F485208

General Info

Members Datasets Scaffolds Average Seq Length
902 395 1804 131

Family's Representative Sequence

Representative Sequence 3300025304|Ga0209257_1000170|Ga0209257_100017020
Length 131
Sequence MERFDGGCLCGKVRLVAQGQPNRVGLCHCMDCRKHHGALFHASAVFPEQAVKVSGETREYAKRYFCPNCGSSVFGRSDIEEIEVNLGCLDAPDQFKPTYELWTVRRESWLPPFPLTGYERDRESTSRYENP

Samples

Sample ID Description Type Environment
1 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
2 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
3 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
4 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
5 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
6 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
7 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
8 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
9 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
10 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
11 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
12 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
13 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
14 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
15 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
16 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
17 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
18 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
19 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
20 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
21 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
22 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
23 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
24 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
25 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
26 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
27 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
28 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
29 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
30 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
31 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
32 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
33 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
34 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
35 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
36 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
37 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
38 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
39 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
40 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
41 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
42 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
43 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
44 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
45 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
46 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
47 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
48 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
49 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
50 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
51 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
52 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
53 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
54 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
55 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
56 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
57 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
58 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
59 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
60 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
61 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
62 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
63 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
64 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
65 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
66 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
67 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
68 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
70 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
71 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
72 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
73 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
74 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
75 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
76 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
77 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
78 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
79 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
80 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
81 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
82 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
83 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
84 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
85 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
86 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
87 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
88 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
89 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
90 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
91 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
92 3300012498 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 Metagenome Rhizosphere
93 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
94 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
95 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
96 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
97 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
98 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
99 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
100 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
101 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
102 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
103 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
104 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
105 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
106 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
107 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
108 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
109 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
110 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
111 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
112 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
113 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
114 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
115 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
116 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
117 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
118 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
119 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
120 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
171 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
172 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
173 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
174 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
175 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
178 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
179 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
180 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
181 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
182 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
183 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
184 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
185 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
186 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
187 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
188 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
189 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
190 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
191 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
192 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
193 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
194 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
195 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
196 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
197 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
198 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
199 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
200 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
201 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
202 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
203 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
204 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
205 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
206 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
207 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
208 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
209 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
210 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
211 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
212 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
213 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
214 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
215 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
216 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
217 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
218 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
219 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
220 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
221 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
222 3300042118 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_082316_2156 Metagenome Rhizosphere
223 3300042128 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123 Metagenome Rhizosphere
224 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
225 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
226 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
227 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
228 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
229 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
230 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
231 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
232 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
233 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
234 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
235 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
236 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
237 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
238 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
239 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
240 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
241 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
242 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
243 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
244 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
245 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
246 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
247 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
248 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
249 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
250 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
251 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
252 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
253 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
254 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
255 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
256 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
257 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
258 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
259 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
260 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
261 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
262 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
263 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
264 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
265 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
266 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
267 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
268 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
269 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
270 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
271 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
272 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
273 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
274 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
275 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
276 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
277 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
278 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
279 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
280 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
281 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
282 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
283 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
284 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
285 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
286 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
287 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
288 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
289 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
290 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
291 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
292 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
293 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
294 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
295 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
296 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
297 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
298 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
299 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
300 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
301 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
302 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
303 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
304 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
305 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
306 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
307 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
308 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
309 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
310 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
311 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
312 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
313 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
314 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
315 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
316 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
317 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
318 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
319 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
320 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
321 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
322 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
323 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
324 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
325 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
326 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
327 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
328 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
329 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
330 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
331 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
332 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
333 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
334 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
335 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
336 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
337 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
338 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
339 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
340 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
341 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
342 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
343 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
344 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
345 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
346 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
347 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
348 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
349 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
350 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
351 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
352 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
353 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
354 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
355 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
356 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
357 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
358 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
359 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
360 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
361 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
362 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
363 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
364 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
365 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
366 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
367 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
368 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
369 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
370 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
371 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
372 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
373 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
374 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
375 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
376 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
377 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
378 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
379 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
380 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
381 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
382 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
383 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
384 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
385 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
386 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
387 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
388 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
389 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
390 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
391 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
392 3300059642 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
393 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
394 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
395 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.89
Metatranscriptomes 0.11
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.53
Nodule 0.33
Rhizoplane 3.33
Rhizosphere 80.04
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0209257_1000170 3300025304 Bacteria 169384
2 JGI24735J21928_10011016 3300002067 Bacteria 2873
3 JGI24735J21928_10073659 3300002067 Bacteria 978
4 JGI25152J39213_1002426 3300002773 Bacteria 7098
5 JGI25151J46595_10091505 3300003187 Bacteria 845
6 rootH2_10060589 3300003320 Bacteria 3443
7 rootH1_10005225 3300003323 Bacteria 17841
8 rootH1_10014341 3300003323 Bacteria 3538
9 rootH1_10029371 3300003323 Bacteria 3252
10 rootH1_10043722 3300003323 Bacteria 9212
11 JGI25160J50197_1015076 3300003354 Bacteria 2554
12 Ga0055526_1020884 3300003771 Bacteria 2304
13 Ga0055524_1003534 3300003775 Bacteria 7557
14 Ga0055524_1008747 3300003775 Bacteria 4181
15 Ga0055524_1014639 3300003775 Bacteria 2898
16 Ga0055524_1019646 3300003775 Bacteria 2302
17 Ga0055524_1084418 3300003775 Bacteria 568
18 Ga0055528_1000475 3300003790 Bacteria 32037
19 Ga0055528_1003617 3300003790 Bacteria 7687
20 Ga0055528_1011147 3300003790 Bacteria 3597
21 Ga0055528_1090489 3300003790 Bacteria 526
22 Ga0055531_10000002 3300003794 Bacteria 421971
23 Ga0055531_10001058 3300003794 Bacteria 21682
24 Ga0055531_10008411 3300003794 Bacteria 5448
25 Ga0065165_1004191 3300005262 Bacteria 9187
26 Ga0065165_1011457 3300005262 Bacteria 3696
27 Ga0065704_10168884 3300005289 Bacteria 1304
28 Ga0065707_10087132 3300005295 Bacteria 5150
29 Ga0070658_10017036 3300005327 Bacteria 5815
30 Ga0070658_10057334 3300005327 Bacteria 3168
31 Ga0070670_100117899 3300005331 Bacteria 2289
32 Ga0070666_10208579 3300005335 Bacteria 1376
33 Ga0070682_100472831 3300005337 Bacteria 965
34 Ga0068868_100020866 3300005338 Bacteria 4931
35 Ga0070660_100008686 3300005339 Bacteria 7113
36 Ga0070660_100068646 3300005339 Bacteria 2763
37 Ga0070660_100708682 3300005339 Bacteria 844
38 Ga0070660_101069361 3300005339 Bacteria 682
39 Ga0070689_100457419 3300005340 Bacteria 1087
40 Ga0070687_100057783 3300005343 Bacteria 2036
41 Ga0070661_100050772 3300005344 Bacteria 3035
42 Ga0070661_100169133 3300005344 Bacteria 1659
43 Ga0070661_100183810 3300005344 Bacteria 1591
44 Ga0070661_100430351 3300005344 Bacteria 1047
45 Ga0070661_100670641 3300005344 Bacteria 843
46 Ga0070661_100720653 3300005344 Bacteria 814
47 Ga0070692_10874066 3300005345 Bacteria 619
48 Ga0070668_101262275 3300005347 Bacteria 671
49 Ga0070668_101671731 3300005347 Bacteria 584
50 Ga0070669_100056577 3300005353 Bacteria 2876
51 Ga0070669_100168372 3300005353 Bacteria 1707
52 Ga0070669_100191230 3300005353 Bacteria 1606
53 Ga0070669_101048602 3300005353 Bacteria 701
54 Ga0070671_100008751 3300005355 Bacteria 8121
55 Ga0070671_100087030 3300005355 Bacteria 2614
56 Ga0070671_100445573 3300005355 Bacteria 1111
57 Ga0070673_100110750 3300005364 Bacteria 2276
58 Ga0070673_100498116 3300005364 Bacteria 1102
59 Ga0070659_100264336 3300005366 Bacteria 1428
60 Ga0070659_101313775 3300005366 Bacteria 641
61 Ga0070667_100153388 3300005367 Bacteria 2025
62 Ga0070667_100201231 3300005367 Bacteria 1767
63 Ga0070667_100312753 3300005367 Bacteria 1416
64 Ga0070713_100467204 3300005436 Bacteria 1187
65 Ga0070710_10913216 3300005437 Bacteria 635
66 Ga0070708_101618107 3300005445 Bacteria 603
67 Ga0070663_100334556 3300005455 Bacteria 1221
68 Ga0070662_100939768 3300005457 Bacteria 739
69 Ga0070662_100977375 3300005457 Bacteria 724
70 Ga0070681_11281180 3300005458 Bacteria 655
71 Ga0070685_10001187 3300005466 Bacteria 13922
72 Ga0070706_100170084 3300005467 Bacteria 2035
73 Ga0070679_100075528 3300005530 Bacteria 3359
74 Ga0070679_100474960 3300005530 Bacteria 1195
75 Ga0070679_101384469 3300005530 Bacteria 649
76 Ga0068853_102116744 3300005539 Bacteria 545
77 Ga0070672_100646831 3300005543 Bacteria 923
78 Ga0070672_101965724 3300005543 Bacteria 527
79 Ga0070686_100759300 3300005544 Bacteria 778
80 Ga0070695_100062209 3300005545 Bacteria 2423
81 Ga0070696_100013709 3300005546 Bacteria 5443
82 Ga0070665_100979034 3300005548 Bacteria 858
83 Ga0070704_100525375 3300005549 Bacteria 1031
84 Ga0068855_100210671 3300005563 Bacteria 2184
85 Ga0068855_100454263 3300005563 Bacteria 1397
86 Ga0068855_100742786 3300005563 Bacteria 1047
87 Ga0068855_102211242 3300005563 Bacteria 552
88 Ga0070664_100105907 3300005564 Bacteria 2449
89 Ga0070664_100164382 3300005564 Bacteria 1966
90 Ga0070664_100291307 3300005564 Bacteria 1474
91 Ga0070664_100654928 3300005564 Bacteria 976
92 Ga0068857_100044117 3300005577 Bacteria 3954
93 Ga0068857_100123702 3300005577 Bacteria 2330
94 Ga0068857_100735999 3300005577 Bacteria 939
95 Ga0068857_100744445 3300005577 Bacteria 933
96 Ga0068857_101015093 3300005577 Bacteria 799
97 Ga0068854_100006731 3300005578 Bacteria 7324
98 Ga0068854_100355935 3300005578 Bacteria 1200
99 Ga0068854_100890762 3300005578 Bacteria 781
100 Ga0068856_100682688 3300005614 Bacteria 1047
101 Ga0068856_101289433 3300005614 Bacteria 746
102 Ga0068852_100002742 3300005616 Bacteria 12191
103 Ga0068852_100018079 3300005616 Bacteria 5546
104 Ga0068852_100266785 3300005616 Bacteria 1646
105 Ga0068864_100495147 3300005618 Bacteria 1175
106 Ga0068864_100868716 3300005618 Bacteria 889
107 Ga0068863_100024383 3300005841 Bacteria 5769
108 Ga0068863_100115167 3300005841 Bacteria 2561
109 Ga0068858_100063774 3300005842 Bacteria 3409
110 Ga0068858_100131894 3300005842 Bacteria 2343
111 Ga0068860_100341450 3300005843 Bacteria 1472
112 Ga0068862_100002492 3300005844 Bacteria 16289
113 Ga0068862_100102772 3300005844 Bacteria 2502
114 Ga0068862_100153873 3300005844 Bacteria 2048
115 Ga0068862_100260289 3300005844 Bacteria 1583
116 Ga0081540_1107817 3300005983 Bacteria 1185
117 Ga0070717_10088091 3300006028 Bacteria 2616
118 Ga0075365_10021778 3300006038 Bacteria 4004
119 Ga0075365_10054022 3300006038 Bacteria 2662
120 Ga0075365_10583498 3300006038 Bacteria 791
121 Ga0075368_10381293 3300006042 Bacteria 617
122 Ga0075363_100107209 3300006048 Bacteria 1550
123 Ga0075363_100143057 3300006048 Bacteria 1348
124 Ga0075364_10265618 3300006051 Bacteria 1167
125 Ga0070716_100384072 3300006173 Bacteria 1005
126 Ga0075367_10009681 3300006178 Bacteria 5047
127 Ga0075367_10094217 3300006178 Bacteria 1825
128 Ga0075369_10117962 3300006186 Bacteria 1200
129 Ga0075366_10103623 3300006195 Bacteria 1709
130 Ga0075366_10319573 3300006195 Bacteria 951
131 Ga0097621_100175276 3300006237 Bacteria 1851
132 Ga0097621_100889258 3300006237 Bacteria 829
133 Ga0075370_10003381 3300006353 Bacteria 7580
134 Ga0075370_10529970 3300006353 Bacteria 712
135 Ga0075370_10910602 3300006353 Bacteria 538
136 Ga0075428_100003477 3300006844 Bacteria 17232
137 Ga0075428_100036137 3300006844 Bacteria 5443
138 Ga0075428_101280148 3300006844 Bacteria 771
139 Ga0075430_100046455 3300006846 Bacteria 3667
140 Ga0075431_100001075 3300006847 Bacteria 24442
141 Ga0075429_100000334 3300006880 Bacteria 34171
142 Ga0068865_100082918 3300006881 Bacteria 2306
143 Ga0099823_1000009 3300006944 Bacteria 99451
144 Ga0099826_10395219 3300006948 Bacteria 673
145 Ga0075435_100611812 3300007076 Bacteria 945
146 Ga0105251_10134733 3300009011 Bacteria 1119
147 Ga0105244_10070577 3300009036 Bacteria 1743
148 Ga0105244_10084035 3300009036 Bacteria 1572
149 Ga0105244_10151978 3300009036 Bacteria 1109
150 Ga0105250_10005683 3300009092 Bacteria 5568
151 Ga0105250_10057962 3300009092 Bacteria 1554
152 Ga0105240_10015147 3300009093 Bacteria 10494
153 Ga0105240_10016001 3300009093 Bacteria 10168
154 Ga0105240_10019692 3300009093 Bacteria 9014
155 Ga0105240_11221325 3300009093 Bacteria 795
156 Ga0111539_10247370 3300009094 Bacteria 2076
157 Ga0114129_10014757 3300009147 Bacteria 11132
158 Ga0114129_10468654 3300009147 Bacteria 1650
159 Ga0105243_10097354 3300009148 Bacteria 2435
160 Ga0105243_10972223 3300009148 Bacteria 850
161 Ga0105241_11448946 3300009174 Bacteria 659
162 Ga0105242_10036321 3300009176 Bacteria 3952
163 Ga0105248_10191910 3300009177 Bacteria 2302
164 Ga0105248_10417179 3300009177 Bacteria 1511
165 Ga0105248_10820906 3300009177 Bacteria 1049
166 Ga0105238_10014401 3300009551 Bacteria 7994
167 Ga0105238_10352917 3300009551 Bacteria 1460
168 Ga0105238_11685639 3300009551 Bacteria 665
169 Ga0105249_10085952 3300009553 Bacteria 2932
170 Ga0105239_10950159 3300010375 Bacteria 987
171 Ga0105239_11169829 3300010375 Bacteria 886
172 Ga0105239_11955748 3300010375 Bacteria 680
173 Ga0105246_10189567 3300011119 Bacteria 1590
174 Ga0157345_1000052 3300012498 Bacteria 25093
175 Ga0157373_10024005 3300013100 Bacteria 4419
176 Ga0157373_10031653 3300013100 Bacteria 3807
177 Ga0157373_10047416 3300013100 Bacteria 3065
178 Ga0157373_10272510 3300013100 Bacteria 1198
179 Ga0157373_10635751 3300013100 Bacteria 778
180 Ga0157371_10072136 3300013102 Bacteria 2445
181 Ga0157371_11220883 3300013102 Bacteria 580
182 Ga0157371_11377705 3300013102 Bacteria 547
183 Ga0157370_10204812 3300013104 Bacteria 1830
184 Ga0157369_10000310 3300013105 Bacteria 65383
185 Ga0157369_10002441 3300013105 Bacteria 22331
186 Ga0157369_10027082 3300013105 Bacteria 6356
187 Ga0157369_10196894 3300013105 Bacteria 2116
188 Ga0157369_10285813 3300013105 Bacteria 1717
189 Ga0157369_10355770 3300013105 Bacteria 1521
190 Ga0157369_10539991 3300013105 Bacteria 1205
191 Ga0157369_11322390 3300013105 Bacteria 734
192 Ga0157374_10200668 3300013296 Bacteria 1953
193 Ga0163162_10003202 3300013306 Bacteria 15655
194 Ga0163162_12241803 3300013306 Bacteria 627
195 Ga0157372_10012201 3300013307 Bacteria 9153
196 Ga0157372_10015919 3300013307 Bacteria 8065
197 Ga0157372_10530283 3300013307 Bacteria 1373
198 Ga0157372_11788816 3300013307 Bacteria 707
199 Ga0157375_10610790 3300013308 Bacteria 1249
200 Ga0163163_11439095 3300014325 Bacteria 751
201 Ga0163163_11894911 3300014325 Bacteria 656
202 Ga0157380_10074367 3300014326 Bacteria 2758
203 Ga0157380_10130045 3300014326 Bacteria 2146
204 Ga0157380_10452739 3300014326 Bacteria 1233
205 Ga0157380_11702254 3300014326 Bacteria 688
206 Ga0182008_10489313 3300014497 Bacteria 675
207 Ga0182006_1001284 3300015261 Bacteria 15487
208 Ga0182007_10120587 3300015262 Bacteria 877
209 Ga0182005_1013156 3300015265 Bacteria 2329
210 Ga0163161_10320220 3300017792 Bacteria 1226
211 Ga0163161_10643660 3300017792 Bacteria 878
212 Ga0209563_101280 3300025230 Bacteria 6865
213 Ga0209148_1002133 3300025254 Bacteria 7386
214 Ga0209129_1000080 3300025258 Bacteria 186416
215 Ga0209455_1000467 3300025272 Bacteria 30363
216 Ga0209673_1000037 3300025273 Bacteria 313804
217 Ga0209673_1000117 3300025273 Bacteria 172081
218 Ga0209673_1003273 3300025273 Bacteria 9771
219 Ga0209673_1005570 3300025273 Bacteria 6296
220 Ga0209673_1025818 3300025273 Bacteria 1945
221 Ga0209025_1003312 3300025294 Bacteria 15491
222 Ga0209025_1010330 3300025294 Bacteria 6338
223 Ga0209025_1021478 3300025294 Bacteria 3474
224 Ga0209025_1084115 3300025294 Bacteria 1067
225 Ga0209564_1000581 3300025295 Bacteria 57912
226 Ga0209564_1005748 3300025295 Bacteria 6924
227 Ga0209564_1007900 3300025295 Bacteria 5375
228 Ga0209758_1002963 3300025297 Bacteria 16285
229 Ga0209758_1024155 3300025297 Bacteria 2719
230 Ga0209050_1001983 3300025298 Bacteria 19191
231 Ga0209050_1002868 3300025298 Bacteria 13648
232 Ga0209256_1000109 3300025299 Bacteria 184928
233 Ga0209256_1000656 3300025299 Bacteria 47104
234 Ga0209256_1001157 3300025299 Bacteria 29830
235 Ga0209256_1001879 3300025299 Bacteria 19359
236 Ga0209256_1004966 3300025299 Bacteria 7968
237 Ga0209256_1022913 3300025299 Bacteria 1878
238 Ga0209256_1082178 3300025299 Bacteria 702
239 Ga0207426_1002469 3300025302 Bacteria 11759
240 Ga0207426_1076373 3300025302 Bacteria 920
241 Ga0209051_1000845 3300025303 Bacteria 31409
242 Ga0209051_1001940 3300025303 Bacteria 15964
243 Ga0209051_1106521 3300025303 Bacteria 741
244 Ga0209257_1000049 3300025304 Bacteria 441224
245 Ga0209257_1001347 3300025304 Bacteria 29785
246 Ga0207696_1000051 3300025711 Bacteria 276833
247 Ga0207696_1010723 3300025711 Bacteria 3342
248 Ga0207696_1076987 3300025711 Bacteria 924
249 Ga0207655_1005367 3300025728 Bacteria 8733
250 Ga0207655_1010748 3300025728 Bacteria 5523
251 Ga0207655_1041915 3300025728 Bacteria 1956
252 Ga0207655_1051374 3300025728 Bacteria 1667
253 Ga0207655_1063013 3300025728 Bacteria 1423
254 Ga0207713_1061247 3300025735 Bacteria 1433
255 Ga0207713_1131662 3300025735 Bacteria 827
256 Ga0207680_10119456 3300025903 Bacteria 1722
257 Ga0207647_10018127 3300025904 Bacteria 4771
258 Ga0207647_10277415 3300025904 Bacteria 957
259 Ga0207647_10398338 3300025904 Bacteria 776
260 Ga0207647_10768965 3300025904 Bacteria 520
261 Ga0207705_10003365 3300025909 Bacteria 12153
262 Ga0207705_10004105 3300025909 Bacteria 11042
263 Ga0207705_10216753 3300025909 Bacteria 1453
264 Ga0207684_10078604 3300025910 Bacteria 2806
265 Ga0207654_11310197 3300025911 Bacteria 528
266 Ga0207707_10100779 3300025912 Bacteria 2524
267 Ga0207707_11004307 3300025912 Bacteria 684
268 Ga0207695_10022781 3300025913 Bacteria 7096
269 Ga0207695_10024131 3300025913 Bacteria 6851
270 Ga0207660_10514934 3300025917 Bacteria 971
271 Ga0207662_10357186 3300025918 Bacteria 982
272 Ga0207657_10003486 3300025919 Bacteria 16785
273 Ga0207657_10014426 3300025919 Bacteria 7718
274 Ga0207657_10151371 3300025919 Bacteria 1889
275 Ga0207657_10275109 3300025919 Bacteria 1338
276 Ga0207657_11135466 3300025919 Bacteria 596
277 Ga0207649_10135118 3300025920 Bacteria 1680
278 Ga0207649_10237898 3300025920 Bacteria 1306
279 Ga0207649_10243668 3300025920 Bacteria 1292
280 Ga0207649_10927974 3300025920 Bacteria 683
281 Ga0207652_10036592 3300025921 Bacteria 4150
282 Ga0207652_10131672 3300025921 Bacteria 2231
283 Ga0207652_10609517 3300025921 Bacteria 979
284 Ga0207681_10343268 3300025923 Bacteria 1193
285 Ga0207694_10001010 3300025924 Bacteria 24549
286 Ga0207694_10009321 3300025924 Bacteria 7406
287 Ga0207650_10060161 3300025925 Bacteria 2834
288 Ga0207659_10713977 3300025926 Bacteria 859
289 Ga0207700_10409874 3300025928 Bacteria 1189
290 Ga0207644_10000978 3300025931 Bacteria 18260
291 Ga0207644_10010905 3300025931 Bacteria 6003
292 Ga0207644_10094876 3300025931 Bacteria 2230
293 Ga0207690_10004900 3300025932 Bacteria 7896
294 Ga0207690_10290452 3300025932 Bacteria 1276
295 Ga0207706_10054320 3300025933 Bacteria 3535
296 Ga0207706_10299829 3300025933 Bacteria 1400
297 Ga0207706_10708198 3300025933 Bacteria 860
298 Ga0207706_11348630 3300025933 Bacteria 588
299 Ga0207686_10104538 3300025934 Bacteria 1897
300 Ga0207709_10023143 3300025935 Bacteria 3532
301 Ga0207670_10142129 3300025936 Bacteria 1771
302 Ga0207704_10536042 3300025938 Bacteria 949
303 Ga0207665_11252541 3300025939 Bacteria 592
304 Ga0207691_10887847 3300025940 Bacteria 747
305 Ga0207711_10205223 3300025941 Bacteria 1799
306 Ga0207689_10031290 3300025942 Bacteria 4432
307 Ga0207689_10849296 3300025942 Bacteria 770
308 Ga0207689_11379721 3300025942 Bacteria 591
309 Ga0207661_10490448 3300025944 Bacteria 1122
310 Ga0207661_10713737 3300025944 Bacteria 922
311 Ga0207679_10079279 3300025945 Bacteria 2504
312 Ga0207679_10124489 3300025945 Bacteria 2058
313 Ga0207679_10260037 3300025945 Bacteria 1480
314 Ga0207679_10368066 3300025945 Bacteria 1257
315 Ga0207679_10940376 3300025945 Bacteria 791
316 Ga0207667_10007513 3300025949 Bacteria 13084
317 Ga0207667_10936219 3300025949 Bacteria 856
318 Ga0207667_11030892 3300025949 Bacteria 809
319 Ga0207651_10027541 3300025960 Bacteria 3571
320 Ga0207651_10570638 3300025960 Bacteria 986
321 Ga0207712_10121493 3300025961 Bacteria 1977
322 Ga0207712_10617420 3300025961 Bacteria 939
323 Ga0207712_12003517 3300025961 Bacteria 518
324 Ga0207668_10275753 3300025972 Bacteria 1377
325 Ga0207668_10850331 3300025972 Bacteria 810
326 Ga0207668_10945240 3300025972 Bacteria 769
327 Ga0207668_11178046 3300025972 Bacteria 688
328 Ga0207640_10000633 3300025981 Bacteria 20639
329 Ga0207640_10028998 3300025981 Bacteria 3391
330 Ga0207658_10137548 3300025986 Bacteria 1972
331 Ga0207658_11099536 3300025986 Bacteria 726
332 Ga0207658_11161856 3300025986 Bacteria 705
333 Ga0207677_10568772 3300026023 Bacteria 990
334 Ga0207703_10220470 3300026035 Bacteria 1696
335 Ga0207639_10000181 3300026041 Bacteria 49444
336 Ga0207639_10118646 3300026041 Bacteria 2170
337 Ga0207639_12190506 3300026041 Bacteria 514
338 Ga0207678_10191150 3300026067 Bacteria 1749
339 Ga0207702_10047197 3300026078 Bacteria 3628
340 Ga0207702_10439494 3300026078 Bacteria 1264
341 Ga0207702_10542610 3300026078 Bacteria 1137
342 Ga0207641_10055494 3300026088 Bacteria 3364
343 Ga0207641_10070353 3300026088 Bacteria 3006
344 Ga0207641_11081325 3300026088 Bacteria 800
345 Ga0207676_10007783 3300026095 Bacteria 7620
346 Ga0207674_10016271 3300026116 Bacteria 8146
347 Ga0207674_10040272 3300026116 Bacteria 4841
348 Ga0207674_10621483 3300026116 Bacteria 1043
349 Ga0207675_100268274 3300026118 Bacteria 1656
350 Ga0207683_10009677 3300026121 Bacteria 8216
351 Ga0207698_10442013 3300026142 Bacteria 1253
352 Ga0207698_10484437 3300026142 Bacteria 1200
353 Ga0209389_1014263 3300027296 Bacteria 7218
354 Ga0209371_1010320 3300027312 Bacteria 2886
355 Ga0209969_1027187 3300027360 Bacteria 867
356 Ga0209813_10415125 3300027866 Bacteria 545
357 Ga0207428_10003328 3300027907 Bacteria 15627
358 Ga0268266_10843802 3300028379 Bacteria 885
359 Ga0268265_10019146 3300028380 Bacteria 4752
360 Ga0268265_10046894 3300028380 Bacteria 3233
361 Ga0268265_10982329 3300028380 Bacteria 833
362 Ga0307515_10527058 3300028794 Bacteria 791
363 Ga0307515_10745371 3300028794 Bacteria 598
364 Ga0268256_1011069 3300030500 Bacteria 2886
365 Ga0314311_1050680 3300030733 Bacteria 568
366 Ga0265325_10171569 3300031241 Bacteria 1015
367 Ga0307513_10241022 3300031456 Bacteria 1613
368 Ga0307509_10052108 3300031507 Bacteria 4370
369 Ga0307509_10692791 3300031507 Bacteria 686
370 Ga0307408_100133083 3300031548 Bacteria 1942
371 Ga0307408_100536519 3300031548 Bacteria 1030
372 Ga0307408_101184443 3300031548 Bacteria 712
373 Ga0307508_10403104 3300031616 Bacteria 959
374 Ga0316579_10313441 3300031691 Bacteria 759
375 Ga0316576_10355938 3300031727 Bacteria 1089
376 Ga0307516_10431512 3300031730 Bacteria 975
377 Ga0307516_10590278 3300031730 Bacteria 765
378 Ga0307516_10963301 3300031730 Bacteria 523
379 Ga0307405_10365195 3300031731 Bacteria 1118
380 Ga0307405_11375511 3300031731 Bacteria 616
381 Ga0307405_11659317 3300031731 Bacteria 565
382 Ga0307413_10004740 3300031824 Bacteria 5970
383 Ga0307413_10011197 3300031824 Bacteria 4396
384 Ga0307413_10567085 3300031824 Bacteria 924
385 Ga0307410_10063738 3300031852 Bacteria 2529
386 Ga0307410_10414799 3300031852 Bacteria 1091
387 Ga0307410_12030807 3300031852 Bacteria 513
388 Ga0307406_10419966 3300031901 Bacteria 1065
389 Ga0307406_10430194 3300031901 Bacteria 1054
390 Ga0307406_10487264 3300031901 Bacteria 997
391 Ga0307406_10918431 3300031901 Bacteria 746
392 Ga0307407_10002665 3300031903 Bacteria 7067
393 Ga0307407_10734802 3300031903 Bacteria 746
394 Ga0307412_10014518 3300031911 Bacteria 4646
395 Ga0307412_10040110 3300031911 Bacteria 3028
396 Ga0307412_10100196 3300031911 Bacteria 2047
397 Ga0307412_11227467 3300031911 Bacteria 672
398 Ga0307409_100000590 3300031995 Bacteria 15843
399 Ga0307416_100073768 3300032002 Bacteria 2847
400 Ga0307416_100184069 3300032002 Bacteria 1961
401 Ga0307416_102102536 3300032002 Bacteria 666
402 Ga0307414_10055855 3300032004 Bacteria 2766
403 Ga0307414_10102932 3300032004 Bacteria 2153
404 Ga0307414_10307675 3300032004 Bacteria 1344
405 Ga0307414_10366947 3300032004 Bacteria 1241
406 Ga0307414_10427082 3300032004 Bacteria 1157
407 Ga0307414_10842476 3300032004 Bacteria 838
408 Ga0307414_10959442 3300032004 Bacteria 786
409 Ga0307414_11201480 3300032004 Bacteria 702
410 Ga0307411_10004233 3300032005 Bacteria 6828
411 Ga0307411_10163473 3300032005 Bacteria 1670
412 Ga0307411_11662145 3300032005 Bacteria 590
413 Ga0307415_100003944 3300032126 Bacteria 7625
414 Ga0307415_100137096 3300032126 Bacteria 1863
415 Ga0307415_100177228 3300032126 Bacteria 1669
416 Ga0307415_100276214 3300032126 Bacteria 1379
417 Ga0307510_10001323 3300033180 Bacteria 27015
418 Ga0307510_10550295 3300033180 Bacteria 600
419 Ga0373930_0047838 3300034816 Bacteria 926
420 Ga0373934_0061583 3300035086 Bacteria 1495
421 Ga0373957_0287446 3300035120 Bacteria 696
422 Ga0316582_0188785 3300036647 Bacteria 1404
423 Ga0395899_0044169 3300037312 Bacteria 3321
424 Ga0395899_0287324 3300037312 Bacteria 1117
425 Ga0395899_0304654 3300037312 Bacteria 1077
426 Ga0395900_0067916 3300037418 Bacteria 3662
427 Ga0395900_0157309 3300037418 Bacteria 2320
428 Ga0395900_0166800 3300037418 Bacteria 2244
429 Ga0395900_0853211 3300037418 Bacteria 836
430 Ga0395900_1083263 3300037418 Bacteria 719
431 Ga0395900_1599776 3300037418 Bacteria 563
432 Ga0395898_0027920 3300037466 Bacteria 5660
433 Ga0395898_0078844 3300037466 Bacteria 3177
434 Ga0395898_0079979 3300037466 Bacteria 3152
435 Ga0395898_0539289 3300037466 Bacteria 1108
436 Ga0395898_0593232 3300037466 Bacteria 1050
437 Ga0395905_0002010 3300037471 Bacteria 23225
438 Ga0395905_0013726 3300037471 Bacteria 7754
439 Ga0395905_0146548 3300037471 Bacteria 2221
440 Ga0395905_0261726 3300037471 Bacteria 1615
441 Ga0395905_0417338 3300037471 Bacteria 1238
442 Ga0395905_0770138 3300037471 Bacteria 865
443 Ga0395905_0853427 3300037471 Bacteria 814
444 Ga0395905_0866608 3300037471 Bacteria 806
445 Ga0395905_1314548 3300037471 Bacteria 627
446 Ga0395905_1492189 3300037471 Bacteria 580
447 Ga0395905_1619365 3300037471 Bacteria 552
448 Ga0395901_0025775 3300038443 Bacteria 6036
449 Ga0395901_0051769 3300038443 Bacteria 4268
450 Ga0395901_0298965 3300038443 Bacteria 1669
451 Ga0395901_1777365 3300038443 Bacteria 566
452 Ga0436363_1121625 3300039450 Bacteria 665
453 Ga0439447_093068 3300041407 Bacteria 693
454 Ga0439461_0001777 3300041410 Bacteria 3374
455 Ga0439465_0000403 3300041413 Bacteria 12547
456 Ga0451791_1665661 3300041451 Bacteria 4918
457 Ga0451798_0608123 3300041458 Bacteria 776
458 Ga0451800_1610971 3300041459 Bacteria 817
459 Ga0451807_0510360 3300041486 Bacteria 3308
460 Ga0439445_0051067 3300042004 Bacteria 1117
461 Ga0439445_0195483 3300042004 Bacteria 596
462 Ga0439432_007592 3300042006 Bacteria 3833
463 Ga0439449_0377756 3300042007 Bacteria 537
464 Ga0439455_0026513 3300042012 Bacteria 1415
465 Ga0439455_0055098 3300042012 Bacteria 1045
466 Ga0439455_0206663 3300042012 Bacteria 569
467 Ga0439457_063186 3300042014 Bacteria 840
468 Ga0450914_000414 3300042118 Bacteria 1959
469 Ga0450914_022173 3300042118 Bacteria 715
470 Ga0450897_040572 3300042128 Bacteria 547
471 Ga0450894_026049 3300042131 Bacteria 802
472 Ga0450905_000656 3300042142 Bacteria 4255
473 Ga0450889_000037 3300042144 Bacteria 11669
474 Ga0450889_029751 3300042144 Bacteria 635
475 Ga0450906_066656 3300042145 Bacteria 643
476 Ga0450907_035050 3300042146 Bacteria 856
477 Ga0439458_0004015 3300042157 Bacteria 3398
478 Ga0450909_042490 3300042185 Bacteria 701
479 Ga0439464_0314947 3300042439 Bacteria 513
480 Ga0450916_049155 3300042530 Bacteria 661
481 Ga0450918_013478 3300042531 Bacteria 1422
482 Ga0450893_0013993 3300042532 Bacteria 1341
483 Ga0466969_0086865 3300044656 Bacteria 1485
484 Ga0466966_0008609 3300044684 Bacteria 6754
485 Ga0466961_0001441 3300044693 Bacteria 14761
486 Ga0466963_0040538 3300044694 Bacteria 3052
487 Ga0466963_0191139 3300044694 Bacteria 1430
488 Ga0466963_0246078 3300044694 Bacteria 1254
489 Ga0466964_0282825 3300044706 Bacteria 830
490 Ga0466971_0003172 3300044719 Bacteria 7011
491 Ga0466971_0026306 3300044719 Bacteria 2599
492 Ga0466971_0119740 3300044719 Bacteria 1218
493 Ga0466970_0191784 3300044765 Bacteria 1135
494 Ga0466957_0012308 3300044842 Bacteria 4953
495 Ga0466957_0090691 3300044842 Bacteria 1914
496 Ga0466957_0588157 3300044842 Bacteria 778
497 Ga0466960_0029259 3300044901 Bacteria 2527
498 Ga0466959_0004725 3300045049 Bacteria 9175
499 Ga0466959_0018173 3300045049 Bacteria 5160
500 Ga0451576_0000707 3300045051 Bacteria 67610
501 Ga0466958_0000157 3300045836 Bacteria 23916
502 Ga0466967_0015120 3300045976 Bacteria 6041
503 Ga0466967_0155394 3300045976 Bacteria 2142
504 Ga0495617_009662 3300046452 Bacteria 3308
505 Ga0495617_044824 3300046452 Bacteria 1475
506 Ga0495617_046768 3300046452 Bacteria 1441
507 Ga0495617_199847 3300046452 Bacteria 625
508 Ga0495627_000695 3300046453 Bacteria 25747
509 Ga0495627_001370 3300046453 Bacteria 14538
510 Ga0495627_002456 3300046453 Bacteria 8921
511 Ga0495627_192178 3300046453 Bacteria 563
512 Ga0495590_0014085 3300046457 Bacteria 2927
513 Ga0495590_0032456 3300046457 Bacteria 1826
514 Ga0495591_000662 3300046458 Bacteria 25480
515 Ga0495591_004084 3300046458 Bacteria 7269
516 Ga0495591_017663 3300046458 Bacteria 2441
517 Ga0495591_019643 3300046458 Bacteria 2255
518 Ga0495591_045323 3300046458 Bacteria 1226
519 Ga0495591_046392 3300046458 Bacteria 1207
520 Ga0495591_092953 3300046458 Bacteria 755
521 Ga0495629_0193716 3300046459 Bacteria 1406
522 Ga0495638_0001957 3300046460 Bacteria 17643
523 Ga0495638_0025148 3300046460 Bacteria 3874
524 Ga0495638_0052888 3300046460 Bacteria 2528
525 Ga0495638_0562359 3300046460 Bacteria 565
526 Ga0495653_0002927 3300046463 Bacteria 13659
527 Ga0495653_0024069 3300046463 Bacteria 4912
528 Ga0495653_0089532 3300046463 Bacteria 2254
529 Ga0495653_0138611 3300046463 Bacteria 1713
530 Ga0495650_0020843 3300046471 Bacteria 3185
531 Ga0495650_0122477 3300046471 Bacteria 956
532 Ga0495650_0131493 3300046471 Bacteria 912
533 Ga0495650_0241639 3300046471 Bacteria 616
534 Ga0495650_0245935 3300046471 Bacteria 609
535 Ga0495650_0335613 3300046471 Bacteria 501
536 Ga0495605_0001168 3300046474 Bacteria 17435
537 Ga0495605_0038614 3300046474 Bacteria 2395
538 Ga0495605_0127706 3300046474 Bacteria 1148
539 Ga0495605_0268359 3300046474 Bacteria 727
540 Ga0495639_0679438 3300046475 Bacteria 531
541 Ga0495584_0014450 3300046491 Bacteria 4022
542 Ga0495584_0105950 3300046491 Bacteria 1421
543 Ga0495585_0002349 3300046492 Bacteria 13593
544 Ga0495585_0004774 3300046492 Bacteria 8719
545 Ga0495585_0036146 3300046492 Bacteria 2788
546 Ga0495585_0052160 3300046492 Bacteria 2264
547 Ga0495596_0003136 3300046500 Bacteria 8522
548 Ga0495596_0029573 3300046500 Bacteria 2195
549 Ga0495596_0039132 3300046500 Bacteria 1873
550 Ga0495607_0006304 3300046501 Bacteria 8359
551 Ga0495607_0020367 3300046501 Bacteria 4194
552 Ga0495607_0040518 3300046501 Bacteria 2772
553 Ga0495607_0061578 3300046501 Bacteria 2132
554 Ga0495607_0068256 3300046501 Bacteria 1994
555 Ga0495607_0128439 3300046501 Bacteria 1322
556 Ga0495607_0197659 3300046501 Bacteria 997
557 Ga0495583_0006509 3300046506 Bacteria 7622
558 Ga0495583_0010574 3300046506 Bacteria 5367
559 Ga0495583_0167124 3300046506 Bacteria 905
560 Ga0495606_0001321 3300046507 Bacteria 33870
561 Ga0495606_0001801 3300046507 Bacteria 27281
562 Ga0495606_0003948 3300046507 Bacteria 15242
563 Ga0495606_0123786 3300046507 Bacteria 1544
564 Ga0495606_0172930 3300046507 Bacteria 1251
565 Ga0495606_0419400 3300046507 Bacteria 692
566 Ga0495610_0001087 3300046512 Bacteria 24865
567 Ga0495610_0005074 3300046512 Bacteria 9487
568 Ga0495610_0010564 3300046512 Bacteria 5725
569 Ga0495610_0080385 3300046512 Bacteria 1499
570 Ga0495616_0000042 3300046513 Bacteria 120923
571 Ga0495616_0000704 3300046513 Bacteria 24772
572 Ga0495616_0001304 3300046513 Bacteria 17440
573 Ga0495616_0002303 3300046513 Bacteria 12771
574 Ga0495616_0060078 3300046513 Bacteria 1868
575 Ga0495616_0107084 3300046513 Bacteria 1303
576 Ga0495616_0182289 3300046513 Bacteria 932
577 Ga0495616_0222700 3300046513 Bacteria 821
578 Ga0495616_0226938 3300046513 Bacteria 811
579 Ga0495620_0000532 3300046515 Bacteria 24382
580 Ga0495620_0032112 3300046515 Bacteria 2396
581 Ga0495620_0242797 3300046515 Bacteria 687
582 Ga0495631_0000229 3300046518 Bacteria 38438
583 Ga0495631_0000547 3300046518 Bacteria 25286
584 Ga0495631_0182701 3300046518 Bacteria 898
585 Ga0495632_0005221 3300046519 Bacteria 8656
586 Ga0495632_0006967 3300046519 Bacteria 7175
587 Ga0495632_0010870 3300046519 Bacteria 5353
588 Ga0495632_0013653 3300046519 Bacteria 4623
589 Ga0495632_0295697 3300046519 Bacteria 719
590 Ga0495632_0377121 3300046519 Bacteria 621
591 Ga0495637_0000839 3300046520 Bacteria 20292
592 Ga0495637_0001641 3300046520 Bacteria 12936
593 Ga0495637_0002034 3300046520 Bacteria 11401
594 Ga0495637_0008706 3300046520 Bacteria 4975
595 Ga0495637_0021867 3300046520 Bacteria 2925
596 Ga0495637_0045936 3300046520 Bacteria 1849
597 Ga0495643_0004653 3300046522 Bacteria 9531
598 Ga0495643_0036166 3300046522 Bacteria 2714
599 Ga0495643_0037736 3300046522 Bacteria 2648
600 Ga0495643_0066324 3300046522 Bacteria 1904
601 Ga0495643_0070683 3300046522 Bacteria 1832
602 Ga0495643_0288195 3300046522 Bacteria 753
603 Ga0495644_0051968 3300046523 Bacteria 1538
604 Ga0495648_0009698 3300046524 Bacteria 7420
605 Ga0495648_0068137 3300046524 Bacteria 2078
606 Ga0495648_0122201 3300046524 Bacteria 1398
607 Ga0495648_0130273 3300046524 Bacteria 1338
608 Ga0495648_0335667 3300046524 Bacteria 695
609 Ga0495648_0425661 3300046524 Bacteria 587
610 Ga0495666_0010713 3300046526 Bacteria 4573
611 Ga0495642_0011651 3300046528 Bacteria 3384
612 Ga0495654_0000444 3300046530 Bacteria 35120
613 Ga0495654_0020054 3300046530 Bacteria 3489
614 Ga0495654_0069039 3300046530 Bacteria 1678
615 Ga0495654_0074879 3300046530 Bacteria 1598
616 Ga0495654_0321522 3300046530 Bacteria 627
617 Ga0495587_0053104 3300046536 Bacteria 2390
618 Ga0495609_0001751 3300046538 Bacteria 13969
619 Ga0495609_0004084 3300046538 Bacteria 8130
620 Ga0495609_0021618 3300046538 Bacteria 2969
621 Ga0495609_0036842 3300046538 Bacteria 2208
622 Ga0495609_0075316 3300046538 Bacteria 1479
623 Ga0495609_0134296 3300046538 Bacteria 1058
624 Ga0495597_0002633 3300046542 Bacteria 11160
625 Ga0495597_0003247 3300046542 Bacteria 9651
626 Ga0495597_0232386 3300046542 Bacteria 729
627 Ga0495645_0032397 3300046543 Bacteria 3813
628 Ga0495622_0000537 3300046557 Bacteria 22795
629 Ga0495622_0039129 3300046557 Bacteria 2208
630 Ga0495622_0168502 3300046557 Bacteria 985
631 Ga0495622_0226396 3300046557 Bacteria 827
632 Ga0495633_0000867 3300046558 Bacteria 26255
633 Ga0495633_0004843 3300046558 Bacteria 8427
634 Ga0495633_0091052 3300046558 Bacteria 1418
635 Ga0495668_0000033 3300046616 Bacteria 254277
636 Ga0495668_0002790 3300046616 Bacteria 13912
637 Ga0495668_0002819 3300046616 Bacteria 13819
638 Ga0495668_0113588 3300046616 Bacteria 1481
639 Ga0495668_0160963 3300046616 Bacteria 1229
640 Ga0495668_0254387 3300046616 Bacteria 961
641 Ga0495634_0025019 3300046642 Bacteria 4184
642 Ga0495611_0000468 3300046648 Bacteria 24110
643 Ga0495611_0006667 3300046648 Bacteria 4913
644 Ga0495611_0084121 3300046648 Bacteria 1466
645 Ga0495611_0347910 3300046648 Bacteria 680
646 Ga0495625_0000014 3300046660 Bacteria 323486
647 Ga0495625_0000032 3300046660 Bacteria 233135
648 Ga0495625_0006003 3300046660 Bacteria 10914
649 Ga0495625_0016634 3300046660 Bacteria 5780
650 Ga0495625_0032684 3300046660 Bacteria 3855
651 Ga0495625_0059700 3300046660 Bacteria 2704
652 Ga0495625_0120424 3300046660 Bacteria 1786
653 Ga0495625_0657696 3300046660 Bacteria 623
654 Ga0495625_0691110 3300046660 Bacteria 603
655 Ga0495625_0820312 3300046660 Bacteria 539
656 Ga0495661_0028015 3300046665 Bacteria 3612
657 Ga0495661_0067472 3300046665 Bacteria 2101
658 Ga0495661_0071801 3300046665 Bacteria 2021
659 Ga0495661_0184477 3300046665 Bacteria 1103
660 Ga0495661_0515255 3300046665 Bacteria 569
661 Ga0495588_0090822 3300046674 Bacteria 1600
662 Ga0495646_0081794 3300046680 Bacteria 1880
663 Ga0495669_0098426 3300046684 Bacteria 1357
664 Ga0495613_0010857 3300046689 Bacteria 6757
665 Ga0495624_0001286 3300046690 Bacteria 19787
666 Ga0495624_0221077 3300046690 Bacteria 1148
667 Ga0495670_0000868 3300046691 Bacteria 14664
668 Ga0495670_0064032 3300046691 Bacteria 1852
669 Ga0495671_0012713 3300046692 Bacteria 4587
670 Ga0495671_0015611 3300046692 Bacteria 4065
671 Ga0495671_0036514 3300046692 Bacteria 2488
672 Ga0495671_0040326 3300046692 Bacteria 2354
673 Ga0495671_0041873 3300046692 Bacteria 2304
674 Ga0495671_0125879 3300046692 Bacteria 1249
675 Ga0495649_0005359 3300046694 Bacteria 8178
676 Ga0495649_0008701 3300046694 Bacteria 6090
677 Ga0495649_0011931 3300046694 Bacteria 5078
678 Ga0495649_0014874 3300046694 Bacteria 4446
679 Ga0495649_0025203 3300046694 Bacteria 3312
680 Ga0495649_0029499 3300046694 Bacteria 3033
681 Ga0495649_0039808 3300046694 Bacteria 2577
682 Ga0495649_0189302 3300046694 Bacteria 1071
683 Ga0495589_0002576 3300046794 Bacteria 10080
684 Ga0495589_0046180 3300046794 Bacteria 2163
685 Ga0495589_0064063 3300046794 Bacteria 1802
686 Ga0495600_0041644 3300046809 Bacteria 2993
687 Ga0495660_0001455 3300046810 Bacteria 16179
688 Ga0495660_0008129 3300046810 Bacteria 6160
689 Ga0495660_0016083 3300046810 Bacteria 4315
690 Ga0495660_0022703 3300046810 Bacteria 3580
691 Ga0495660_0083573 3300046810 Bacteria 1670
692 Ga0495660_0104049 3300046810 Bacteria 1457
693 Ga0495660_0194128 3300046810 Bacteria 973
694 Ga0495660_0341172 3300046810 Bacteria 668
695 Ga0495672_0003388 3300047320 Bacteria 13709
696 Ga0495672_0025786 3300047320 Bacteria 3757
697 Ga0495672_0184653 3300047320 Bacteria 1053
698 Ga0495676_0022364 3300047321 Bacteria 5501
699 Ga0495680_0021555 3300047322 Bacteria 5392
700 Ga0495683_0012750 3300047323 Bacteria 4411
701 Ga0495683_0035832 3300047323 Bacteria 2521
702 Ga0495683_0039231 3300047323 Bacteria 2394
703 Ga0495683_0067207 3300047323 Bacteria 1765
704 Ga0495683_0141858 3300047323 Bacteria 1125
705 Ga0495687_003196 3300047443 Bacteria 12157
706 Ga0495687_004060 3300047443 Bacteria 10140
707 Ga0495677_0029578 3300047445 Bacteria 1992
708 Ga0495679_003112 3300047446 Bacteria 8123
709 Ga0495679_003907 3300047446 Bacteria 7047
710 Ga0495679_008516 3300047446 Bacteria 4161
711 Ga0495679_074448 3300047446 Bacteria 972
712 Ga0495685_003890 3300047447 Bacteria 4794
713 Ga0495673_0000753 3300047469 Bacteria 30736
714 Ga0495673_0027210 3300047469 Bacteria 2724
715 Ga0495673_0104462 3300047469 Bacteria 1140
716 Ga0495673_0167187 3300047469 Bacteria 840
717 Ga0495673_0206659 3300047469 Bacteria 732
718 Ga0495681_0001461 3300047470 Bacteria 17673
719 Ga0495681_0002502 3300047470 Bacteria 13099
720 Ga0495681_0007017 3300047470 Bacteria 7277
721 Ga0495681_0019921 3300047470 Bacteria 3649
722 Ga0495681_0031407 3300047470 Bacteria 2688
723 Ga0495681_0052867 3300047470 Bacteria 1903
724 Ga0495681_0173821 3300047470 Bacteria 889
725 Ga0495681_0188834 3300047470 Bacteria 842
726 Ga0495684_0082176 3300047471 Bacteria 2444
727 Ga0495686_0015781 3300047472 Bacteria 5142
728 Ga0495686_0019521 3300047472 Bacteria 4529
729 Ga0495686_0083392 3300047472 Bacteria 1949
730 Ga0495686_0546353 3300047472 Bacteria 605
731 Ga0495593_0063897 3300047673 Bacteria 1921
732 Ga0495602_0005007 3300048088 Bacteria 13890
733 Ga0495626_0001094 3300048091 Bacteria 22950
734 Ga0495626_0003316 3300048091 Bacteria 10385
735 Ga0495626_0004857 3300048091 Bacteria 8087
736 Ga0495626_0010834 3300048091 Bacteria 4843
737 Ga0495626_0011130 3300048091 Bacteria 4769
738 Ga0495626_0128203 3300048091 Bacteria 1085
739 Ga0496100_0169522 3300048903 Bacteria 1571
740 Ga0496101_0117724 3300048904 Bacteria 2006
741 Ga0496102_0453094 3300048905 Bacteria 1204
742 Ga0496103_0086160 3300048906 Bacteria 1980
743 Ga0496104_0038060 3300048907 Bacteria 4499
744 Ga0496104_0043329 3300048907 Bacteria 4227
745 Ga0496104_0113266 3300048907 Bacteria 2601
746 Ga0496105_0062100 3300048908 Bacteria 3083
747 Ga0496106_0022929 3300048909 Bacteria 4637
748 Ga0496106_0054336 3300048909 Bacteria 3026
749 Ga0496106_0189450 3300048909 Bacteria 1635
750 Ga0496107_0159890 3300048910 Bacteria 1669
751 Ga0496108_0004780 3300048911 Bacteria 10923
752 Ga0496108_0040427 3300048911 Bacteria 3888
753 Ga0496109_1138860 3300048912 Bacteria 717
754 Ga0496110_0054042 3300048913 Bacteria 3532
755 Ga0496110_0155609 3300048913 Bacteria 2071
756 Ga0496110_1547932 3300048913 Bacteria 573
757 Ga0496111_0038150 3300048914 Bacteria 3441
758 Ga0496111_0389402 3300048914 Bacteria 1030
759 Ga0496112_0162148 3300048915 Bacteria 2202
760 Ga0496112_0372031 3300048915 Bacteria 1370
761 Ga0496113_0017769 3300048916 Bacteria 4944
762 Ga0496113_0056174 3300048916 Bacteria 2954
763 Ga0496113_0208800 3300048916 Bacteria 1554
764 Ga0496114_0036664 3300048917 Bacteria 4054
765 Ga0496116_0003545 3300048919 Bacteria 15358
766 Ga0496116_0017743 3300048919 Bacteria 5514
767 Ga0496116_0088921 3300048919 Bacteria 1886
768 Ga0496116_0266902 3300048919 Bacteria 839
769 Ga0496117_0027194 3300048920 Bacteria 4463
770 Ga0496117_0293362 3300048920 Bacteria 865
771 Ga0496118_0008537 3300048921 Bacteria 10568
772 Ga0496118_0301313 3300048921 Bacteria 880
773 Ga0496119_0020858 3300048922 Bacteria 4756
774 Ga0496119_0117583 3300048922 Bacteria 1465
775 Ga0496120_0030183 3300048923 Bacteria 3299
776 Ga0496121_0013324 3300048924 Bacteria 8849
777 Ga0496121_0232089 3300048924 Bacteria 1291
778 Ga0496121_0232770 3300048924 Bacteria 1289
779 Ga0496121_0286096 3300048924 Bacteria 1125
780 Ga0496122_0014141 3300048925 Bacteria 7738
781 Ga0496122_0032295 3300048925 Bacteria 4333
782 Ga0496122_0034042 3300048925 Bacteria 4177
783 Ga0496122_0058737 3300048925 Bacteria 2844
784 Ga0496122_0271984 3300048925 Bacteria 932
785 Ga0496123_0000020 3300048926 Bacteria 388748
786 Ga0496123_0046923 3300048926 Bacteria 2924
787 Ga0496123_0132554 3300048926 Bacteria 1377
788 Ga0496123_0157473 3300048926 Bacteria 1215
789 Ga0496123_0249094 3300048926 Bacteria 877
790 Ga0496124_0003161 3300048927 Bacteria 20373
791 Ga0496124_0158351 3300048927 Bacteria 1768
792 Ga0496124_0261992 3300048927 Bacteria 1271
793 Ga0496125_0025002 3300048928 Bacteria 5480
794 Ga0496125_0110891 3300048928 Bacteria 1987
795 Ga0496125_0171203 3300048928 Bacteria 1459
796 Ga0496125_0284690 3300048928 Bacteria 1021
797 Ga0496126_0063321 3300048929 Bacteria 3315
798 Ga0496126_0082410 3300048929 Bacteria 2842
799 Ga0496126_0341537 3300048929 Bacteria 1226
800 Ga0495678_000954 3300049459 Bacteria 25047
801 Ga0495678_002489 3300049459 Bacteria 12416
802 Ga0495678_009254 3300049459 Bacteria 4893
803 Ga0495678_063984 3300049459 Bacteria 1371
804 Ga0495678_110956 3300049459 Bacteria 935
805 Ga0495678_185707 3300049459 Bacteria 649
806 Ga0495678_192423 3300049459 Bacteria 633
807 Ga0495682_0000556 3300049460 Bacteria 25639
808 Ga0495682_0014059 3300049460 Bacteria 3038
809 Ga0501031_0028830 3300049568 Bacteria 3618
810 Ga0501031_0057700 3300049568 Bacteria 2529
811 Ga0501032_0053899 3300049569 Bacteria 2707
812 Ga0501032_0140764 3300049569 Bacteria 1588
813 Ga0501033_0083547 3300049570 Bacteria 2340
814 Ga0501033_0479752 3300049570 Bacteria 861
815 Ga0501034_0068653 3300049571 Bacteria 3554
816 Ga0501034_0112795 3300049571 Bacteria 2708
817 Ga0501034_0711989 3300049571 Bacteria 902
818 Ga0501036_0058022 3300049572 Bacteria 3279
819 Ga0501036_0209107 3300049572 Bacteria 1640
820 Ga0501036_0732426 3300049572 Bacteria 816
821 Ga0501037_0012878 3300049573 Bacteria 6165
822 Ga0501037_0030893 3300049573 Bacteria 3956
823 Ga0501037_0130195 3300049573 Bacteria 1804
824 Ga0501038_0025722 3300049574 Bacteria 5243
825 Ga0501038_0028034 3300049574 Bacteria 5003
826 Ga0501039_0042948 3300049575 Bacteria 3492
827 Ga0501039_0054312 3300049575 Bacteria 3100
828 Ga0501040_0571443 3300049576 Bacteria 816
829 Ga0501042_0116182 3300049578 Bacteria 1926
830 Ga0501043_0098532 3300049579 Bacteria 2297
831 Ga0501043_0216829 3300049579 Bacteria 1482
832 Ga0501043_0426904 3300049579 Bacteria 999
833 Ga0501046_0037115 3300049580 Bacteria 3917
834 Ga0501047_0035677 3300049581 Bacteria 4804
835 Ga0501047_0063768 3300049581 Bacteria 3554
836 Ga0501048_0146260 3300049582 Bacteria 1671
837 Ga0501069_0030732 3300049585 Bacteria 2951
838 Ga0501070_0011113 3300049586 Bacteria 7598
839 Ga0501070_0063171 3300049586 Bacteria 3067
840 Ga0501070_0206570 3300049586 Bacteria 1612
841 Ga0501070_0287193 3300049586 Bacteria 1341
842 Ga0501071_0448376 3300049587 Bacteria 987
843 Ga0501071_1021687 3300049587 Bacteria 639
844 Ga0501073_0101081 3300049589 Bacteria 2002
845 Ga0501073_0131100 3300049589 Bacteria 1738
846 Ga0501073_0236535 3300049589 Bacteria 1261
847 Ga0501074_0124175 3300049590 Bacteria 1846
848 Ga0501074_0298882 3300049590 Bacteria 1143
849 Ga0501075_0807908 3300049591 Bacteria 714
850 Ga0501076_0149012 3300049592 Bacteria 1903
851 Ga0501076_0847889 3300049592 Bacteria 754
852 Ga0501077_0381007 3300049593 Bacteria 901
853 Ga0501202_054665 3300049652 Bacteria 891
854 Ga0501217_246076 3300049661 Bacteria 574
855 Ga0501080_0031412 3300049742 Bacteria 4948
856 Ga0501080_0882580 3300049742 Bacteria 780
857 Ga0501083_0063591 3300049744 Bacteria 2461
858 Ga0501035_0021781 3300049822 Bacteria 5891
859 Ga0501035_0127290 3300049822 Bacteria 2223
860 Ga0501035_0365832 3300049822 Bacteria 1204
861 Ga0501035_0990425 3300049822 Bacteria 661
862 Ga0501044_0251622 3300049823 Bacteria 1707
863 Ga0501044_0683548 3300049823 Bacteria 913
864 nmdc:mga03683_492934_c1 3300050489 Bacteria 593
865 nmdc:mga03n38_17318_c1 3300050490 Bacteria 2819
866 nmdc:mga00v17_504546_c1 3300050491 Bacteria 784
867 nmdc:mga00v17_636387_c1 3300050491 Bacteria 686
868 nmdc:mga0yw44_314513_c1 3300050492 Bacteria 1051
869 nmdc:mga0yw44_711061_c1 3300050492 Bacteria 682
870 nmdc:mga0k408_16913_c1 3300050493 Bacteria 4056
871 nmdc:mga0k408_549752_c1 3300050493 Bacteria 682
872 nmdc:mga06z11_224023_c1 3300050494 Bacteria 1100
873 nmdc:mga06z11_236255_c1 3300050494 Bacteria 1072
874 nmdc:mga04h51_74183_c1 3300050495 Bacteria 1194
875 nmdc:mga07m45_1099_c1 3300050496 Bacteria 12074
876 nmdc:mga07m45_112250_c1 3300050496 Bacteria 1571
877 nmdc:mga07m45_816968_c1 3300050496 Bacteria 534
878 nmdc:mga09592_1721871_c1 3300050508 Bacteria 505
879 nmdc:mga09592_1938_c1 3300050508 Bacteria 16654
880 nmdc:mga0qj67_209826_c1 3300050509 Bacteria 1582
881 nmdc:mga06r32_62_c1 3300050510 Bacteria 68174
882 nmdc:mga08y16_269637_c1 3300050511 Bacteria 1757
883 nmdc:mga08y16_4022_c1 3300050511 Bacteria 15340
884 nmdc:mga08y16_40823_c1 3300050511 Bacteria 4861
885 nmdc:mga0sz30_78724_c1 3300050516 Bacteria 1425
886 Ga0500650_0239442 3300053098 Bacteria 817
887 Ga0500572_000400 3300053111 Bacteria 15243
888 Ga0500594_0010415 3300053118 Bacteria 2158
889 Ga0500658_0001972 3300053134 Bacteria 8015
890 Ga0500658_0002314 3300053134 Bacteria 7382
891 Ga0500658_0038836 3300053134 Bacteria 1899
892 Ga0500568_0012118 3300053139 Bacteria 3975
893 Ga0500586_061357 3300053145 Bacteria 1308
894 Ga0500604_0000177 3300053151 Bacteria 18255
895 Ga0500616_0000011 3300053153 Bacteria 732880
896 Ga0500636_0039342 3300053177 Bacteria 2796
897 Ga0590077_123937 3300059426 Bacteria 612
898 Ga0587069_066719 3300059642 Bacteria 675
899 Ga0501082_0360576 3300060353 Bacteria 1268
900 Ga0466962_0001092 3300061719 Bacteria 12476
901 Ga0466962_0032454 3300061719 Bacteria 2500
902 Ga0530510_0547387 3300061734 Bacteria 879
903 Ga0209257_1000170
904 JGI24735J21928_10011016
905 JGI24735J21928_10073659
906 JGI25152J39213_1002426
907 JGI25151J46595_10091505
908 rootH2_10060589
909 rootH1_10005225
910 rootH1_10014341
911 rootH1_10029371
912 rootH1_10043722
913 JGI25160J50197_1015076
914 Ga0055526_1020884
915 Ga0055524_1003534
916 Ga0055524_1008747
917 Ga0055524_1014639
918 Ga0055524_1019646
919 Ga0055524_1084418
920 Ga0055528_1000475
921 Ga0055528_1003617
922 Ga0055528_1011147
923 Ga0055528_1090489
924 Ga0055531_10000002
925 Ga0055531_10001058
926 Ga0055531_10008411
927 Ga0065165_1004191
928 Ga0065165_1011457
929 Ga0065704_10168884
930 Ga0065707_10087132
931 Ga0070658_10017036
932 Ga0070658_10057334
933 Ga0070670_100117899
934 Ga0070666_10208579
935 Ga0070682_100472831
936 Ga0068868_100020866
937 Ga0070660_100008686
938 Ga0070660_100068646
939 Ga0070660_100708682
940 Ga0070660_101069361
941 Ga0070689_100457419
942 Ga0070687_100057783
943 Ga0070661_100050772
944 Ga0070661_100169133
945 Ga0070661_100183810
946 Ga0070661_100430351
947 Ga0070661_100670641
948 Ga0070661_100720653
949 Ga0070692_10874066
950 Ga0070668_101262275
951 Ga0070668_101671731
952 Ga0070669_100056577
953 Ga0070669_100168372
954 Ga0070669_100191230
955 Ga0070669_101048602
956 Ga0070671_100008751
957 Ga0070671_100087030
958 Ga0070671_100445573
959 Ga0070673_100110750
960 Ga0070673_100498116
961 Ga0070659_100264336
962 Ga0070659_101313775
963 Ga0070667_100153388
964 Ga0070667_100201231
965 Ga0070667_100312753
966 Ga0070713_100467204
967 Ga0070710_10913216
968 Ga0070708_101618107
969 Ga0070663_100334556
970 Ga0070662_100939768
971 Ga0070662_100977375
972 Ga0070681_11281180
973 Ga0070685_10001187
974 Ga0070706_100170084
975 Ga0070679_100075528
976 Ga0070679_100474960
977 Ga0070679_101384469
978 Ga0068853_102116744
979 Ga0070672_100646831
980 Ga0070672_101965724
981 Ga0070686_100759300
982 Ga0070695_100062209
983 Ga0070696_100013709
984 Ga0070665_100979034
985 Ga0070704_100525375
986 Ga0068855_100210671
987 Ga0068855_100454263
988 Ga0068855_100742786
989 Ga0068855_102211242
990 Ga0070664_100105907
991 Ga0070664_100164382
992 Ga0070664_100291307
993 Ga0070664_100654928
994 Ga0068857_100044117
995 Ga0068857_100123702
996 Ga0068857_100735999
997 Ga0068857_100744445
998 Ga0068857_101015093
999 Ga0068854_100006731
1000 Ga0068854_100355935
1001 Ga0068854_100890762
1002 Ga0068856_100682688
1003 Ga0068856_101289433
1004 Ga0068852_100002742
1005 Ga0068852_100018079
1006 Ga0068852_100266785
1007 Ga0068864_100495147
1008 Ga0068864_100868716
1009 Ga0068863_100024383
1010 Ga0068863_100115167
1011 Ga0068858_100063774
1012 Ga0068858_100131894
1013 Ga0068860_100341450
1014 Ga0068862_100002492
1015 Ga0068862_100102772
1016 Ga0068862_100153873
1017 Ga0068862_100260289
1018 Ga0081540_1107817
1019 Ga0070717_10088091
1020 Ga0075365_10021778
1021 Ga0075365_10054022
1022 Ga0075365_10583498
1023 Ga0075368_10381293
1024 Ga0075363_100107209
1025 Ga0075363_100143057
1026 Ga0075364_10265618
1027 Ga0070716_100384072
1028 Ga0075367_10009681
1029 Ga0075367_10094217
1030 Ga0075369_10117962
1031 Ga0075366_10103623
1032 Ga0075366_10319573
1033 Ga0097621_100175276
1034 Ga0097621_100889258
1035 Ga0075370_10003381
1036 Ga0075370_10529970
1037 Ga0075370_10910602
1038 Ga0075428_100003477
1039 Ga0075428_100036137
1040 Ga0075428_101280148
1041 Ga0075430_100046455
1042 Ga0075431_100001075
1043 Ga0075429_100000334
1044 Ga0068865_100082918
1045 Ga0099823_1000009
1046 Ga0099826_10395219
1047 Ga0075435_100611812
1048 Ga0105251_10134733
1049 Ga0105244_10070577
1050 Ga0105244_10084035
1051 Ga0105244_10151978
1052 Ga0105250_10005683
1053 Ga0105250_10057962
1054 Ga0105240_10015147
1055 Ga0105240_10016001
1056 Ga0105240_10019692
1057 Ga0105240_11221325
1058 Ga0111539_10247370
1059 Ga0114129_10014757
1060 Ga0114129_10468654
1061 Ga0105243_10097354
1062 Ga0105243_10972223
1063 Ga0105241_11448946
1064 Ga0105242_10036321
1065 Ga0105248_10191910
1066 Ga0105248_10417179
1067 Ga0105248_10820906
1068 Ga0105238_10014401
1069 Ga0105238_10352917
1070 Ga0105238_11685639
1071 Ga0105249_10085952
1072 Ga0105239_10950159
1073 Ga0105239_11169829
1074 Ga0105239_11955748
1075 Ga0105246_10189567
1076 Ga0157345_1000052
1077 Ga0157373_10024005
1078 Ga0157373_10031653
1079 Ga0157373_10047416
1080 Ga0157373_10272510
1081 Ga0157373_10635751
1082 Ga0157371_10072136
1083 Ga0157371_11220883
1084 Ga0157371_11377705
1085 Ga0157370_10204812
1086 Ga0157369_10000310
1087 Ga0157369_10002441
1088 Ga0157369_10027082
1089 Ga0157369_10196894
1090 Ga0157369_10285813
1091 Ga0157369_10355770
1092 Ga0157369_10539991
1093 Ga0157369_11322390
1094 Ga0157374_10200668
1095 Ga0163162_10003202
1096 Ga0163162_12241803
1097 Ga0157372_10012201
1098 Ga0157372_10015919
1099 Ga0157372_10530283
1100 Ga0157372_11788816
1101 Ga0157375_10610790
1102 Ga0163163_11439095
1103 Ga0163163_11894911
1104 Ga0157380_10074367
1105 Ga0157380_10130045
1106 Ga0157380_10452739
1107 Ga0157380_11702254
1108 Ga0182008_10489313
1109 Ga0182006_1001284
1110 Ga0182007_10120587
1111 Ga0182005_1013156
1112 Ga0163161_10320220
1113 Ga0163161_10643660
1114 Ga0209563_101280
1115 Ga0209148_1002133
1116 Ga0209129_1000080
1117 Ga0209455_1000467
1118 Ga0209673_1000037
1119 Ga0209673_1000117
1120 Ga0209673_1003273
1121 Ga0209673_1005570
1122 Ga0209673_1025818
1123 Ga0209025_1003312
1124 Ga0209025_1010330
1125 Ga0209025_1021478
1126 Ga0209025_1084115
1127 Ga0209564_1000581
1128 Ga0209564_1005748
1129 Ga0209564_1007900
1130 Ga0209758_1002963
1131 Ga0209758_1024155
1132 Ga0209050_1001983
1133 Ga0209050_1002868
1134 Ga0209256_1000109
1135 Ga0209256_1000656
1136 Ga0209256_1001157
1137 Ga0209256_1001879
1138 Ga0209256_1004966
1139 Ga0209256_1022913
1140 Ga0209256_1082178
1141 Ga0207426_1002469
1142 Ga0207426_1076373
1143 Ga0209051_1000845
1144 Ga0209051_1001940
1145 Ga0209051_1106521
1146 Ga0209257_1000049
1147 Ga0209257_1001347
1148 Ga0207696_1000051
1149 Ga0207696_1010723
1150 Ga0207696_1076987
1151 Ga0207655_1005367
1152 Ga0207655_1010748
1153 Ga0207655_1041915
1154 Ga0207655_1051374
1155 Ga0207655_1063013
1156 Ga0207713_1061247
1157 Ga0207713_1131662
1158 Ga0207680_10119456
1159 Ga0207647_10018127
1160 Ga0207647_10277415
1161 Ga0207647_10398338
1162 Ga0207647_10768965
1163 Ga0207705_10003365
1164 Ga0207705_10004105
1165 Ga0207705_10216753
1166 Ga0207684_10078604
1167 Ga0207654_11310197
1168 Ga0207707_10100779
1169 Ga0207707_11004307
1170 Ga0207695_10022781
1171 Ga0207695_10024131
1172 Ga0207660_10514934
1173 Ga0207662_10357186
1174 Ga0207657_10003486
1175 Ga0207657_10014426
1176 Ga0207657_10151371
1177 Ga0207657_10275109
1178 Ga0207657_11135466
1179 Ga0207649_10135118
1180 Ga0207649_10237898
1181 Ga0207649_10243668
1182 Ga0207649_10927974
1183 Ga0207652_10036592
1184 Ga0207652_10131672
1185 Ga0207652_10609517
1186 Ga0207681_10343268
1187 Ga0207694_10001010
1188 Ga0207694_10009321
1189 Ga0207650_10060161
1190 Ga0207659_10713977
1191 Ga0207700_10409874
1192 Ga0207644_10000978
1193 Ga0207644_10010905
1194 Ga0207644_10094876
1195 Ga0207690_10004900
1196 Ga0207690_10290452
1197 Ga0207706_10054320
1198 Ga0207706_10299829
1199 Ga0207706_10708198
1200 Ga0207706_11348630
1201 Ga0207686_10104538
1202 Ga0207709_10023143
1203 Ga0207670_10142129
1204 Ga0207704_10536042
1205 Ga0207665_11252541
1206 Ga0207691_10887847
1207 Ga0207711_10205223
1208 Ga0207689_10031290
1209 Ga0207689_10849296
1210 Ga0207689_11379721
1211 Ga0207661_10490448
1212 Ga0207661_10713737
1213 Ga0207679_10079279
1214 Ga0207679_10124489
1215 Ga0207679_10260037
1216 Ga0207679_10368066
1217 Ga0207679_10940376
1218 Ga0207667_10007513
1219 Ga0207667_10936219
1220 Ga0207667_11030892
1221 Ga0207651_10027541
1222 Ga0207651_10570638
1223 Ga0207712_10121493
1224 Ga0207712_10617420
1225 Ga0207712_12003517
1226 Ga0207668_10275753
1227 Ga0207668_10850331
1228 Ga0207668_10945240
1229 Ga0207668_11178046
1230 Ga0207640_10000633
1231 Ga0207640_10028998
1232 Ga0207658_10137548
1233 Ga0207658_11099536
1234 Ga0207658_11161856
1235 Ga0207677_10568772
1236 Ga0207703_10220470
1237 Ga0207639_10000181
1238 Ga0207639_10118646
1239 Ga0207639_12190506
1240 Ga0207678_10191150
1241 Ga0207702_10047197
1242 Ga0207702_10439494
1243 Ga0207702_10542610
1244 Ga0207641_10055494
1245 Ga0207641_10070353
1246 Ga0207641_11081325
1247 Ga0207676_10007783
1248 Ga0207674_10016271
1249 Ga0207674_10040272
1250 Ga0207674_10621483
1251 Ga0207675_100268274
1252 Ga0207683_10009677
1253 Ga0207698_10442013
1254 Ga0207698_10484437
1255 Ga0209389_1014263
1256 Ga0209371_1010320
1257 Ga0209969_1027187
1258 Ga0209813_10415125
1259 Ga0207428_10003328
1260 Ga0268266_10843802
1261 Ga0268265_10019146
1262 Ga0268265_10046894
1263 Ga0268265_10982329
1264 Ga0307515_10527058
1265 Ga0307515_10745371
1266 Ga0268256_1011069
1267 Ga0314311_1050680
1268 Ga0265325_10171569
1269 Ga0307513_10241022
1270 Ga0307509_10052108
1271 Ga0307509_10692791
1272 Ga0307408_100133083
1273 Ga0307408_100536519
1274 Ga0307408_101184443
1275 Ga0307508_10403104
1276 Ga0316579_10313441
1277 Ga0316576_10355938
1278 Ga0307516_10431512
1279 Ga0307516_10590278
1280 Ga0307516_10963301
1281 Ga0307405_10365195
1282 Ga0307405_11375511
1283 Ga0307405_11659317
1284 Ga0307413_10004740
1285 Ga0307413_10011197
1286 Ga0307413_10567085
1287 Ga0307410_10063738
1288 Ga0307410_10414799
1289 Ga0307410_12030807
1290 Ga0307406_10419966
1291 Ga0307406_10430194
1292 Ga0307406_10487264
1293 Ga0307406_10918431
1294 Ga0307407_10002665
1295 Ga0307407_10734802
1296 Ga0307412_10014518
1297 Ga0307412_10040110
1298 Ga0307412_10100196
1299 Ga0307412_11227467
1300 Ga0307409_100000590
1301 Ga0307416_100073768
1302 Ga0307416_100184069
1303 Ga0307416_102102536
1304 Ga0307414_10055855
1305 Ga0307414_10102932
1306 Ga0307414_10307675
1307 Ga0307414_10366947
1308 Ga0307414_10427082
1309 Ga0307414_10842476
1310 Ga0307414_10959442
1311 Ga0307414_11201480
1312 Ga0307411_10004233
1313 Ga0307411_10163473
1314 Ga0307411_11662145
1315 Ga0307415_100003944
1316 Ga0307415_100137096
1317 Ga0307415_100177228
1318 Ga0307415_100276214
1319 Ga0307510_10001323
1320 Ga0307510_10550295
1321 Ga0373930_0047838
1322 Ga0373934_0061583
1323 Ga0373957_0287446
1324 Ga0316582_0188785
1325 Ga0395899_0044169
1326 Ga0395899_0287324
1327 Ga0395899_0304654
1328 Ga0395900_0067916
1329 Ga0395900_0157309
1330 Ga0395900_0166800
1331 Ga0395900_0853211
1332 Ga0395900_1083263
1333 Ga0395900_1599776
1334 Ga0395898_0027920
1335 Ga0395898_0078844
1336 Ga0395898_0079979
1337 Ga0395898_0539289
1338 Ga0395898_0593232
1339 Ga0395905_0002010
1340 Ga0395905_0013726
1341 Ga0395905_0146548
1342 Ga0395905_0261726
1343 Ga0395905_0417338
1344 Ga0395905_0770138
1345 Ga0395905_0853427
1346 Ga0395905_0866608
1347 Ga0395905_1314548
1348 Ga0395905_1492189
1349 Ga0395905_1619365
1350 Ga0395901_0025775
1351 Ga0395901_0051769
1352 Ga0395901_0298965
1353 Ga0395901_1777365
1354 Ga0436363_1121625
1355 Ga0439447_093068
1356 Ga0439461_0001777
1357 Ga0439465_0000403
1358 Ga0451791_1665661
1359 Ga0451798_0608123
1360 Ga0451800_1610971
1361 Ga0451807_0510360
1362 Ga0439445_0051067
1363 Ga0439445_0195483
1364 Ga0439432_007592
1365 Ga0439449_0377756
1366 Ga0439455_0026513
1367 Ga0439455_0055098
1368 Ga0439455_0206663
1369 Ga0439457_063186
1370 Ga0450914_000414
1371 Ga0450914_022173
1372 Ga0450897_040572
1373 Ga0450894_026049
1374 Ga0450905_000656
1375 Ga0450889_000037
1376 Ga0450889_029751
1377 Ga0450906_066656
1378 Ga0450907_035050
1379 Ga0439458_0004015
1380 Ga0450909_042490
1381 Ga0439464_0314947
1382 Ga0450916_049155
1383 Ga0450918_013478
1384 Ga0450893_0013993
1385 Ga0466969_0086865
1386 Ga0466966_0008609
1387 Ga0466961_0001441
1388 Ga0466963_0040538
1389 Ga0466963_0191139
1390 Ga0466963_0246078
1391 Ga0466964_0282825
1392 Ga0466971_0003172
1393 Ga0466971_0026306
1394 Ga0466971_0119740
1395 Ga0466970_0191784
1396 Ga0466957_0012308
1397 Ga0466957_0090691
1398 Ga0466957_0588157
1399 Ga0466960_0029259
1400 Ga0466959_0004725
1401 Ga0466959_0018173
1402 Ga0451576_0000707
1403 Ga0466958_0000157
1404 Ga0466967_0015120
1405 Ga0466967_0155394
1406 Ga0495617_009662
1407 Ga0495617_044824
1408 Ga0495617_046768
1409 Ga0495617_199847
1410 Ga0495627_000695
1411 Ga0495627_001370
1412 Ga0495627_002456
1413 Ga0495627_192178
1414 Ga0495590_0014085
1415 Ga0495590_0032456
1416 Ga0495591_000662
1417 Ga0495591_004084
1418 Ga0495591_017663
1419 Ga0495591_019643
1420 Ga0495591_045323
1421 Ga0495591_046392
1422 Ga0495591_092953
1423 Ga0495629_0193716
1424 Ga0495638_0001957
1425 Ga0495638_0025148
1426 Ga0495638_0052888
1427 Ga0495638_0562359
1428 Ga0495653_0002927
1429 Ga0495653_0024069
1430 Ga0495653_0089532
1431 Ga0495653_0138611
1432 Ga0495650_0020843
1433 Ga0495650_0122477
1434 Ga0495650_0131493
1435 Ga0495650_0241639
1436 Ga0495650_0245935
1437 Ga0495650_0335613
1438 Ga0495605_0001168
1439 Ga0495605_0038614
1440 Ga0495605_0127706
1441 Ga0495605_0268359
1442 Ga0495639_0679438
1443 Ga0495584_0014450
1444 Ga0495584_0105950
1445 Ga0495585_0002349
1446 Ga0495585_0004774
1447 Ga0495585_0036146
1448 Ga0495585_0052160
1449 Ga0495596_0003136
1450 Ga0495596_0029573
1451 Ga0495596_0039132
1452 Ga0495607_0006304
1453 Ga0495607_0020367
1454 Ga0495607_0040518
1455 Ga0495607_0061578
1456 Ga0495607_0068256
1457 Ga0495607_0128439
1458 Ga0495607_0197659
1459 Ga0495583_0006509
1460 Ga0495583_0010574
1461 Ga0495583_0167124
1462 Ga0495606_0001321
1463 Ga0495606_0001801
1464 Ga0495606_0003948
1465 Ga0495606_0123786
1466 Ga0495606_0172930
1467 Ga0495606_0419400
1468 Ga0495610_0001087
1469 Ga0495610_0005074
1470 Ga0495610_0010564
1471 Ga0495610_0080385
1472 Ga0495616_0000042
1473 Ga0495616_0000704
1474 Ga0495616_0001304
1475 Ga0495616_0002303
1476 Ga0495616_0060078
1477 Ga0495616_0107084
1478 Ga0495616_0182289
1479 Ga0495616_0222700
1480 Ga0495616_0226938
1481 Ga0495620_0000532
1482 Ga0495620_0032112
1483 Ga0495620_0242797
1484 Ga0495631_0000229
1485 Ga0495631_0000547
1486 Ga0495631_0182701
1487 Ga0495632_0005221
1488 Ga0495632_0006967
1489 Ga0495632_0010870
1490 Ga0495632_0013653
1491 Ga0495632_0295697
1492 Ga0495632_0377121
1493 Ga0495637_0000839
1494 Ga0495637_0001641
1495 Ga0495637_0002034
1496 Ga0495637_0008706
1497 Ga0495637_0021867
1498 Ga0495637_0045936
1499 Ga0495643_0004653
1500 Ga0495643_0036166
1501 Ga0495643_0037736
1502 Ga0495643_0066324
1503 Ga0495643_0070683
1504 Ga0495643_0288195
1505 Ga0495644_0051968
1506 Ga0495648_0009698
1507 Ga0495648_0068137
1508 Ga0495648_0122201
1509 Ga0495648_0130273
1510 Ga0495648_0335667
1511 Ga0495648_0425661
1512 Ga0495666_0010713
1513 Ga0495642_0011651
1514 Ga0495654_0000444
1515 Ga0495654_0020054
1516 Ga0495654_0069039
1517 Ga0495654_0074879
1518 Ga0495654_0321522
1519 Ga0495587_0053104
1520 Ga0495609_0001751
1521 Ga0495609_0004084
1522 Ga0495609_0021618
1523 Ga0495609_0036842
1524 Ga0495609_0075316
1525 Ga0495609_0134296
1526 Ga0495597_0002633
1527 Ga0495597_0003247
1528 Ga0495597_0232386
1529 Ga0495645_0032397
1530 Ga0495622_0000537
1531 Ga0495622_0039129
1532 Ga0495622_0168502
1533 Ga0495622_0226396
1534 Ga0495633_0000867
1535 Ga0495633_0004843
1536 Ga0495633_0091052
1537 Ga0495668_0000033
1538 Ga0495668_0002790
1539 Ga0495668_0002819
1540 Ga0495668_0113588
1541 Ga0495668_0160963
1542 Ga0495668_0254387
1543 Ga0495634_0025019
1544 Ga0495611_0000468
1545 Ga0495611_0006667
1546 Ga0495611_0084121
1547 Ga0495611_0347910
1548 Ga0495625_0000014
1549 Ga0495625_0000032
1550 Ga0495625_0006003
1551 Ga0495625_0016634
1552 Ga0495625_0032684
1553 Ga0495625_0059700
1554 Ga0495625_0120424
1555 Ga0495625_0657696
1556 Ga0495625_0691110
1557 Ga0495625_0820312
1558 Ga0495661_0028015
1559 Ga0495661_0067472
1560 Ga0495661_0071801
1561 Ga0495661_0184477
1562 Ga0495661_0515255
1563 Ga0495588_0090822
1564 Ga0495646_0081794
1565 Ga0495669_0098426
1566 Ga0495613_0010857
1567 Ga0495624_0001286
1568 Ga0495624_0221077
1569 Ga0495670_0000868
1570 Ga0495670_0064032
1571 Ga0495671_0012713
1572 Ga0495671_0015611
1573 Ga0495671_0036514
1574 Ga0495671_0040326
1575 Ga0495671_0041873
1576 Ga0495671_0125879
1577 Ga0495649_0005359
1578 Ga0495649_0008701
1579 Ga0495649_0011931
1580 Ga0495649_0014874
1581 Ga0495649_0025203
1582 Ga0495649_0029499
1583 Ga0495649_0039808
1584 Ga0495649_0189302
1585 Ga0495589_0002576
1586 Ga0495589_0046180
1587 Ga0495589_0064063
1588 Ga0495600_0041644
1589 Ga0495660_0001455
1590 Ga0495660_0008129
1591 Ga0495660_0016083
1592 Ga0495660_0022703
1593 Ga0495660_0083573
1594 Ga0495660_0104049
1595 Ga0495660_0194128
1596 Ga0495660_0341172
1597 Ga0495672_0003388
1598 Ga0495672_0025786
1599 Ga0495672_0184653
1600 Ga0495676_0022364
1601 Ga0495680_0021555
1602 Ga0495683_0012750
1603 Ga0495683_0035832
1604 Ga0495683_0039231
1605 Ga0495683_0067207
1606 Ga0495683_0141858
1607 Ga0495687_003196
1608 Ga0495687_004060
1609 Ga0495677_0029578
1610 Ga0495679_003112
1611 Ga0495679_003907
1612 Ga0495679_008516
1613 Ga0495679_074448
1614 Ga0495685_003890
1615 Ga0495673_0000753
1616 Ga0495673_0027210
1617 Ga0495673_0104462
1618 Ga0495673_0167187
1619 Ga0495673_0206659
1620 Ga0495681_0001461
1621 Ga0495681_0002502
1622 Ga0495681_0007017
1623 Ga0495681_0019921
1624 Ga0495681_0031407
1625 Ga0495681_0052867
1626 Ga0495681_0173821
1627 Ga0495681_0188834
1628 Ga0495684_0082176
1629 Ga0495686_0015781
1630 Ga0495686_0019521
1631 Ga0495686_0083392
1632 Ga0495686_0546353
1633 Ga0495593_0063897
1634 Ga0495602_0005007
1635 Ga0495626_0001094
1636 Ga0495626_0003316
1637 Ga0495626_0004857
1638 Ga0495626_0010834
1639 Ga0495626_0011130
1640 Ga0495626_0128203
1641 Ga0496100_0169522
1642 Ga0496101_0117724
1643 Ga0496102_0453094
1644 Ga0496103_0086160
1645 Ga0496104_0038060
1646 Ga0496104_0043329
1647 Ga0496104_0113266
1648 Ga0496105_0062100
1649 Ga0496106_0022929
1650 Ga0496106_0054336
1651 Ga0496106_0189450
1652 Ga0496107_0159890
1653 Ga0496108_0004780
1654 Ga0496108_0040427
1655 Ga0496109_1138860
1656 Ga0496110_0054042
1657 Ga0496110_0155609
1658 Ga0496110_1547932
1659 Ga0496111_0038150
1660 Ga0496111_0389402
1661 Ga0496112_0162148
1662 Ga0496112_0372031
1663 Ga0496113_0017769
1664 Ga0496113_0056174
1665 Ga0496113_0208800
1666 Ga0496114_0036664
1667 Ga0496116_0003545
1668 Ga0496116_0017743
1669 Ga0496116_0088921
1670 Ga0496116_0266902
1671 Ga0496117_0027194
1672 Ga0496117_0293362
1673 Ga0496118_0008537
1674 Ga0496118_0301313
1675 Ga0496119_0020858
1676 Ga0496119_0117583
1677 Ga0496120_0030183
1678 Ga0496121_0013324
1679 Ga0496121_0232089
1680 Ga0496121_0232770
1681 Ga0496121_0286096
1682 Ga0496122_0014141
1683 Ga0496122_0032295
1684 Ga0496122_0034042
1685 Ga0496122_0058737
1686 Ga0496122_0271984
1687 Ga0496123_0000020
1688 Ga0496123_0046923
1689 Ga0496123_0132554
1690 Ga0496123_0157473
1691 Ga0496123_0249094
1692 Ga0496124_0003161
1693 Ga0496124_0158351
1694 Ga0496124_0261992
1695 Ga0496125_0025002
1696 Ga0496125_0110891
1697 Ga0496125_0171203
1698 Ga0496125_0284690
1699 Ga0496126_0063321
1700 Ga0496126_0082410
1701 Ga0496126_0341537
1702 Ga0495678_000954
1703 Ga0495678_002489
1704 Ga0495678_009254
1705 Ga0495678_063984
1706 Ga0495678_110956
1707 Ga0495678_185707
1708 Ga0495678_192423
1709 Ga0495682_0000556
1710 Ga0495682_0014059
1711 Ga0501031_0028830
1712 Ga0501031_0057700
1713 Ga0501032_0053899
1714 Ga0501032_0140764
1715 Ga0501033_0083547
1716 Ga0501033_0479752
1717 Ga0501034_0068653
1718 Ga0501034_0112795
1719 Ga0501034_0711989
1720 Ga0501036_0058022
1721 Ga0501036_0209107
1722 Ga0501036_0732426
1723 Ga0501037_0012878
1724 Ga0501037_0030893
1725 Ga0501037_0130195
1726 Ga0501038_0025722
1727 Ga0501038_0028034
1728 Ga0501039_0042948
1729 Ga0501039_0054312
1730 Ga0501040_0571443
1731 Ga0501042_0116182
1732 Ga0501043_0098532
1733 Ga0501043_0216829
1734 Ga0501043_0426904
1735 Ga0501046_0037115
1736 Ga0501047_0035677
1737 Ga0501047_0063768
1738 Ga0501048_0146260
1739 Ga0501069_0030732
1740 Ga0501070_0011113
1741 Ga0501070_0063171
1742 Ga0501070_0206570
1743 Ga0501070_0287193
1744 Ga0501071_0448376
1745 Ga0501071_1021687
1746 Ga0501073_0101081
1747 Ga0501073_0131100
1748 Ga0501073_0236535
1749 Ga0501074_0124175
1750 Ga0501074_0298882
1751 Ga0501075_0807908
1752 Ga0501076_0149012
1753 Ga0501076_0847889
1754 Ga0501077_0381007
1755 Ga0501202_054665
1756 Ga0501217_246076
1757 Ga0501080_0031412
1758 Ga0501080_0882580
1759 Ga0501083_0063591
1760 Ga0501035_0021781
1761 Ga0501035_0127290
1762 Ga0501035_0365832
1763 Ga0501035_0990425
1764 Ga0501044_0251622
1765 Ga0501044_0683548
1766 nmdc:mga03683_492934_c1
1767 nmdc:mga03n38_17318_c1
1768 nmdc:mga00v17_504546_c1
1769 nmdc:mga00v17_636387_c1
1770 nmdc:mga0yw44_314513_c1
1771 nmdc:mga0yw44_711061_c1
1772 nmdc:mga0k408_16913_c1
1773 nmdc:mga0k408_549752_c1
1774 nmdc:mga06z11_224023_c1
1775 nmdc:mga06z11_236255_c1
1776 nmdc:mga04h51_74183_c1
1777 nmdc:mga07m45_1099_c1
1778 nmdc:mga07m45_112250_c1
1779 nmdc:mga07m45_816968_c1
1780 nmdc:mga09592_1721871_c1
1781 nmdc:mga09592_1938_c1
1782 nmdc:mga0qj67_209826_c1
1783 nmdc:mga06r32_62_c1
1784 nmdc:mga08y16_269637_c1
1785 nmdc:mga08y16_4022_c1
1786 nmdc:mga08y16_40823_c1
1787 nmdc:mga0sz30_78724_c1
1788 Ga0500650_0239442
1789 Ga0500572_000400
1790 Ga0500594_0010415
1791 Ga0500658_0001972
1792 Ga0500658_0002314
1793 Ga0500658_0038836
1794 Ga0500568_0012118
1795 Ga0500586_061357
1796 Ga0500604_0000177
1797 Ga0500616_0000011
1798 Ga0500636_0039342
1799 Ga0590077_123937
1800 Ga0587069_066719
1801 Ga0501082_0360576
1802 Ga0466962_0001092
1803 Ga0466962_0032454
1804 Ga0530510_0547387

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04828

GFA

Glutathione-dependent formaldehyde-activating enzyme

25

105

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
8ajq-assembly3.cif.gz_E crystal structure of pa2722 from pseudomonas aeruginosa pao1 0.9561 1 130
8ajq-assembly3.cif.gz_E crystal structure of pa2722 from pseudomonas aeruginosa pao1 0.949 1 130
1xa8-assembly1.cif.gz_A crystal structure analysis of glutathione-dependent formaldehyde-activating enzyme (gfa) 0.7963 3 100
3fac-assembly8.cif.gz_H crystal structure of rhodobacter sphaeroides protein rsp_2168. northeast structural genomics target rhr83. 0.7723 5 89
3fac-assembly8.cif.gz_H crystal structure of rhodobacter sphaeroides protein rsp_2168. northeast structural genomics target rhr83. 0.619 5 89
ID Description Score Start End Superfamily
af_O14034_2_133_3.90.1590.10 Alpha Beta;Alpha-Beta Complex;glutathione-dependent formaldehyde- activating enzyme (gfa);glutathione-dependent formaldehyde- activating enzyme (gfa) 0.7902 2 117 3.90.1590.10
1xa8D00 Alpha Beta;Alpha-Beta Complex;glutathione-dependent formaldehyde- activating enzyme (gfa);glutathione-dependent formaldehyde- activating enzyme (gfa) 0.786 1 100 3.90.1590.10
af_A0A1D6EPM0_14_114_2.170.150.70 Mainly Beta;Beta Complex;Metal Binding Protein, Guanine Nucleotide Exchange Factor; Chain A; 0.7641 4 90 2.170.150.70
af_K7MPT9_9_124_2.170.150.70 Mainly Beta;Beta Complex;Metal Binding Protein, Guanine Nucleotide Exchange Factor; Chain A; 0.7592 6 100 2.170.150.70
af_Q54X87_13_141_2.170.150.70 Mainly Beta;Beta Complex;Metal Binding Protein, Guanine Nucleotide Exchange Factor; Chain A; 0.7452 5 93 2.170.150.70
ID Description Score Start End GO Terms
AF-A0A531KHJ2-F1-model_v4 GFA family protein 0.9864 1 103 GO:0016846
GO:0046872
AF-A0A529KEZ5-F1-model_v4 GFA family protein 0.9845 1 82 GO:0016846
GO:0046872
AF-A0A531KHJ2-F1-model_v4 GFA family protein 0.977 1 103 GO:0016846
GO:0046872
AF-Q8KLY1-F1-model_v4 CENP-V/GFA domain-containing protein 0.9737 1 130 GO:0016846
GO:0046872
AF-A0A090DLE2-F1-model_v4 Glutathione-dependent formaldehyde-activating, GFA 0.9736 1 130 GO:0016846
GO:0046872

Map