F485218

General Info

Members Datasets Scaffolds Average Seq Length
902 333 902 131

Family's Representative Sequence

Representative Sequence 3300037466|Ga0395898_0590056|Ga0395898_0590056_174_614
Length 146
Sequence VRARSKNLSTDERSDDVAEESYPEDLKYHPEHDWARIEGDTATLGITWYGQDALGELVHYEPPDVGATLSKDGAYGEVESVKAVSDLIAPLSGEVLEVNQKVVDEPETVNADPYGDGWLVRIRVSDPGETDALMDAESYRSHLQTL

Samples

Sample ID Description Type Environment
1 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
11 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
22 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
23 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
24 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
25 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
26 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
27 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
28 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
29 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
30 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
31 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
32 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
33 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
34 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
35 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
36 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
37 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
38 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
39 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
40 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
41 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
42 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
43 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
44 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
45 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
46 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
47 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
48 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
49 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
50 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
51 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
52 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
53 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
54 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
55 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
56 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
57 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
58 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
59 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
60 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
61 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
62 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
63 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
64 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
65 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
66 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
67 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
68 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
70 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
71 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
72 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
73 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
74 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
75 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
76 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
77 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
78 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
79 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
80 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
81 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
82 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
83 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
84 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
85 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
86 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
87 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
88 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
89 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
90 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
91 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
92 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
93 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
94 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
95 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
96 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
97 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
98 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
99 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
100 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
101 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
102 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
103 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
104 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
105 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
106 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
107 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
108 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
109 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
161 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
162 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
163 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
164 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
165 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
166 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
167 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
168 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
169 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
170 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
171 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
172 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
173 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
174 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
175 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
176 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
177 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
178 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
179 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
180 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
181 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
182 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
183 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
184 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
185 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
186 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
187 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
188 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
189 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
190 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
191 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
192 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
193 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
194 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
195 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
196 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
197 3300038698 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot15 Metagenome Rhizosphere
198 3300038699 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot26 Metagenome Rhizosphere
199 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
200 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
201 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
202 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
203 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
204 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
205 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
206 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
207 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
208 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
209 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
210 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
211 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
212 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
213 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
214 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
215 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
216 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
217 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
218 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
219 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
220 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
221 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
222 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
223 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
224 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
225 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
226 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
227 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
228 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
229 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
230 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
231 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
232 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
233 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
234 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
235 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
236 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
237 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
238 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
239 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
240 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
241 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
242 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
243 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
244 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
245 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
246 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
247 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
248 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
249 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
250 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
251 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
252 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
253 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
254 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
255 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
256 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
257 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
258 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
259 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
260 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
261 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
262 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
263 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
264 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
265 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
266 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
267 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
268 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
269 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
270 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
271 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
272 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
273 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
274 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
275 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
276 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
277 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
278 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
279 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
280 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
281 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
282 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
283 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
284 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
285 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
286 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
287 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
288 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
289 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
290 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
291 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
292 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
293 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
294 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
295 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
296 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
297 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
298 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
299 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
300 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
301 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
302 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
303 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
304 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
305 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
306 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
307 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
308 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
309 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
310 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
311 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
312 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
313 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
314 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
315 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
316 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
317 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
318 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
319 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
320 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
321 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
322 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
323 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
324 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
325 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
326 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
327 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
328 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
329 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
330 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
331 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
332 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
333 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.11
Metatranscriptomes 0.89
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.1
Nodule 0
Rhizoplane 12.08
Rhizosphere 84.37
Stem 0
Stem Tuber 0
Unclassified 0.44

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10036185 3300003203 Bacteria 1794
2 JGI25406J46586_10170740 3300003203 Unclassified 634
3 Ga0070658_10008240 3300005327 Bacteria 8383
4 Ga0070658_10512798 3300005327 Bacteria 1036
5 Ga0070683_100005095 3300005329 Bacteria 10922
6 Ga0070683_100008967 3300005329 Bacteria 8527
7 Ga0070683_100147264 3300005329 Bacteria 2232
8 Ga0070683_100210639 3300005329 Bacteria 1846
9 Ga0070683_102099234 3300005329 Bacteria 543
10 Ga0070690_101253862 3300005330 Bacteria 593
11 Ga0070666_10142825 3300005335 Bacteria 1668
12 Ga0070680_100061784 3300005336 Bacteria 3067
13 Ga0070680_100712558 3300005336 Bacteria 864
14 Ga0070680_101043513 3300005336 Bacteria 706
15 Ga0070680_101544923 3300005336 Bacteria 575
16 Ga0070680_101658759 3300005336 Unclassified 554
17 Ga0070682_100232060 3300005337 Bacteria 1320
18 Ga0070682_100531497 3300005337 Bacteria 917
19 Ga0068868_100775841 3300005338 Bacteria 863
20 Ga0070660_100045171 3300005339 Bacteria 3371
21 Ga0070660_100077437 3300005339 Bacteria 2605
22 Ga0070660_100670785 3300005339 Unclassified 869
23 Ga0070660_100680924 3300005339 Unclassified 862
24 Ga0070660_100826626 3300005339 Bacteria 780
25 Ga0070691_10771556 3300005341 Bacteria 583
26 Ga0070687_100381079 3300005343 Bacteria 919
27 Ga0070661_100206900 3300005344 Bacteria 1501
28 Ga0070661_100583191 3300005344 Bacteria 902
29 Ga0070661_101010636 3300005344 Bacteria 690
30 Ga0070692_10632675 3300005345 Bacteria 712
31 Ga0070668_100097191 3300005347 Bacteria 2329
32 Ga0070668_100306058 3300005347 Bacteria 1334
33 Ga0070668_100309106 3300005347 Bacteria 1328
34 Ga0070669_100457680 3300005353 Bacteria 1053
35 Ga0070671_100386286 3300005355 Bacteria 1197
36 Ga0070671_100559681 3300005355 Bacteria 986
37 Ga0070671_102038603 3300005355 Bacteria 511
38 Ga0070674_100216807 3300005356 Bacteria 1487
39 Ga0070674_100233845 3300005356 Bacteria 1436
40 Ga0070673_100855926 3300005364 Bacteria 841
41 Ga0070688_100173502 3300005365 Bacteria 1490
42 Ga0070659_100056686 3300005366 Bacteria 3089
43 Ga0070659_100280626 3300005366 Bacteria 1386
44 Ga0070659_101009031 3300005366 Bacteria 731
45 Ga0070709_10063824 3300005434 Bacteria 2353
46 Ga0070714_100443034 3300005435 Bacteria 1233
47 Ga0070714_101310714 3300005435 Bacteria 707
48 Ga0070713_100202845 3300005436 Bacteria 1792
49 Ga0070713_100452660 3300005436 Bacteria 1206
50 Ga0070713_100466729 3300005436 Bacteria 1187
51 Ga0070713_100839756 3300005436 Viruses 882
52 Ga0070713_100947523 3300005436 Unclassified 829
53 Ga0070713_101441098 3300005436 Unclassified 668
54 Ga0070710_10009026 3300005437 Bacteria 4874
55 Ga0070710_10099411 3300005437 Bacteria 1730
56 Ga0070710_10309267 3300005437 Bacteria 1034
57 Ga0070701_10085966 3300005438 Unclassified 1713
58 Ga0070711_100038326 3300005439 Bacteria 3223
59 Ga0070711_100168410 3300005439 Bacteria 1667
60 Ga0070711_100202229 3300005439 Bacteria 1534
61 Ga0070705_100123792 3300005440 Bacteria 1674
62 Ga0070705_100553676 3300005440 Bacteria 882
63 Ga0070705_101948893 3300005440 Bacteria 501
64 Ga0070700_101125289 3300005441 Bacteria 652
65 Ga0070694_100074768 3300005444 Bacteria 2342
66 Ga0070694_100090238 3300005444 Bacteria 2149
67 Ga0070708_100171666 3300005445 Bacteria 2025
68 Ga0070708_100186023 3300005445 Bacteria 1942
69 Ga0070708_100294220 3300005445 Bacteria 1529
70 Ga0070708_100353176 3300005445 Bacteria 1386
71 Ga0070708_100714660 3300005445 Bacteria 943
72 Ga0070708_102195912 3300005445 Bacteria 510
73 Ga0070663_100546089 3300005455 Bacteria 968
74 Ga0070678_100228885 3300005456 Bacteria 1549
75 Ga0070678_100930602 3300005456 Bacteria 796
76 Ga0070681_10022081 3300005458 Bacteria 6386
77 Ga0070681_10111187 3300005458 Bacteria 2679
78 Ga0070685_10852669 3300005466 Bacteria 675
79 Ga0070706_100229391 3300005467 Bacteria 1733
80 Ga0070706_100233059 3300005467 Bacteria 1719
81 Ga0070707_100629281 3300005468 Unclassified 1036
82 Ga0070707_100772166 3300005468 Bacteria 925
83 Ga0070707_101886825 3300005468 Unclassified 565
84 Ga0070698_100032881 3300005471 Bacteria 5373
85 Ga0070698_100386912 3300005471 Bacteria 1331
86 Ga0070699_100322895 3300005518 Bacteria 1388
87 Ga0070679_100007568 3300005530 Bacteria 10159
88 Ga0070679_100013106 3300005530 Bacteria 7939
89 Ga0070684_100000286 3300005535 Bacteria 35165
90 Ga0070684_100010068 3300005535 Bacteria 7474
91 Ga0070684_100020927 3300005535 Bacteria 5431
92 Ga0070684_100488073 3300005535 Unclassified 1140
93 Ga0070684_100758427 3300005535 Bacteria 906
94 Ga0070697_100069763 3300005536 Bacteria 2879
95 Ga0070697_100235797 3300005536 Bacteria 1562
96 Ga0070697_101173066 3300005536 Bacteria 684
97 Ga0070686_100171734 3300005544 Bacteria 1534
98 Ga0070686_101384173 3300005544 Bacteria 590
99 Ga0070695_100330904 3300005545 Bacteria 1135
100 Ga0070695_100483213 3300005545 Bacteria 955
101 Ga0070696_100075073 3300005546 Bacteria 2385
102 Ga0070696_100534900 3300005546 Bacteria 937
103 Ga0070693_100510772 3300005547 Bacteria 854
104 Ga0070693_101312426 3300005547 Bacteria 560
105 Ga0070665_100459721 3300005548 Bacteria 1283
106 Ga0070704_100082166 3300005549 Bacteria 2375
107 Ga0068855_100017076 3300005563 Bacteria 8730
108 Ga0068855_100077276 3300005563 Bacteria 3862
109 Ga0068855_100077741 3300005563 Bacteria 3850
110 Ga0068855_102062937 3300005563 Bacteria 575
111 Ga0070664_100137055 3300005564 Bacteria 2153
112 Ga0070664_100223690 3300005564 Bacteria 1685
113 Ga0068857_100096601 3300005577 Bacteria 2648
114 Ga0068857_100130441 3300005577 Bacteria 2267
115 Ga0068856_100054954 3300005614 Bacteria 3929
116 Ga0068856_100688561 3300005614 Bacteria 1043
117 Ga0068856_100817094 3300005614 Bacteria 952
118 Ga0070702_100028067 3300005615 Bacteria 3046
119 Ga0070702_100848141 3300005615 Bacteria 711
120 Ga0068859_102150856 3300005617 Bacteria 616
121 Ga0068861_100057930 3300005719 Bacteria 2961
122 Ga0068870_10114627 3300005840 Bacteria 1544
123 Ga0068870_10561980 3300005840 Bacteria 770
124 Ga0068862_100743184 3300005844 Bacteria 954
125 Ga0081455_10032931 3300005937 Bacteria 4663
126 Ga0081455_10112401 3300005937 Bacteria 2162
127 Ga0081455_10123075 3300005937 Bacteria 2041
128 Ga0081455_10148585 3300005937 Unclassified 1809
129 Ga0081455_10162975 3300005937 Bacteria 1707
130 Ga0081455_10376675 3300005937 Bacteria 993
131 Ga0081455_10852386 3300005937 Bacteria 569
132 Ga0081538_10022318 3300005981 Bacteria 4589
133 Ga0081539_10000041 3300005985 Bacteria 292660
134 Ga0081539_10042610 3300005985 Bacteria 2641
135 Ga0081539_10237100 3300005985 Bacteria 819
136 Ga0081539_10284082 3300005985 Bacteria 719
137 Ga0070717_10050974 3300006028 Bacteria 3404
138 Ga0070717_10588683 3300006028 Bacteria 1009
139 Ga0070717_12051928 3300006028 Unclassified 515
140 Ga0075365_10003891 3300006038 Bacteria 7814
141 Ga0075365_10015202 3300006038 Bacteria 4650
142 Ga0075365_10153616 3300006038 Bacteria 1602
143 Ga0075365_10171956 3300006038 Bacteria 1512
144 Ga0075365_10415227 3300006038 Bacteria 950
145 Ga0075363_100298189 3300006048 Bacteria 935
146 Ga0075363_100839151 3300006048 Bacteria 560
147 Ga0075364_10123730 3300006051 Bacteria 1732
148 Ga0075364_10125182 3300006051 Bacteria 1723
149 Ga0075364_10132352 3300006051 Bacteria 1674
150 Ga0075364_10455044 3300006051 Bacteria 874
151 Ga0075364_10497899 3300006051 Bacteria 833
152 Ga0075432_10020848 3300006058 Bacteria 2242
153 Ga0070716_100111073 3300006173 Bacteria 1699
154 Ga0070716_100169461 3300006173 Bacteria 1424
155 Ga0070716_100971576 3300006173 Bacteria 670
156 Ga0070712_100015956 3300006175 Bacteria 4844
157 Ga0070712_100062040 3300006175 Bacteria 2642
158 Ga0070712_100593532 3300006175 Bacteria 937
159 Ga0070712_100615216 3300006175 Bacteria 920
160 Ga0070712_100952525 3300006175 Unclassified 741
161 Ga0070712_100978973 3300006175 Bacteria 731
162 Ga0075367_10133745 3300006178 Bacteria 1534
163 Ga0075367_10216978 3300006178 Bacteria 1197
164 Ga0075367_10999641 3300006178 Bacteria 534
165 Ga0097621_100213116 3300006237 Bacteria 1681
166 Ga0097621_100363984 3300006237 Bacteria 1289
167 Ga0068871_101061968 3300006358 Bacteria 756
168 Ga0068871_101750675 3300006358 Bacteria 590
169 Ga0075428_100007984 3300006844 Bacteria 11740
170 Ga0075428_100036324 3300006844 Bacteria 5428
171 Ga0075428_100309683 3300006844 Bacteria 1697
172 Ga0075428_100580490 3300006844 Bacteria 1198
173 Ga0075428_100583764 3300006844 Unclassified 1194
174 Ga0075428_102132311 3300006844 Bacteria 579
175 Ga0075431_100038295 3300006847 Bacteria 4937
176 Ga0075431_100235771 3300006847 Bacteria 1863
177 Ga0075433_10468092 3300006852 Bacteria 1110
178 Ga0075433_10756443 3300006852 Bacteria 850
179 Ga0075433_10987625 3300006852 Bacteria 733
180 Ga0075434_100028518 3300006871 Bacteria 5485
181 Ga0075434_100047775 3300006871 Bacteria 4246
182 Ga0075434_100049169 3300006871 Bacteria 4186
183 Ga0075429_100314316 3300006880 Bacteria 1371
184 Ga0075429_100437594 3300006880 Bacteria 1146
185 Ga0068865_101109617 3300006881 Bacteria 697
186 Ga0075436_100002183 3300006914 Bacteria 13493
187 Ga0075436_100029390 3300006914 Bacteria 3779
188 Ga0075436_100369654 3300006914 Bacteria 1036
189 Ga0097620_102150825 3300006931 Bacteria 616
190 Ga0075435_100012599 3300007076 Bacteria 6264
191 Ga0075435_100055348 3300007076 Bacteria 3204
192 Ga0075435_100083256 3300007076 Bacteria 2630
193 Ga0075435_100087463 3300007076 Bacteria 2568
194 Ga0075435_100379651 3300007076 Bacteria 1214
195 Ga0105240_10027311 3300009093 Bacteria 7474
196 Ga0105240_10492909 3300009093 Bacteria 1364
197 Ga0111539_10011337 3300009094 Bacteria 11196
198 Ga0111539_10040887 3300009094 Bacteria 5579
199 Ga0111539_10966657 3300009094 Unclassified 990
200 Ga0111539_11978653 3300009094 Bacteria 676
201 Ga0105245_10122828 3300009098 Bacteria 2427
202 Ga0105245_10137493 3300009098 Bacteria 2298
203 Ga0105245_10211852 3300009098 Bacteria 1865
204 Ga0105245_10251480 3300009098 Bacteria 1717
205 Ga0105245_10259335 3300009098 Bacteria 1691
206 Ga0105245_10348748 3300009098 Bacteria 1466
207 Ga0105245_11862597 3300009098 Bacteria 655
208 Ga0114129_10000727 3300009147 Bacteria 41768
209 Ga0114129_10012477 3300009147 Bacteria 12097
210 Ga0114129_10024257 3300009147 Bacteria 8593
211 Ga0114129_10170675 3300009147 Bacteria 2966
212 Ga0114129_10327639 3300009147 Bacteria 2034
213 Ga0114129_10919239 3300009147 Bacteria 1107
214 Ga0114129_11431861 3300009147 Bacteria 852
215 Ga0114129_13133112 3300009147 Unclassified 540
216 Ga0105243_10054496 3300009148 Bacteria 3175
217 Ga0105243_10109909 3300009148 Bacteria 2304
218 Ga0105243_10374651 3300009148 Bacteria 1314
219 Ga0105243_12750862 3300009148 Bacteria 532
220 Ga0105241_10829209 3300009174 Bacteria 854
221 Ga0105242_10083979 3300009176 Bacteria 2667
222 Ga0105242_10134171 3300009176 Bacteria 2141
223 Ga0105242_10329695 3300009176 Bacteria 1403
224 Ga0105242_10934870 3300009176 Bacteria 870
225 Ga0105242_11306124 3300009176 Bacteria 749
226 Ga0105242_11383508 3300009176 Bacteria 730
227 Ga0105248_10160218 3300009177 Bacteria 2538
228 Ga0105248_11006895 3300009177 Bacteria 941
229 Ga0105237_10974551 3300009545 Bacteria 855
230 Ga0105238_10996094 3300009551 Bacteria 859
231 Ga0105249_10624440 3300009553 Bacteria 1134
232 Ga0105239_10221657 3300010375 Bacteria 2121
233 Ga0105239_10362957 3300010375 Bacteria 1636
234 Ga0105239_13244118 3300010375 Bacteria 530
235 Ga0105246_10969760 3300011119 Unclassified 767
236 Ga0157370_10093330 3300013104 Bacteria 2824
237 Ga0157370_10372328 3300013104 Bacteria 1316
238 Ga0157370_10611214 3300013104 Bacteria 998
239 Ga0157370_11539966 3300013104 Bacteria 598
240 Ga0157369_10006794 3300013105 Bacteria 13198
241 Ga0157369_10732870 3300013105 Bacteria 1017
242 Ga0157369_11690269 3300013105 Bacteria 643
243 Ga0157374_10128262 3300013296 Bacteria 2453
244 Ga0157374_11043122 3300013296 Bacteria 837
245 Ga0157374_11300703 3300013296 Bacteria 749
246 Ga0157378_10101928 3300013297 Bacteria 2622
247 Ga0157378_10275550 3300013297 Bacteria 1620
248 Ga0157378_12248028 3300013297 Bacteria 597
249 Ga0163162_10093384 3300013306 Bacteria 3093
250 Ga0157372_10287435 3300013307 Bacteria 1912
251 Ga0157372_10830094 3300013307 Bacteria 1073
252 Ga0157372_11319231 3300013307 Bacteria 833
253 Ga0157372_12120176 3300013307 Bacteria 646
254 Ga0157372_13018400 3300013307 Bacteria 538
255 Ga0157375_10297023 3300013308 Bacteria 1779
256 Ga0157375_10790965 3300013308 Bacteria 1098
257 Ga0157375_11036210 3300013308 Bacteria 959
258 Ga0157375_11204406 3300013308 Bacteria 888
259 Ga0163163_10164086 3300014325 Bacteria 2267
260 Ga0163163_12034623 3300014325 Bacteria 634
261 Ga0182008_10250564 3300014497 Bacteria 913
262 Ga0182008_10845273 3300014497 Bacteria 535
263 Ga0157377_10030329 3300014745 Bacteria 2928
264 Ga0157377_10313810 3300014745 Unclassified 1039
265 Ga0157379_10256715 3300014968 Bacteria 1588
266 Ga0157376_10094137 3300014969 Bacteria 2602
267 Ga0157376_10254312 3300014969 Bacteria 1642
268 Ga0157376_10464925 3300014969 Bacteria 1237
269 Ga0157376_10704573 3300014969 Bacteria 1015
270 Ga0157376_11751010 3300014969 Bacteria 657
271 Ga0182007_10280670 3300015262 Bacteria 606
272 Ga0163161_10342206 3300017792 Bacteria 1187
273 Ga0197907_10799915 3300020069 Bacteria 1483
274 Ga0206353_10259235 3300020082 Bacteria 769
275 Ga0206353_11073166 3300020082 Bacteria 4497
276 Ga0224712_10422282 3300022467 Bacteria 638
277 Ga0207692_10063853 3300025898 Bacteria 1915
278 Ga0207692_10125979 3300025898 Bacteria 1441
279 Ga0207642_10329929 3300025899 Bacteria 894
280 Ga0207688_10091228 3300025901 Bacteria 1750
281 Ga0207688_10490131 3300025901 Bacteria 769
282 Ga0207647_10234741 3300025904 Bacteria 1055
283 Ga0207685_10451309 3300025905 Bacteria 668
284 Ga0207705_10019314 3300025909 Bacteria 4873
285 Ga0207705_10045782 3300025909 Bacteria 3144
286 Ga0207684_10441074 3300025910 Bacteria 1118
287 Ga0207654_10455777 3300025911 Bacteria 897
288 Ga0207707_10030088 3300025912 Bacteria 4747
289 Ga0207707_10031620 3300025912 Bacteria 4632
290 Ga0207695_10138907 3300025913 Bacteria 2381
291 Ga0207695_10365656 3300025913 Bacteria 1329
292 Ga0207693_10006225 3300025915 Bacteria 9898
293 Ga0207693_10023433 3300025915 Bacteria 4902
294 Ga0207693_10252700 3300025915 Bacteria 1383
295 Ga0207663_10059220 3300025916 Bacteria 2422
296 Ga0207663_10285045 3300025916 Bacteria 1228
297 Ga0207663_10689903 3300025916 Bacteria 808
298 Ga0207660_10140212 3300025917 Bacteria 1848
299 Ga0207660_11160961 3300025917 Unclassified 629
300 Ga0207662_10352534 3300025918 Bacteria 989
301 Ga0207657_10002271 3300025919 Bacteria 20838
302 Ga0207657_10342322 3300025919 Unclassified 1180
303 Ga0207657_10731425 3300025919 Bacteria 767
304 Ga0207649_11234295 3300025920 Bacteria 591
305 Ga0207652_10006892 3300025921 Bacteria 9156
306 Ga0207652_10020012 3300025921 Bacteria 5510
307 Ga0207646_10489785 3300025922 Bacteria 1108
308 Ga0207646_10718454 3300025922 Bacteria 893
309 Ga0207681_10001013 3300025923 Bacteria 18329
310 Ga0207681_11778714 3300025923 Bacteria 514
311 Ga0207650_11333318 3300025925 Bacteria 611
312 Ga0207659_10359004 3300025926 Bacteria 1211
313 Ga0207687_10049998 3300025927 Bacteria 2909
314 Ga0207687_10100296 3300025927 Bacteria 2129
315 Ga0207687_10681934 3300025927 Bacteria 871
316 Ga0207687_10682290 3300025927 Bacteria 871
317 Ga0207687_10864587 3300025927 Unclassified 773
318 Ga0207687_11003703 3300025927 Bacteria 716
319 Ga0207687_11205023 3300025927 Bacteria 651
320 Ga0207700_10296300 3300025928 Bacteria 1395
321 Ga0207700_10608149 3300025928 Bacteria 973
322 Ga0207700_10666842 3300025928 Unclassified 928
323 Ga0207700_10781608 3300025928 Bacteria 854
324 Ga0207700_11069270 3300025928 Bacteria 722
325 Ga0207664_10339744 3300025929 Bacteria 1327
326 Ga0207664_10565140 3300025929 Bacteria 1021
327 Ga0207644_10199581 3300025931 Bacteria 1577
328 Ga0207644_10326211 3300025931 Bacteria 1242
329 Ga0207644_10860961 3300025931 Bacteria 759
330 Ga0207690_10653091 3300025932 Bacteria 862
331 Ga0207690_11077391 3300025932 Bacteria 670
332 Ga0207706_10219535 3300025933 Bacteria 1665
333 Ga0207686_10312281 3300025934 Bacteria 1171
334 Ga0207686_10364590 3300025934 Bacteria 1091
335 Ga0207686_10504363 3300025934 Bacteria 939
336 Ga0207686_10588042 3300025934 Bacteria 874
337 Ga0207709_10091967 3300025935 Bacteria 1985
338 Ga0207709_10110243 3300025935 Bacteria 1839
339 Ga0207709_10958849 3300025935 Bacteria 698
340 Ga0207709_11631939 3300025935 Bacteria 536
341 Ga0207669_11933980 3300025937 Bacteria 504
342 Ga0207704_10440476 3300025938 Bacteria 1038
343 Ga0207665_10007335 3300025939 Bacteria 7294
344 Ga0207665_10154222 3300025939 Bacteria 1647
345 Ga0207711_10753361 3300025941 Bacteria 908
346 Ga0207689_11041366 3300025942 Bacteria 690
347 Ga0207661_10003778 3300025944 Bacteria 10556
348 Ga0207661_10019199 3300025944 Bacteria 5092
349 Ga0207661_10094389 3300025944 Bacteria 2499
350 Ga0207661_10229811 3300025944 Bacteria 1642
351 Ga0207661_10632168 3300025944 Bacteria 983
352 Ga0207679_10042141 3300025945 Bacteria 3279
353 Ga0207679_10130440 3300025945 Bacteria 2016
354 Ga0207667_10062476 3300025949 Bacteria 3894
355 Ga0207667_10151667 3300025949 Bacteria 2385
356 Ga0207667_10438227 3300025949 Bacteria 1328
357 Ga0207712_10129121 3300025961 Bacteria 1923
358 Ga0207668_10061896 3300025972 Bacteria 2634
359 Ga0207668_10106338 3300025972 Bacteria 2096
360 Ga0207668_10152887 3300025972 Bacteria 1789
361 Ga0207668_11239844 3300025972 Bacteria 671
362 Ga0207677_10627762 3300026023 Bacteria 946
363 Ga0207678_10342509 3300026067 Bacteria 1288
364 Ga0207678_10826813 3300026067 Bacteria 818
365 Ga0207708_11121002 3300026075 Bacteria 686
366 Ga0207702_10026096 3300026078 Bacteria 4851
367 Ga0207702_10055906 3300026078 Bacteria 3349
368 Ga0207702_11244373 3300026078 Bacteria 738
369 Ga0207648_10039412 3300026089 Bacteria 4155
370 Ga0207676_10838310 3300026095 Bacteria 899
371 Ga0207674_10103020 3300026116 Bacteria 2834
372 Ga0207674_10108055 3300026116 Bacteria 2759
373 Ga0207675_100088997 3300026118 Bacteria 2900
374 Ga0207675_101388605 3300026118 Bacteria 723
375 Ga0207683_11329260 3300026121 Bacteria 665
376 Ga0207683_11684754 3300026121 Bacteria 583
377 Ga0268266_10252098 3300028379 Bacteria 1633
378 Ga0268265_10998321 3300028380 Bacteria 827
379 Ga0268264_10596134 3300028381 Bacteria 1088
380 Ga0265319_1025488 3300028563 Bacteria 2116
381 Ga0265318_10052499 3300028577 Bacteria 1530
382 Ga0265318_10078356 3300028577 Bacteria 1221
383 Ga0265318_10087716 3300028577 Bacteria 1146
384 Ga0265322_10054404 3300028654 Unclassified 1135
385 Ga0265338_10007064 3300028800 Bacteria 14079
386 Ga0265338_10382411 3300028800 Unclassified 1006
387 Ga0265338_10506487 3300028800 Bacteria 849
388 Ga0265320_10070894 3300031240 Bacteria 1642
389 Ga0265327_10017969 3300031251 Bacteria 4405
390 Ga0265327_10088501 3300031251 Bacteria 1514
391 Ga0307405_10128514 3300031731 Bacteria 1747
392 Ga0307413_10453533 3300031824 Bacteria 1018
393 Ga0307410_10346642 3300031852 Bacteria 1185
394 Ga0307410_11576523 3300031852 Bacteria 580
395 Ga0307406_10218345 3300031901 Bacteria 1415
396 Ga0307407_11274296 3300031903 Bacteria 576
397 Ga0307412_10295070 3300031911 Bacteria 1279
398 Ga0307409_100413067 3300031995 Bacteria 1292
399 Ga0307409_101331804 3300031995 Bacteria 743
400 Ga0307416_100051442 3300032002 Bacteria 3291
401 Ga0307416_100260956 3300032002 Bacteria 1693
402 Ga0307416_101081339 3300032002 Bacteria 906
403 Ga0307416_101655456 3300032002 Unclassified 745
404 Ga0307414_10493413 3300032004 Bacteria 1082
405 Ga0307415_100038491 3300032126 Bacteria 3152
406 Ga0307415_100305203 3300032126 Bacteria 1320
407 Ga0307415_100650673 3300032126 Bacteria 945
408 Ga0307415_101497355 3300032126 Bacteria 645
409 Ga0373926_0059401 3300035083 Unclassified 1392
410 Ga0373944_0010616 3300035089 Bacteria 2512
411 Ga0373941_0417103 3300035115 Bacteria 558
412 Ga0373945_0012208 3300035116 Bacteria 2849
413 Ga0373956_0159685 3300035119 Bacteria 1062
414 Ga0373943_0000112 3300035170 Bacteria 30215
415 Ga0373943_0069862 3300035170 Bacteria 1776
416 Ga0373943_0409292 3300035170 Bacteria 784
417 Ga0373946_0008171 3300035171 Bacteria 3840
418 Ga0373955_0134969 3300035172 Bacteria 1443
419 Ga0373931_0512209 3300035691 Bacteria 775
420 Ga0373935_0091508 3300035692 Bacteria 1992
421 Ga0373927_0021849 3300035695 Bacteria 4194
422 Ga0373933_0413786 3300035724 Bacteria 880
423 Ga0373947_0000600 3300035725 Bacteria 21231
424 Ga0373947_0205433 3300035725 Bacteria 1290
425 Ga0373937_0709846 3300036401 Bacteria 952
426 Ga0373937_0940959 3300036401 Bacteria 813
427 Ga0316584_0500003 3300036712 Bacteria 854
428 Ga0373925_0009167 3300037068 Bacteria 7203
429 Ga0395899_0001446 3300037312 Bacteria 20244
430 Ga0395899_0013404 3300037312 Bacteria 6272
431 Ga0395899_0019546 3300037312 Bacteria 5144
432 Ga0395899_0020632 3300037312 Bacteria 4995
433 Ga0395899_0029130 3300037312 Bacteria 4152
434 Ga0395899_0062762 3300037312 Bacteria 2735
435 Ga0395899_0084198 3300037312 Bacteria 2311
436 Ga0395899_0156099 3300037312 Bacteria 1615
437 Ga0395899_0246384 3300037312 Bacteria 1228
438 Ga0395899_0272482 3300037312 Bacteria 1154
439 Ga0395900_0000871 3300037418 Bacteria 39650
440 Ga0395900_0001970 3300037418 Bacteria 23182
441 Ga0395900_0008763 3300037418 Bacteria 10393
442 Ga0395900_0013678 3300037418 Bacteria 8285
443 Ga0395900_0024341 3300037418 Bacteria 6200
444 Ga0395900_0041807 3300037418 Bacteria 4724
445 Ga0395900_0043734 3300037418 Bacteria 4617
446 Ga0395900_0188662 3300037418 Bacteria 2092
447 Ga0395900_0203195 3300037418 Bacteria 2004
448 Ga0395900_0227314 3300037418 Bacteria 1878
449 Ga0395900_0324415 3300037418 Bacteria 1519
450 Ga0395900_0364281 3300037418 Bacteria 1416
451 Ga0395900_0391491 3300037418 Bacteria 1356
452 Ga0395900_0633137 3300037418 Bacteria 1007
453 Ga0395898_0003281 3300037466 Bacteria 18190
454 Ga0395898_0003578 3300037466 Bacteria 17318
455 Ga0395898_0011698 3300037466 Bacteria 9099
456 Ga0395898_0017911 3300037466 Bacteria 7227
457 Ga0395898_0039798 3300037466 Bacteria 4651
458 Ga0395898_0058640 3300037466 Bacteria 3747
459 Ga0395898_0069093 3300037466 Bacteria 3418
460 Ga0395898_0069994 3300037466 Bacteria 3393
461 Ga0395898_0077875 3300037466 Bacteria 3200
462 Ga0395898_0102181 3300037466 Bacteria 2752
463 Ga0395898_0163183 3300037466 Bacteria 2131
464 Ga0395898_0196377 3300037466 Bacteria 1927
465 Ga0395898_0482248 3300037466 Bacteria 1180
466 Ga0395898_0499507 3300037466 Bacteria 1157
467 Ga0395898_0590056 3300037466 Bacteria 1054
468 Ga0395898_0603532 3300037466 Bacteria 1040
469 Ga0395898_0634691 3300037466 Bacteria 1011
470 Ga0395898_0774995 3300037466 Bacteria 900
471 Ga0395905_0001130 3300037471 Bacteria 33392
472 Ga0395905_0002425 3300037471 Bacteria 20684
473 Ga0395905_0006790 3300037471 Bacteria 11468
474 Ga0395905_0034713 3300037471 Bacteria 4737
475 Ga0395905_0085832 3300037471 Bacteria 2949
476 Ga0395905_0178137 3300037471 Bacteria 1995
477 Ga0395905_0345195 3300037471 Bacteria 1380
478 Ga0395905_0612284 3300037471 Bacteria 991
479 Ga0395905_1288090 3300037471 Bacteria 634
480 Ga0395905_1795841 3300037471 Bacteria 519
481 Ga0395901_0004009 3300038443 Bacteria 14831
482 Ga0395901_0005447 3300038443 Bacteria 12885
483 Ga0395901_0006956 3300038443 Bacteria 11428
484 Ga0395901_0007511 3300038443 Bacteria 11008
485 Ga0395901_0016021 3300038443 Bacteria 7637
486 Ga0395901_0038828 3300038443 Bacteria 4924
487 Ga0395901_0061730 3300038443 Bacteria 3900
488 Ga0395901_0062370 3300038443 Bacteria 3879
489 Ga0395901_0093813 3300038443 Bacteria 3143
490 Ga0395901_0118265 3300038443 Bacteria 2784
491 Ga0395901_0127957 3300038443 Bacteria 2669
492 Ga0395901_0144701 3300038443 Bacteria 2499
493 Ga0395901_0239619 3300038443 Bacteria 1892
494 Ga0395901_0267913 3300038443 Bacteria 1777
495 Ga0395901_0383850 3300038443 Bacteria 1445
496 Ga0395901_0434513 3300038443 Bacteria 1344
497 Ga0395901_0516672 3300038443 Bacteria 1214
498 Ga0395901_0706815 3300038443 Bacteria 1005
499 Ga0395901_1356169 3300038443 Unclassified 671
500 Ga0395901_1934535 3300038443 Bacteria 537
501 Ga0242419_009978 3300038698 Bacteria 723
502 Ga0242422_03412 3300038699 Bacteria 1040
503 Ga0436363_0452021 3300039450 Bacteria 770
504 Ga0451835_0186085 3300041492 Unclassified 1001
505 Ga0451839_1214626 3300041496 Unclassified 677
506 Ga0451853_2305819 3300041512 Bacteria 1007
507 Ga0466969_0337257 3300044656 Bacteria 682
508 Ga0453683_0557697 3300044673 Bacteria 746
509 Ga0466965_0428286 3300044683 Bacteria 734
510 Ga0466966_0131090 3300044684 Bacteria 1535
511 Ga0466966_0723016 3300044684 Bacteria 600
512 Ga0466961_0330984 3300044693 Bacteria 928
513 Ga0466963_0006377 3300044694 Bacteria 6980
514 Ga0466963_0009698 3300044694 Bacteria 5808
515 Ga0466963_0288214 3300044694 Bacteria 1154
516 Ga0466963_0331079 3300044694 Bacteria 1072
517 Ga0466968_0600552 3300044735 Unclassified 556
518 Ga0466959_0640218 3300045049 Bacteria 714
519 Ga0466967_0035947 3300045976 Bacteria 4223
520 Ga0466967_0046714 3300045976 Bacteria 3771
521 Ga0466967_0046844 3300045976 Bacteria 3767
522 Ga0466967_0062330 3300045976 Bacteria 3310
523 Ga0466967_0249412 3300045976 Bacteria 1695
524 Ga0466967_0409917 3300045976 Bacteria 1320
525 Ga0466967_1112655 3300045976 Bacteria 787
526 Ga0466967_2277628 3300045976 Unclassified 537
527 Ga0495592_0165482 3300046454 Bacteria 1518
528 Ga0495592_0291818 3300046454 Bacteria 1063
529 Ga0495603_0254211 3300046455 Bacteria 1012
530 Ga0495603_0768697 3300046455 Bacteria 550
531 Ga0495629_0000593 3300046459 Bacteria 29449
532 Ga0495629_0011270 3300046459 Bacteria 6495
533 Ga0495629_0222495 3300046459 Bacteria 1302
534 Ga0495641_0000529 3300046461 Bacteria 32060
535 Ga0495641_0019594 3300046461 Bacteria 3455
536 Ga0495641_0063366 3300046461 Bacteria 1666
537 Ga0495641_0120231 3300046461 Bacteria 1172
538 Ga0495641_0320446 3300046461 Bacteria 699
539 Ga0495651_0082191 3300046462 Bacteria 2430
540 Ga0495651_0170718 3300046462 Bacteria 1549
541 Ga0495653_0006289 3300046463 Bacteria 9743
542 Ga0495653_0115903 3300046463 Bacteria 1917
543 Ga0495653_0178742 3300046463 Unclassified 1458
544 Ga0495653_0181433 3300046463 Bacteria 1444
545 Ga0495582_0000056 3300046473 Bacteria 57084
546 Ga0495582_0106181 3300046473 Bacteria 1575
547 Ga0495582_0151341 3300046473 Bacteria 1317
548 Ga0495605_0068460 3300046474 Bacteria 1682
549 Ga0495639_0003603 3300046475 Bacteria 6681
550 Ga0495662_0015110 3300046476 Bacteria 3750
551 Ga0495662_0058719 3300046476 Bacteria 1858
552 Ga0495662_0572808 3300046476 Bacteria 553
553 Ga0495664_0111202 3300046477 Bacteria 1653
554 Ga0495584_0123605 3300046491 Bacteria 1311
555 Ga0495584_0303429 3300046491 Bacteria 811
556 Ga0495608_0012356 3300046511 Bacteria 5929
557 Ga0495608_0263552 3300046511 Bacteria 1072
558 Ga0495618_0218025 3300046514 Bacteria 1204
559 Ga0495628_0580398 3300046516 Bacteria 802
560 Ga0495630_0005694 3300046517 Bacteria 8809
561 Ga0495630_0297650 3300046517 Bacteria 1233
562 Ga0495663_0100296 3300046525 Bacteria 953
563 Ga0495666_0041659 3300046526 Bacteria 2223
564 Ga0495666_0223944 3300046526 Bacteria 861
565 Ga0495652_0215186 3300046529 Bacteria 1447
566 Ga0495665_0000910 3300046531 Bacteria 15584
567 Ga0495665_0360023 3300046531 Bacteria 740
568 Ga0495665_0395869 3300046531 Bacteria 701
569 Ga0495640_0017849 3300046533 Bacteria 5278
570 Ga0495640_0074570 3300046533 Bacteria 2268
571 Ga0495587_0115628 3300046536 Bacteria 1539
572 Ga0495609_0215392 3300046538 Bacteria 799
573 Ga0495645_0390316 3300046543 Unclassified 889
574 Ga0495645_0489058 3300046543 Bacteria 771
575 Ga0495667_0047005 3300046559 Bacteria 2852
576 Ga0495667_0228023 3300046559 Bacteria 1188
577 Ga0495656_0020716 3300046615 Bacteria 2553
578 Ga0495656_0069782 3300046615 Bacteria 1558
579 Ga0495668_0843772 3300046616 Bacteria 508
580 Ga0495634_0026999 3300046642 Bacteria 4000
581 Ga0495634_0059917 3300046642 Bacteria 2534
582 Ga0495634_0129034 3300046642 Bacteria 1613
583 Ga0495634_0293268 3300046642 Bacteria 985
584 Ga0495635_0062901 3300046663 Bacteria 2548
585 Ga0495635_0068001 3300046663 Bacteria 2443
586 Ga0495661_0506470 3300046665 Bacteria 575
587 Ga0495657_0141611 3300046675 Bacteria 1498
588 Ga0495657_0419244 3300046675 Bacteria 786
589 Ga0495599_0472628 3300046678 Unclassified 740
590 Ga0495646_0176412 3300046680 Bacteria 1175
591 Ga0495647_0036946 3300046681 Bacteria 1841
592 Ga0495647_0039362 3300046681 Bacteria 1792
593 Ga0495658_0000204 3300046683 Bacteria 34365
594 Ga0495658_0023753 3300046683 Bacteria 3258
595 Ga0495658_0656960 3300046683 Bacteria 672
596 Ga0495613_0000401 3300046689 Bacteria 37127
597 Ga0495613_0028490 3300046689 Bacteria 4154
598 Ga0495613_0142879 3300046689 Bacteria 1709
599 Ga0495624_0006658 3300046690 Bacteria 8170
600 Ga0495624_0596970 3300046690 Bacteria 658
601 Ga0495589_0297348 3300046794 Bacteria 749
602 Ga0495600_0030104 3300046809 Bacteria 3515
603 Ga0495600_0344849 3300046809 Bacteria 934
604 Ga0495600_0957011 3300046809 Bacteria 503
605 Ga0495581_0000517 3300047315 Bacteria 19788
606 Ga0495581_0009359 3300047315 Bacteria 5669
607 Ga0495581_0213008 3300047315 Bacteria 1130
608 Ga0495604_0074351 3300047317 Bacteria 2561
609 Ga0495604_0148497 3300047317 Bacteria 1668
610 Ga0495674_0029603 3300047319 Bacteria 4985
611 Ga0495674_1054872 3300047319 Unclassified 620
612 Ga0495676_0010912 3300047321 Bacteria 8212
613 Ga0495676_0026584 3300047321 Bacteria 4980
614 Ga0495676_0027069 3300047321 Bacteria 4924
615 Ga0495680_0004651 3300047322 Bacteria 13073
616 Ga0495680_0008870 3300047322 Bacteria 9095
617 Ga0495680_0019712 3300047322 Bacteria 5690
618 Ga0495680_0317005 3300047322 Bacteria 1092
619 Ga0495675_0260164 3300047444 Bacteria 1040
620 Ga0495684_0020222 3300047471 Bacteria 5128
621 Ga0495684_0233497 3300047471 Unclassified 1344
622 Ga0495684_0834263 3300047471 Bacteria 599
623 Ga0495593_0001987 3300047673 Bacteria 12195
624 Ga0495593_0099580 3300047673 Bacteria 1492
625 Ga0495614_0026119 3300048089 Bacteria 2517
626 Ga0496100_0002141 3300048903 Bacteria 9943
627 Ga0496100_0044261 3300048903 Bacteria 2850
628 Ga0496100_0048104 3300048903 Bacteria 2752
629 Ga0496100_0068131 3300048903 Bacteria 2366
630 Ga0496100_0081240 3300048903 Bacteria 2189
631 Ga0496100_0791936 3300048903 Bacteria 742
632 Ga0496101_0018182 3300048904 Bacteria 4776
633 Ga0496101_0029430 3300048904 Bacteria 3841
634 Ga0496101_0074736 3300048904 Bacteria 2493
635 Ga0496101_0121800 3300048904 Bacteria 1972
636 Ga0496101_0133624 3300048904 Bacteria 1886
637 Ga0496101_0154321 3300048904 Bacteria 1758
638 Ga0496101_0158421 3300048904 Bacteria 1735
639 Ga0496101_0178505 3300048904 Bacteria 1634
640 Ga0496101_0326361 3300048904 Bacteria 1204
641 Ga0496101_0764501 3300048904 Bacteria 762
642 Ga0496102_0015240 3300048905 Bacteria 6693
643 Ga0496102_0023826 3300048905 Bacteria 5439
644 Ga0496102_0081453 3300048905 Bacteria 2984
645 Ga0496102_0172819 3300048905 Bacteria 2034
646 Ga0496102_0225713 3300048905 Bacteria 1766
647 Ga0496102_0337572 3300048905 Bacteria 1419
648 Ga0496102_0610899 3300048905 Bacteria 1013
649 Ga0496102_0646653 3300048905 Bacteria 981
650 Ga0496102_1549033 3300048905 Bacteria 581
651 Ga0496103_0009328 3300048906 Bacteria 5813
652 Ga0496103_0081294 3300048906 Bacteria 2038
653 Ga0496103_0103250 3300048906 Bacteria 1806
654 Ga0496103_0143006 3300048906 Bacteria 1530
655 Ga0496103_0147150 3300048906 Bacteria 1508
656 Ga0496104_0000571 3300048907 Bacteria 31432
657 Ga0496104_0004078 3300048907 Bacteria 12675
658 Ga0496104_0013102 3300048907 Bacteria 7472
659 Ga0496104_0063550 3300048907 Bacteria 3501
660 Ga0496104_0477178 3300048907 Bacteria 1158
661 Ga0496105_0019907 3300048908 Bacteria 5415
662 Ga0496105_0021402 3300048908 Bacteria 5233
663 Ga0496105_0102434 3300048908 Bacteria 2364
664 Ga0496105_0240795 3300048908 Bacteria 1468
665 Ga0496105_0340463 3300048908 Bacteria 1199
666 Ga0496105_0582406 3300048908 Bacteria 870
667 Ga0496105_0660240 3300048908 Bacteria 806
668 Ga0496106_0001809 3300048909 Bacteria 15988
669 Ga0496106_0061267 3300048909 Bacteria 2854
670 Ga0496106_0212736 3300048909 Bacteria 1540
671 Ga0496106_0249434 3300048909 Bacteria 1419
672 Ga0496106_0268126 3300048909 Bacteria 1367
673 Ga0496107_0029831 3300048910 Bacteria 3884
674 Ga0496107_0053635 3300048910 Bacteria 2908
675 Ga0496107_0180795 3300048910 Bacteria 1566
676 Ga0496107_0198279 3300048910 Bacteria 1492
677 Ga0496107_0491331 3300048910 Bacteria 910
678 Ga0496107_0570107 3300048910 Bacteria 838
679 Ga0496108_0006700 3300048911 Bacteria 9326
680 Ga0496108_0015055 3300048911 Bacteria 6315
681 Ga0496108_0037194 3300048911 Bacteria 4053
682 Ga0496108_0098939 3300048911 Bacteria 2486
683 Ga0496108_0213516 3300048911 Bacteria 1675
684 Ga0496108_0286532 3300048911 Bacteria 1434
685 Ga0496108_0602890 3300048911 Bacteria 957
686 Ga0496108_0913356 3300048911 Unclassified 753
687 Ga0496109_0000638 3300048912 Bacteria 29181
688 Ga0496109_0000992 3300048912 Bacteria 23409
689 Ga0496109_0017313 3300048912 Bacteria 6314
690 Ga0496109_0236587 3300048912 Bacteria 1718
691 Ga0496109_0255488 3300048912 Bacteria 1650
692 Ga0496109_0292057 3300048912 Bacteria 1537
693 Ga0496109_0834842 3300048912 Bacteria 859
694 Ga0496109_0882527 3300048912 Bacteria 832
695 Ga0496109_1794561 3300048912 Bacteria 547
696 Ga0496110_0001697 3300048913 Bacteria 16194
697 Ga0496110_0004437 3300048913 Bacteria 10877
698 Ga0496110_0030272 3300048913 Bacteria 4665
699 Ga0496110_0163250 3300048913 Bacteria 2019
700 Ga0496110_0280503 3300048913 Bacteria 1517
701 Ga0496110_0601741 3300048913 Bacteria 997
702 Ga0496110_0635728 3300048913 Bacteria 966
703 Ga0496110_0883451 3300048913 Bacteria 799
704 Ga0496111_0000025 3300048914 Bacteria 62100
705 Ga0496111_0000598 3300048914 Bacteria 19022
706 Ga0496111_0019783 3300048914 Bacteria 4682
707 Ga0496111_0027978 3300048914 Bacteria 3993
708 Ga0496111_0058238 3300048914 Bacteria 2797
709 Ga0496111_0194638 3300048914 Bacteria 1507
710 Ga0496111_0265303 3300048914 Bacteria 1274
711 Ga0496111_0347061 3300048914 Bacteria 1099
712 Ga0496112_0001024 3300048915 Bacteria 20548
713 Ga0496112_0185421 3300048915 Bacteria 2044
714 Ga0496112_0253100 3300048915 Bacteria 1712
715 Ga0496112_0488967 3300048915 Bacteria 1167
716 Ga0496112_0530166 3300048915 Unclassified 1112
717 Ga0496112_0717772 3300048915 Bacteria 927
718 Ga0496112_0818207 3300048915 Bacteria 856
719 Ga0496113_0207636 3300048916 Bacteria 1558
720 Ga0496113_0418151 3300048916 Bacteria 1077
721 Ga0496114_0001903 3300048917 Bacteria 15881
722 Ga0496114_0019534 3300048917 Bacteria 5490
723 Ga0496114_0039807 3300048917 Bacteria 3890
724 Ga0496114_0045742 3300048917 Bacteria 3637
725 Ga0496114_0093503 3300048917 Bacteria 2556
726 Ga0496114_0094560 3300048917 Bacteria 2542
727 Ga0496114_0116801 3300048917 Bacteria 2291
728 Ga0496114_0147736 3300048917 Bacteria 2038
729 Ga0496114_0429351 3300048917 Bacteria 1170
730 Ga0496114_0555414 3300048917 Bacteria 1014
731 Ga0496115_0005415 3300048918 Bacteria 9283
732 Ga0496115_0035750 3300048918 Bacteria 3932
733 Ga0496115_0298254 3300048918 Bacteria 1321
734 Ga0496115_0546724 3300048918 Bacteria 926
735 Ga0501031_0002836 3300049568 Bacteria 11064
736 Ga0501031_0215861 3300049568 Bacteria 1249
737 Ga0501032_0023044 3300049569 Bacteria 4310
738 Ga0501032_0590662 3300049569 Bacteria 707
739 Ga0501034_0064118 3300049571 Bacteria 3688
740 Ga0501036_0006773 3300049572 Bacteria 9303
741 Ga0501036_0073602 3300049572 Bacteria 2888
742 Ga0501036_0301277 3300049572 Bacteria 1341
743 Ga0501036_0764951 3300049572 Bacteria 796
744 Ga0501036_0992622 3300049572 Bacteria 687
745 Ga0501036_1314319 3300049572 Bacteria 587
746 Ga0501037_0103140 3300049573 Bacteria 2057
747 Ga0501037_0228977 3300049573 Unclassified 1305
748 Ga0501038_0024691 3300049574 Bacteria 5359
749 Ga0501038_0129474 3300049574 Bacteria 2074
750 Ga0501038_0401156 3300049574 Bacteria 1061
751 Ga0501039_0004746 3300049575 Bacteria 10292
752 Ga0501039_0181537 3300049575 Bacteria 1655
753 Ga0501039_0394550 3300049575 Bacteria 1087
754 Ga0501040_0004225 3300049576 Bacteria 9349
755 Ga0501040_0052394 3300049576 Bacteria 2793
756 Ga0501041_0004653 3300049577 Bacteria 7961
757 Ga0501041_0089853 3300049577 Bacteria 1896
758 Ga0501042_0008074 3300049578 Bacteria 6926
759 Ga0501042_0009416 3300049578 Bacteria 6508
760 Ga0501042_0090944 3300049578 Bacteria 2190
761 Ga0501042_0184233 3300049578 Bacteria 1506
762 Ga0501042_0573871 3300049578 Unclassified 820
763 Ga0501043_0049092 3300049579 Bacteria 3317
764 Ga0501043_0784959 3300049579 Bacteria 690
765 Ga0501046_0001448 3300049580 Bacteria 22833
766 Ga0501046_0132061 3300049580 Bacteria 1893
767 Ga0501046_0328974 3300049580 Bacteria 1112
768 Ga0501046_0708062 3300049580 Bacteria 709
769 Ga0501047_0230687 3300049581 Bacteria 1705
770 Ga0501047_0502347 3300049581 Bacteria 1039
771 Ga0501047_0646821 3300049581 Bacteria 877
772 Ga0501047_0742354 3300049581 Bacteria 798
773 Ga0501048_0003992 3300049582 Bacteria 11203
774 Ga0501048_0119455 3300049582 Bacteria 1862
775 Ga0501048_0236980 3300049582 Bacteria 1295
776 Ga0501067_0086276 3300049583 Bacteria 1742
777 Ga0501067_0223945 3300049583 Bacteria 1047
778 Ga0501067_0224914 3300049583 Bacteria 1045
779 Ga0501067_0231389 3300049583 Bacteria 1029
780 Ga0501068_0377105 3300049584 Bacteria 913
781 Ga0501068_0600260 3300049584 Bacteria 717
782 Ga0501069_0059219 3300049585 Bacteria 2137
783 Ga0501069_0075565 3300049585 Bacteria 1892
784 Ga0501069_0128744 3300049585 Bacteria 1449
785 Ga0501069_0149679 3300049585 Bacteria 1341
786 Ga0501069_0257508 3300049585 Bacteria 1018
787 Ga0501069_0638757 3300049585 Bacteria 640
788 Ga0501070_0003866 3300049586 Bacteria 12917
789 Ga0501070_0128150 3300049586 Bacteria 2097
790 Ga0501070_0273348 3300049586 Unclassified 1379
791 Ga0501070_0315070 3300049586 Bacteria 1273
792 Ga0501070_0517461 3300049586 Bacteria 957
793 Ga0501070_0697168 3300049586 Bacteria 803
794 Ga0501071_0026636 3300049587 Bacteria 4059
795 Ga0501071_1021160 3300049587 Bacteria 639
796 Ga0501071_1115318 3300049587 Bacteria 609
797 Ga0501072_0011874 3300049588 Bacteria 6653
798 Ga0501072_0026024 3300049588 Bacteria 4559
799 Ga0501072_0034638 3300049588 Bacteria 3957
800 Ga0501073_0006969 3300049589 Bacteria 8417
801 Ga0501073_0020460 3300049589 Bacteria 4772
802 Ga0501074_0018234 3300049590 Bacteria 5099
803 Ga0501074_0035342 3300049590 Bacteria 3620
804 Ga0501074_0063116 3300049590 Bacteria 2668
805 Ga0501075_0006432 3300049591 Bacteria 8087
806 Ga0501075_0027647 3300049591 Bacteria 4181
807 Ga0501075_0260221 3300049591 Bacteria 1322
808 Ga0501075_0787888 3300049591 Bacteria 723
809 Ga0501076_0008714 3300049592 Bacteria 7448
810 Ga0501076_0124959 3300049592 Bacteria 2084
811 Ga0501076_0674294 3300049592 Bacteria 853
812 Ga0501077_0010250 3300049593 Bacteria 5833
813 Ga0501077_0989404 3300049593 Bacteria 541
814 Ga0501242_029051 3300049674 Bacteria 741
815 Ga0501243_066454 3300049675 Bacteria 678
816 Ga0501079_0010771 3300049741 Bacteria 6961
817 Ga0501079_0109663 3300049741 Bacteria 2144
818 Ga0501079_0145539 3300049741 Bacteria 1846
819 Ga0501079_1569962 3300049741 Unclassified 518
820 Ga0501080_0007957 3300049742 Bacteria 9606
821 Ga0501080_0070880 3300049742 Bacteria 3241
822 Ga0501080_0209697 3300049742 Bacteria 1786
823 Ga0501081_0011195 3300049743 Bacteria 5865
824 Ga0501081_0035504 3300049743 Bacteria 3394
825 Ga0501081_0036002 3300049743 Bacteria 3372
826 Ga0501081_0047344 3300049743 Bacteria 2959
827 Ga0501083_0033307 3300049744 Bacteria 3529
828 Ga0501283_098101 3300049779 Bacteria 568
829 Ga0501035_0008623 3300049822 Bacteria 9486
830 Ga0501035_0014191 3300049822 Bacteria 7352
831 Ga0501035_0458567 3300049822 Bacteria 1054
832 Ga0501035_0734223 3300049822 Bacteria 794
833 Ga0501044_0078509 3300049823 Bacteria 3345
834 Ga0501044_0162808 3300049823 Bacteria 2206
835 Ga0501044_0808063 3300049823 Bacteria 817
836 Ga0501045_0005742 3300049824 Bacteria 8593
837 Ga0501045_0033361 3300049824 Bacteria 3732
838 Ga0501045_0047826 3300049824 Bacteria 3116
839 nmdc:mga03n38_844024_c1 3300050490 Bacteria 535
840 nmdc:mga00v17_127916_c1 3300050491 Bacteria 1622
841 nmdc:mga00v17_144754_c1 3300050491 Bacteria 1525
842 nmdc:mga00v17_259255_c1 3300050491 Bacteria 1128
843 nmdc:mga00v17_632437_c1 3300050491 Bacteria 689
844 nmdc:mga0yw44_273301_c1 3300050492 Bacteria 1128
845 nmdc:mga0yw44_328455_c1 3300050492 Bacteria 1028
846 nmdc:mga0yw44_47913_c1 3300050492 Bacteria 2575
847 nmdc:mga0yw44_946406_c1 3300050492 Bacteria 584
848 nmdc:mga0yw44_996418_c1 3300050492 Bacteria 567
849 nmdc:mga06z11_156255_c1 3300050494 Bacteria 1300
850 nmdc:mga06z11_187276_c1 3300050494 Bacteria 1196
851 nmdc:mga06z11_200348_c1 3300050494 Bacteria 1159
852 nmdc:mga05p37_205574_c1 3300050507 Bacteria 2382
853 nmdc:mga05p37_206353_c1 3300050507 Bacteria 2377
854 nmdc:mga05p37_59740_c1 3300050507 Bacteria 4695
855 nmdc:mga05p37_718187_c1 3300050507 Bacteria 1107
856 nmdc:mga06r32_125637_c1 3300050510 Bacteria 2533
857 nmdc:mga06r32_289020_c1 3300050510 Bacteria 1626
858 nmdc:mga08y16_77841_c1 3300050511 Bacteria 3457
859 nmdc:mga0n895_11302_c1 3300050512 Bacteria 7956
860 nmdc:mga0n895_1512414_c1 3300050512 Bacteria 637
861 nmdc:mga0n895_418012_c1 3300050512 Bacteria 1355
862 nmdc:mga0n895_77600_c1 3300050512 Bacteria 3305
863 nmdc:mga0n895_91185_c1 3300050512 Bacteria 3050
864 nmdc:mga0n895_99622_c1 3300050512 Bacteria 2914
865 nmdc:mga0rr50_101254_c1 3300050513 Bacteria 2264
866 nmdc:mga0rr50_328964_c1 3300050513 Bacteria 1282
867 nmdc:mga0rr50_4672_c1 3300050513 Bacteria 8072
868 nmdc:mga0rr50_468178_c1 3300050513 Bacteria 1069
869 nmdc:mga0rr50_702115_c1 3300050513 Bacteria 863
870 nmdc:mga08x19_59131_c1 3300050514 Bacteria 2481
871 nmdc:mga0a205_22729_c1 3300050515 Bacteria 5945
872 nmdc:mga0a205_39954_c1 3300050515 Bacteria 4517
873 nmdc:mga0a205_50115_c1 3300050515 Bacteria 4031
874 nmdc:mga0a205_758204_c1 3300050515 Unclassified 819
875 Ga0495601_0101811 3300053077 Bacteria 1855
876 Ga0495601_0151594 3300053077 Bacteria 1513
877 Ga0495601_0175373 3300053077 Bacteria 1401
878 Ga0495601_0459364 3300053077 Unclassified 823
879 Ga0495601_0991394 3300053077 Unclassified 528
880 Ga0495612_0055292 3300053078 Bacteria 1636
881 Ga0495595_0009175 3300053084 Bacteria 4086
882 Ga0495595_0023650 3300053084 Bacteria 2708
883 Ga0495619_0001914 3300053085 Bacteria 13865
884 Ga0495619_0008233 3300053085 Bacteria 6597
885 Ga0495619_0019321 3300053085 Bacteria 4329
886 Ga0495619_0063338 3300053085 Bacteria 2463
887 Ga0495619_0075685 3300053085 Bacteria 2259
888 Ga0501084_0013416 3300054114 Bacteria 6780
889 Ga0501084_0072442 3300054114 Bacteria 2885
890 Ga0501084_0219343 3300054114 Bacteria 1605
891 Ga0501084_0776493 3300054114 Bacteria 807
892 Ga0501084_0892034 3300054114 Bacteria 748
893 Ga0587070_135859 3300059491 Bacteria 603
894 Ga0587073_0218009 3300059492 Unclassified 581
895 Ga0587077_196937 3300059493 Bacteria 555
896 Ga0587067_179603 3300059640 Bacteria 550
897 Ga0501082_0037616 3300060353 Bacteria 4173
898 Ga0466962_0367385 3300061719 Bacteria 718
899 Ga0530510_0018249 3300061734 Bacteria 4974
900 Ga0530510_0171003 3300061734 Bacteria 1609
901 Ga0530510_0519490 3300061734 Bacteria 903
902 Ga0530510_0605013 3300061734 Bacteria 834

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048918 Ga0496115_0298254 Ga0496115_0298254_301_675 124
2 3300003203 JGI25406J46586_10170740 JGI25406J46586_101707401 126
3 3300005985 Ga0081539_10042610 Ga0081539_100426102 126
4 3300006038 Ga0075365_10015202 Ga0075365_100152023 128
5 3300006038 Ga0075365_10153616 Ga0075365_101536162 128
6 3300006038 Ga0075365_10171956 Ga0075365_101719562 128
7 3300006048 Ga0075363_100298189 Ga0075363_1002981892 128
8 3300006051 Ga0075364_10123730 Ga0075364_101237302 128
9 3300006051 Ga0075364_10125182 Ga0075364_101251822 128
10 3300006051 Ga0075364_10455044 Ga0075364_104550442 128
11 3300006178 Ga0075367_10133745 Ga0075367_101337452 128
12 3300037466 Ga0395898_0603532 Ga0395898_0603532_327_713 128
13 3300038443 Ga0395901_0267913 Ga0395901_0267913_148_534 128
14 3300044694 Ga0466963_0006377 Ga0466963_0006377_3081_3467 128
15 3300044694 Ga0466963_0331079 Ga0466963_0331079_525_911 128
16 3300045976 Ga0466967_0062330 Ga0466967_0062330_1761_2147 128
17 3300045976 Ga0466967_0249412 Ga0466967_0249412_219_605 128
18 3300049581 Ga0501047_0230687 Ga0501047_0230687_33_419 128
19 3300049583 Ga0501067_0086276 Ga0501067_0086276_305_691 128
20 3300050491 nmdc:mga00v17_127916_c1 nmdc:mga00v17_127916_c1_1116_1502 128
21 3300050491 nmdc:mga00v17_259255_c1 nmdc:mga00v17_259255_c1_657_1043 128
22 3300050492 nmdc:mga0yw44_273301_c1 nmdc:mga0yw44_273301_c1_723_1109 128
23 3300050492 nmdc:mga0yw44_946406_c1 nmdc:mga0yw44_946406_c1_169_555 128
24 3300050494 nmdc:mga06z11_200348_c1 nmdc:mga06z11_200348_c1_375_761 128
25 3300005339 Ga0070660_100680924 Ga0070660_1006809242 129
26 3300005436 Ga0070713_100947523 Ga0070713_1009475232 129
27 3300005439 Ga0070711_100202229 Ga0070711_1002022292 129
28 3300005468 Ga0070707_101886825 Ga0070707_1018868251 129
29 3300005985 Ga0081539_10237100 Ga0081539_102371002 129
30 3300005985 Ga0081539_10284082 Ga0081539_102840821 129
31 3300006028 Ga0070717_10588683 Ga0070717_105886832 129
32 3300006038 Ga0075365_10003891 Ga0075365_100038912 129
33 3300006051 Ga0075364_10132352 Ga0075364_101323521 129
34 3300006175 Ga0070712_100615216 Ga0070712_1006152162 129
35 3300006175 Ga0070712_100952525 Ga0070712_1009525251 129
36 3300025904 Ga0207647_10234741 Ga0207647_102347412 129
37 3300025915 Ga0207693_10252700 Ga0207693_102527002 129
38 3300025916 Ga0207663_10059220 Ga0207663_100592203 129
39 3300025922 Ga0207646_10718454 Ga0207646_107184542 129
40 3300025923 Ga0207681_10001013 Ga0207681_1000101312 129
41 3300025928 Ga0207700_10666842 Ga0207700_106668422 129
42 3300025942 Ga0207689_11041366 Ga0207689_110413662 129
43 3300028379 Ga0268266_10252098 Ga0268266_102520982 129
44 3300035083 Ga0373926_0059401 Ga0373926_0059401_376_765 129
45 3300035089 Ga0373944_0010616 Ga0373944_0010616_1379_1768 129
46 3300035116 Ga0373945_0012208 Ga0373945_0012208_1145_1534 129
47 3300035170 Ga0373943_0000112 Ga0373943_0000112_22858_23247 129
48 3300035171 Ga0373946_0008171 Ga0373946_0008171_3313_3702 129
49 3300035692 Ga0373935_0091508 Ga0373935_0091508_1235_1624 129
50 3300035695 Ga0373927_0021849 Ga0373927_0021849_2093_2482 129
51 3300035725 Ga0373947_0000600 Ga0373947_0000600_6797_7186 129
52 3300036712 Ga0316584_0500003 Ga0316584_0500003_224_616 129
53 3300037068 Ga0373925_0009167 Ga0373925_0009167_4258_4647 129
54 3300037312 Ga0395899_0246384 Ga0395899_0246384_169_558 129
55 3300037418 Ga0395900_0227314 Ga0395900_0227314_746_1135 129
56 3300037466 Ga0395898_0058640 Ga0395898_0058640_3134_3523 129
57 3300037466 Ga0395898_0163183 Ga0395898_0163183_969_1358 129
58 3300037471 Ga0395905_0345195 Ga0395905_0345195_140_529 129
59 3300038443 Ga0395901_0062370 Ga0395901_0062370_796_1185 129
60 3300038443 Ga0395901_0383850 Ga0395901_0383850_487_876 129
61 3300046454 Ga0495592_0165482 Ga0495592_0165482_72_461 129
62 3300046459 Ga0495629_0000593 Ga0495629_0000593_3301_3690 129
63 3300046461 Ga0495641_0000529 Ga0495641_0000529_25433_25822 129
64 3300046462 Ga0495651_0082191 Ga0495651_0082191_1980_2369 129
65 3300046463 Ga0495653_0006289 Ga0495653_0006289_9294_9683 129
66 3300046463 Ga0495653_0178742 Ga0495653_0178742_194_583 129
67 3300046473 Ga0495582_0000056 Ga0495582_0000056_33889_34278 129
68 3300046475 Ga0495639_0003603 Ga0495639_0003603_1889_2278 129
69 3300046476 Ga0495662_0015110 Ga0495662_0015110_1357_1746 129
70 3300046477 Ga0495664_0111202 Ga0495664_0111202_470_859 129
71 3300046511 Ga0495608_0263552 Ga0495608_0263552_375_764 129
72 3300046514 Ga0495618_0218025 Ga0495618_0218025_101_490 129
73 3300046516 Ga0495628_0580398 Ga0495628_0580398_182_571 129
74 3300046517 Ga0495630_0005694 Ga0495630_0005694_4203_4592 129
75 3300046526 Ga0495666_0041659 Ga0495666_0041659_1475_1864 129
76 3300046529 Ga0495652_0215186 Ga0495652_0215186_419_808 129
77 3300046531 Ga0495665_0000910 Ga0495665_0000910_14280_14669 129
78 3300046533 Ga0495640_0017849 Ga0495640_0017849_1179_1568 129
79 3300046533 Ga0495640_0074570 Ga0495640_0074570_1794_2183 129
80 3300046559 Ga0495667_0047005 Ga0495667_0047005_1248_1637 129
81 3300046642 Ga0495634_0026999 Ga0495634_0026999_1275_1664 129
82 3300046642 Ga0495634_0129034 Ga0495634_0129034_109_498 129
83 3300046663 Ga0495635_0062901 Ga0495635_0062901_734_1123 129
84 3300046663 Ga0495635_0068001 Ga0495635_0068001_24_413 129
85 3300046675 Ga0495657_0419244 Ga0495657_0419244_329_718 129
86 3300046678 Ga0495599_0472628 Ga0495599_0472628_299_688 129
87 3300046680 Ga0495646_0176412 Ga0495646_0176412_339_728 129
88 3300046681 Ga0495647_0039362 Ga0495647_0039362_1156_1545 129
89 3300046683 Ga0495658_0000204 Ga0495658_0000204_22970_23359 129
90 3300046689 Ga0495613_0000401 Ga0495613_0000401_13815_14204 129
91 3300046690 Ga0495624_0006658 Ga0495624_0006658_2987_3376 129
92 3300046809 Ga0495600_0030104 Ga0495600_0030104_931_1320 129
93 3300047315 Ga0495581_0000517 Ga0495581_0000517_8167_8556 129
94 3300047317 Ga0495604_0074351 Ga0495604_0074351_1178_1567 129
95 3300047319 Ga0495674_0029603 Ga0495674_0029603_3125_3514 129
96 3300047319 Ga0495674_1054872 Ga0495674_1054872_36_425 129
97 3300047321 Ga0495676_0010912 Ga0495676_0010912_2347_2736 129
98 3300047322 Ga0495680_0008870 Ga0495680_0008870_1243_1632 129
99 3300047322 Ga0495680_0019712 Ga0495680_0019712_1735_2124 129
100 3300047444 Ga0495675_0260164 Ga0495675_0260164_241_630 129
101 3300047471 Ga0495684_0020222 Ga0495684_0020222_3736_4125 129
102 3300047673 Ga0495593_0001987 Ga0495593_0001987_1304_1693 129
103 3300048089 Ga0495614_0026119 Ga0495614_0026119_109_498 129
104 3300048917 Ga0496114_0093503 Ga0496114_0093503_1768_2157 129
105 3300048918 Ga0496115_0035750 Ga0496115_0035750_1730_2119 129
106 3300049571 Ga0501034_0064118 Ga0501034_0064118_2132_2524 129
107 3300049572 Ga0501036_0301277 Ga0501036_0301277_546_938 129
108 3300049581 Ga0501047_0646821 Ga0501047_0646821_81_473 129
109 3300049586 Ga0501070_0003866 Ga0501070_0003866_11325_11714 129
110 3300050491 nmdc:mga00v17_144754_c1 nmdc:mga00v17_144754_c1_371_763 129
111 3300050492 nmdc:mga0yw44_328455_c1 nmdc:mga0yw44_328455_c1_300_692 129
112 3300050492 nmdc:mga0yw44_47913_c1 nmdc:mga0yw44_47913_c1_791_1183 129
113 3300053077 Ga0495601_0151594 Ga0495601_0151594_211_600 129
114 3300053077 Ga0495601_0991394 Ga0495601_0991394_105_494 129
115 3300053084 Ga0495595_0009175 Ga0495595_0009175_2361_2750 129
116 3300053085 Ga0495619_0001914 Ga0495619_0001914_5589_5978 129
117 3300053085 Ga0495619_0008233 Ga0495619_0008233_2362_2751 129
118 3300005329 Ga0070683_100005095 Ga0070683_1000050959 130
119 3300005329 Ga0070683_102099234 Ga0070683_1020992342 130
120 3300005330 Ga0070690_101253862 Ga0070690_1012538621 130
121 3300005335 Ga0070666_10142825 Ga0070666_101428252 130
122 3300005336 Ga0070680_100712558 Ga0070680_1007125581 130
123 3300005336 Ga0070680_101544923 Ga0070680_1015449231 130
124 3300005336 Ga0070680_101658759 Ga0070680_1016587591 130
125 3300005337 Ga0070682_100232060 Ga0070682_1002320602 130
126 3300005337 Ga0070682_100531497 Ga0070682_1005314972 130
127 3300005339 Ga0070660_100077437 Ga0070660_1000774373 130
128 3300005339 Ga0070660_100826626 Ga0070660_1008266262 130
129 3300005344 Ga0070661_100206900 Ga0070661_1002069002 130
130 3300005344 Ga0070661_101010636 Ga0070661_1010106361 130
131 3300005345 Ga0070692_10632675 Ga0070692_106326751 130
132 3300005355 Ga0070671_102038603 Ga0070671_1020386031 130
133 3300005356 Ga0070674_100216807 Ga0070674_1002168072 130
134 3300005364 Ga0070673_100855926 Ga0070673_1008559262 130
135 3300005365 Ga0070688_100173502 Ga0070688_1001735022 130
136 3300005366 Ga0070659_100280626 Ga0070659_1002806262 130
137 3300005436 Ga0070713_100202845 Ga0070713_1002028452 130
138 3300005441 Ga0070700_101125289 Ga0070700_1011252891 130
139 3300005456 Ga0070678_100228885 Ga0070678_1002288852 130
140 3300005458 Ga0070681_10111187 Ga0070681_101111871 130
141 3300005530 Ga0070679_100007568 Ga0070679_1000075683 130
142 3300005535 Ga0070684_100000286 Ga0070684_1000002866 130
143 3300005535 Ga0070684_100758427 Ga0070684_1007584272 130
144 3300005536 Ga0070697_101173066 Ga0070697_1011730662 130
145 3300005544 Ga0070686_100171734 Ga0070686_1001717342 130
146 3300005544 Ga0070686_101384173 Ga0070686_1013841731 130
147 3300005545 Ga0070695_100483213 Ga0070695_1004832132 130
148 3300005546 Ga0070696_100534900 Ga0070696_1005349002 130
149 3300005547 Ga0070693_100510772 Ga0070693_1005107722 130
150 3300005548 Ga0070665_100459721 Ga0070665_1004597212 130
151 3300005563 Ga0068855_100077276 Ga0068855_1000772763 130
152 3300005564 Ga0070664_100137055 Ga0070664_1001370553 130
153 3300005614 Ga0068856_100054954 Ga0068856_1000549544 130
154 3300005615 Ga0070702_100848141 Ga0070702_1008481411 130
155 3300005617 Ga0068859_102150856 Ga0068859_1021508561 130
156 3300005840 Ga0068870_10114627 Ga0068870_101146272 130
157 3300005840 Ga0068870_10561980 Ga0068870_105619802 130
158 3300005937 Ga0081455_10112401 Ga0081455_101124012 130
159 3300005937 Ga0081455_10123075 Ga0081455_101230752 130
160 3300005937 Ga0081455_10376675 Ga0081455_103766752 130
161 3300005937 Ga0081455_10852386 Ga0081455_108523861 130
162 3300006038 Ga0075365_10415227 Ga0075365_104152272 130
163 3300006051 Ga0075364_10497899 Ga0075364_104978992 130
164 3300006175 Ga0070712_100593532 Ga0070712_1005935322 130
165 3300006178 Ga0075367_10999641 Ga0075367_109996412 130
166 3300006237 Ga0097621_100213116 Ga0097621_1002131162 130
167 3300006237 Ga0097621_100363984 Ga0097621_1003639842 130
168 3300006358 Ga0068871_101750675 Ga0068871_1017506751 130
169 3300006844 Ga0075428_100007984 Ga0075428_1000079849 130
170 3300006844 Ga0075428_100583764 Ga0075428_1005837641 130
171 3300006852 Ga0075433_10756443 Ga0075433_107564432 130
172 3300006880 Ga0075429_100314316 Ga0075429_1003143162 130
173 3300006914 Ga0075436_100369654 Ga0075436_1003696542 130
174 3300006931 Ga0097620_102150825 Ga0097620_1021508252 130
175 3300007076 Ga0075435_100055348 Ga0075435_1000553484 130
176 3300009094 Ga0111539_10040887 Ga0111539_100408876 130
177 3300009098 Ga0105245_10122828 Ga0105245_101228284 130
178 3300009098 Ga0105245_10137493 Ga0105245_101374932 130
179 3300009098 Ga0105245_10348748 Ga0105245_103487482 130
180 3300009098 Ga0105245_11862597 Ga0105245_118625972 130
181 3300009147 Ga0114129_10000727 Ga0114129_1000072742 130
182 3300009147 Ga0114129_10170675 Ga0114129_101706753 130
183 3300009147 Ga0114129_11431861 Ga0114129_114318612 130
184 3300009148 Ga0105243_10109909 Ga0105243_101099092 130
185 3300009174 Ga0105241_10829209 Ga0105241_108292091 130
186 3300009176 Ga0105242_10329695 Ga0105242_103296952 130
187 3300009176 Ga0105242_11306124 Ga0105242_113061242 130
188 3300009177 Ga0105248_10160218 Ga0105248_101602182 130
189 3300009177 Ga0105248_11006895 Ga0105248_110068952 130
190 3300009545 Ga0105237_10974551 Ga0105237_109745512 130
191 3300009551 Ga0105238_10996094 Ga0105238_109960942 130
192 3300010375 Ga0105239_10221657 Ga0105239_102216572 130
193 3300011119 Ga0105246_10969760 Ga0105246_109697602 130
194 3300013296 Ga0157374_10128262 Ga0157374_101282622 130
195 3300013296 Ga0157374_11043122 Ga0157374_110431221 130
196 3300013297 Ga0157378_10275550 Ga0157378_102755502 130
197 3300013306 Ga0163162_10093384 Ga0163162_100933842 130
198 3300013307 Ga0157372_12120176 Ga0157372_121201762 130
199 3300013308 Ga0157375_10297023 Ga0157375_102970232 130
200 3300013308 Ga0157375_11204406 Ga0157375_112044062 130
201 3300014325 Ga0163163_10164086 Ga0163163_101640862 130
202 3300014325 Ga0163163_12034623 Ga0163163_120346232 130
203 3300014497 Ga0182008_10845273 Ga0182008_108452731 130
204 3300014745 Ga0157377_10030329 Ga0157377_100303292 130
205 3300014969 Ga0157376_10254312 Ga0157376_102543122 130
206 3300014969 Ga0157376_10464925 Ga0157376_104649251 130
207 3300014969 Ga0157376_10704573 Ga0157376_107045732 130
208 3300017792 Ga0163161_10342206 Ga0163161_103422062 130
209 3300020082 Ga0206353_10259235 Ga0206353_102592352 130
210 3300025899 Ga0207642_10329929 Ga0207642_103299292 130
211 3300025901 Ga0207688_10490131 Ga0207688_104901311 130
212 3300025911 Ga0207654_10455777 Ga0207654_104557772 130
213 3300025912 Ga0207707_10031620 Ga0207707_100316201 130
214 3300025916 Ga0207663_10689903 Ga0207663_106899031 130
215 3300025917 Ga0207660_11160961 Ga0207660_111609612 130
216 3300025919 Ga0207657_10731425 Ga0207657_107314252 130
217 3300025921 Ga0207652_10006892 Ga0207652_100068924 130
218 3300025925 Ga0207650_11333318 Ga0207650_113333182 130
219 3300025926 Ga0207659_10359004 Ga0207659_103590042 130
220 3300025927 Ga0207687_10049998 Ga0207687_100499983 130
221 3300025927 Ga0207687_10100296 Ga0207687_101002964 130
222 3300025927 Ga0207687_10864587 Ga0207687_108645872 130
223 3300025927 Ga0207687_11003703 Ga0207687_110037032 130
224 3300025927 Ga0207687_11205023 Ga0207687_112050232 130
225 3300025928 Ga0207700_10608149 Ga0207700_106081491 130
226 3300025931 Ga0207644_10860961 Ga0207644_108609612 130
227 3300025932 Ga0207690_10653091 Ga0207690_106530911 130
228 3300025934 Ga0207686_10588042 Ga0207686_105880422 130
229 3300025935 Ga0207709_10091967 Ga0207709_100919672 130
230 3300025935 Ga0207709_10958849 Ga0207709_109588492 130
231 3300025938 Ga0207704_10440476 Ga0207704_104404762 130
232 3300025941 Ga0207711_10753361 Ga0207711_107533612 130
233 3300025944 Ga0207661_10003778 Ga0207661_100037789 130
234 3300025944 Ga0207661_10094389 Ga0207661_100943893 130
235 3300025945 Ga0207679_10042141 Ga0207679_100421414 130
236 3300025949 Ga0207667_10438227 Ga0207667_104382272 130
237 3300025961 Ga0207712_10129121 Ga0207712_101291213 130
238 3300025972 Ga0207668_10152887 Ga0207668_101528872 130
239 3300025972 Ga0207668_11239844 Ga0207668_112398441 130
240 3300026067 Ga0207678_10826813 Ga0207678_108268132 130
241 3300026078 Ga0207702_10026096 Ga0207702_100260962 130
242 3300026078 Ga0207702_11244373 Ga0207702_112443732 130
243 3300026095 Ga0207676_10838310 Ga0207676_108383102 130
244 3300026118 Ga0207675_101388605 Ga0207675_1013886052 130
245 3300028380 Ga0268265_10998321 Ga0268265_109983212 130
246 3300028577 Ga0265318_10078356 Ga0265318_100783562 130
247 3300031824 Ga0307413_10453533 Ga0307413_104535332 130
248 3300031852 Ga0307410_10346642 Ga0307410_103466422 130
249 3300031852 Ga0307410_11576523 Ga0307410_115765232 130
250 3300031901 Ga0307406_10218345 Ga0307406_102183452 130
251 3300031995 Ga0307409_100413067 Ga0307409_1004130672 130
252 3300031995 Ga0307409_101331804 Ga0307409_1013318042 130
253 3300032002 Ga0307416_100260956 Ga0307416_1002609562 130
254 3300032004 Ga0307414_10493413 Ga0307414_104934132 130
255 3300032126 Ga0307415_100305203 Ga0307415_1003052031 130
256 3300032126 Ga0307415_101497355 Ga0307415_1014973551 130
257 3300037312 Ga0395899_0062762 Ga0395899_0062762_1991_2383 130
258 3300037312 Ga0395899_0272482 Ga0395899_0272482_418_813 130
259 3300037418 Ga0395900_0041807 Ga0395900_0041807_1290_1682 130
260 3300037418 Ga0395900_0043734 Ga0395900_0043734_975_1367 130
261 3300037418 Ga0395900_0188662 Ga0395900_0188662_491_886 130
262 3300037418 Ga0395900_0203195 Ga0395900_0203195_1031_1426 130
263 3300037466 Ga0395898_0039798 Ga0395898_0039798_1147_1539 130
264 3300037466 Ga0395898_0102181 Ga0395898_0102181_1712_2107 130
265 3300037466 Ga0395898_0634691 Ga0395898_0634691_35_430 130
266 3300037471 Ga0395905_0612284 Ga0395905_0612284_521_916 130
267 3300037471 Ga0395905_1288090 Ga0395905_1288090_14_409 130
268 3300037471 Ga0395905_1795841 Ga0395905_1795841_61_453 130
269 3300038443 Ga0395901_0016021 Ga0395901_0016021_5123_5518 130
270 3300038443 Ga0395901_0061730 Ga0395901_0061730_735_1127 130
271 3300038443 Ga0395901_0093813 Ga0395901_0093813_500_892 130
272 3300038443 Ga0395901_0144701 Ga0395901_0144701_1927_2322 130
273 3300038443 Ga0395901_0239619 Ga0395901_0239619_1441_1836 130
274 3300044684 Ga0466966_0723016 Ga0466966_0723016_148_540 130
275 3300045976 Ga0466967_0035947 Ga0466967_0035947_2113_2505 130
276 3300046455 Ga0495603_0254211 Ga0495603_0254211_161_553 130
277 3300046474 Ga0495605_0068460 Ga0495605_0068460_86_478 130
278 3300046476 Ga0495662_0058719 Ga0495662_0058719_1005_1397 130
279 3300046491 Ga0495584_0303429 Ga0495584_0303429_293_685 130
280 3300046525 Ga0495663_0100296 Ga0495663_0100296_70_462 130
281 3300046543 Ga0495645_0390316 Ga0495645_0390316_332_724 130
282 3300046615 Ga0495656_0020716 Ga0495656_0020716_1459_1851 130
283 3300046615 Ga0495656_0069782 Ga0495656_0069782_537_929 130
284 3300046642 Ga0495634_0293268 Ga0495634_0293268_264_656 130
285 3300046681 Ga0495647_0036946 Ga0495647_0036946_1337_1729 130
286 3300046794 Ga0495589_0297348 Ga0495589_0297348_57_449 130
287 3300047322 Ga0495680_0317005 Ga0495680_0317005_189_581 130
288 3300048903 Ga0496100_0044261 Ga0496100_0044261_1322_1714 130
289 3300048903 Ga0496100_0068131 Ga0496100_0068131_188_580 130
290 3300048904 Ga0496101_0018182 Ga0496101_0018182_2598_2990 130
291 3300048904 Ga0496101_0029430 Ga0496101_0029430_3256_3648 130
292 3300048904 Ga0496101_0121800 Ga0496101_0121800_1402_1794 130
293 3300048904 Ga0496101_0154321 Ga0496101_0154321_19_411 130
294 3300048905 Ga0496102_0015240 Ga0496102_0015240_393_785 130
295 3300048905 Ga0496102_0337572 Ga0496102_0337572_867_1259 130
296 3300048905 Ga0496102_0646653 Ga0496102_0646653_522_914 130
297 3300048906 Ga0496103_0143006 Ga0496103_0143006_355_747 130
298 3300048907 Ga0496104_0000571 Ga0496104_0000571_22462_22854 130
299 3300048907 Ga0496104_0013102 Ga0496104_0013102_6706_7098 130
300 3300048908 Ga0496105_0240795 Ga0496105_0240795_206_598 130
301 3300048908 Ga0496105_0340463 Ga0496105_0340463_415_807 130
302 3300048908 Ga0496105_0582406 Ga0496105_0582406_207_599 130
303 3300048908 Ga0496105_0660240 Ga0496105_0660240_384_776 130
304 3300048909 Ga0496106_0249434 Ga0496106_0249434_465_857 130
305 3300048909 Ga0496106_0268126 Ga0496106_0268126_942_1337 130
306 3300048910 Ga0496107_0180795 Ga0496107_0180795_912_1307 130
307 3300048910 Ga0496107_0198279 Ga0496107_0198279_1035_1427 130
308 3300048910 Ga0496107_0491331 Ga0496107_0491331_181_573 130
309 3300048911 Ga0496108_0037194 Ga0496108_0037194_2318_2710 130
310 3300048911 Ga0496108_0286532 Ga0496108_0286532_377_769 130
311 3300048912 Ga0496109_0000638 Ga0496109_0000638_28151_28543 130
312 3300048912 Ga0496109_0292057 Ga0496109_0292057_501_893 130
313 3300048912 Ga0496109_0882527 Ga0496109_0882527_337_735 130
314 3300048912 Ga0496109_1794561 Ga0496109_1794561_35_427 130
315 3300048913 Ga0496110_0001697 Ga0496110_0001697_2418_2810 130
316 3300048913 Ga0496110_0280503 Ga0496110_0280503_821_1213 130
317 3300048913 Ga0496110_0635728 Ga0496110_0635728_538_933 130
318 3300048914 Ga0496111_0000025 Ga0496111_0000025_52962_53354 130
319 3300048914 Ga0496111_0027978 Ga0496111_0027978_2335_2727 130
320 3300048914 Ga0496111_0194638 Ga0496111_0194638_540_935 130
321 3300048914 Ga0496111_0347061 Ga0496111_0347061_15_407 130
322 3300048915 Ga0496112_0253100 Ga0496112_0253100_836_1231 130
323 3300048915 Ga0496112_0530166 Ga0496112_0530166_543_935 130
324 3300048915 Ga0496112_0717772 Ga0496112_0717772_43_435 130
325 3300048917 Ga0496114_0001903 Ga0496114_0001903_4374_4766 130
326 3300048917 Ga0496114_0039807 Ga0496114_0039807_848_1240 130
327 3300048917 Ga0496114_0045742 Ga0496114_0045742_1460_1852 130
328 3300048917 Ga0496114_0116801 Ga0496114_0116801_75_467 130
329 3300048917 Ga0496114_0555414 Ga0496114_0555414_135_527 130
330 3300048918 Ga0496115_0546724 Ga0496115_0546724_296_688 130
331 3300049569 Ga0501032_0590662 Ga0501032_0590662_86_478 130
332 3300049572 Ga0501036_0764951 Ga0501036_0764951_295_687 130
333 3300049574 Ga0501038_0401156 Ga0501038_0401156_84_476 130
334 3300049578 Ga0501042_0184233 Ga0501042_0184233_599_991 130
335 3300049578 Ga0501042_0573871 Ga0501042_0573871_308_700 130
336 3300049579 Ga0501043_0784959 Ga0501043_0784959_112_504 130
337 3300049581 Ga0501047_0502347 Ga0501047_0502347_368_760 130
338 3300049581 Ga0501047_0742354 Ga0501047_0742354_353_745 130
339 3300049582 Ga0501048_0236980 Ga0501048_0236980_540_932 130
340 3300049583 Ga0501067_0223945 Ga0501067_0223945_639_1031 130
341 3300049583 Ga0501067_0231389 Ga0501067_0231389_340_732 130
342 3300049584 Ga0501068_0377105 Ga0501068_0377105_83_475 130
343 3300049585 Ga0501069_0128744 Ga0501069_0128744_152_544 130
344 3300049585 Ga0501069_0149679 Ga0501069_0149679_740_1132 130
345 3300049585 Ga0501069_0638757 Ga0501069_0638757_39_431 130
346 3300049586 Ga0501070_0128150 Ga0501070_0128150_488_880 130
347 3300049586 Ga0501070_0517461 Ga0501070_0517461_51_443 130
348 3300049587 Ga0501071_1021160 Ga0501071_1021160_195_587 130
349 3300049590 Ga0501074_0018234 Ga0501074_0018234_4401_4793 130
350 3300049674 Ga0501242_029051 Ga0501242_029051_142_534 130
351 3300049675 Ga0501243_066454 Ga0501243_066454_16_408 130
352 3300049741 Ga0501079_0109663 Ga0501079_0109663_943_1335 130
353 3300049741 Ga0501079_0145539 Ga0501079_0145539_45_437 130
354 3300049742 Ga0501080_0070880 Ga0501080_0070880_1051_1443 130
355 3300049743 Ga0501081_0035504 Ga0501081_0035504_271_663 130
356 3300049779 Ga0501283_098101 Ga0501283_098101_37_429 130
357 3300049822 Ga0501035_0734223 Ga0501035_0734223_272_664 130
358 3300049823 Ga0501044_0808063 Ga0501044_0808063_188_580 130
359 3300049824 Ga0501045_0047826 Ga0501045_0047826_2168_2560 130
360 3300050490 nmdc:mga03n38_844024_c1 nmdc:mga03n38_844024_c1_62_454 130
361 3300050491 nmdc:mga00v17_632437_c1 nmdc:mga00v17_632437_c1_91_489 130
362 3300050494 nmdc:mga06z11_156255_c1 nmdc:mga06z11_156255_c1_401_793 130
363 3300050507 nmdc:mga05p37_206353_c1 nmdc:mga05p37_206353_c1_1195_1593 130
364 3300050510 nmdc:mga06r32_125637_c1 nmdc:mga06r32_125637_c1_520_912 130
365 3300050511 nmdc:mga08y16_77841_c1 nmdc:mga08y16_77841_c1_495_893 130
366 3300050512 nmdc:mga0n895_418012_c1 nmdc:mga0n895_418012_c1_231_623 130
367 3300050512 nmdc:mga0n895_99622_c1 nmdc:mga0n895_99622_c1_1132_1524 130
368 3300050513 nmdc:mga0rr50_468178_c1 nmdc:mga0rr50_468178_c1_243_635 130
369 3300050513 nmdc:mga0rr50_702115_c1 nmdc:mga0rr50_702115_c1_60_452 130
370 3300050515 nmdc:mga0a205_50115_c1 nmdc:mga0a205_50115_c1_1010_1408 130
371 3300053077 Ga0495601_0459364 Ga0495601_0459364_326_718 130
372 3300054114 Ga0501084_0776493 Ga0501084_0776493_31_423 130
373 3300054114 Ga0501084_0892034 Ga0501084_0892034_234_626 130
374 3300059491 Ga0587070_135859 Ga0587070_135859_101_493 130
375 3300059492 Ga0587073_0218009 Ga0587073_0218009_148_540 130
376 3300059640 Ga0587067_179603 Ga0587067_179603_105_497 130
377 3300060353 Ga0501082_0037616 Ga0501082_0037616_547_939 130
378 3300061734 Ga0530510_0519490 Ga0530510_0519490_98_490 130
379 3300003203 JGI25406J46586_10036185 JGI25406J46586_100361852 131
380 3300005327 Ga0070658_10008240 Ga0070658_100082408 131
381 3300005327 Ga0070658_10512798 Ga0070658_105127981 131
382 3300005329 Ga0070683_100008967 Ga0070683_1000089672 131
383 3300005329 Ga0070683_100147264 Ga0070683_1001472642 131
384 3300005329 Ga0070683_100210639 Ga0070683_1002106392 131
385 3300005336 Ga0070680_100061784 Ga0070680_1000617842 131
386 3300005336 Ga0070680_101043513 Ga0070680_1010435132 131
387 3300005338 Ga0068868_100775841 Ga0068868_1007758412 131
388 3300005339 Ga0070660_100045171 Ga0070660_1000451713 131
389 3300005339 Ga0070660_100670785 Ga0070660_1006707852 131
390 3300005341 Ga0070691_10771556 Ga0070691_107715561 131
391 3300005343 Ga0070687_100381079 Ga0070687_1003810791 131
392 3300005344 Ga0070661_100583191 Ga0070661_1005831912 131
393 3300005347 Ga0070668_100097191 Ga0070668_1000971913 131
394 3300005347 Ga0070668_100306058 Ga0070668_1003060582 131
395 3300005347 Ga0070668_100309106 Ga0070668_1003091062 131
396 3300005353 Ga0070669_100457680 Ga0070669_1004576802 131
397 3300005355 Ga0070671_100386286 Ga0070671_1003862862 131
398 3300005355 Ga0070671_100559681 Ga0070671_1005596812 131
399 3300005356 Ga0070674_100233845 Ga0070674_1002338452 131
400 3300005366 Ga0070659_100056686 Ga0070659_1000566861 131
401 3300005366 Ga0070659_101009031 Ga0070659_1010090312 131
402 3300005434 Ga0070709_10063824 Ga0070709_100638242 131
403 3300005435 Ga0070714_100443034 Ga0070714_1004430342 131
404 3300005435 Ga0070714_101310714 Ga0070714_1013107142 131
405 3300005436 Ga0070713_100452660 Ga0070713_1004526602 131
406 3300005436 Ga0070713_100466729 Ga0070713_1004667292 131
407 3300005436 Ga0070713_100839756 Ga0070713_1008397562 131
408 3300005436 Ga0070713_101441098 Ga0070713_1014410982 131
409 3300005437 Ga0070710_10009026 Ga0070710_100090263 131
410 3300005437 Ga0070710_10099411 Ga0070710_100994113 131
411 3300005437 Ga0070710_10309267 Ga0070710_103092672 131
412 3300005438 Ga0070701_10085966 Ga0070701_100859662 131
413 3300005439 Ga0070711_100038326 Ga0070711_1000383262 131
414 3300005439 Ga0070711_100168410 Ga0070711_1001684102 131
415 3300005440 Ga0070705_100123792 Ga0070705_1001237922 131
416 3300005440 Ga0070705_100553676 Ga0070705_1005536761 131
417 3300005440 Ga0070705_101948893 Ga0070705_1019488931 131
418 3300005444 Ga0070694_100074768 Ga0070694_1000747682 131
419 3300005444 Ga0070694_100090238 Ga0070694_1000902382 131
420 3300005445 Ga0070708_100171666 Ga0070708_1001716662 131
421 3300005445 Ga0070708_100186023 Ga0070708_1001860231 131
422 3300005445 Ga0070708_100294220 Ga0070708_1002942202 131
423 3300005445 Ga0070708_100353176 Ga0070708_1003531762 131
424 3300005445 Ga0070708_100714660 Ga0070708_1007146602 131
425 3300005445 Ga0070708_102195912 Ga0070708_1021959121 131
426 3300005455 Ga0070663_100546089 Ga0070663_1005460892 131
427 3300005456 Ga0070678_100930602 Ga0070678_1009306022 131
428 3300005458 Ga0070681_10022081 Ga0070681_100220818 131
429 3300005466 Ga0070685_10852669 Ga0070685_108526691 131
430 3300005467 Ga0070706_100229391 Ga0070706_1002293912 131
431 3300005467 Ga0070706_100233059 Ga0070706_1002330592 131
432 3300005468 Ga0070707_100629281 Ga0070707_1006292812 131
433 3300005468 Ga0070707_100772166 Ga0070707_1007721662 131
434 3300005471 Ga0070698_100032881 Ga0070698_1000328815 131
435 3300005471 Ga0070698_100386912 Ga0070698_1003869122 131
436 3300005518 Ga0070699_100322895 Ga0070699_1003228952 131
437 3300005530 Ga0070679_100013106 Ga0070679_1000131063 131
438 3300005535 Ga0070684_100010068 Ga0070684_1000100688 131
439 3300005535 Ga0070684_100020927 Ga0070684_1000209272 131
440 3300005535 Ga0070684_100488073 Ga0070684_1004880732 131
441 3300005536 Ga0070697_100069763 Ga0070697_1000697632 131
442 3300005536 Ga0070697_100235797 Ga0070697_1002357972 131
443 3300005545 Ga0070695_100330904 Ga0070695_1003309042 131
444 3300005546 Ga0070696_100075073 Ga0070696_1000750732 131
445 3300005547 Ga0070693_101312426 Ga0070693_1013124261 131
446 3300005549 Ga0070704_100082166 Ga0070704_1000821661 131
447 3300005563 Ga0068855_100017076 Ga0068855_1000170764 131
448 3300005563 Ga0068855_100077741 Ga0068855_1000777414 131
449 3300005563 Ga0068855_102062937 Ga0068855_1020629372 131
450 3300005564 Ga0070664_100223690 Ga0070664_1002236902 131
451 3300005577 Ga0068857_100096601 Ga0068857_1000966013 131
452 3300005577 Ga0068857_100130441 Ga0068857_1001304412 131
453 3300005614 Ga0068856_100688561 Ga0068856_1006885612 131
454 3300005614 Ga0068856_100817094 Ga0068856_1008170942 131
455 3300005615 Ga0070702_100028067 Ga0070702_1000280673 131
456 3300005719 Ga0068861_100057930 Ga0068861_1000579302 131
457 3300005844 Ga0068862_100743184 Ga0068862_1007431842 131
458 3300005937 Ga0081455_10032931 Ga0081455_100329314 131
459 3300005937 Ga0081455_10148585 Ga0081455_101485852 131
460 3300005937 Ga0081455_10162975 Ga0081455_101629752 131
461 3300005981 Ga0081538_10022318 Ga0081538_100223182 131
462 3300005985 Ga0081539_10000041 Ga0081539_10000041225 131
463 3300006028 Ga0070717_10050974 Ga0070717_100509742 131
464 3300006028 Ga0070717_12051928 Ga0070717_120519281 131
465 3300006048 Ga0075363_100839151 Ga0075363_1008391512 131
466 3300006058 Ga0075432_10020848 Ga0075432_100208482 131
467 3300006173 Ga0070716_100111073 Ga0070716_1001110733 131
468 3300006173 Ga0070716_100169461 Ga0070716_1001694612 131
469 3300006173 Ga0070716_100971576 Ga0070716_1009715762 131
470 3300006175 Ga0070712_100015956 Ga0070712_1000159563 131
471 3300006175 Ga0070712_100062040 Ga0070712_1000620403 131
472 3300006175 Ga0070712_100978973 Ga0070712_1009789731 131
473 3300006178 Ga0075367_10216978 Ga0075367_102169782 131
474 3300006358 Ga0068871_101061968 Ga0068871_1010619682 131
475 3300006844 Ga0075428_100036324 Ga0075428_1000363243 131
476 3300006844 Ga0075428_100309683 Ga0075428_1003096832 131
477 3300006844 Ga0075428_100580490 Ga0075428_1005804902 131
478 3300006844 Ga0075428_102132311 Ga0075428_1021323111 131
479 3300006847 Ga0075431_100038295 Ga0075431_1000382954 131
480 3300006847 Ga0075431_100235771 Ga0075431_1002357712 131
481 3300006852 Ga0075433_10468092 Ga0075433_104680922 131
482 3300006852 Ga0075433_10987625 Ga0075433_109876252 131
483 3300006871 Ga0075434_100028518 Ga0075434_1000285182 131
484 3300006871 Ga0075434_100047775 Ga0075434_1000477753 131
485 3300006871 Ga0075434_100049169 Ga0075434_1000491692 131
486 3300006880 Ga0075429_100437594 Ga0075429_1004375942 131
487 3300006881 Ga0068865_101109617 Ga0068865_1011096172 131
488 3300006914 Ga0075436_100002183 Ga0075436_1000021834 131
489 3300006914 Ga0075436_100029390 Ga0075436_1000293903 131
490 3300007076 Ga0075435_100012599 Ga0075435_1000125996 131
491 3300007076 Ga0075435_100083256 Ga0075435_1000832563 131
492 3300007076 Ga0075435_100087463 Ga0075435_1000874632 131
493 3300007076 Ga0075435_100379651 Ga0075435_1003796512 131
494 3300009093 Ga0105240_10027311 Ga0105240_100273117 131
495 3300009093 Ga0105240_10492909 Ga0105240_104929092 131
496 3300009094 Ga0111539_10011337 Ga0111539_100113373 131
497 3300009094 Ga0111539_10966657 Ga0111539_109666572 131
498 3300009094 Ga0111539_11978653 Ga0111539_119786531 131
499 3300009098 Ga0105245_10211852 Ga0105245_102118522 131
500 3300009098 Ga0105245_10251480 Ga0105245_102514802 131
501 3300009098 Ga0105245_10259335 Ga0105245_102593352 131
502 3300009147 Ga0114129_10012477 Ga0114129_100124773 131
503 3300009147 Ga0114129_10024257 Ga0114129_100242576 131
504 3300009147 Ga0114129_10327639 Ga0114129_103276392 131
505 3300009147 Ga0114129_10919239 Ga0114129_109192392 131
506 3300009147 Ga0114129_13133112 Ga0114129_131331122 131
507 3300009148 Ga0105243_10054496 Ga0105243_100544963 131
508 3300009148 Ga0105243_10374651 Ga0105243_103746512 131
509 3300009148 Ga0105243_12750862 Ga0105243_127508622 131
510 3300009176 Ga0105242_10083979 Ga0105242_100839792 131
511 3300009176 Ga0105242_10134171 Ga0105242_101341713 131
512 3300009176 Ga0105242_10934870 Ga0105242_109348702 131
513 3300009176 Ga0105242_11383508 Ga0105242_113835082 131
514 3300009553 Ga0105249_10624440 Ga0105249_106244402 131
515 3300010375 Ga0105239_10362957 Ga0105239_103629572 131
516 3300010375 Ga0105239_13244118 Ga0105239_132441181 131
517 3300013104 Ga0157370_10093330 Ga0157370_100933302 131
518 3300013104 Ga0157370_10372328 Ga0157370_103723282 131
519 3300013104 Ga0157370_10611214 Ga0157370_106112142 131
520 3300013104 Ga0157370_11539966 Ga0157370_115399662 131
521 3300013105 Ga0157369_10006794 Ga0157369_100067942 131
522 3300013105 Ga0157369_10732870 Ga0157369_107328702 131
523 3300013105 Ga0157369_11690269 Ga0157369_116902692 131
524 3300013296 Ga0157374_11300703 Ga0157374_113007032 131
525 3300013297 Ga0157378_10101928 Ga0157378_101019282 131
526 3300013297 Ga0157378_12248028 Ga0157378_122480282 131
527 3300013307 Ga0157372_10287435 Ga0157372_102874352 131
528 3300013307 Ga0157372_10830094 Ga0157372_108300942 131
529 3300013307 Ga0157372_11319231 Ga0157372_113192312 131
530 3300013307 Ga0157372_13018400 Ga0157372_130184002 131
531 3300013308 Ga0157375_10790965 Ga0157375_107909652 131
532 3300013308 Ga0157375_11036210 Ga0157375_110362102 131
533 3300014497 Ga0182008_10250564 Ga0182008_102505642 131
534 3300014745 Ga0157377_10313810 Ga0157377_103138101 131
535 3300014968 Ga0157379_10256715 Ga0157379_102567152 131
536 3300014969 Ga0157376_10094137 Ga0157376_100941373 131
537 3300014969 Ga0157376_11751010 Ga0157376_117510102 131
538 3300015262 Ga0182007_10280670 Ga0182007_102806701 131
539 3300020069 Ga0197907_10799915 Ga0197907_107999152 131
540 3300020082 Ga0206353_11073166 Ga0206353_110731661 131
541 3300022467 Ga0224712_10422282 Ga0224712_104222822 131
542 3300025898 Ga0207692_10063853 Ga0207692_100638532 131
543 3300025898 Ga0207692_10125979 Ga0207692_101259792 131
544 3300025901 Ga0207688_10091228 Ga0207688_100912282 131
545 3300025905 Ga0207685_10451309 Ga0207685_104513092 131
546 3300025909 Ga0207705_10019314 Ga0207705_100193145 131
547 3300025909 Ga0207705_10045782 Ga0207705_100457823 131
548 3300025910 Ga0207684_10441074 Ga0207684_104410742 131
549 3300025912 Ga0207707_10030088 Ga0207707_100300886 131
550 3300025913 Ga0207695_10138907 Ga0207695_101389072 131
551 3300025913 Ga0207695_10365656 Ga0207695_103656562 131
552 3300025915 Ga0207693_10006225 Ga0207693_100062257 131
553 3300025915 Ga0207693_10023433 Ga0207693_100234332 131
554 3300025916 Ga0207663_10285045 Ga0207663_102850452 131
555 3300025917 Ga0207660_10140212 Ga0207660_101402122 131
556 3300025918 Ga0207662_10352534 Ga0207662_103525342 131
557 3300025919 Ga0207657_10002271 Ga0207657_100022712 131
558 3300025919 Ga0207657_10342322 Ga0207657_103423222 131
559 3300025920 Ga0207649_11234295 Ga0207649_112342952 131
560 3300025921 Ga0207652_10020012 Ga0207652_100200125 131
561 3300025922 Ga0207646_10489785 Ga0207646_104897852 131
562 3300025923 Ga0207681_11778714 Ga0207681_117787141 131
563 3300025927 Ga0207687_10681934 Ga0207687_106819342 131
564 3300025927 Ga0207687_10682290 Ga0207687_106822901 131
565 3300025928 Ga0207700_10296300 Ga0207700_102963002 131
566 3300025928 Ga0207700_10781608 Ga0207700_107816082 131
567 3300025928 Ga0207700_11069270 Ga0207700_110692702 131
568 3300025929 Ga0207664_10339744 Ga0207664_103397442 131
569 3300025929 Ga0207664_10565140 Ga0207664_105651402 131
570 3300025931 Ga0207644_10199581 Ga0207644_101995812 131
571 3300025931 Ga0207644_10326211 Ga0207644_103262112 131
572 3300025932 Ga0207690_11077391 Ga0207690_110773911 131
573 3300025933 Ga0207706_10219535 Ga0207706_102195352 131
574 3300025934 Ga0207686_10312281 Ga0207686_103122812 131
575 3300025934 Ga0207686_10364590 Ga0207686_103645902 131
576 3300025934 Ga0207686_10504363 Ga0207686_105043632 131
577 3300025935 Ga0207709_10110243 Ga0207709_101102432 131
578 3300025935 Ga0207709_11631939 Ga0207709_116319392 131
579 3300025937 Ga0207669_11933980 Ga0207669_119339802 131
580 3300025939 Ga0207665_10007335 Ga0207665_100073354 131
581 3300025939 Ga0207665_10154222 Ga0207665_101542222 131
582 3300025944 Ga0207661_10019199 Ga0207661_100191993 131
583 3300025944 Ga0207661_10229811 Ga0207661_102298112 131
584 3300025944 Ga0207661_10632168 Ga0207661_106321682 131
585 3300025945 Ga0207679_10130440 Ga0207679_101304402 131
586 3300025949 Ga0207667_10062476 Ga0207667_100624763 131
587 3300025949 Ga0207667_10151667 Ga0207667_101516672 131
588 3300025972 Ga0207668_10061896 Ga0207668_100618962 131
589 3300025972 Ga0207668_10106338 Ga0207668_101063383 131
590 3300026023 Ga0207677_10627762 Ga0207677_106277622 131
591 3300026067 Ga0207678_10342509 Ga0207678_103425092 131
592 3300026075 Ga0207708_11121002 Ga0207708_111210022 131
593 3300026078 Ga0207702_10055906 Ga0207702_100559062 131
594 3300026089 Ga0207648_10039412 Ga0207648_100394125 131
595 3300026116 Ga0207674_10103020 Ga0207674_101030202 131
596 3300026116 Ga0207674_10108055 Ga0207674_101080552 131
597 3300026118 Ga0207675_100088997 Ga0207675_1000889973 131
598 3300026121 Ga0207683_11329260 Ga0207683_113292601 131
599 3300026121 Ga0207683_11684754 Ga0207683_116847542 131
600 3300028381 Ga0268264_10596134 Ga0268264_105961342 131
601 3300028563 Ga0265319_1025488 Ga0265319_10254882 131
602 3300028577 Ga0265318_10052499 Ga0265318_100524992 131
603 3300028577 Ga0265318_10087716 Ga0265318_100877162 131
604 3300028654 Ga0265322_10054404 Ga0265322_100544042 131
605 3300028800 Ga0265338_10007064 Ga0265338_1000706410 131
606 3300028800 Ga0265338_10382411 Ga0265338_103824112 131
607 3300028800 Ga0265338_10506487 Ga0265338_105064872 131
608 3300031240 Ga0265320_10070894 Ga0265320_100708942 131
609 3300031251 Ga0265327_10017969 Ga0265327_100179692 131
610 3300031251 Ga0265327_10088501 Ga0265327_100885012 131
611 3300031731 Ga0307405_10128514 Ga0307405_101285142 131
612 3300031903 Ga0307407_11274296 Ga0307407_112742961 131
613 3300031911 Ga0307412_10295070 Ga0307412_102950702 131
614 3300032002 Ga0307416_100051442 Ga0307416_1000514422 131
615 3300032002 Ga0307416_101081339 Ga0307416_1010813392 131
616 3300032002 Ga0307416_101655456 Ga0307416_1016554562 131
617 3300032126 Ga0307415_100038491 Ga0307415_1000384913 131
618 3300032126 Ga0307415_100650673 Ga0307415_1006506732 131
619 3300035115 Ga0373941_0417103 Ga0373941_0417103_139_537 131
620 3300035119 Ga0373956_0159685 Ga0373956_0159685_96_491 131
621 3300035170 Ga0373943_0069862 Ga0373943_0069862_618_1016 131
622 3300035170 Ga0373943_0409292 Ga0373943_0409292_194_589 131
623 3300035172 Ga0373955_0134969 Ga0373955_0134969_80_475 131
624 3300035691 Ga0373931_0512209 Ga0373931_0512209_252_650 131
625 3300035724 Ga0373933_0413786 Ga0373933_0413786_421_816 131
626 3300035725 Ga0373947_0205433 Ga0373947_0205433_702_1100 131
627 3300036401 Ga0373937_0709846 Ga0373937_0709846_408_803 131
628 3300036401 Ga0373937_0940959 Ga0373937_0940959_106_504 131
629 3300037312 Ga0395899_0001446 Ga0395899_0001446_5060_5455 131
630 3300037312 Ga0395899_0013404 Ga0395899_0013404_698_1093 131
631 3300037312 Ga0395899_0019546 Ga0395899_0019546_4224_4619 131
632 3300037312 Ga0395899_0020632 Ga0395899_0020632_2768_3163 131
633 3300037312 Ga0395899_0029130 Ga0395899_0029130_2742_3137 131
634 3300037312 Ga0395899_0084198 Ga0395899_0084198_873_1268 131
635 3300037312 Ga0395899_0156099 Ga0395899_0156099_365_760 131
636 3300037418 Ga0395900_0000871 Ga0395900_0000871_19253_19648 131
637 3300037418 Ga0395900_0001970 Ga0395900_0001970_22753_23148 131
638 3300037418 Ga0395900_0008763 Ga0395900_0008763_4178_4573 131
639 3300037418 Ga0395900_0013678 Ga0395900_0013678_7241_7636 131
640 3300037418 Ga0395900_0024341 Ga0395900_0024341_3800_4195 131
641 3300037418 Ga0395900_0324415 Ga0395900_0324415_703_1098 131
642 3300037418 Ga0395900_0364281 Ga0395900_0364281_747_1142 131
643 3300037418 Ga0395900_0391491 Ga0395900_0391491_405_800 131
644 3300037418 Ga0395900_0633137 Ga0395900_0633137_102_497 131
645 3300037466 Ga0395898_0003281 Ga0395898_0003281_15244_15639 131
646 3300037466 Ga0395898_0003578 Ga0395898_0003578_11858_12253 131
647 3300037466 Ga0395898_0011698 Ga0395898_0011698_7957_8352 131
648 3300037466 Ga0395898_0017911 Ga0395898_0017911_4333_4728 131
649 3300037466 Ga0395898_0069093 Ga0395898_0069093_1440_1835 131
650 3300037466 Ga0395898_0069994 Ga0395898_0069994_2322_2717 131
651 3300037466 Ga0395898_0077875 Ga0395898_0077875_1624_2019 131
652 3300037466 Ga0395898_0196377 Ga0395898_0196377_1285_1680 131
653 3300037466 Ga0395898_0482248 Ga0395898_0482248_396_791 131
654 3300037466 Ga0395898_0499507 Ga0395898_0499507_363_758 131
655 3300037466 Ga0395898_0590056 Ga0395898_0590056_174_614 131
656 3300037466 Ga0395898_0774995 Ga0395898_0774995_446_841 131
657 3300037471 Ga0395905_0001130 Ga0395905_0001130_9185_9580 131
658 3300037471 Ga0395905_0002425 Ga0395905_0002425_501_896 131
659 3300037471 Ga0395905_0006790 Ga0395905_0006790_102_497 131
660 3300037471 Ga0395905_0034713 Ga0395905_0034713_1523_1918 131
661 3300037471 Ga0395905_0085832 Ga0395905_0085832_939_1334 131
662 3300037471 Ga0395905_0178137 Ga0395905_0178137_17_412 131
663 3300038443 Ga0395901_0004009 Ga0395901_0004009_12770_13165 131
664 3300038443 Ga0395901_0005447 Ga0395901_0005447_11729_12124 131
665 3300038443 Ga0395901_0006956 Ga0395901_0006956_5566_5961 131
666 3300038443 Ga0395901_0007511 Ga0395901_0007511_3175_3570 131
667 3300038443 Ga0395901_0038828 Ga0395901_0038828_918_1313 131
668 3300038443 Ga0395901_0118265 Ga0395901_0118265_1869_2264 131
669 3300038443 Ga0395901_0127957 Ga0395901_0127957_253_648 131
670 3300038443 Ga0395901_0434513 Ga0395901_0434513_933_1328 131
671 3300038443 Ga0395901_0516672 Ga0395901_0516672_43_438 131
672 3300038443 Ga0395901_0706815 Ga0395901_0706815_214_609 131
673 3300038443 Ga0395901_1356169 Ga0395901_1356169_148_543 131
674 3300038443 Ga0395901_1934535 Ga0395901_1934535_72_467 131
675 3300038698 Ga0242419_009978 Ga0242419_009978_78_473 131
676 3300038699 Ga0242422_03412 Ga0242422_03412_491_886 131
677 3300039450 Ga0436363_0452021 Ga0436363_0452021_60_455 131
678 3300041492 Ga0451835_0186085 Ga0451835_0186085_14_409 131
679 3300041496 Ga0451839_1214626 Ga0451839_1214626_51_449 131
680 3300041512 Ga0451853_2305819 Ga0451853_2305819_371_766 131
681 3300044656 Ga0466969_0337257 Ga0466969_0337257_46_441 131
682 3300044673 Ga0453683_0557697 Ga0453683_0557697_295_690 131
683 3300044683 Ga0466965_0428286 Ga0466965_0428286_219_614 131
684 3300044684 Ga0466966_0131090 Ga0466966_0131090_335_730 131
685 3300044693 Ga0466961_0330984 Ga0466961_0330984_406_801 131
686 3300044694 Ga0466963_0009698 Ga0466963_0009698_1848_2243 131
687 3300044694 Ga0466963_0288214 Ga0466963_0288214_383_778 131
688 3300044735 Ga0466968_0600552 Ga0466968_0600552_133_531 131
689 3300045049 Ga0466959_0640218 Ga0466959_0640218_262_657 131
690 3300045976 Ga0466967_0046714 Ga0466967_0046714_1235_1630 131
691 3300045976 Ga0466967_0046844 Ga0466967_0046844_969_1364 131
692 3300045976 Ga0466967_0409917 Ga0466967_0409917_321_716 131
693 3300045976 Ga0466967_1112655 Ga0466967_1112655_380_775 131
694 3300045976 Ga0466967_2277628 Ga0466967_2277628_124_519 131
695 3300046454 Ga0495592_0291818 Ga0495592_0291818_76_471 131
696 3300046455 Ga0495603_0768697 Ga0495603_0768697_108_503 131
697 3300046459 Ga0495629_0011270 Ga0495629_0011270_4036_4434 131
698 3300046459 Ga0495629_0222495 Ga0495629_0222495_501_896 131
699 3300046461 Ga0495641_0019594 Ga0495641_0019594_2195_2590 131
700 3300046461 Ga0495641_0063366 Ga0495641_0063366_588_983 131
701 3300046461 Ga0495641_0120231 Ga0495641_0120231_127_525 131
702 3300046461 Ga0495641_0320446 Ga0495641_0320446_110_508 131
703 3300046462 Ga0495651_0170718 Ga0495651_0170718_437_835 131
704 3300046463 Ga0495653_0115903 Ga0495653_0115903_534_932 131
705 3300046463 Ga0495653_0181433 Ga0495653_0181433_418_813 131
706 3300046473 Ga0495582_0106181 Ga0495582_0106181_94_489 131
707 3300046473 Ga0495582_0151341 Ga0495582_0151341_137_535 131
708 3300046476 Ga0495662_0572808 Ga0495662_0572808_138_536 131
709 3300046491 Ga0495584_0123605 Ga0495584_0123605_315_710 131
710 3300046511 Ga0495608_0012356 Ga0495608_0012356_4780_5175 131
711 3300046517 Ga0495630_0297650 Ga0495630_0297650_469_867 131
712 3300046526 Ga0495666_0223944 Ga0495666_0223944_214_612 131
713 3300046531 Ga0495665_0360023 Ga0495665_0360023_294_689 131
714 3300046531 Ga0495665_0395869 Ga0495665_0395869_90_488 131
715 3300046536 Ga0495587_0115628 Ga0495587_0115628_443_841 131
716 3300046538 Ga0495609_0215392 Ga0495609_0215392_353_748 131
717 3300046543 Ga0495645_0489058 Ga0495645_0489058_30_428 131
718 3300046559 Ga0495667_0228023 Ga0495667_0228023_42_440 131
719 3300046616 Ga0495668_0843772 Ga0495668_0843772_21_416 131
720 3300046642 Ga0495634_0059917 Ga0495634_0059917_743_1141 131
721 3300046665 Ga0495661_0506470 Ga0495661_0506470_115_516 131
722 3300046675 Ga0495657_0141611 Ga0495657_0141611_70_465 131
723 3300046683 Ga0495658_0023753 Ga0495658_0023753_395_790 131
724 3300046683 Ga0495658_0656960 Ga0495658_0656960_69_464 131
725 3300046689 Ga0495613_0028490 Ga0495613_0028490_3471_3869 131
726 3300046689 Ga0495613_0142879 Ga0495613_0142879_965_1360 131
727 3300046690 Ga0495624_0596970 Ga0495624_0596970_48_443 131
728 3300046809 Ga0495600_0344849 Ga0495600_0344849_114_509 131
729 3300046809 Ga0495600_0957011 Ga0495600_0957011_57_452 131
730 3300047315 Ga0495581_0009359 Ga0495581_0009359_1187_1582 131
731 3300047315 Ga0495581_0213008 Ga0495581_0213008_379_774 131
732 3300047317 Ga0495604_0148497 Ga0495604_0148497_331_726 131
733 3300047321 Ga0495676_0026584 Ga0495676_0026584_3445_3843 131
734 3300047321 Ga0495676_0027069 Ga0495676_0027069_2818_3213 131
735 3300047322 Ga0495680_0004651 Ga0495680_0004651_604_999 131
736 3300047471 Ga0495684_0233497 Ga0495684_0233497_26_421 131
737 3300047471 Ga0495684_0834263 Ga0495684_0834263_165_563 131
738 3300047673 Ga0495593_0099580 Ga0495593_0099580_650_1048 131
739 3300048903 Ga0496100_0002141 Ga0496100_0002141_1347_1742 131
740 3300048903 Ga0496100_0048104 Ga0496100_0048104_344_739 131
741 3300048903 Ga0496100_0081240 Ga0496100_0081240_705_1100 131
742 3300048903 Ga0496100_0791936 Ga0496100_0791936_262_660 131
743 3300048904 Ga0496101_0074736 Ga0496101_0074736_1135_1530 131
744 3300048904 Ga0496101_0133624 Ga0496101_0133624_1104_1502 131
745 3300048904 Ga0496101_0158421 Ga0496101_0158421_1121_1516 131
746 3300048904 Ga0496101_0178505 Ga0496101_0178505_592_987 131
747 3300048904 Ga0496101_0326361 Ga0496101_0326361_380_775 131
748 3300048904 Ga0496101_0764501 Ga0496101_0764501_318_716 131
749 3300048905 Ga0496102_0023826 Ga0496102_0023826_3838_4233 131
750 3300048905 Ga0496102_0081453 Ga0496102_0081453_725_1120 131
751 3300048905 Ga0496102_0172819 Ga0496102_0172819_334_729 131
752 3300048905 Ga0496102_0225713 Ga0496102_0225713_81_479 131
753 3300048905 Ga0496102_0610899 Ga0496102_0610899_230_625 131
754 3300048905 Ga0496102_1549033 Ga0496102_1549033_155_553 131
755 3300048906 Ga0496103_0009328 Ga0496103_0009328_4289_4684 131
756 3300048906 Ga0496103_0081294 Ga0496103_0081294_1237_1632 131
757 3300048906 Ga0496103_0103250 Ga0496103_0103250_1005_1403 131
758 3300048906 Ga0496103_0147150 Ga0496103_0147150_940_1335 131
759 3300048907 Ga0496104_0004078 Ga0496104_0004078_10012_10407 131
760 3300048907 Ga0496104_0063550 Ga0496104_0063550_169_567 131
761 3300048907 Ga0496104_0477178 Ga0496104_0477178_246_644 131
762 3300048908 Ga0496105_0019907 Ga0496105_0019907_1893_2288 131
763 3300048908 Ga0496105_0021402 Ga0496105_0021402_1020_1418 131
764 3300048908 Ga0496105_0102434 Ga0496105_0102434_1733_2131 131
765 3300048909 Ga0496106_0001809 Ga0496106_0001809_5146_5541 131
766 3300048909 Ga0496106_0061267 Ga0496106_0061267_2236_2631 131
767 3300048909 Ga0496106_0212736 Ga0496106_0212736_497_892 131
768 3300048910 Ga0496107_0029831 Ga0496107_0029831_1890_2285 131
769 3300048910 Ga0496107_0053635 Ga0496107_0053635_2286_2681 131
770 3300048910 Ga0496107_0570107 Ga0496107_0570107_313_711 131
771 3300048911 Ga0496108_0006700 Ga0496108_0006700_5577_5975 131
772 3300048911 Ga0496108_0015055 Ga0496108_0015055_5672_6067 131
773 3300048911 Ga0496108_0098939 Ga0496108_0098939_1134_1529 131
774 3300048911 Ga0496108_0213516 Ga0496108_0213516_161_556 131
775 3300048911 Ga0496108_0602890 Ga0496108_0602890_432_830 131
776 3300048911 Ga0496108_0913356 Ga0496108_0913356_266_661 131
777 3300048912 Ga0496109_0000992 Ga0496109_0000992_2183_2581 131
778 3300048912 Ga0496109_0017313 Ga0496109_0017313_4021_4416 131
779 3300048912 Ga0496109_0236587 Ga0496109_0236587_519_917 131
780 3300048912 Ga0496109_0255488 Ga0496109_0255488_101_496 131
781 3300048912 Ga0496109_0834842 Ga0496109_0834842_107_505 131
782 3300048913 Ga0496110_0004437 Ga0496110_0004437_3149_3547 131
783 3300048913 Ga0496110_0030272 Ga0496110_0030272_3747_4142 131
784 3300048913 Ga0496110_0163250 Ga0496110_0163250_1301_1696 131
785 3300048913 Ga0496110_0601741 Ga0496110_0601741_230_625 131
786 3300048913 Ga0496110_0883451 Ga0496110_0883451_208_603 131
787 3300048914 Ga0496111_0000598 Ga0496111_0000598_11295_11693 131
788 3300048914 Ga0496111_0019783 Ga0496111_0019783_4069_4467 131
789 3300048914 Ga0496111_0058238 Ga0496111_0058238_1760_2155 131
790 3300048914 Ga0496111_0265303 Ga0496111_0265303_220_615 131
791 3300048915 Ga0496112_0001024 Ga0496112_0001024_19120_19515 131
792 3300048915 Ga0496112_0185421 Ga0496112_0185421_1538_1936 131
793 3300048915 Ga0496112_0488967 Ga0496112_0488967_240_635 131
794 3300048915 Ga0496112_0818207 Ga0496112_0818207_92_490 131
795 3300048916 Ga0496113_0207636 Ga0496113_0207636_76_474 131
796 3300048916 Ga0496113_0418151 Ga0496113_0418151_162_557 131
797 3300048917 Ga0496114_0019534 Ga0496114_0019534_2163_2558 131
798 3300048917 Ga0496114_0094560 Ga0496114_0094560_616_1014 131
799 3300048917 Ga0496114_0147736 Ga0496114_0147736_1045_1440 131
800 3300048917 Ga0496114_0429351 Ga0496114_0429351_50_445 131
801 3300048918 Ga0496115_0005415 Ga0496115_0005415_4867_5262 131
802 3300049568 Ga0501031_0002836 Ga0501031_0002836_8532_8927 131
803 3300049568 Ga0501031_0215861 Ga0501031_0215861_583_978 131
804 3300049569 Ga0501032_0023044 Ga0501032_0023044_3639_4034 131
805 3300049572 Ga0501036_0006773 Ga0501036_0006773_1159_1554 131
806 3300049572 Ga0501036_0073602 Ga0501036_0073602_1278_1673 131
807 3300049572 Ga0501036_0992622 Ga0501036_0992622_242_637 131
808 3300049572 Ga0501036_1314319 Ga0501036_1314319_25_420 131
809 3300049573 Ga0501037_0103140 Ga0501037_0103140_853_1248 131
810 3300049573 Ga0501037_0228977 Ga0501037_0228977_655_1050 131
811 3300049574 Ga0501038_0024691 Ga0501038_0024691_1002_1397 131
812 3300049574 Ga0501038_0129474 Ga0501038_0129474_1339_1734 131
813 3300049575 Ga0501039_0004746 Ga0501039_0004746_1087_1482 131
814 3300049575 Ga0501039_0181537 Ga0501039_0181537_50_445 131
815 3300049575 Ga0501039_0394550 Ga0501039_0394550_490_885 131
816 3300049576 Ga0501040_0004225 Ga0501040_0004225_2749_3144 131
817 3300049576 Ga0501040_0052394 Ga0501040_0052394_1525_1920 131
818 3300049577 Ga0501041_0004653 Ga0501041_0004653_3504_3899 131
819 3300049577 Ga0501041_0089853 Ga0501041_0089853_203_598 131
820 3300049578 Ga0501042_0008074 Ga0501042_0008074_6226_6621 131
821 3300049578 Ga0501042_0009416 Ga0501042_0009416_315_710 131
822 3300049578 Ga0501042_0090944 Ga0501042_0090944_220_615 131
823 3300049579 Ga0501043_0049092 Ga0501043_0049092_1301_1696 131
824 3300049580 Ga0501046_0001448 Ga0501046_0001448_7595_7990 131
825 3300049580 Ga0501046_0132061 Ga0501046_0132061_221_616 131
826 3300049580 Ga0501046_0328974 Ga0501046_0328974_637_1032 131
827 3300049580 Ga0501046_0708062 Ga0501046_0708062_81_476 131
828 3300049582 Ga0501048_0003992 Ga0501048_0003992_4943_5338 131
829 3300049582 Ga0501048_0119455 Ga0501048_0119455_1275_1670 131
830 3300049583 Ga0501067_0224914 Ga0501067_0224914_16_411 131
831 3300049584 Ga0501068_0600260 Ga0501068_0600260_261_656 131
832 3300049585 Ga0501069_0059219 Ga0501069_0059219_458_853 131
833 3300049585 Ga0501069_0075565 Ga0501069_0075565_684_1079 131
834 3300049585 Ga0501069_0257508 Ga0501069_0257508_85_480 131
835 3300049586 Ga0501070_0273348 Ga0501070_0273348_573_968 131
836 3300049586 Ga0501070_0315070 Ga0501070_0315070_701_1096 131
837 3300049586 Ga0501070_0697168 Ga0501070_0697168_75_470 131
838 3300049587 Ga0501071_0026636 Ga0501071_0026636_3617_4012 131
839 3300049587 Ga0501071_1115318 Ga0501071_1115318_136_531 131
840 3300049588 Ga0501072_0011874 Ga0501072_0011874_306_701 131
841 3300049588 Ga0501072_0026024 Ga0501072_0026024_2877_3272 131
842 3300049588 Ga0501072_0034638 Ga0501072_0034638_1606_2001 131
843 3300049589 Ga0501073_0006969 Ga0501073_0006969_809_1204 131
844 3300049589 Ga0501073_0020460 Ga0501073_0020460_4318_4713 131
845 3300049590 Ga0501074_0035342 Ga0501074_0035342_2179_2574 131
846 3300049590 Ga0501074_0063116 Ga0501074_0063116_1904_2299 131
847 3300049591 Ga0501075_0006432 Ga0501075_0006432_5736_6131 131
848 3300049591 Ga0501075_0027647 Ga0501075_0027647_1507_1902 131
849 3300049591 Ga0501075_0260221 Ga0501075_0260221_261_656 131
850 3300049591 Ga0501075_0787888 Ga0501075_0787888_25_420 131
851 3300049592 Ga0501076_0008714 Ga0501076_0008714_2262_2657 131
852 3300049592 Ga0501076_0124959 Ga0501076_0124959_1448_1843 131
853 3300049592 Ga0501076_0674294 Ga0501076_0674294_59_454 131
854 3300049593 Ga0501077_0010250 Ga0501077_0010250_4865_5260 131
855 3300049593 Ga0501077_0989404 Ga0501077_0989404_63_458 131
856 3300049741 Ga0501079_0010771 Ga0501079_0010771_4007_4402 131
857 3300049741 Ga0501079_1569962 Ga0501079_1569962_113_508 131
858 3300049742 Ga0501080_0007957 Ga0501080_0007957_4013_4408 131
859 3300049742 Ga0501080_0209697 Ga0501080_0209697_1131_1526 131
860 3300049743 Ga0501081_0011195 Ga0501081_0011195_3081_3476 131
861 3300049743 Ga0501081_0036002 Ga0501081_0036002_1299_1694 131
862 3300049743 Ga0501081_0047344 Ga0501081_0047344_1141_1536 131
863 3300049744 Ga0501083_0033307 Ga0501083_0033307_1129_1524 131
864 3300049822 Ga0501035_0008623 Ga0501035_0008623_6574_6969 131
865 3300049822 Ga0501035_0014191 Ga0501035_0014191_5079_5474 131
866 3300049822 Ga0501035_0458567 Ga0501035_0458567_141_536 131
867 3300049823 Ga0501044_0078509 Ga0501044_0078509_2518_2913 131
868 3300049823 Ga0501044_0162808 Ga0501044_0162808_804_1199 131
869 3300049824 Ga0501045_0005742 Ga0501045_0005742_2366_2761 131
870 3300049824 Ga0501045_0033361 Ga0501045_0033361_2078_2473 131
871 3300050492 nmdc:mga0yw44_996418_c1 nmdc:mga0yw44_996418_c1_19_417 131
872 3300050494 nmdc:mga06z11_187276_c1 nmdc:mga06z11_187276_c1_585_980 131
873 3300050507 nmdc:mga05p37_205574_c1 nmdc:mga05p37_205574_c1_1451_1846 131
874 3300050507 nmdc:mga05p37_59740_c1 nmdc:mga05p37_59740_c1_936_1331 131
875 3300050507 nmdc:mga05p37_718187_c1 nmdc:mga05p37_718187_c1_220_615 131
876 3300050510 nmdc:mga06r32_289020_c1 nmdc:mga06r32_289020_c1_1106_1501 131
877 3300050512 nmdc:mga0n895_11302_c1 nmdc:mga0n895_11302_c1_782_1177 131
878 3300050512 nmdc:mga0n895_1512414_c1 nmdc:mga0n895_1512414_c1_90_485 131
879 3300050512 nmdc:mga0n895_77600_c1 nmdc:mga0n895_77600_c1_2513_2908 131
880 3300050512 nmdc:mga0n895_91185_c1 nmdc:mga0n895_91185_c1_1059_1454 131
881 3300050513 nmdc:mga0rr50_101254_c1 nmdc:mga0rr50_101254_c1_305_700 131
882 3300050513 nmdc:mga0rr50_328964_c1 nmdc:mga0rr50_328964_c1_665_1060 131
883 3300050513 nmdc:mga0rr50_4672_c1 nmdc:mga0rr50_4672_c1_2513_2908 131
884 3300050514 nmdc:mga08x19_59131_c1 nmdc:mga08x19_59131_c1_1059_1454 131
885 3300050515 nmdc:mga0a205_22729_c1 nmdc:mga0a205_22729_c1_1758_2153 131
886 3300050515 nmdc:mga0a205_39954_c1 nmdc:mga0a205_39954_c1_2963_3358 131
887 3300050515 nmdc:mga0a205_758204_c1 nmdc:mga0a205_758204_c1_33_428 131
888 3300053077 Ga0495601_0101811 Ga0495601_0101811_334_732 131
889 3300053077 Ga0495601_0175373 Ga0495601_0175373_192_590 131
890 3300053078 Ga0495612_0055292 Ga0495612_0055292_829_1227 131
891 3300053084 Ga0495595_0023650 Ga0495595_0023650_1415_1813 131
892 3300053085 Ga0495619_0019321 Ga0495619_0019321_2499_2897 131
893 3300053085 Ga0495619_0063338 Ga0495619_0063338_1556_1954 131
894 3300053085 Ga0495619_0075685 Ga0495619_0075685_1759_2154 131
895 3300054114 Ga0501084_0013416 Ga0501084_0013416_5952_6347 131
896 3300054114 Ga0501084_0072442 Ga0501084_0072442_229_624 131
897 3300054114 Ga0501084_0219343 Ga0501084_0219343_871_1266 131
898 3300059493 Ga0587077_196937 Ga0587077_196937_141_539 131
899 3300061719 Ga0466962_0367385 Ga0466962_0367385_239_634 131
900 3300061734 Ga0530510_0018249 Ga0530510_0018249_3172_3567 131
901 3300061734 Ga0530510_0171003 Ga0530510_0171003_1156_1551 131
902 3300061734 Ga0530510_0605013 Ga0530510_0605013_380_775 131

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01597

GCV_H

Glycine cleavage H-protein

26

146

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
1htp-assembly1.cif.gz_A refined structures at 2 angstroms and 2.2 angstroms of the two forms of the h-protein, a lipoamide-containing protein of the glycine decarboxylase complex 0.9913 6 130
3wdn-assembly1.cif.gz_A high-resolution x-ray crystal structure of bovine h-protein using a high-pressure cryocooling method 0.98 11 130
1onl-assembly3.cif.gz_C crystal structure of thermus thermophilus hb8 h-protein of the glycine cleavage system 0.9712 6 130
3a7a-assembly1.cif.gz_B crystal structure of e. coli lipoate-protein ligase a in complex with octyl-amp and apoh-protein 0.9681 6 131
3a7a-assembly2.cif.gz_D crystal structure of e. coli lipoate-protein ligase a in complex with octyl-amp and apoh-protein 0.9621 6 131
ID Description Score Start End Superfamily
af_Q20634_6_139_2.40.50.100 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.9851 10 127 2.40.50.100
3wdnA00 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.9791 11 130 2.40.50.100
af_K7TZ76_31_128_2.40.50.100 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.9654 41 131 2.40.50.100
af_A4IC11_1_107_2.40.50.100 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.9599 25 128 2.40.50.100
3a8jE00 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.9512 8 129 2.40.50.100
ID Description Score Start End GO Terms
AF-A0A534S1C2-F1-model_v4 Glycine cleavage system H protein 0.9998 12 131 GO:0005829
GO:0005960
GO:0019464
AF-A0A538FZ14-F1-model_v4 Glycine cleavage system H protein 0.9967 1 131 GO:0005829
GO:0005960
GO:0019464
AF-A0A7W0RC94-F1-model_v4 Glycine cleavage system H protein 0.9964 3 128 GO:0005829
GO:0005960
GO:0019464
AF-A0A532DA06-F1-model_v4 Glycine cleavage system H protein 0.9955 6 131 GO:0005829
GO:0005960
GO:0019464
AF-A0A2K3NJQ1-F1-model_v4 Glycine cleavage system H protein 0.9952 9 130 GO:0005739
GO:0005960
GO:0019464

Feature Viewer

pLDDT pTM Quality
96.72 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map