 | Ga0316576_10355938 | 3300031727 | Bacteria | 1089 |
| 376 | Ga0307516_10431512 | 3300031730 | Bacteria | 975 |
| 377 | Ga0307516_10590278 | 3300031730 | Bacteria | 765 |
| 378 | Ga0307516_10963301 | 3300031730 | Bacteria | 523 |
| 379 | Ga0307405_10365195 | 3300031731 | Bacteria | 1118 |
| 380 | Ga0307405_11375511 | 3300031731 | Bacteria | 616 |
| 381 | Ga0307405_11659317 | 3300031731 | Bacteria | 565 |
| 382 | Ga0307413_10004740 | 3300031824 | Bacteria | 5970 |
| 383 | Ga0307413_10011197 | 3300031824 | Bacteria | 4396 |
| 384 | Ga0307413_10567085 | 3300031824 | Bacteria | 924 |
| 385 | Ga0307410_10063738 | 3300031852 | Bacteria | 2529 |
| 386 | Ga0307410_10414799 | 3300031852 | Bacteria | 1091 |
| 387 | Ga0307410_12030807 | 3300031852 | Bacteria | 513 |
| 388 | Ga0307406_10419966 | 3300031901 | Bacteria | 1065 |
| 389 | Ga0307406_10430194 | 3300031901 | Bacteria | 1054 |
| 390 | Ga0307406_10487264 | 3300031901 | Bacteria | 997 |
| 391 | Ga0307406_10918431 | 3300031901 | Bacteria | 746 |
| 392 | Ga0307407_10002665 | 3300031903 | Bacteria | 7067 |
| 393 | Ga0307407_10734802 | 3300031903 | Bacteria | 746 |
| 394 | Ga0307412_10014518 | 3300031911 | Bacteria | 4646 |
| 395 | Ga0307412_10040110 | 3300031911 | Bacteria | 3028 |
| 396 | Ga0307412_10100196 | 3300031911 | Bacteria | 2047 |
| 397 | Ga0307412_11227467 | 3300031911 | Bacteria | 672 |
| 398 | Ga0307409_100000590 | 3300031995 | Bacteria | 15843 |
| 399 | Ga0307416_100073768 | 3300032002 | Bacteria | 2847 |
| 400 | Ga0307416_100184069 | 3300032002 | Bacteria | 1961 |
| 401 | Ga0307416_102102536 | 3300032002 | Bacteria | 666 |
| 402 | Ga0307414_10055855 | 3300032004 | Bacteria | 2766 |
| 403 | Ga0307414_10102932 | 3300032004 | Bacteria | 2153 |
| 404 | Ga0307414_10307675 | 3300032004 | Bacteria | 1344 |
| 405 | Ga0307414_10366947 | 3300032004 | Bacteria | 1241 |
| 406 | Ga0307414_10427082 | 3300032004 | Bacteria | 1157 |
| 407 | Ga0307414_10842476 | 3300032004 | Bacteria | 838 |
| 408 | Ga0307414_10959442 | 3300032004 | Bacteria | 786 |
| 409 | Ga0307414_11201480 | 3300032004 | Bacteria | 702 |
| 410 | Ga0307411_10004233 | 3300032005 | Bacteria | 6828 |
| 411 | Ga0307411_10163473 | 3300032005 | Bacteria | 1670 |
| 412 | Ga0307411_11662145 | 3300032005 | Bacteria | 590 |
| 413 | Ga0307415_100003944 | 3300032126 | Bacteria | 7625 |
| 414 | Ga0307415_100137096 | 3300032126 | Bacteria | 1863 |
| 415 | Ga0307415_100177228 | 3300032126 | Bacteria | 1669 |
| 416 | Ga0307415_100276214 | 3300032126 | Bacteria | 1379 |
| 417 | Ga0307510_10001323 | 3300033180 | Bacteria | 27015 |
| 418 | Ga0307510_10550295 | 3300033180 | Bacteria | 600 |
| 419 | Ga0373930_0047838 | 3300034816 | Bacteria | 926 |
| 420 | Ga0373934_0061583 | 3300035086 | Bacteria | 1495 |
| 421 | Ga0373957_0287446 | 3300035120 | Bacteria | 696 |
| 422 | Ga0316582_0188785 | 3300036647 | Bacteria | 1404 |
| 423 | Ga0395899_0044169 | 3300037312 | Bacteria | 3321 |
| 424 | Ga0395899_0287324 | 3300037312 | Bacteria | 1117 |
| 425 | Ga0395899_0304654 | 3300037312 | Bacteria | 1077 |
| 426 | Ga0395900_0067916 | 3300037418 | Bacteria | 3662 |
| 427 | Ga0395900_0157309 | 3300037418 | Bacteria | 2320 |
| 428 | Ga0395900_0166800 | 3300037418 | Bacteria | 2244 |
| 429 | Ga0395900_0853211 | 3300037418 | Bacteria | 836 |
| 430 | Ga0395900_1083263 | 3300037418 | Bacteria | 719 |
| 431 | Ga0395900_1599776 | 3300037418 | Bacteria | 563 |
| 432 | Ga0395898_0027920 | 3300037466 | Bacteria | 5660 |
| 433 | Ga0395898_0078844 | 3300037466 | Bacteria | 3177 |
| 434 | Ga0395898_0079979 | 3300037466 | Bacteria | 3152 |
| 435 | Ga0395898_0539289 | 3300037466 | Bacteria | 1108 |
| 436 | Ga0395898_0593232 | 3300037466 | Bacteria | 1050 |
| 437 | Ga0395905_0002010 | 3300037471 | Bacteria | 23225 |
| 438 | Ga0395905_0013726 | 3300037471 | Bacteria | 7754 |
| 439 | Ga0395905_0146548 | 3300037471 | Bacteria | 2221 |
| 440 | Ga0395905_0261726 | 3300037471 | Bacteria | 1615 |
| 441 | Ga0395905_0417338 | 3300037471 | Bacteria | 1238 |
| 442 | Ga0395905_0770138 | 3300037471 | Bacteria | 865 |
| 443 | Ga0395905_0853427 | 3300037471 | Bacteria | 814 |
| 444 | Ga0395905_0866608 | 3300037471 | Bacteria | 806 |
| 445 | Ga0395905_1314548 | 3300037471 | Bacteria | 627 |
| 446 | Ga0395905_1492189 | 3300037471 | Bacteria | 580 |
| 447 | Ga0395905_1619365 | 3300037471 | Bacteria | 552 |
| 448 | Ga0395901_0025775 | 3300038443 | Bacteria | 6036 |
| 449 | Ga0395901_0051769 | 3300038443 | Bacteria | 4268 |
| 450 | Ga0395901_0298965 | 3300038443 | Bacteria | 1669 |
| 451 | Ga0395901_1777365 | 3300038443 | Bacteria | 566 |
| 452 | Ga0436363_1121625 | 3300039450 | Bacteria | 665 |
| 453 | Ga0439447_093068 | 3300041407 | Bacteria | 693 |
| 454 | Ga0439461_0001777 | 3300041410 | Bacteria | 3374 |
| 455 | Ga0439465_0000403 | 3300041413 | Bacteria | 12547 |
| 456 | Ga0451791_1665661 | 3300041451 | Bacteria | 4918 |
| 457 | Ga0451798_0608123 | 3300041458 | Bacteria | 776 |
| 458 | Ga0451800_1610971 | 3300041459 | Bacteria | 817 |
| 459 | Ga0451807_0510360 | 3300041486 | Bacteria | 3308 |
| 460 | Ga0439445_0051067 | 3300042004 | Bacteria | 1117 |
| 461 | Ga0439445_0195483 | 3300042004 | Bacteria | 596 |
| 462 | Ga0439432_007592 | 3300042006 | Bacteria | 3833 |
| 463 | Ga0439449_0377756 | 3300042007 | Bacteria | 537 |
| 464 | Ga0439455_0026513 | 3300042012 | Bacteria | 1415 |
| 465 | Ga0439455_0055098 | 3300042012 | Bacteria | 1045 |
| 466 | Ga0439455_0206663 | 3300042012 | Bacteria | 569 |
| 467 | Ga0439457_063186 | 3300042014 | Bacteria | 840 |
| 468 | Ga0450914_000414 | 3300042118 | Bacteria | 1959 |
| 469 | Ga0450914_022173 | 3300042118 | Bacteria | 715 |
| 470 | Ga0450897_040572 | 3300042128 | Bacteria | 547 |
| 471 | Ga0450894_026049 | 3300042131 | Bacteria | 802 |
| 472 | Ga0450905_000656 | 3300042142 | Bacteria | 4255 |
| 473 | Ga0450889_000037 | 3300042144 | Bacteria | 11669 |
| 474 | Ga0450889_029751 | 3300042144 | Bacteria | 635 |
| 475 | Ga0450906_066656 | 3300042145 | Bacteria | 643 |
| 476 | Ga0450907_035050 | 3300042146 | Bacteria | 856 |
| 477 | Ga0439458_0004015 | 3300042157 | Bacteria | 3398 |
| 478 | Ga0450909_042490 | 3300042185 | Bacteria | 701 |
| 479 | Ga0439464_0314947 | 3300042439 | Bacteria | 513 |
| 480 | Ga0450916_049155 | 3300042530 | Bacteria | 661 |
| 481 | Ga0450918_013478 | 3300042531 | Bacteria | 1422 |
| 482 | Ga0450893_0013993 | 3300042532 | Bacteria | 1341 |
| 483 | Ga0466969_0086865 | 3300044656 | Bacteria | 1485 |
| 484 | Ga0466966_0008609 | 3300044684 | Bacteria | 6754 |
| 485 | Ga0466961_0001441 | 3300044693 | Bacteria | 14761 |
| 486 | Ga0466963_0040538 | 3300044694 | Bacteria | 3052 |
| 487 | Ga0466963_0191139 | 3300044694 | Bacteria | 1430 |
| 488 | Ga0466963_0246078 | 3300044694 | Bacteria | 1254 |
| 489 | Ga0466964_0282825 | 3300044706 | Bacteria | 830 |
| 490 | Ga0466971_0003172 | 3300044719 | Bacteria | 7011 |
| 491 | Ga0466971_0026306 | 3300044719 | Bacteria | 2599 |
| 492 | Ga0466971_0119740 | 3300044719 | Bacteria | 1218 |
| 493 | Ga0466970_0191784 | 3300044765 | Bacteria | 1135 |
| 494 | Ga0466957_0012308 | 3300044842 | Bacteria | 4953 |
| 495 | Ga0466957_0090691 | 3300044842 | Bacteria | 1914 |
| 496 | Ga0466957_0588157 | 3300044842 | Bacteria | 778 |
| 497 | Ga0466960_0029259 | 3300044901 | Bacteria | 2527 |
| 498 | Ga0466959_0004725 | 3300045049 | Bacteria | 9175 |
| 499 | Ga0466959_0018173 | 3300045049 | Bacteria | 5160 |
| 500 | Ga0451576_0000707 | 3300045051 | Bacteria | 67610 |
| 501 | Ga0466958_0000157 | 3300045836 | Bacteria | 23916 |
| 502 | Ga0466967_0015120 | 3300045976 | Bacteria | 6041 |
| 503 | Ga0466967_0155394 | 3300045976 | Bacteria | 2142 |
| 504 | Ga0495617_009662 | 3300046452 | Bacteria | 3308 |
| 505 | Ga0495617_044824 | 3300046452 | Bacteria | 1475 |
| 506 | Ga0495617_046768 | 3300046452 | Bacteria | 1441 |
| 507 | Ga0495617_199847 | 3300046452 | Bacteria | 625 |
| 508 | Ga0495627_000695 | 3300046453 | Bacteria | 25747 |
| 509 | Ga0495627_001370 | 3300046453 | Bacteria | 14538 |
| 510 | Ga0495627_002456 | 3300046453 | Bacteria | 8921 |
| 511 | Ga0495627_192178 | 3300046453 | Bacteria | 563 |
| 512 | Ga0495590_0014085 | 3300046457 | Bacteria | 2927 |
| 513 | Ga0495590_0032456 | 3300046457 | Bacteria | 1826 |
| 514 | Ga0495591_000662 | 3300046458 | Bacteria | 25480 |
| 515 | Ga0495591_004084 | 3300046458 | Bacteria | 7269 |
| 516 | Ga0495591_017663 | 3300046458 | Bacteria | 2441 |
| 517 | Ga0495591_019643 | 3300046458 | Bacteria | 2255 |
| 518 | Ga0495591_045323 | 3300046458 | Bacteria | 1226 |
| 519 | Ga0495591_046392 | 3300046458 | Bacteria | 1207 |
| 520 | Ga0495591_092953 | 3300046458 | Bacteria | 755 |
| 521 | Ga0495629_0193716 | 3300046459 | Bacteria | 1406 |
| 522 | Ga0495638_0001957 | 3300046460 | Bacteria | 17643 |
| 523 | Ga0495638_0025148 | 3300046460 | Bacteria | 3874 |
| 524 | Ga0495638_0052888 | 3300046460 | Bacteria | 2528 |
| 525 | Ga0495638_0562359 | 3300046460 | Bacteria | 565 |
| 526 | Ga0495653_0002927 | 3300046463 | Bacteria | 13659 |
| 527 | Ga0495653_0024069 | 3300046463 | Bacteria | 4912 |
| 528 | Ga0495653_0089532 | 3300046463 | Bacteria | 2254 |
| 529 | Ga0495653_0138611 | 3300046463 | Bacteria | 1713 |
| 530 | Ga0495650_0020843 | 3300046471 | Bacteria | 3185 |
| 531 | Ga0495650_0122477 | 3300046471 | Bacteria | 956 |
| 532 | Ga0495650_0131493 | 3300046471 | Bacteria | 912 |
| 533 | Ga0495650_0241639 | 3300046471 | Bacteria | 616 |
| 534 | Ga0495650_0245935 | 3300046471 | Bacteria | 609 |
| 535 | Ga0495650_0335613 | 3300046471 | Bacteria | 501 |
| 536 | Ga0495605_0001168 | 3300046474 | Bacteria | 17435 |
| 537 | Ga0495605_0038614 | 3300046474 | Bacteria | 2395 |
| 538 | Ga0495605_0127706 | 3300046474 | Bacteria | 1148 |
| 539 | Ga0495605_0268359 | 3300046474 | Bacteria | 727 |
| 540 | Ga0495639_0679438 | 3300046475 | Bacteria | 531 |
| 541 | Ga0495584_0014450 | 3300046491 | Bacteria | 4022 |
| 542 | Ga0495584_0105950 | 3300046491 | Bacteria | 1421 |
| 543 | Ga0495585_0002349 | 3300046492 | Bacteria | 13593 |
| 544 | Ga0495585_0004774 | 3300046492 | Bacteria | 8719 |
| 545 | Ga0495585_0036146 | 3300046492 | Bacteria | 2788 |
| 546 | Ga0495585_0052160 | 3300046492 | Bacteria | 2264 |
| 547 | Ga0495596_0003136 | 3300046500 | Bacteria | 8522 |
| 548 | Ga0495596_0029573 | 3300046500 | Bacteria | 2195 |
| 549 | Ga0495596_0039132 | 3300046500 | Bacteria | 1873 |
| 550 | Ga0495607_0006304 | 3300046501 | Bacteria | 8359 |
| 551 | Ga0495607_0020367 | 3300046501 | Bacteria | 4194 |
| 552 | Ga0495607_0040518 | 3300046501 | Bacteria | 2772 |
| 553 | Ga0495607_0061578 | 3300046501 | Bacteria | 2132 |
| 554 | Ga0495607_0068256 | 3300046501 | Bacteria | 1994 |
| 555 | Ga0495607_0128439 | 3300046501 | Bacteria | 1322 |
| 556 | Ga0495607_0197659 | 3300046501 | Bacteria | 997 |
| 557 | Ga0495583_0006509 | 3300046506 | Bacteria | 7622 |
| 558 | Ga0495583_0010574 | 3300046506 | Bacteria | 5367 |
| 559 | Ga0495583_0167124 | 3300046506 | Bacteria | 905 |
| 560 | Ga0495606_0001321 | 3300046507 | Bacteria | 33870 |
| 561 | Ga0495606_0001801 | 3300046507 | Bacteria | 27281 |
| 562 | Ga0495606_0003948 | 3300046507 | Bacteria | 15242 |
| 563 | Ga0495606_0123786 | 3300046507 | Bacteria | 1544 |
| 564 | Ga0495606_0172930 | 3300046507 | Bacteria | 1251 |
| 565 | Ga0495606_0419400 | 3300046507 | Bacteria | 692 |
| 566 | Ga0495610_0001087 | 3300046512 | Bacteria | 24865 |
| 567 | Ga0495610_0005074 | 3300046512 | Bacteria | 9487 |
| 568 | Ga0495610_0010564 | 3300046512 | Bacteria | 5725 |
| 569 | Ga0495610_0080385 | 3300046512 | Bacteria | 1499 |
| 570 | Ga0495616_0000042 | 3300046513 | Bacteria | 120923 |
| 571 | Ga0495616_0000704 | 3300046513 | Bacteria | 24772 |
| 572 | Ga0495616_0001304 | 3300046513 | Bacteria | 17440 |
| 573 | Ga0495616_0002303 | 3300046513 | Bacteria | 12771 |
| 574 | Ga0495616_0060078 | 3300046513 | Bacteria | 1868 |
| 575 | Ga0495616_0107084 | 3300046513 | Bacteria | 1303 |
| 576 | Ga0495616_0182289 | 3300046513 | Bacteria | 932 |
| 577 | Ga0495616_0222700 | 3300046513 | Bacteria | 821 |
| 578 | Ga0495616_0226938 | 3300046513 | Bacteria | 811 |
| 579 | Ga0495620_0000532 | 3300046515 | Bacteria | 24382 |
| 580 | Ga0495620_0032112 | 3300046515 | Bacteria | 2396 |
| 581 | Ga0495620_0242797 | 3300046515 | Bacteria | 687 |
| 582 | Ga0495631_0000229 | 3300046518 | Bacteria | 38438 |
| 583 | Ga0495631_0000547 | 3300046518 | Bacteria | 25286 |
| 584 | Ga0495631_0182701 | 3300046518 | Bacteria | 898 |
| 585 | Ga0495632_0005221 | 3300046519 | Bacteria | 8656 |
| 586 | Ga0495632_0006967 | 3300046519 | Bacteria | 7175 |
| 587 | Ga0495632_0010870 | 3300046519 | Bacteria | 5353 |
| 588 | Ga0495632_0013653 | 3300046519 | Bacteria | 4623 |
| 589 | Ga0495632_0295697 | 3300046519 | Bacteria | 719 |
| 590 | Ga0495632_0377121 | 3300046519 | Bacteria | 621 |
| 591 | Ga0495637_0000839 | 3300046520 | Bacteria | 20292 |
| 592 | Ga0495637_0001641 | 3300046520 | Bacteria | 12936 |
| 593 | Ga0495637_0002034 | 3300046520 | Bacteria | 11401 |
| 594 | Ga0495637_0008706 | 3300046520 | Bacteria | 4975 |
| 595 | Ga0495637_0021867 | 3300046520 | Bacteria | 2925 |
| 596 | Ga0495637_0045936 | 3300046520 | Bacteria | 1849 |
| 597 | Ga0495643_0004653 | 3300046522 | Bacteria | 9531 |
| 598 | Ga0495643_0036166 | 3300046522 | Bacteria | 2714 |
| 599 | Ga0495643_0037736 | 3300046522 | Bacteria | 2648 |
| 600 | Ga0495643_0066324 | 3300046522 | Bacteria | 1904 |
| 601 | Ga0495643_0070683 | 3300046522 | Bacteria | 1832 |
| 602 | Ga0495643_0288195 | 3300046522 | Bacteria | 753 |
| 603 | Ga0495644_0051968 | 3300046523 | Bacteria | 1538 |
| 604 | Ga0495648_0009698 | 3300046524 | Bacteria | 7420 |
| 605 | Ga0495648_0068137 | 3300046524 | Bacteria | 2078 |
| 606 | Ga0495648_0122201 | 3300046524 | Bacteria | 1398 |
| 607 | Ga0495648_0130273 | 3300046524 | Bacteria | 1338 |
| 608 | Ga0495648_0335667 | 3300046524 | Bacteria | 695 |
| 609 | Ga0495648_0425661 | 3300046524 | Bacteria | 587 |
| 610 | Ga0495666_0010713 | 3300046526 | Bacteria | 4573 |
| 611 | Ga0495642_0011651 | 3300046528 | Bacteria | 3384 |
| 612 | Ga0495654_0000444 | 3300046530 | Bacteria | 35120 |
| 613 | Ga0495654_0020054 | 3300046530 | Bacteria | 3489 |
| 614 | Ga0495654_0069039 | 3300046530 | Bacteria | 1678 |
| 615 | Ga0495654_0074879 | 3300046530 | Bacteria | 1598 |
| 616 | Ga0495654_0321522 | 3300046530 | Bacteria | 627 |
| 617 | Ga0495587_0053104 | 3300046536 | Bacteria | 2390 |
| 618 | Ga0495609_0001751 | 3300046538 | Bacteria | 13969 |
| 619 | Ga0495609_0004084 | 3300046538 | Bacteria | 8130 |
| 620 | Ga0495609_0021618 | 3300046538 | Bacteria | 2969 |
| 621 | Ga0495609_0036842 | 3300046538 | Bacteria | 2208 |
| 622 | Ga0495609_0075316 | 3300046538 | Bacteria | 1479 |
| 623 | Ga0495609_0134296 | 3300046538 | Bacteria | 1058 |
| 624 | Ga0495597_0002633 | 3300046542 | Bacteria | 11160 |
| 625 | Ga0495597_0003247 | 3300046542 | Bacteria | 9651 |
| 626 | Ga0495597_0232386 | 3300046542 | Bacteria | 729 |
| 627 | Ga0495645_0032397 | 3300046543 | Bacteria | 3813 |
| 628 | Ga0495622_0000537 | 3300046557 | Bacteria | 22795 |
| 629 | Ga0495622_0039129 | 3300046557 | Bacteria | 2208 |
| 630 | Ga0495622_0168502 | 3300046557 | Bacteria | 985 |
| 631 | Ga0495622_0226396 | 3300046557 | Bacteria | 827 |
| 632 | Ga0495633_0000867 | 3300046558 | Bacteria | 26255 |
| 633 | Ga0495633_0004843 | 3300046558 | Bacteria | 8427 |
| 634 | Ga0495633_0091052 | 3300046558 | Bacteria | 1418 |
| 635 | Ga0495668_0000033 | 3300046616 | Bacteria | 254277 |
| 636 | Ga0495668_0002790 | 3300046616 | Bacteria | 13912 |
| 637 | Ga0495668_0002819 | 3300046616 | Bacteria | 13819 |
| 638 | Ga0495668_0113588 | 3300046616 | Bacteria | 1481 |
| 639 | Ga0495668_0160963 | 3300046616 | Bacteria | 1229 |
| 640 | Ga0495668_0254387 | 3300046616 | Bacteria | 961 |
| 641 | Ga0495634_0025019 | 3300046642 | Bacteria | 4184 |
| 642 | Ga0495611_0000468 | 3300046648 | Bacteria | 24110 |
| 643 | Ga0495611_0006667 | 3300046648 | Bacteria | 4913 |
| 644 | Ga0495611_0084121 | 3300046648 | Bacteria | 1466 |
| 645 | Ga0495611_0347910 | 3300046648 | Bacteria | 680 |
| 646 | Ga0495625_0000014 | 3300046660 | Bacteria | 323486 |
| 647 | Ga0495625_0000032 | 3300046660 | Bacteria | 233135 |
| 648 | Ga0495625_0006003 | 3300046660 | Bacteria | 10914 |
| 649 | Ga0495625_0016634 | 3300046660 | Bacteria | 5780 |
| 650 | Ga0495625_0032684 | 3300046660 | Bacteria | 3855 |
| 651 | Ga0495625_0059700 | 3300046660 | Bacteria | 2704 |
| 652 | Ga0495625_0120424 | 3300046660 | Bacteria | 1786 |
| 653 | Ga0495625_0657696 | 3300046660 | Bacteria | 623 |
| 654 | Ga0495625_0691110 | 3300046660 | Bacteria | 603 |
| 655 | Ga0495625_0820312 | 3300046660 | Bacteria | 539 |
| 656 | Ga0495661_0028015 | 3300046665 | Bacteria | 3612 |
| 657 | Ga0495661_0067472 | 3300046665 | Bacteria | 2101 |
| 658 | Ga0495661_0071801 | 3300046665 | Bacteria | 2021 |
| 659 | Ga0495661_0184477 | 3300046665 | Bacteria | 1103 |
| 660 | Ga0495661_0515255 | 3300046665 | Bacteria | 569 |
| 661 | Ga0495588_0090822 | 3300046674 | Bacteria | 1600 |
| 662 | Ga0495646_0081794 | 3300046680 | Bacteria | 1880 |
| 663 | Ga0495669_0098426 | 3300046684 | Bacteria | 1357 |
| 664 | Ga0495613_0010857 | 3300046689 | Bacteria | 6757 |
| 665 | Ga0495624_0001286 | 3300046690 | Bacteria | 19787 |
| 666 | Ga0495624_0221077 | 3300046690 | Bacteria | 1148 |
| 667 | Ga0495670_0000868 | 3300046691 | Bacteria | 14664 |
| 668 | Ga0495670_0064032 | 3300046691 | Bacteria | 1852 |
| 669 | Ga0495671_0012713 | 3300046692 | Bacteria | 4587 |
| 670 | Ga0495671_0015611 | 3300046692 | Bacteria | 4065 |
| 671 | Ga0495671_0036514 | 3300046692 | Bacteria | 2488 |
| 672 | Ga0495671_0040326 | 3300046692 | Bacteria | 2354 |
| 673 | Ga0495671_0041873 | 3300046692 | Bacteria | 2304 |
| 674 | Ga0495671_0125879 | 3300046692 | Bacteria | 1249 |
| 675 | Ga0495649_0005359 | 3300046694 | Bacteria | 8178 |
| 676 | Ga0495649_0008701 | 3300046694 | Bacteria | 6090 |
| 677 | Ga0495649_0011931 | 3300046694 | Bacteria | 5078 |
| 678 | Ga0495649_0014874 | 3300046694 | Bacteria | 4446 |
| 679 | Ga0495649_0025203 | 3300046694 | Bacteria | 3312 |
| 680 | Ga0495649_0029499 | 3300046694 | Bacteria | 3033 |
| 681 | Ga0495649_0039808 | 3300046694 | Bacteria | 2577 |
| 682 | Ga0495649_0189302 | 3300046694 | Bacteria | 1071 |
| 683 | Ga0495589_0002576 | 3300046794 | Bacteria | 10080 |
| 684 | Ga0495589_0046180 | 3300046794 | Bacteria | 2163 |
| 685 | Ga0495589_0064063 | 3300046794 | Bacteria | 1802 |
| 686 | Ga0495600_0041644 | 3300046809 | Bacteria | 2993 |
| 687 | Ga0495660_0001455 | 3300046810 | Bacteria | 16179 |
| 688 | Ga0495660_0008129 | 3300046810 | Bacteria | 6160 |
| 689 | Ga0495660_0016083 | 3300046810 | Bacteria | 4315 |
| 690 | Ga0495660_0022703 | 3300046810 | Bacteria | 3580 |
| 691 | Ga0495660_0083573 | 3300046810 | Bacteria | 1670 |
| 692 | Ga0495660_0104049 | 3300046810 | Bacteria | 1457 |
| 693 | Ga0495660_0194128 | 3300046810 | Bacteria | 973 |
| 694 | Ga0495660_0341172 | 3300046810 | Bacteria | 668 |
| 695 | Ga0495672_0003388 | 3300047320 | Bacteria | 13709 |
| 696 | Ga0495672_0025786 | 3300047320 | Bacteria | 3757 |
| 697 | Ga0495672_0184653 | 3300047320 | Bacteria | 1053 |
| 698 | Ga0495676_0022364 | 3300047321 | Bacteria | 5501 |
| 699 | Ga0495680_0021555 | 3300047322 | Bacteria | 5392 |
| 700 | Ga0495683_0012750 | 3300047323 | Bacteria | 4411 |
| 701 | Ga0495683_0035832 | 3300047323 | Bacteria | 2521 |
| 702 | Ga0495683_0039231 | 3300047323 | Bacteria | 2394 |
| 703 | Ga0495683_0067207 | 3300047323 | Bacteria | 1765 |
| 704 | Ga0495683_0141858 | 3300047323 | Bacteria | 1125 |
| 705 | Ga0495687_003196 | 3300047443 | Bacteria | 12157 |
| 706 | Ga0495687_004060 | 3300047443 | Bacteria | 10140 |
| 707 | Ga0495677_0029578 | 3300047445 | Bacteria | 1992 |
| 708 | Ga0495679_003112 | 3300047446 | Bacteria | 8123 |
| 709 | Ga0495679_003907 | 3300047446 | Bacteria | 7047 |
| 710 | Ga0495679_008516 | 3300047446 | Bacteria | 4161 |
| 711 | Ga0495679_074448 | 3300047446 | Bacteria | 972 |
| 712 | Ga0495685_003890 | 3300047447 | Bacteria | 4794 |
| 713 | Ga0495673_0000753 | 3300047469 | Bacteria | 30736 |
| 714 | Ga0495673_0027210 | 3300047469 | Bacteria | 2724 |
| 715 | Ga0495673_0104462 | 3300047469 | Bacteria | 1140 |
| 716 | Ga0495673_0167187 | 3300047469 | Bacteria | 840 |
| 717 | Ga0495673_0206659 | 3300047469 | Bacteria | 732 |
| 718 | Ga0495681_0001461 | 3300047470 | Bacteria | 17673 |
| 719 | Ga0495681_0002502 | 3300047470 | Bacteria | 13099 |
| 720 | Ga0495681_0007017 | 3300047470 | Bacteria | 7277 |
| 721 | Ga0495681_0019921 | 3300047470 | Bacteria | 3649 |
| 722 | Ga0495681_0031407 | 3300047470 | Bacteria | 2688 |
| 723 | Ga0495681_0052867 | 3300047470 | Bacteria | 1903 |
| 724 | Ga0495681_0173821 | 3300047470 | Bacteria | 889 |
| 725 | Ga0495681_0188834 | 3300047470 | Bacteria | 842 |
| 726 | Ga0495684_0082176 | 3300047471 | Bacteria | 2444 |
| 727 | Ga0495686_0015781 | 3300047472 | Bacteria | 5142 |
| 728 | Ga0495686_0019521 | 3300047472 | Bacteria | 4529 |
| 729 | Ga0495686_0083392 | 3300047472 | Bacteria | 1949 |
| 730 | Ga0495686_0546353 | 3300047472 | Bacteria | 605 |
| 731 | Ga0495593_0063897 | 3300047673 | Bacteria | 1921 |
| 732 | Ga0495602_0005007 | 3300048088 | Bacteria | 13890 |
| 733 | Ga0495626_0001094 | 3300048091 | Bacteria | 22950 |
| 734 | Ga0495626_0003316 | 3300048091 | Bacteria | 10385 |
| 735 | Ga0495626_0004857 | 3300048091 | Bacteria | 8087 |
| 736 | Ga0495626_0010834 | 3300048091 | Bacteria | 4843 |
| 737 | Ga0495626_0011130 | 3300048091 | Bacteria | 4769 |
| 738 | Ga0495626_0128203 | 3300048091 | Bacteria | 1085 |
| 739 | Ga0496100_0169522 | 3300048903 | Bacteria | 1571 |
| 740 | Ga0496101_0117724 | 3300048904 | Bacteria | 2006 |
| 741 | Ga0496102_0453094 | 3300048905 | Bacteria | 1204 |
| 742 | Ga0496103_0086160 | 3300048906 | Bacteria | 1980 |
| 743 | Ga0496104_0038060 | 3300048907 | Bacteria | 4499 |
| 744 | Ga0496104_0043329 | 3300048907 | Bacteria | 4227 |
| 745 | Ga0496104_0113266 | 3300048907 | Bacteria | 2601 |
| 746 | Ga0496105_0062100 | 3300048908 | Bacteria | 3083 |
| 747 | Ga0496106_0022929 | 3300048909 | Bacteria | 4637 |
| 748 | Ga0496106_0054336 | 3300048909 | Bacteria | 3026 |
| 749 | Ga0496106_0189450 | 3300048909 | Bacteria | 1635 |
| 750 | Ga0496107_0159890 | 3300048910 | Bacteria | 1669 |
| 751 | Ga0496108_0004780 | 3300048911 | Bacteria | 10923 |
| 752 | Ga0496108_0040427 | 3300048911 | Bacteria | 3888 |
| 753 | Ga0496109_1138860 | 3300048912 | Bacteria | 717 |
| 754 | Ga0496110_0054042 | 3300048913 | Bacteria | 3532 |
| 755 | Ga0496110_0155609 | 3300048913 | Bacteria | 2071 |
| 756 | Ga0496110_1547932 | 3300048913 | Bacteria | 573 |
| 757 | Ga0496111_0038150 | 3300048914 | Bacteria | 3441 |
| 758 | Ga0496111_0389402 | 3300048914 | Bacteria | 1030 |
| 759 | Ga0496112_0162148 | 3300048915 | Bacteria | 2202 |
| 760 | Ga0496112_0372031 | 3300048915 | Bacteria | 1370 |
| 761 | Ga0496113_0017769 | 3300048916 | Bacteria | 4944 |
| 762 | Ga0496113_0056174 | 3300048916 | Bacteria | 2954 |
| 763 | Ga0496113_0208800 | 3300048916 | Bacteria | 1554 |
| 764 | Ga0496114_0036664 | 3300048917 | Bacteria | 4054 |
| 765 | Ga0496116_0003545 | 3300048919 | Bacteria | 15358 |
| 766 | Ga0496116_0017743 | 3300048919 | Bacteria | 5514 |
| 767 | Ga0496116_0088921 | 3300048919 | Bacteria | 1886 |
| 768 | Ga0496116_0266902 | 3300048919 | Bacteria | 839 |
| 769 | Ga0496117_0027194 | 3300048920 | Bacteria | 4463 |
| 770 | Ga0496117_0293362 | 3300048920 | Bacteria | 865 |
| 771 | Ga0496118_0008537 | 3300048921 | Bacteria | 10568 |
| 772 | Ga0496118_0301313 | 3300048921 | Bacteria | 880 |
| 773 | Ga0496119_0020858 | 3300048922 | Bacteria | 4756 |
| 774 | Ga0496119_0117583 | 3300048922 | Bacteria | 1465 |
| 775 | Ga0496120_0030183 | 3300048923 | Bacteria | 3299 |
| 776 | Ga0496121_0013324 | 3300048924 | Bacteria | 8849 |
| 777 | Ga0496121_0232089 | 3300048924 | Bacteria | 1291 |
| 778 | Ga0496121_0232770 | 3300048924 | Bacteria | 1289 |
| 779 | Ga0496121_0286096 | 3300048924 | Bacteria | 1125 |
| 780 | Ga0496122_0014141 | 3300048925 | Bacteria | 7738 |
| 781 | Ga0496122_0032295 | 3300048925 | Bacteria | 4333 |
| 782 | Ga0496122_0034042 | 3300048925 | Bacteria | 4177 |
| 783 | Ga0496122_0058737 | 3300048925 | Bacteria | 2844 |
| 784 | Ga0496122_0271984 | 3300048925 | Bacteria | 932 |
| 785 | Ga0496123_0000020 | 3300048926 | Bacteria | 388748 |
| 786 | Ga0496123_0046923 | 3300048926 | Bacteria | 2924 |
| 787 | Ga0496123_0132554 | 3300048926 | Bacteria | 1377 |
| 788 | Ga0496123_0157473 | 3300048926 | Bacteria | 1215 |
| 789 | Ga0496123_0249094 | 3300048926 | Bacteria | 877 |
| 790 | Ga0496124_0003161 | 3300048927 | Bacteria | 20373 |
| 791 | Ga0496124_0158351 | 3300048927 | Bacteria | 1768 |
| 792 | Ga0496124_0261992 | 3300048927 | Bacteria | 1271 |
| 793 | Ga0496125_0025002 | 3300048928 | Bacteria | 5480 |
| 794 | Ga0496125_0110891 | 3300048928 | Bacteria | 1987 |
| 795 | Ga0496125_0171203 | 3300048928 | Bacteria | 1459 |
| 796 | Ga0496125_0284690 | 3300048928 | Bacteria | 1021 |
| 797 | Ga0496126_0063321 | 3300048929 | Bacteria | 3315 |
| 798 | Ga0496126_0082410 | 3300048929 | Bacteria | 2842 |
| 799 | Ga0496126_0341537 | 3300048929 | Bacteria | 1226 |
| 800 | Ga0495678_000954 | 3300049459 | Bacteria | 25047 |
| 801 | Ga0495678_002489 | 3300049459 | Bacteria | 12416 |
| 802 | Ga0495678_009254 | 3300049459 | Bacteria | 4893 |
| 803 | Ga0495678_063984 | 3300049459 | Bacteria | 1371 |
| 804 | Ga0495678_110956 | 3300049459 | Bacteria | 935 |
| 805 | Ga0495678_185707 | 3300049459 | Bacteria | 649 |
| 806 | Ga0495678_192423 | 3300049459 | Bacteria | 633 |
| 807 | Ga0495682_0000556 | 3300049460 | Bacteria | 25639 |
| 808 | Ga0495682_0014059 | 3300049460 | Bacteria | 3038 |
| 809 | Ga0501031_0028830 | 3300049568 | Bacteria | 3618 |
| 810 | Ga0501031_0057700 | 3300049568 | Bacteria | 2529 |
| 811 | Ga0501032_0053899 | 3300049569 | Bacteria | 2707 |
| 812 | Ga0501032_0140764 | 3300049569 | Bacteria | 1588 |
| 813 | Ga0501033_0083547 | 3300049570 | Bacteria | 2340 |
| 814 | Ga0501033_0479752 | 3300049570 | Bacteria | 861 |
| 815 | Ga0501034_0068653 | 3300049571 | Bacteria | 3554 |
| 816 | Ga0501034_0112795 | 3300049571 | Bacteria | 2708 |
| 817 | Ga0501034_0711989 | 3300049571 | Bacteria | 902 |
| 818 | Ga0501036_0058022 | 3300049572 | Bacteria | 3279 |
| 819 | Ga0501036_0209107 | 3300049572 | Bacteria | 1640 |
| 820 | Ga0501036_0732426 | 3300049572 | Bacteria | 816 |
| 821 | Ga0501037_0012878 | 3300049573 | Bacteria | 6165 |
| 822 | Ga0501037_0030893 | 3300049573 | Bacteria | 3956 |
| 823 | Ga0501037_0130195 | 3300049573 | Bacteria | 1804 |
| 824 | Ga0501038_0025722 | 3300049574 | Bacteria | 5243 |
| 825 | Ga0501038_0028034 | 3300049574 | Bacteria | 5003 |
| 826 | Ga0501039_0042948 | 3300049575 | Bacteria | 3492 |
| 827 | Ga0501039_0054312 | 3300049575 | Bacteria | 3100 |
| 828 | Ga0501040_0571443 | 3300049576 | Bacteria | 816 |
| 829 | Ga0501042_0116182 | 3300049578 | Bacteria | 1926 |
| 830 | Ga0501043_0098532 | 3300049579 | Bacteria | 2297 |
| 831 | Ga0501043_0216829 | 3300049579 | Bacteria | 1482 |
| 832 | Ga0501043_0426904 | 3300049579 | Bacteria | 999 |
| 833 | Ga0501046_0037115 | 3300049580 | Bacteria | 3917 |
| 834 | Ga0501047_0035677 | 3300049581 | Bacteria | 4804 |
| 835 | Ga0501047_0063768 | 3300049581 | Bacteria | 3554 |
| 836 | Ga0501048_0146260 | 3300049582 | Bacteria | 1671 |
| 837 | Ga0501069_0030732 | 3300049585 | Bacteria | 2951 |
| 838 | Ga0501070_0011113 | 3300049586 | Bacteria | 7598 |
| 839 | Ga0501070_0063171 | 3300049586 | Bacteria | 3067 |
| 840 | Ga0501070_0206570 | 3300049586 | Bacteria | 1612 |
| 841 | Ga0501070_0287193 | 3300049586 | Bacteria | 1341 |
| 842 | Ga0501071_0448376 | 3300049587 | Bacteria | 987 |
| 843 | Ga0501071_1021687 | 3300049587 | Bacteria | 639 |
| 844 | Ga0501073_0101081 | 3300049589 | Bacteria | 2002 |
| 845 | Ga0501073_0131100 | 3300049589 | Bacteria | 1738 |
| 846 | Ga0501073_0236535 | 3300049589 | Bacteria | 1261 |
| 847 | Ga0501074_0124175 | 3300049590 | Bacteria | 1846 |
| 848 | Ga0501074_0298882 | 3300049590 | Bacteria | 1143 |
| 849 | Ga0501075_0807908 | 3300049591 | Bacteria | 714 |
| 850 | Ga0501076_0149012 | 3300049592 | Bacteria | 1903 |
| 851 | Ga0501076_0847889 | 3300049592 | Bacteria | 754 |
| 852 | Ga0501077_0381007 | 3300049593 | Bacteria | 901 |
| 853 | Ga0501202_054665 | 3300049652 | Bacteria | 891 |
| 854 | Ga0501217_246076 | 3300049661 | Bacteria | 574 |
| 855 | Ga0501080_0031412 | 3300049742 | Bacteria | 4948 |
| 856 | Ga0501080_0882580 | 3300049742 | Bacteria | 780 |
| 857 | Ga0501083_0063591 | 3300049744 | Bacteria | 2461 |
| 858 | Ga0501035_0021781 | 3300049822 | Bacteria | 5891 |
| 859 | Ga0501035_0127290 | 3300049822 | Bacteria | 2223 |
| 860 | Ga0501035_0365832 | 3300049822 | Bacteria | 1204 |
| 861 | Ga0501035_0990425 | 3300049822 | Bacteria | 661 |
| 862 | Ga0501044_0251622 | 3300049823 | Bacteria | 1707 |
| 863 | Ga0501044_0683548 | 3300049823 | Bacteria | 913 |
| 864 | nmdc:mga03683_492934_c1 | 3300050489 | Bacteria | 593 |
| 865 | nmdc:mga03n38_17318_c1 | 3300050490 | Bacteria | 2819 |
| 866 | nmdc:mga00v17_504546_c1 | 3300050491 | Bacteria | 784 |
| 867 | nmdc:mga00v17_636387_c1 | 3300050491 | Bacteria | 686 |
| 868 | nmdc:mga0yw44_314513_c1 | 3300050492 | Bacteria | 1051 |
| 869 | nmdc:mga0yw44_711061_c1 | 3300050492 | Bacteria | 682 |
| 870 | nmdc:mga0k408_16913_c1 | 3300050493 | Bacteria | 4056 |
| 871 | nmdc:mga0k408_549752_c1 | 3300050493 | Bacteria | 682 |
| 872 | nmdc:mga06z11_224023_c1 | 3300050494 | Bacteria | 1100 |
| 873 | nmdc:mga06z11_236255_c1 | 3300050494 | Bacteria | 1072 |
| 874 | nmdc:mga04h51_74183_c1 | 3300050495 | Bacteria | 1194 |
| 875 | nmdc:mga07m45_1099_c1 | 3300050496 | Bacteria | 12074 |
| 876 | nmdc:mga07m45_112250_c1 | 3300050496 | Bacteria | 1571 |
| 877 | nmdc:mga07m45_816968_c1 | 3300050496 | Bacteria | 534 |
| 878 | nmdc:mga09592_1721871_c1 | 3300050508 | Bacteria | 505 |
| 879 | nmdc:mga09592_1938_c1 | 3300050508 | Bacteria | 16654 |
| 880 | nmdc:mga0qj67_209826_c1 | 3300050509 | Bacteria | 1582 |
| 881 | nmdc:mga06r32_62_c1 | 3300050510 | Bacteria | 68174 |
| 882 | nmdc:mga08y16_269637_c1 | 3300050511 | Bacteria | 1757 |
| 883 | nmdc:mga08y16_4022_c1 | 3300050511 | Bacteria | 15340 |
| 884 | nmdc:mga08y16_40823_c1 | 3300050511 | Bacteria | 4861 |
| 885 | nmdc:mga0sz30_78724_c1 | 3300050516 | Bacteria | 1425 |
| 886 | Ga0500650_0239442 | 3300053098 | Bacteria | 817 |
| 887 | Ga0500572_000400 | 3300053111 | Bacteria | 15243 |
| 888 | Ga0500594_0010415 | 3300053118 | Bacteria | 2158 |
| 889 | Ga0500658_0001972 | 3300053134 | Bacteria | 8015 |
| 890 | Ga0500658_0002314 | 3300053134 | Bacteria | 7382 |
| 891 | Ga0500658_0038836 | 3300053134 | Bacteria | 1899 |
| 892 | Ga0500568_0012118 | 3300053139 | Bacteria | 3975 |
| 893 | Ga0500586_061357 | 3300053145 | Bacteria | 1308 |
| 894 | Ga0500604_0000177 | 3300053151 | Bacteria | 18255 |
| 895 | Ga0500616_0000011 | 3300053153 | Bacteria | 732880 |
| 896 | Ga0500636_0039342 | 3300053177 | Bacteria | 2796 |
| 897 | Ga0590077_123937 | 3300059426 | Bacteria | 612 |
| 898 | Ga0587069_066719 | 3300059642 | Bacteria | 675 |
| 899 | Ga0501082_0360576 | 3300060353 | Bacteria | 1268 |
| 900 | Ga0466962_0001092 | 3300061719 | Bacteria | 12476 |
| 901 | Ga0466962_0032454 | 3300061719 | Bacteria | 2500 |
| 902 | Ga0530510_0547387 | 3300061734 | Bacteria | 879 |
| 903 | Ga0209257_1000170 | |||
| 904 | JGI24735J21928_10011016 | |||
| 905 | JGI24735J21928_10073659 | |||
| 906 | JGI25152J39213_1002426 | |||
| 907 | JGI25151J46595_10091505 | |||
| 908 | rootH2_10060589 | |||
| 909 | rootH1_10005225 | |||
| 910 | rootH1_10014341 | |||
| 911 | rootH1_10029371 | |||
| 912 | rootH1_10043722 | |||
| 913 | JGI25160J50197_1015076 | |||
| 914 | Ga0055526_1020884 | |||
| 915 | Ga0055524_1003534 | |||
| 916 | Ga0055524_1008747 | |||
| 917 | Ga0055524_1014639 | |||
| 918 | Ga0055524_1019646 | |||
| 919 | Ga0055524_1084418 | |||
| 920 | Ga0055528_1000475 | |||
| 921 | Ga0055528_1003617 | |||
| 922 | Ga0055528_1011147 | |||
| 923 | Ga0055528_1090489 | |||
| 924 | Ga0055531_10000002 | |||
| 925 | Ga0055531_10001058 | |||
| 926 | Ga0055531_10008411 | |||
| 927 | Ga0065165_1004191 | |||
| 928 | Ga0065165_1011457 | |||
| 929 | Ga0065704_10168884 | |||
| 930 | Ga0065707_10087132 | |||
| 931 | Ga0070658_10017036 | |||
| 932 | Ga0070658_10057334 | |||
| 933 | Ga0070670_100117899 | |||
| 934 | Ga0070666_10208579 | |||
| 935 | Ga0070682_100472831 | |||
| 936 | Ga0068868_100020866 | |||
| 937 | Ga0070660_100008686 | |||
| 938 | Ga0070660_100068646 | |||
| 939 | Ga0070660_100708682 | |||
| 940 | Ga0070660_101069361 | |||
| 941 | Ga0070689_100457419 | |||
| 942 | Ga0070687_100057783 | |||
| 943 | Ga0070661_100050772 | |||
| 944 | Ga0070661_100169133 | |||
| 945 | Ga0070661_100183810 | |||
| 946 | Ga0070661_100430351 | |||
| 947 | Ga0070661_100670641 | |||
| 948 | Ga0070661_100720653 | |||
| 949 | Ga0070692_10874066 | |||
| 950 | Ga0070668_101262275 | |||
| 951 | Ga0070668_101671731 | |||
| 952 | Ga0070669_100056577 | |||
| 953 | Ga0070669_100168372 | |||
| 954 | Ga0070669_100191230 | |||
| 955 | Ga0070669_101048602 | |||
| 956 | Ga0070671_100008751 | |||
| 957 | Ga0070671_100087030 | |||
| 958 | Ga0070671_100445573 | |||
| 959 | Ga0070673_100110750 | |||
| 960 | Ga0070673_100498116 | |||
| 961 | Ga0070659_100264336 | |||
| 962 | Ga0070659_101313775 | |||
| 963 | Ga0070667_100153388 | |||
| 964 | Ga0070667_100201231 | |||
| 965 | Ga0070667_100312753 | |||
| 966 | Ga0070713_100467204 | |||
| 967 | Ga0070710_10913216 | |||
| 968 | Ga0070708_101618107 | |||
| 969 | Ga0070663_100334556 | |||
| 970 | Ga0070662_100939768 | |||
| 971 | Ga0070662_100977375 | |||
| 972 | Ga0070681_11281180 | |||
| 973 | Ga0070685_10001187 | |||
| 974 | Ga0070706_100170084 | |||
| 975 | Ga0070679_100075528 | |||
| 976 | Ga0070679_100474960 | |||
| 977 | Ga0070679_101384469 | |||
| 978 | Ga0068853_102116744 | |||
| 979 | Ga0070672_100646831 | |||
| 980 | Ga0070672_101965724 | |||
| 981 | Ga0070686_100759300 | |||
| 982 | Ga0070695_100062209 | |||
| 983 | Ga0070696_100013709 | |||
| 984 | Ga0070665_100979034 | |||
| 985 | Ga0070704_100525375 | |||
| 986 | Ga0068855_100210671 | |||
| 987 | Ga0068855_100454263 | |||
| 988 | Ga0068855_100742786 | |||
| 989 | Ga0068855_102211242 | |||
| 990 | Ga0070664_100105907 | |||
| 991 | Ga0070664_100164382 | |||
| 992 | Ga0070664_100291307 | |||
| 993 | Ga0070664_100654928 | |||
| 994 | Ga0068857_100044117 | |||
| 995 | Ga0068857_100123702 | |||
| 996 | Ga0068857_100735999 | |||
| 997 | Ga0068857_100744445 | |||
| 998 | Ga0068857_101015093 | |||
| 999 | Ga0068854_100006731 | |||
| 1000 | Ga0068854_100355935 | |||
| 1001 | Ga0068854_100890762 | |||
| 1002 | Ga0068856_100682688 | |||
| 1003 | Ga0068856_101289433 | |||
| 1004 | Ga0068852_100002742 | |||
| 1005 | Ga0068852_100018079 | |||
| 1006 | Ga0068852_100266785 | |||
| 1007 | Ga0068864_100495147 | |||
| 1008 | Ga0068864_100868716 | |||
| 1009 | Ga0068863_100024383 | |||
| 1010 | Ga0068863_100115167 | |||
| 1011 | Ga0068858_100063774 | |||
| 1012 | Ga0068858_100131894 | |||
| 1013 | Ga0068860_100341450 | |||
| 1014 | Ga0068862_100002492 | |||
| 1015 | Ga0068862_100102772 | |||
| 1016 | Ga0068862_100153873 | |||
| 1017 | Ga0068862_100260289 | |||
| 1018 | Ga0081540_1107817 | |||
| 1019 | Ga0070717_10088091 | |||
| 1020 | Ga0075365_10021778 | |||
| 1021 | Ga0075365_10054022 | |||
| 1022 | Ga0075365_10583498 | |||
| 1023 | Ga0075368_10381293 | |||
| 1024 | Ga0075363_100107209 | |||
| 1025 | Ga0075363_100143057 | |||
| 1026 | Ga0075364_10265618 | |||
| 1027 | Ga0070716_100384072 | |||
| 1028 | Ga0075367_10009681 | |||
| 1029 | Ga0075367_10094217 | |||
| 1030 | Ga0075369_10117962 | |||
| 1031 | Ga0075366_10103623 | |||
| 1032 | Ga0075366_10319573 | |||
| 1033 | Ga0097621_100175276 | |||
| 1034 | Ga0097621_100889258 | |||
| 1035 | Ga0075370_10003381 | |||
| 1036 | Ga0075370_10529970 | |||
| 1037 | Ga0075370_10910602 | |||
| 1038 | Ga0075428_100003477 | |||
| 1039 | Ga0075428_100036137 | |||
| 1040 | Ga0075428_101280148 | |||
| 1041 | Ga0075430_100046455 | |||
| 1042 | Ga0075431_100001075 | |||
| 1043 | Ga0075429_100000334 | |||
| 1044 | Ga0068865_100082918 | |||
| 1045 | Ga0099823_1000009 | |||
| 1046 | Ga0099826_10395219 | |||
| 1047 | Ga0075435_100611812 | |||
| 1048 | Ga0105251_10134733 | |||
| 1049 | Ga0105244_10070577 | |||
| 1050 | Ga0105244_10084035 | |||
| 1051 | Ga0105244_10151978 | |||
| 1052 | Ga0105250_10005683 | |||
| 1053 | Ga0105250_10057962 | |||
| 1054 | Ga0105240_10015147 | |||
| 1055 | Ga0105240_10016001 | |||
| 1056 | Ga0105240_10019692 | |||
| 1057 | Ga0105240_11221325 | |||
| 1058 | Ga0111539_10247370 | |||
| 1059 | Ga0114129_10014757 | |||
| 1060 | Ga0114129_10468654 | |||
| 1061 | Ga0105243_10097354 | |||
| 1062 | Ga0105243_10972223 | |||
| 1063 | Ga0105241_11448946 | |||
| 1064 | Ga0105242_10036321 | |||
| 1065 | Ga0105248_10191910 | |||
| 1066 | Ga0105248_10417179 | |||
| 1067 | Ga0105248_10820906 | |||
| 1068 | Ga0105238_10014401 | |||
| 1069 | Ga0105238_10352917 | |||
| 1070 | Ga0105238_11685639 | |||
| 1071 | Ga0105249_10085952 | |||
| 1072 | Ga0105239_10950159 | |||
| 1073 | Ga0105239_11169829 | |||
| 1074 | Ga0105239_11955748 | |||
| 1075 | Ga0105246_10189567 | |||
| 1076 | Ga0157345_1000052 | |||
| 1077 | Ga0157373_10024005 | |||
| 1078 | Ga0157373_10031653 | |||
| 1079 | Ga0157373_10047416 | |||
| 1080 | Ga0157373_10272510 | |||
| 1081 | Ga0157373_10635751 | |||
| 1082 | Ga0157371_10072136 | |||
| 1083 | Ga0157371_11220883 | |||
| 1084 | Ga0157371_11377705 | |||
| 1085 | Ga0157370_10204812 | |||
| 1086 | Ga0157369_10000310 | |||
| 1087 | Ga0157369_10002441 | |||
| 1088 | Ga0157369_10027082 | |||
| 1089 | Ga0157369_10196894 | |||
| 1090 | Ga0157369_10285813 | |||
| 1091 | Ga0157369_10355770 | |||
| 1092 | Ga0157369_10539991 | |||
| 1093 | Ga0157369_11322390 | |||
| 1094 | Ga0157374_10200668 | |||
| 1095 | Ga0163162_10003202 | |||
| 1096 | Ga0163162_12241803 | |||
| 1097 | Ga0157372_10012201 | |||
| 1098 | Ga0157372_10015919 | |||
| 1099 | Ga0157372_10530283 | |||
| 1100 | Ga0157372_11788816 | |||
| 1101 | Ga0157375_10610790 | |||
| 1102 | Ga0163163_11439095 | |||
| 1103 | Ga0163163_11894911 | |||
| 1104 | Ga0157380_10074367 | |||
| 1105 | Ga0157380_10130045 | |||
| 1106 | Ga0157380_10452739 | |||
| 1107 | Ga0157380_11702254 | |||
| 1108 | Ga0182008_10489313 | |||
| 1109 | Ga0182006_1001284 | |||
| 1110 | Ga0182007_10120587 | |||
| 1111 | Ga0182005_1013156 | |||
| 1112 | Ga0163161_10320220 | |||
| 1113 | Ga0163161_10643660 | |||
| 1114 | Ga0209563_101280 | |||
| 1115 | Ga0209148_1002133 | |||
| 1116 | Ga0209129_1000080 | |||
| 1117 | Ga0209455_1000467 | |||
| 1118 | Ga0209673_1000037 | |||
| 1119 | Ga0209673_1000117 | |||
| 1120 | Ga0209673_1003273 | |||
| 1121 | Ga0209673_1005570 | |||
| 1122 | Ga0209673_1025818 | |||
| 1123 | Ga0209025_1003312 | |||
| 1124 | Ga0209025_1010330 | |||
| 1125 | Ga0209025_1021478 | |||
| 1126 | Ga0209025_1084115 | |||
| 1127 | Ga0209564_1000581 | |||
| 1128 | Ga0209564_1005748 | |||
| 1129 | Ga0209564_1007900 | |||
| 1130 | Ga0209758_1002963 | |||
| 1131 | Ga0209758_1024155 | |||
| 1132 | Ga0209050_1001983 | |||
| 1133 | Ga0209050_1002868 | |||
| 1134 | Ga0209256_1000109 | |||
| 1135 | Ga0209256_1000656 | |||
| 1136 | Ga0209256_1001157 | |||
| 1137 | Ga0209256_1001879 | |||
| 1138 | Ga0209256_1004966 | |||
| 1139 | Ga0209256_1022913 | |||
| 1140 | Ga0209256_1082178 | |||
| 1141 | Ga0207426_1002469 | |||
| 1142 | Ga0207426_1076373 | |||
| 1143 | Ga0209051_1000845 | |||
| 1144 | Ga0209051_1001940 | |||
| 1145 | Ga0209051_1106521 | |||
| 1146 | Ga0209257_1000049 | |||
| 1147 | Ga0209257_1001347 | |||
| 1148 | Ga0207696_1000051 | |||
| 1149 | Ga0207696_1010723 | |||
| 1150 | Ga0207696_1076987 | |||
| 1151 | Ga0207655_1005367 | |||
| 1152 | Ga0207655_1010748 | |||
| 1153 | Ga0207655_1041915 | |||
| 1154 | Ga0207655_1051374 | |||
| 1155 | Ga0207655_1063013 | |||
| 1156 | Ga0207713_1061247 | |||
| 1157 | Ga0207713_1131662 | |||
| 1158 | Ga0207680_10119456 | |||
| 1159 | Ga0207647_10018127 | |||
| 1160 | Ga0207647_10277415 | |||
| 1161 | Ga0207647_10398338 | |||
| 1162 | Ga0207647_10768965 | |||
| 1163 | Ga0207705_10003365 | |||
| 1164 | Ga0207705_10004105 | |||
| 1165 | Ga0207705_10216753 | |||
| 1166 | Ga0207684_10078604 | |||
| 1167 | Ga0207654_11310197 | |||
| 1168 | Ga0207707_10100779 | |||
| 1169 | Ga0207707_11004307 | |||
| 1170 | Ga0207695_10022781 | |||
| 1171 | Ga0207695_10024131 | |||
| 1172 | Ga0207660_10514934 | |||
| 1173 | Ga0207662_10357186 | |||
| 1174 | Ga0207657_10003486 | |||
| 1175 | Ga0207657_10014426 | |||
| 1176 | Ga0207657_10151371 | |||
| 1177 | Ga0207657_10275109 | |||
| 1178 | Ga0207657_11135466 | |||
| 1179 | Ga0207649_10135118 | |||
| 1180 | Ga0207649_10237898 | |||
| 1181 | Ga0207649_10243668 | |||
| 1182 | Ga0207649_10927974 | |||
| 1183 | Ga0207652_10036592 | |||
| 1184 | Ga0207652_10131672 | |||
| 1185 | Ga0207652_10609517 | |||
| 1186 | Ga0207681_10343268 | |||
| 1187 | Ga0207694_10001010 | |||
| 1188 | Ga0207694_10009321 | |||
| 1189 | Ga0207650_10060161 | |||
| 1190 | Ga0207659_10713977 | |||
| 1191 | Ga0207700_10409874 | |||
| 1192 | Ga0207644_10000978 | |||
| 1193 | Ga0207644_10010905 | |||
| 1194 | Ga0207644_10094876 | |||
| 1195 | Ga0207690_10004900 | |||
| 1196 | Ga0207690_10290452 | |||
| 1197 | Ga0207706_10054320 | |||
| 1198 | Ga0207706_10299829 | |||
| 1199 | Ga0207706_10708198 | |||
| 1200 | Ga0207706_11348630 | |||
| 1201 | Ga0207686_10104538 | |||
| 1202 | Ga0207709_10023143 | |||
| 1203 | Ga0207670_10142129 | |||
| 1204 | Ga0207704_10536042 | |||
| 1205 | Ga0207665_11252541 | |||
| 1206 | Ga0207691_10887847 | |||
| 1207 | Ga0207711_10205223 | |||
| 1208 | Ga0207689_10031290 | |||
| 1209 | Ga0207689_10849296 | |||
| 1210 | Ga0207689_11379721 | |||
| 1211 | Ga0207661_10490448 | |||
| 1212 | Ga0207661_10713737 | |||
| 1213 | Ga0207679_10079279 | |||
| 1214 | Ga0207679_10124489 | |||
| 1215 | Ga0207679_10260037 | |||
| 1216 | Ga0207679_10368066 | |||
| 1217 | Ga0207679_10940376 | |||
| 1218 | Ga0207667_10007513 | |||
| 1219 | Ga0207667_10936219 | |||
| 1220 | Ga0207667_11030892 | |||
| 1221 | Ga0207651_10027541 | |||
| 1222 | Ga0207651_10570638 | |||
| 1223 | Ga0207712_10121493 | |||
| 1224 | Ga0207712_10617420 | |||
| 1225 | Ga0207712_12003517 | |||
| 1226 | Ga0207668_10275753 | |||
| 1227 | Ga0207668_10850331 | |||
| 1228 | Ga0207668_10945240 | |||
| 1229 | Ga0207668_11178046 | |||
| 1230 | Ga0207640_10000633 | |||
| 1231 | Ga0207640_10028998 | |||
| 1232 | Ga0207658_10137548 | |||
| 1233 | Ga0207658_11099536 | |||
| 1234 | Ga0207658_11161856 | |||
| 1235 | Ga0207677_10568772 | |||
| 1236 | Ga0207703_10220470 | |||
| 1237 | Ga0207639_10000181 | |||
| 1238 | Ga0207639_10118646 | |||
| 1239 | Ga0207639_12190506 | |||
| 1240 | Ga0207678_10191150 | |||
| 1241 | Ga0207702_10047197 | |||
| 1242 | Ga0207702_10439494 | |||
| 1243 | Ga0207702_10542610 | |||
| 1244 | Ga0207641_10055494 | |||
| 1245 | Ga0207641_10070353 | |||
| 1246 | Ga0207641_11081325 | |||
| 1247 | Ga0207676_10007783 | |||
| 1248 | Ga0207674_10016271 | |||
| 1249 | Ga0207674_10040272 | |||
| 1250 | Ga0207674_10621483 | |||
| 1251 | Ga0207675_100268274 | |||
| 1252 | Ga0207683_10009677 | |||
| 1253 | Ga0207698_10442013 | |||
| 1254 | Ga0207698_10484437 | |||
| 1255 | Ga0209389_1014263 | |||
| 1256 | Ga0209371_1010320 | |||
| 1257 | Ga0209969_1027187 | |||
| 1258 | Ga0209813_10415125 | |||
| 1259 | Ga0207428_10003328 | |||
| 1260 | Ga0268266_10843802 | |||
| 1261 | Ga0268265_10019146 | |||
| 1262 | Ga0268265_10046894 | |||
| 1263 | Ga0268265_10982329 | |||
| 1264 | Ga0307515_10527058 | |||
| 1265 | Ga0307515_10745371 | |||
| 1266 | Ga0268256_1011069 | |||
| 1267 | Ga0314311_1050680 | |||
| 1268 | Ga0265325_10171569 | |||
| 1269 | Ga0307513_10241022 | |||
| 1270 | Ga0307509_10052108 | |||
| 1271 | Ga0307509_10692791 | |||
| 1272 | Ga0307408_100133083 | |||
| 1273 | Ga0307408_100536519 | |||
| 1274 | Ga0307408_101184443 | |||
| 1275 | Ga0307508_10403104 | |||
| 1276 | Ga0316579_10313441 | |||
| 1277 | Ga0316576_10355938 | |||
| 1278 | Ga0307516_10431512 | |||
| 1279 | Ga0307516_10590278 | |||
| 1280 | Ga0307516_10963301 | |||
| 1281 | Ga0307405_10365195 | |||
| 1282 | Ga0307405_11375511 | |||
| 1283 | Ga0307405_11659317 | |||
| 1284 | Ga0307413_10004740 | |||
| 1285 | Ga0307413_10011197 | |||
| 1286 | Ga0307413_10567085 | |||
| 1287 | Ga0307410_10063738 | |||
| 1288 | Ga0307410_10414799 | |||
| 1289 | Ga0307410_12030807 | |||
| 1290 | Ga0307406_10419966 | |||
| 1291 | Ga0307406_10430194 | |||
| 1292 | Ga0307406_10487264 | |||
| 1293 | Ga0307406_10918431 | |||
| 1294 | Ga0307407_10002665 | |||
| 1295 | Ga0307407_10734802 | |||
| 1296 | Ga0307412_10014518 | |||
| 1297 | Ga0307412_10040110 | |||
| 1298 | Ga0307412_10100196 | |||
| 1299 | Ga0307412_11227467 | |||
| 1300 | Ga0307409_100000590 | |||
| 1301 | Ga0307416_100073768 | |||
| 1302 | Ga0307416_100184069 | |||
| 1303 | Ga0307416_102102536 | |||
| 1304 | Ga0307414_10055855 | |||
| 1305 | Ga0307414_10102932 | |||
| 1306 | Ga0307414_10307675 | |||
| 1307 | Ga0307414_10366947 | |||
| 1308 | Ga0307414_10427082 | |||
| 1309 | Ga0307414_10842476 | |||
| 1310 | Ga0307414_10959442 | |||
| 1311 | Ga0307414_11201480 | |||
| 1312 | Ga0307411_10004233 | |||
| 1313 | Ga0307411_10163473 | |||
| 1314 | Ga0307411_11662145 | |||
| 1315 | Ga0307415_100003944 | |||
| 1316 | Ga0307415_100137096 | |||
| 1317 | Ga0307415_100177228 | |||
| 1318 | Ga0307415_100276214 | |||
| 1319 | Ga0307510_10001323 | |||
| 1320 | Ga0307510_10550295 | |||
| 1321 | Ga0373930_0047838 | |||
| 1322 | Ga0373934_0061583 | |||
| 1323 | Ga0373957_0287446 | |||
| 1324 | Ga0316582_0188785 | |||
| 1325 | Ga0395899_0044169 | |||
| 1326 | Ga0395899_0287324 | |||
| 1327 | Ga0395899_0304654 | |||
| 1328 | Ga0395900_0067916 | |||
| 1329 | Ga0395900_0157309 | |||
| 1330 | Ga0395900_0166800 | |||
| 1331 | Ga0395900_0853211 | |||
| 1332 | Ga0395900_1083263 | |||
| 1333 | Ga0395900_1599776 | |||
| 1334 | Ga0395898_0027920 | |||
| 1335 | Ga0395898_0078844 | |||
| 1336 | Ga0395898_0079979 | |||
| 1337 | Ga0395898_0539289 | |||
| 1338 | Ga0395898_0593232 | |||
| 1339 | Ga0395905_0002010 | |||
| 1340 | Ga0395905_0013726 | |||
| 1341 | Ga0395905_0146548 | |||
| 1342 | Ga0395905_0261726 | |||
| 1343 | Ga0395905_0417338 | |||
| 1344 | Ga0395905_0770138 | |||
| 1345 | Ga0395905_0853427 | |||
| 1346 | Ga0395905_0866608 | |||
| 1347 | Ga0395905_1314548 | |||
| 1348 | Ga0395905_1492189 | |||
| 1349 | Ga0395905_1619365 | |||
| 1350 | Ga0395901_0025775 | |||
| 1351 | Ga0395901_0051769 | |||
| 1352 | Ga0395901_0298965 | |||
| 1353 | Ga0395901_1777365 | |||
| 1354 | Ga0436363_1121625 | |||
| 1355 | Ga0439447_093068 | |||
| 1356 | Ga0439461_0001777 | |||
| 1357 | Ga0439465_0000403 | |||
| 1358 | Ga0451791_1665661 | |||
| 1359 | Ga0451798_0608123 | |||
| 1360 | Ga0451800_1610971 | |||
| 1361 | Ga0451807_0510360 | |||
| 1362 | Ga0439445_0051067 | |||
| 1363 | Ga0439445_0195483 | |||
| 1364 | Ga0439432_007592 | |||
| 1365 | Ga0439449_0377756 | |||
| 1366 | Ga0439455_0026513 | |||
| 1367 | Ga0439455_0055098 | |||
| 1368 | Ga0439455_0206663 | |||
| 1369 | Ga0439457_063186 | |||
| 1370 | Ga0450914_000414 | |||
| 1371 | Ga0450914_022173 | |||
| 1372 | Ga0450897_040572 | |||
| 1373 | Ga0450894_026049 | |||
| 1374 | Ga0450905_000656 | |||
| 1375 | Ga0450889_000037 | |||
| 1376 | Ga0450889_029751 | |||
| 1377 | Ga0450906_066656 | |||
| 1378 | Ga0450907_035050 | |||
| 1379 | Ga0439458_0004015 | |||
| 1380 | Ga0450909_042490 | |||
| 1381 | Ga0439464_0314947 | |||
| 1382 | Ga0450916_049155 | |||
| 1383 | Ga0450918_013478 | |||
| 1384 | Ga0450893_0013993 | |||
| 1385 | Ga0466969_0086865 | |||
| 1386 | Ga0466966_0008609 | |||
| 1387 | Ga0466961_0001441 | |||
| 1388 | Ga0466963_0040538 | |||
| 1389 | Ga0466963_0191139 | |||
| 1390 | Ga0466963_0246078 | |||
| 1391 | Ga0466964_0282825 | |||
| 1392 | Ga0466971_0003172 | |||
| 1393 | Ga0466971_0026306 | |||
| 1394 | Ga0466971_0119740 | |||
| 1395 | Ga0466970_0191784 | |||
| 1396 | Ga0466957_0012308 | |||
| 1397 | Ga0466957_0090691 | |||
| 1398 | Ga0466957_0588157 | |||
| 1399 | Ga0466960_0029259 | |||
| 1400 | Ga0466959_0004725 | |||
| 1401 | Ga0466959_0018173 | |||
| 1402 | Ga0451576_0000707 | |||
| 1403 | Ga0466958_0000157 | |||
| 1404 | Ga0466967_0015120 | |||
| 1405 | Ga0466967_0155394 | |||
| 1406 | Ga0495617_009662 | |||
| 1407 | Ga0495617_044824 | |||
| 1408 | Ga0495617_046768 | |||
| 1409 | Ga0495617_199847 | |||
| 1410 | Ga0495627_000695 | |||
| 1411 | Ga0495627_001370 | |||
| 1412 | Ga0495627_002456 | |||
| 1413 | Ga0495627_192178 | |||
| 1414 | Ga0495590_0014085 | |||
| 1415 | Ga0495590_0032456 | |||
| 1416 | Ga0495591_000662 | |||
| 1417 | Ga0495591_004084 | |||
| 1418 | Ga0495591_017663 | |||
| 1419 | Ga0495591_019643 | |||
| 1420 | Ga0495591_045323 | |||
| 1421 | Ga0495591_046392 | |||
| 1422 | Ga0495591_092953 | |||
| 1423 | Ga0495629_0193716 | |||
| 1424 | Ga0495638_0001957 | |||
| 1425 | Ga0495638_0025148 | |||
| 1426 | Ga0495638_0052888 | |||
| 1427 | Ga0495638_0562359 | |||
| 1428 | Ga0495653_0002927 | |||
| 1429 | Ga0495653_0024069 | |||
| 1430 | Ga0495653_0089532 | |||
| 1431 | Ga0495653_0138611 | |||
| 1432 | Ga0495650_0020843 | |||
| 1433 | Ga0495650_0122477 | |||
| 1434 | Ga0495650_0131493 | |||
| 1435 | Ga0495650_0241639 | |||
| 1436 | Ga0495650_0245935 | |||
| 1437 | Ga0495650_0335613 | |||
| 1438 | Ga0495605_0001168 | |||
| 1439 | Ga0495605_0038614 | |||
| 1440 | Ga0495605_0127706 | |||
| 1441 | Ga0495605_0268359 | |||
| 1442 | Ga0495639_0679438 | |||
| 1443 | Ga0495584_0014450 | |||
| 1444 | Ga0495584_0105950 | |||
| 1445 | Ga0495585_0002349 | |||
| 1446 | Ga0495585_0004774 | |||
| 1447 | Ga0495585_0036146 | |||
| 1448 | Ga0495585_0052160 | |||
| 1449 | Ga0495596_0003136 | |||
| 1450 | Ga0495596_0029573 | |||
| 1451 | Ga0495596_0039132 | |||
| 1452 | Ga0495607_0006304 | |||
| 1453 | Ga0495607_0020367 | |||
| 1454 | Ga0495607_0040518 | |||
| 1455 | Ga0495607_0061578 | |||
| 1456 | Ga0495607_0068256 | |||
| 1457 | Ga0495607_0128439 | |||
| 1458 | Ga0495607_0197659 | |||
| 1459 | Ga0495583_0006509 | |||
| 1460 | Ga0495583_0010574 | |||
| 1461 | Ga0495583_0167124 | |||
| 1462 | Ga0495606_0001321 | |||
| 1463 | Ga0495606_0001801 | |||
| 1464 | Ga0495606_0003948 | |||
| 1465 | Ga0495606_0123786 | |||
| 1466 | Ga0495606_0172930 | |||
| 1467 | Ga0495606_0419400 | |||
| 1468 | Ga0495610_0001087 | |||
| 1469 | Ga0495610_0005074 | |||
| 1470 | Ga0495610_0010564 | |||
| 1471 | Ga0495610_0080385 | |||
| 1472 | Ga0495616_0000042 | |||
| 1473 | Ga0495616_0000704 | |||
| 1474 | Ga0495616_0001304 | |||
| 1475 | Ga0495616_0002303 | |||
| 1476 | Ga0495616_0060078 | |||
| 1477 | Ga0495616_0107084 | |||
| 1478 | Ga0495616_0182289 | |||
| 1479 | Ga0495616_0222700 | |||
| 1480 | Ga0495616_0226938 | |||
| 1481 | Ga0495620_0000532 | |||
| 1482 | Ga0495620_0032112 | |||
| 1483 | Ga0495620_0242797 | |||
| 1484 | Ga0495631_0000229 | |||
| 1485 | Ga0495631_0000547 | |||
| 1486 | Ga0495631_0182701 | |||
| 1487 | Ga0495632_0005221 | |||
| 1488 | Ga0495632_0006967 | |||
| 1489 | Ga0495632_0010870 | |||
| 1490 | Ga0495632_0013653 | |||
| 1491 | Ga0495632_0295697 | |||
| 1492 | Ga0495632_0377121 | |||
| 1493 | Ga0495637_0000839 | |||
| 1494 | Ga0495637_0001641 | |||
| 1495 | Ga0495637_0002034 | |||
| 1496 | Ga0495637_0008706 | |||
| 1497 | Ga0495637_0021867 | |||
| 1498 | Ga0495637_0045936 | |||
| 1499 | Ga0495643_0004653 | |||
| 1500 | Ga0495643_0036166 | |||
| 1501 | Ga0495643_0037736 | |||
| 1502 | Ga0495643_0066324 | |||
| 1503 | Ga0495643_0070683 | |||
| 1504 | Ga0495643_0288195 | |||
| 1505 | Ga0495644_0051968 | |||
| 1506 | Ga0495648_0009698 | |||
| 1507 | Ga0495648_0068137 | |||
| 1508 | Ga0495648_0122201 | |||
| 1509 | Ga0495648_0130273 | |||
| 1510 | Ga0495648_0335667 | |||
| 1511 | Ga0495648_0425661 | |||
| 1512 | Ga0495666_0010713 | |||
| 1513 | Ga0495642_0011651 | |||
| 1514 | Ga0495654_0000444 | |||
| 1515 | Ga0495654_0020054 | |||
| 1516 | Ga0495654_0069039 | |||
| 1517 | Ga0495654_0074879 | |||
| 1518 | Ga0495654_0321522 | |||
| 1519 | Ga0495587_0053104 | |||
| 1520 | Ga0495609_0001751 | |||
| 1521 | Ga0495609_0004084 | |||
| 1522 | Ga0495609_0021618 | |||
| 1523 | Ga0495609_0036842 | |||
| 1524 | Ga0495609_0075316 | |||
| 1525 | Ga0495609_0134296 | |||
| 1526 | Ga0495597_0002633 | |||
| 1527 | Ga0495597_0003247 | |||
| 1528 | Ga0495597_0232386 | |||
| 1529 | Ga0495645_0032397 | |||
| 1530 | Ga0495622_0000537 | |||
| 1531 | Ga0495622_0039129 | |||
| 1532 | Ga0495622_0168502 | |||
| 1533 | Ga0495622_0226396 | |||
| 1534 | Ga0495633_0000867 | |||
| 1535 | Ga0495633_0004843 | |||
| 1536 | Ga0495633_0091052 | |||
| 1537 | Ga0495668_0000033 | |||
| 1538 | Ga0495668_0002790 | |||
| 1539 | Ga0495668_0002819 | |||
| 1540 | Ga0495668_0113588 | |||
| 1541 | Ga0495668_0160963 | |||
| 1542 | Ga0495668_0254387 | |||
| 1543 | Ga0495634_0025019 | |||
| 1544 | Ga0495611_0000468 | |||
| 1545 | Ga0495611_0006667 | |||
| 1546 | Ga0495611_0084121 | |||
| 1547 | Ga0495611_0347910 | |||
| 1548 | Ga0495625_0000014 | |||
| 1549 | Ga0495625_0000032 | |||
| 1550 | Ga0495625_0006003 | |||
| 1551 | Ga0495625_0016634 | |||
| 1552 | Ga0495625_0032684 | |||
| 1553 | Ga0495625_0059700 | |||
| 1554 | Ga0495625_0120424 | |||
| 1555 | Ga0495625_0657696 | |||
| 1556 | Ga0495625_0691110 | |||
| 1557 | Ga0495625_0820312 | |||
| 1558 | Ga0495661_0028015 | |||
| 1559 | Ga0495661_0067472 | |||
| 1560 | Ga0495661_0071801 | |||
| 1561 | Ga0495661_0184477 | |||
| 1562 | Ga0495661_0515255 | |||
| 1563 | Ga0495588_0090822 | |||
| 1564 | Ga0495646_0081794 | |||
| 1565 | Ga0495669_0098426 | |||
| 1566 | Ga0495613_0010857 | |||
| 1567 | Ga0495624_0001286 | |||
| 1568 | Ga0495624_0221077 | |||
| 1569 | Ga0495670_0000868 | |||
| 1570 | Ga0495670_0064032 | |||
| 1571 | Ga0495671_0012713 | |||
| 1572 | Ga0495671_0015611 | |||
| 1573 | Ga0495671_0036514 | |||
| 1574 | Ga0495671_0040326 | |||
| 1575 | Ga0495671_0041873 | |||
| 1576 | Ga0495671_0125879 | |||
| 1577 | Ga0495649_0005359 | |||
| 1578 | Ga0495649_0008701 | |||
| 1579 | Ga0495649_0011931 | |||
| 1580 | Ga0495649_0014874 | |||
| 1581 | Ga0495649_0025203 | |||
| 1582 | Ga0495649_0029499 | |||
| 1583 | Ga0495649_0039808 | |||
| 1584 | Ga0495649_0189302 | |||
| 1585 | Ga0495589_0002576 | |||
| 1586 | Ga0495589_0046180 | |||
| 1587 | Ga0495589_0064063 | |||
| 1588 | Ga0495600_0041644 | |||
| 1589 | Ga0495660_0001455 | |||
| 1590 | Ga0495660_0008129 | |||
| 1591 | Ga0495660_0016083 | |||
| 1592 | Ga0495660_0022703 | |||
| 1593 | Ga0495660_0083573 | |||
| 1594 | Ga0495660_0104049 | |||
| 1595 | Ga0495660_0194128 | |||
| 1596 | Ga0495660_0341172 | |||
| 1597 | Ga0495672_0003388 | |||
| 1598 | Ga0495672_0025786 | |||
| 1599 | Ga0495672_0184653 | |||
| 1600 | Ga0495676_0022364 | |||
| 1601 | Ga0495680_0021555 | |||
| 1602 | Ga0495683_0012750 | |||
| 1603 | Ga0495683_0035832 | |||
| 1604 | Ga0495683_0039231 | |||
| 1605 | Ga0495683_0067207 | |||
| 1606 | Ga0495683_0141858 | |||
| 1607 | Ga0495687_003196 | |||
| 1608 | Ga0495687_004060 | |||
| 1609 | Ga0495677_0029578 | |||
| 1610 | Ga0495679_003112 | |||
| 1611 | Ga0495679_003907 | |||
| 1612 | Ga0495679_008516 | |||
| 1613 | Ga0495679_074448 | |||
| 1614 | Ga0495685_003890 | |||
| 1615 | Ga0495673_0000753 | |||
| 1616 | Ga0495673_0027210 | |||
| 1617 | Ga0495673_0104462 | |||
| 1618 | Ga0495673_0167187 | |||
| 1619 | Ga0495673_0206659 | |||
| 1620 | Ga0495681_0001461 | |||
| 1621 | Ga0495681_0002502 | |||
| 1622 | Ga0495681_0007017 | |||
| 1623 | Ga0495681_0019921 | |||
| 1624 | Ga0495681_0031407 | |||
| 1625 | Ga0495681_0052867 | |||
| 1626 | Ga0495681_0173821 | |||
| 1627 | Ga0495681_0188834 | |||
| 1628 | Ga0495684_0082176 | |||
| 1629 | Ga0495686_0015781 | |||
| 1630 | Ga0495686_0019521 | |||
| 1631 | Ga0495686_0083392 | |||
| 1632 | Ga0495686_0546353 | |||
| 1633 | Ga0495593_0063897 | |||
| 1634 | Ga0495602_0005007 | |||
| 1635 | Ga0495626_0001094 | |||
| 1636 | Ga0495626_0003316 | |||
| 1637 | Ga0495626_0004857 | |||
| 1638 | Ga0495626_0010834 | |||
| 1639 | Ga0495626_0011130 | |||
| 1640 | Ga0495626_0128203 | |||
| 1641 | Ga0496100_0169522 | |||
| 1642 | Ga0496101_0117724 | |||
| 1643 | Ga0496102_0453094 | |||
| 1644 | Ga0496103_0086160 | |||
| 1645 | Ga0496104_0038060 | |||
| 1646 | Ga0496104_0043329 | |||
| 1647 | Ga0496104_0113266 | |||
| 1648 | Ga0496105_0062100 | |||
| 1649 | Ga0496106_0022929 | |||
| 1650 | Ga0496106_0054336 | |||
| 1651 | Ga0496106_0189450 | |||
| 1652 | Ga0496107_0159890 | |||
| 1653 | Ga0496108_0004780 | |||
| 1654 | Ga0496108_0040427 | |||
| 1655 | Ga0496109_1138860 | |||
| 1656 | Ga0496110_0054042 | |||
| 1657 | Ga0496110_0155609 | |||
| 1658 | Ga0496110_1547932 | |||
| 1659 | Ga0496111_0038150 | |||
| 1660 | Ga0496111_0389402 | |||
| 1661 | Ga0496112_0162148 | |||
| 1662 | Ga0496112_0372031 | |||
| 1663 | Ga0496113_0017769 | |||
| 1664 | Ga0496113_0056174 | |||
| 1665 | Ga0496113_0208800 | |||
| 1666 | Ga0496114_0036664 | |||
| 1667 | Ga0496116_0003545 | |||
| 1668 | Ga0496116_0017743 | |||
| 1669 | Ga0496116_0088921 | |||
| 1670 | Ga0496116_0266902 | |||
| 1671 | Ga0496117_0027194 | |||
| 1672 | Ga0496117_0293362 | |||
| 1673 | Ga0496118_0008537 | |||
| 1674 | Ga0496118_0301313 | |||
| 1675 | Ga0496119_0020858 | |||
| 1676 | Ga0496119_0117583 | |||
| 1677 | Ga0496120_0030183 | |||
| 1678 | Ga0496121_0013324 | |||
| 1679 | Ga0496121_0232089 | |||
| 1680 | Ga0496121_0232770 | |||
| 1681 | Ga0496121_0286096 | |||
| 1682 | Ga0496122_0014141 | |||
| 1683 | Ga0496122_0032295 | |||
| 1684 | Ga0496122_0034042 | |||
| 1685 | Ga0496122_0058737 | |||
| 1686 | Ga0496122_0271984 | |||
| 1687 | Ga0496123_0000020 | |||
| 1688 | Ga0496123_0046923 | |||
| 1689 | Ga0496123_0132554 | |||
| 1690 | Ga0496123_0157473 | |||
| 1691 | Ga0496123_0249094 | |||
| 1692 | Ga0496124_0003161 | |||
| 1693 | Ga0496124_0158351 | |||
| 1694 | Ga0496124_0261992 | |||
| 1695 | Ga0496125_0025002 | |||
| 1696 | Ga0496125_0110891 | |||
| 1697 | Ga0496125_0171203 | |||
| 1698 | Ga0496125_0284690 | |||
| 1699 | Ga0496126_0063321 | |||
| 1700 | Ga0496126_0082410 | |||
| 1701 | Ga0496126_0341537 | |||
| 1702 | Ga0495678_000954 | |||
| 1703 | Ga0495678_002489 | |||
| 1704 | Ga0495678_009254 | |||
| 1705 | Ga0495678_063984 | |||
| 1706 | Ga0495678_110956 | |||
| 1707 | Ga0495678_185707 | |||
| 1708 | Ga0495678_192423 | |||
| 1709 | Ga0495682_0000556 | |||
| 1710 | Ga0495682_0014059 | |||
| 1711 | Ga0501031_0028830 | |||
| 1712 | Ga0501031_0057700 | |||
| 1713 | Ga0501032_0053899 | |||
| 1714 | Ga0501032_0140764 | |||
| 1715 | Ga0501033_0083547 | |||
| 1716 | Ga0501033_0479752 | |||
| 1717 | Ga0501034_0068653 | |||
| 1718 | Ga0501034_0112795 | |||
| 1719 | Ga0501034_0711989 | |||
| 1720 | Ga0501036_0058022 | |||
| 1721 | Ga0501036_0209107 | |||
| 1722 | Ga0501036_0732426 | |||
| 1723 | Ga0501037_0012878 | |||
| 1724 | Ga0501037_0030893 | |||
| 1725 | Ga0501037_0130195 | |||
| 1726 | Ga0501038_0025722 | |||
| 1727 | Ga0501038_0028034 | |||
| 1728 | Ga0501039_0042948 | |||
| 1729 | Ga0501039_0054312 | |||
| 1730 | Ga0501040_0571443 | |||
| 1731 | Ga0501042_0116182 | |||
| 1732 | Ga0501043_0098532 | |||
| 1733 | Ga0501043_0216829 | |||
| 1734 | Ga0501043_0426904 | |||
| 1735 | Ga0501046_0037115 | |||
| 1736 | Ga0501047_0035677 | |||
| 1737 | Ga0501047_0063768 | |||
| 1738 | Ga0501048_0146260 | |||
| 1739 | Ga0501069_0030732 | |||
| 1740 | Ga0501070_0011113 | |||
| 1741 | Ga0501070_0063171 | |||
| 1742 | Ga0501070_0206570 | |||
| 1743 | Ga0501070_0287193 | |||
| 1744 | Ga0501071_0448376 | |||
| 1745 | Ga0501071_1021687 | |||
| 1746 | Ga0501073_0101081 | |||
| 1747 | Ga0501073_0131100 | |||
| 1748 | Ga0501073_0236535 | |||
| 1749 | Ga0501074_0124175 | |||
| 1750 | Ga0501074_0298882 | |||
| 1751 | Ga0501075_0807908 | |||
| 1752 | Ga0501076_0149012 | |||
| 1753 | Ga0501076_0847889 | |||
| 1754 | Ga0501077_0381007 | |||
| 1755 | Ga0501202_054665 | |||
| 1756 | Ga0501217_246076 | |||
| 1757 | Ga0501080_0031412 | |||
| 1758 | Ga0501080_0882580 | |||
| 1759 | Ga0501083_0063591 | |||
| 1760 | Ga0501035_0021781 | |||
| 1761 | Ga0501035_0127290 | |||
| 1762 | Ga0501035_0365832 | |||
| 1763 | Ga0501035_0990425 | |||
| 1764 | Ga0501044_0251622 | |||
| 1765 | Ga0501044_0683548 | |||
| 1766 | nmdc:mga03683_492934_c1 | |||
| 1767 | nmdc:mga03n38_17318_c1 | |||
| 1768 | nmdc:mga00v17_504546_c1 | |||
| 1769 | nmdc:mga00v17_636387_c1 | |||
| 1770 | nmdc:mga0yw44_314513_c1 | |||
| 1771 | nmdc:mga0yw44_711061_c1 | |||
| 1772 | nmdc:mga0k408_16913_c1 | |||
| 1773 | nmdc:mga0k408_549752_c1 | |||
| 1774 | nmdc:mga06z11_224023_c1 | |||
| 1775 | nmdc:mga06z11_236255_c1 | |||
| 1776 | nmdc:mga04h51_74183_c1 | |||
| 1777 | nmdc:mga07m45_1099_c1 | |||
| 1778 | nmdc:mga07m45_112250_c1 | |||
| 1779 | nmdc:mga07m45_816968_c1 | |||
| 1780 | nmdc:mga09592_1721871_c1 | |||
| 1781 | nmdc:mga09592_1938_c1 | |||
| 1782 | nmdc:mga0qj67_209826_c1 | |||
| 1783 | nmdc:mga06r32_62_c1 | |||
| 1784 | nmdc:mga08y16_269637_c1 | |||
| 1785 | nmdc:mga08y16_4022_c1 | |||
| 1786 | nmdc:mga08y16_40823_c1 | |||
| 1787 | nmdc:mga0sz30_78724_c1 | |||
| 1788 | Ga0500650_0239442 | |||
| 1789 | Ga0500572_000400 | |||
| 1790 | Ga0500594_0010415 | |||
| 1791 | Ga0500658_0001972 | |||
| 1792 | Ga0500658_0002314 | |||
| 1793 | Ga0500658_0038836 | |||
| 1794 | Ga0500568_0012118 | |||
| 1795 | Ga0500586_061357 | |||
| 1796 | Ga0500604_0000177 | |||
| 1797 | Ga0500616_0000011 | |||
| 1798 | Ga0500636_0039342 | |||
| 1799 | Ga0590077_123937 | |||
| 1800 | Ga0587069_066719 | |||
| 1801 | Ga0501082_0360576 | |||
| 1802 | Ga0466962_0001092 | |||
| 1803 | Ga0466962_0032454 | |||
| 1804 | Ga0530510_0547387 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 8ajq-assembly3.cif.gz_E | crystal structure of pa2722 from pseudomonas aeruginosa pao1 | 0.9561 | 1 | 130 |
| 8ajq-assembly3.cif.gz_E | crystal structure of pa2722 from pseudomonas aeruginosa pao1 | 0.949 | 1 | 130 |
| 1xa8-assembly1.cif.gz_A | crystal structure analysis of glutathione-dependent formaldehyde-activating enzyme (gfa) | 0.7963 | 3 | 100 |
| 3fac-assembly8.cif.gz_H | crystal structure of rhodobacter sphaeroides protein rsp_2168. northeast structural genomics target rhr83. | 0.7723 | 5 | 89 |
| 3fac-assembly8.cif.gz_H | crystal structure of rhodobacter sphaeroides protein rsp_2168. northeast structural genomics target rhr83. | 0.619 | 5 | 89 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_O14034_2_133_3.90.1590.10 | Alpha Beta;Alpha-Beta Complex;glutathione-dependent formaldehyde- activating enzyme (gfa);glutathione-dependent formaldehyde- activating enzyme (gfa) | 0.7902 | 2 | 117 | 3.90.1590.10 |
| 1xa8D00 | Alpha Beta;Alpha-Beta Complex;glutathione-dependent formaldehyde- activating enzyme (gfa);glutathione-dependent formaldehyde- activating enzyme (gfa) | 0.786 | 1 | 100 | 3.90.1590.10 |
| af_A0A1D6EPM0_14_114_2.170.150.70 | Mainly Beta;Beta Complex;Metal Binding Protein, Guanine Nucleotide Exchange Factor; Chain A; | 0.7641 | 4 | 90 | 2.170.150.70 |
| af_K7MPT9_9_124_2.170.150.70 | Mainly Beta;Beta Complex;Metal Binding Protein, Guanine Nucleotide Exchange Factor; Chain A; | 0.7592 | 6 | 100 | 2.170.150.70 |
| af_Q54X87_13_141_2.170.150.70 | Mainly Beta;Beta Complex;Metal Binding Protein, Guanine Nucleotide Exchange Factor; Chain A; | 0.7452 | 5 | 93 | 2.170.150.70 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A531KHJ2-F1-model_v4 | GFA family protein | 0.9864 | 1 | 103 |
GO:0016846
GO:0046872 |
| AF-A0A529KEZ5-F1-model_v4 | GFA family protein | 0.9845 | 1 | 82 |
GO:0016846
GO:0046872 |
| AF-A0A531KHJ2-F1-model_v4 | GFA family protein | 0.977 | 1 | 103 |
GO:0016846
GO:0046872 |
| AF-Q8KLY1-F1-model_v4 | CENP-V/GFA domain-containing protein | 0.9737 | 1 | 130 |
GO:0016846
GO:0046872 |
| AF-A0A090DLE2-F1-model_v4 | Glutathione-dependent formaldehyde-activating, GFA | 0.9736 | 1 | 130 |
GO:0016846
GO:0046872 |