F485218
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 902 | 333 | 902 | 131 |
Family's Representative Sequence
| Representative Sequence | 3300037466|Ga0395898_0590056|Ga0395898_0590056_174_614 |
| Length | 146 |
| Sequence | VRARSKNLSTDERSDDVAEESYPEDLKYHPEHDWARIEGDTATLGITWYGQDALGELVHYEPPDVGATLSKDGAYGEVESVKAVSDLIAPLSGEVLEVNQKVVDEPETVNADPYGDGWLVRIRVSDPGETDALMDAESYRSHLQTL |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 2 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 3 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 4 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 5 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 7 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 8 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 9 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 11 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 12 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 14 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 20 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 22 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 24 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 25 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 26 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 29 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 30 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 34 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 35 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 36 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 40 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 41 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 42 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 43 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 44 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 48 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 49 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 51 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 52 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 54 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 55 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 56 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 57 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 58 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 59 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 60 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 62 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 63 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 64 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 65 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 66 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 67 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 68 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 70 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 71 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 72 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 73 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 74 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 75 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 76 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 77 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 79 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 101 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 105 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 107 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 108 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 109 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 161 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 162 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 163 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 164 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 165 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 166 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 167 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 168 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 169 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 170 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 171 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 172 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 173 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 174 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 175 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 176 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 177 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 178 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 179 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 180 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 181 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 182 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 183 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 184 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 185 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 186 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 187 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 188 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 189 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 190 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 191 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 192 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 193 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 194 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 195 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 196 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 197 | 3300038698 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot15 | Metagenome | Rhizosphere |
| 198 | 3300038699 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot26 | Metagenome | Rhizosphere |
| 199 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 200 | 3300041492 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG | Metagenome | Unclassified |
| 201 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 202 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 203 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 204 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 205 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 206 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 207 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 208 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 209 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 210 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 211 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 212 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 261 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 262 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 263 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 264 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 265 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 266 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 267 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 268 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 269 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 270 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 271 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 272 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 273 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 274 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 275 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 276 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 277 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 278 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 279 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 280 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 281 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 282 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 283 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 284 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 285 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 286 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 287 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 288 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 289 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 290 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 291 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 292 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 293 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 294 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 295 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 296 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 297 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 298 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 299 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 300 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 301 | 3300049674 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought | Metagenome | Rhizosphere |
| 302 | 3300049675 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control | Metagenome | Rhizosphere |
| 303 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 304 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 305 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 306 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 307 | 3300049779 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought | Metagenome | Rhizosphere |
| 308 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 309 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 310 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 311 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 312 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 313 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 314 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 315 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 316 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 317 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 318 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 319 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 320 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 321 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 322 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 327 | 3300059491 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 328 | 3300059492 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 329 | 3300059493 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 330 | 3300059640 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 331 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 332 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 333 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.11 |
| Metatranscriptomes | 0.89 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 3.1 |
| Nodule | 0 |
| Rhizoplane | 12.08 |
| Rhizosphere | 84.37 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.44 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25406J46586_10036185 | 3300003203 | Bacteria | 1794 |
| 2 | JGI25406J46586_10170740 | 3300003203 | Unclassified | 634 |
| 3 | Ga0070658_10008240 | 3300005327 | Bacteria | 8383 |
| 4 | Ga0070658_10512798 | 3300005327 | Bacteria | 1036 |
| 5 | Ga0070683_100005095 | 3300005329 | Bacteria | 10922 |
| 6 | Ga0070683_100008967 | 3300005329 | Bacteria | 8527 |
| 7 | Ga0070683_100147264 | 3300005329 | Bacteria | 2232 |
| 8 | Ga0070683_100210639 | 3300005329 | Bacteria | 1846 |
| 9 | Ga0070683_102099234 | 3300005329 | Bacteria | 543 |
| 10 | Ga0070690_101253862 | 3300005330 | Bacteria | 593 |
| 11 | Ga0070666_10142825 | 3300005335 | Bacteria | 1668 |
| 12 | Ga0070680_100061784 | 3300005336 | Bacteria | 3067 |
| 13 | Ga0070680_100712558 | 3300005336 | Bacteria | 864 |
| 14 | Ga0070680_101043513 | 3300005336 | Bacteria | 706 |
| 15 | Ga0070680_101544923 | 3300005336 | Bacteria | 575 |
| 16 | Ga0070680_101658759 | 3300005336 | Unclassified | 554 |
| 17 | Ga0070682_100232060 | 3300005337 | Bacteria | 1320 |
| 18 | Ga0070682_100531497 | 3300005337 | Bacteria | 917 |
| 19 | Ga0068868_100775841 | 3300005338 | Bacteria | 863 |
| 20 | Ga0070660_100045171 | 3300005339 | Bacteria | 3371 |
| 21 | Ga0070660_100077437 | 3300005339 | Bacteria | 2605 |
| 22 | Ga0070660_100670785 | 3300005339 | Unclassified | 869 |
| 23 | Ga0070660_100680924 | 3300005339 | Unclassified | 862 |
| 24 | Ga0070660_100826626 | 3300005339 | Bacteria | 780 |
| 25 | Ga0070691_10771556 | 3300005341 | Bacteria | 583 |
| 26 | Ga0070687_100381079 | 3300005343 | Bacteria | 919 |
| 27 | Ga0070661_100206900 | 3300005344 | Bacteria | 1501 |
| 28 | Ga0070661_100583191 | 3300005344 | Bacteria | 902 |
| 29 | Ga0070661_101010636 | 3300005344 | Bacteria | 690 |
| 30 | Ga0070692_10632675 | 3300005345 | Bacteria | 712 |
| 31 | Ga0070668_100097191 | 3300005347 | Bacteria | 2329 |
| 32 | Ga0070668_100306058 | 3300005347 | Bacteria | 1334 |
| 33 | Ga0070668_100309106 | 3300005347 | Bacteria | 1328 |
| 34 | Ga0070669_100457680 | 3300005353 | Bacteria | 1053 |
| 35 | Ga0070671_100386286 | 3300005355 | Bacteria | 1197 |
| 36 | Ga0070671_100559681 | 3300005355 | Bacteria | 986 |
| 37 | Ga0070671_102038603 | 3300005355 | Bacteria | 511 |
| 38 | Ga0070674_100216807 | 3300005356 | Bacteria | 1487 |
| 39 | Ga0070674_100233845 | 3300005356 | Bacteria | 1436 |
| 40 | Ga0070673_100855926 | 3300005364 | Bacteria | 841 |
| 41 | Ga0070688_100173502 | 3300005365 | Bacteria | 1490 |
| 42 | Ga0070659_100056686 | 3300005366 | Bacteria | 3089 |
| 43 | Ga0070659_100280626 | 3300005366 | Bacteria | 1386 |
| 44 | Ga0070659_101009031 | 3300005366 | Bacteria | 731 |
| 45 | Ga0070709_10063824 | 3300005434 | Bacteria | 2353 |
| 46 | Ga0070714_100443034 | 3300005435 | Bacteria | 1233 |
| 47 | Ga0070714_101310714 | 3300005435 | Bacteria | 707 |
| 48 | Ga0070713_100202845 | 3300005436 | Bacteria | 1792 |
| 49 | Ga0070713_100452660 | 3300005436 | Bacteria | 1206 |
| 50 | Ga0070713_100466729 | 3300005436 | Bacteria | 1187 |
| 51 | Ga0070713_100839756 | 3300005436 | Viruses | 882 |
| 52 | Ga0070713_100947523 | 3300005436 | Unclassified | 829 |
| 53 | Ga0070713_101441098 | 3300005436 | Unclassified | 668 |
| 54 | Ga0070710_10009026 | 3300005437 | Bacteria | 4874 |
| 55 | Ga0070710_10099411 | 3300005437 | Bacteria | 1730 |
| 56 | Ga0070710_10309267 | 3300005437 | Bacteria | 1034 |
| 57 | Ga0070701_10085966 | 3300005438 | Unclassified | 1713 |
| 58 | Ga0070711_100038326 | 3300005439 | Bacteria | 3223 |
| 59 | Ga0070711_100168410 | 3300005439 | Bacteria | 1667 |
| 60 | Ga0070711_100202229 | 3300005439 | Bacteria | 1534 |
| 61 | Ga0070705_100123792 | 3300005440 | Bacteria | 1674 |
| 62 | Ga0070705_100553676 | 3300005440 | Bacteria | 882 |
| 63 | Ga0070705_101948893 | 3300005440 | Bacteria | 501 |
| 64 | Ga0070700_101125289 | 3300005441 | Bacteria | 652 |
| 65 | Ga0070694_100074768 | 3300005444 | Bacteria | 2342 |
| 66 | Ga0070694_100090238 | 3300005444 | Bacteria | 2149 |
| 67 | Ga0070708_100171666 | 3300005445 | Bacteria | 2025 |
| 68 | Ga0070708_100186023 | 3300005445 | Bacteria | 1942 |
| 69 | Ga0070708_100294220 | 3300005445 | Bacteria | 1529 |
| 70 | Ga0070708_100353176 | 3300005445 | Bacteria | 1386 |
| 71 | Ga0070708_100714660 | 3300005445 | Bacteria | 943 |
| 72 | Ga0070708_102195912 | 3300005445 | Bacteria | 510 |
| 73 | Ga0070663_100546089 | 3300005455 | Bacteria | 968 |
| 74 | Ga0070678_100228885 | 3300005456 | Bacteria | 1549 |
| 75 | Ga0070678_100930602 | 3300005456 | Bacteria | 796 |
| 76 | Ga0070681_10022081 | 3300005458 | Bacteria | 6386 |
| 77 | Ga0070681_10111187 | 3300005458 | Bacteria | 2679 |
| 78 | Ga0070685_10852669 | 3300005466 | Bacteria | 675 |
| 79 | Ga0070706_100229391 | 3300005467 | Bacteria | 1733 |
| 80 | Ga0070706_100233059 | 3300005467 | Bacteria | 1719 |
| 81 | Ga0070707_100629281 | 3300005468 | Unclassified | 1036 |
| 82 | Ga0070707_100772166 | 3300005468 | Bacteria | 925 |
| 83 | Ga0070707_101886825 | 3300005468 | Unclassified | 565 |
| 84 | Ga0070698_100032881 | 3300005471 | Bacteria | 5373 |
| 85 | Ga0070698_100386912 | 3300005471 | Bacteria | 1331 |
| 86 | Ga0070699_100322895 | 3300005518 | Bacteria | 1388 |
| 87 | Ga0070679_100007568 | 3300005530 | Bacteria | 10159 |
| 88 | Ga0070679_100013106 | 3300005530 | Bacteria | 7939 |
| 89 | Ga0070684_100000286 | 3300005535 | Bacteria | 35165 |
| 90 | Ga0070684_100010068 | 3300005535 | Bacteria | 7474 |
| 91 | Ga0070684_100020927 | 3300005535 | Bacteria | 5431 |
| 92 | Ga0070684_100488073 | 3300005535 | Unclassified | 1140 |
| 93 | Ga0070684_100758427 | 3300005535 | Bacteria | 906 |
| 94 | Ga0070697_100069763 | 3300005536 | Bacteria | 2879 |
| 95 | Ga0070697_100235797 | 3300005536 | Bacteria | 1562 |
| 96 | Ga0070697_101173066 | 3300005536 | Bacteria | 684 |
| 97 | Ga0070686_100171734 | 3300005544 | Bacteria | 1534 |
| 98 | Ga0070686_101384173 | 3300005544 | Bacteria | 590 |
| 99 | Ga0070695_100330904 | 3300005545 | Bacteria | 1135 |
| 100 | Ga0070695_100483213 | 3300005545 | Bacteria | 955 |
| 101 | Ga0070696_100075073 | 3300005546 | Bacteria | 2385 |
| 102 | Ga0070696_100534900 | 3300005546 | Bacteria | 937 |
| 103 | Ga0070693_100510772 | 3300005547 | Bacteria | 854 |
| 104 | Ga0070693_101312426 | 3300005547 | Bacteria | 560 |
| 105 | Ga0070665_100459721 | 3300005548 | Bacteria | 1283 |
| 106 | Ga0070704_100082166 | 3300005549 | Bacteria | 2375 |
| 107 | Ga0068855_100017076 | 3300005563 | Bacteria | 8730 |
| 108 | Ga0068855_100077276 | 3300005563 | Bacteria | 3862 |
| 109 | Ga0068855_100077741 | 3300005563 | Bacteria | 3850 |
| 110 | Ga0068855_102062937 | 3300005563 | Bacteria | 575 |
| 111 | Ga0070664_100137055 | 3300005564 | Bacteria | 2153 |
| 112 | Ga0070664_100223690 | 3300005564 | Bacteria | 1685 |
| 113 | Ga0068857_100096601 | 3300005577 | Bacteria | 2648 |
| 114 | Ga0068857_100130441 | 3300005577 | Bacteria | 2267 |
| 115 | Ga0068856_100054954 | 3300005614 | Bacteria | 3929 |
| 116 | Ga0068856_100688561 | 3300005614 | Bacteria | 1043 |
| 117 | Ga0068856_100817094 | 3300005614 | Bacteria | 952 |
| 118 | Ga0070702_100028067 | 3300005615 | Bacteria | 3046 |
| 119 | Ga0070702_100848141 | 3300005615 | Bacteria | 711 |
| 120 | Ga0068859_102150856 | 3300005617 | Bacteria | 616 |
| 121 | Ga0068861_100057930 | 3300005719 | Bacteria | 2961 |
| 122 | Ga0068870_10114627 | 3300005840 | Bacteria | 1544 |
| 123 | Ga0068870_10561980 | 3300005840 | Bacteria | 770 |
| 124 | Ga0068862_100743184 | 3300005844 | Bacteria | 954 |
| 125 | Ga0081455_10032931 | 3300005937 | Bacteria | 4663 |
| 126 | Ga0081455_10112401 | 3300005937 | Bacteria | 2162 |
| 127 | Ga0081455_10123075 | 3300005937 | Bacteria | 2041 |
| 128 | Ga0081455_10148585 | 3300005937 | Unclassified | 1809 |
| 129 | Ga0081455_10162975 | 3300005937 | Bacteria | 1707 |
| 130 | Ga0081455_10376675 | 3300005937 | Bacteria | 993 |
| 131 | Ga0081455_10852386 | 3300005937 | Bacteria | 569 |
| 132 | Ga0081538_10022318 | 3300005981 | Bacteria | 4589 |
| 133 | Ga0081539_10000041 | 3300005985 | Bacteria | 292660 |
| 134 | Ga0081539_10042610 | 3300005985 | Bacteria | 2641 |
| 135 | Ga0081539_10237100 | 3300005985 | Bacteria | 819 |
| 136 | Ga0081539_10284082 | 3300005985 | Bacteria | 719 |
| 137 | Ga0070717_10050974 | 3300006028 | Bacteria | 3404 |
| 138 | Ga0070717_10588683 | 3300006028 | Bacteria | 1009 |
| 139 | Ga0070717_12051928 | 3300006028 | Unclassified | 515 |
| 140 | Ga0075365_10003891 | 3300006038 | Bacteria | 7814 |
| 141 | Ga0075365_10015202 | 3300006038 | Bacteria | 4650 |
| 142 | Ga0075365_10153616 | 3300006038 | Bacteria | 1602 |
| 143 | Ga0075365_10171956 | 3300006038 | Bacteria | 1512 |
| 144 | Ga0075365_10415227 | 3300006038 | Bacteria | 950 |
| 145 | Ga0075363_100298189 | 3300006048 | Bacteria | 935 |
| 146 | Ga0075363_100839151 | 3300006048 | Bacteria | 560 |
| 147 | Ga0075364_10123730 | 3300006051 | Bacteria | 1732 |
| 148 | Ga0075364_10125182 | 3300006051 | Bacteria | 1723 |
| 149 | Ga0075364_10132352 | 3300006051 | Bacteria | 1674 |
| 150 | Ga0075364_10455044 | 3300006051 | Bacteria | 874 |
| 151 | Ga0075364_10497899 | 3300006051 | Bacteria | 833 |
| 152 | Ga0075432_10020848 | 3300006058 | Bacteria | 2242 |
| 153 | Ga0070716_100111073 | 3300006173 | Bacteria | 1699 |
| 154 | Ga0070716_100169461 | 3300006173 | Bacteria | 1424 |
| 155 | Ga0070716_100971576 | 3300006173 | Bacteria | 670 |
| 156 | Ga0070712_100015956 | 3300006175 | Bacteria | 4844 |
| 157 | Ga0070712_100062040 | 3300006175 | Bacteria | 2642 |
| 158 | Ga0070712_100593532 | 3300006175 | Bacteria | 937 |
| 159 | Ga0070712_100615216 | 3300006175 | Bacteria | 920 |
| 160 | Ga0070712_100952525 | 3300006175 | Unclassified | 741 |
| 161 | Ga0070712_100978973 | 3300006175 | Bacteria | 731 |
| 162 | Ga0075367_10133745 | 3300006178 | Bacteria | 1534 |
| 163 | Ga0075367_10216978 | 3300006178 | Bacteria | 1197 |
| 164 | Ga0075367_10999641 | 3300006178 | Bacteria | 534 |
| 165 | Ga0097621_100213116 | 3300006237 | Bacteria | 1681 |
| 166 | Ga0097621_100363984 | 3300006237 | Bacteria | 1289 |
| 167 | Ga0068871_101061968 | 3300006358 | Bacteria | 756 |
| 168 | Ga0068871_101750675 | 3300006358 | Bacteria | 590 |
| 169 | Ga0075428_100007984 | 3300006844 | Bacteria | 11740 |
| 170 | Ga0075428_100036324 | 3300006844 | Bacteria | 5428 |
| 171 | Ga0075428_100309683 | 3300006844 | Bacteria | 1697 |
| 172 | Ga0075428_100580490 | 3300006844 | Bacteria | 1198 |
| 173 | Ga0075428_100583764 | 3300006844 | Unclassified | 1194 |
| 174 | Ga0075428_102132311 | 3300006844 | Bacteria | 579 |
| 175 | Ga0075431_100038295 | 3300006847 | Bacteria | 4937 |
| 176 | Ga0075431_100235771 | 3300006847 | Bacteria | 1863 |
| 177 | Ga0075433_10468092 | 3300006852 | Bacteria | 1110 |
| 178 | Ga0075433_10756443 | 3300006852 | Bacteria | 850 |
| 179 | Ga0075433_10987625 | 3300006852 | Bacteria | 733 |
| 180 | Ga0075434_100028518 | 3300006871 | Bacteria | 5485 |
| 181 | Ga0075434_100047775 | 3300006871 | Bacteria | 4246 |
| 182 | Ga0075434_100049169 | 3300006871 | Bacteria | 4186 |
| 183 | Ga0075429_100314316 | 3300006880 | Bacteria | 1371 |
| 184 | Ga0075429_100437594 | 3300006880 | Bacteria | 1146 |
| 185 | Ga0068865_101109617 | 3300006881 | Bacteria | 697 |
| 186 | Ga0075436_100002183 | 3300006914 | Bacteria | 13493 |
| 187 | Ga0075436_100029390 | 3300006914 | Bacteria | 3779 |
| 188 | Ga0075436_100369654 | 3300006914 | Bacteria | 1036 |
| 189 | Ga0097620_102150825 | 3300006931 | Bacteria | 616 |
| 190 | Ga0075435_100012599 | 3300007076 | Bacteria | 6264 |
| 191 | Ga0075435_100055348 | 3300007076 | Bacteria | 3204 |
| 192 | Ga0075435_100083256 | 3300007076 | Bacteria | 2630 |
| 193 | Ga0075435_100087463 | 3300007076 | Bacteria | 2568 |
| 194 | Ga0075435_100379651 | 3300007076 | Bacteria | 1214 |
| 195 | Ga0105240_10027311 | 3300009093 | Bacteria | 7474 |
| 196 | Ga0105240_10492909 | 3300009093 | Bacteria | 1364 |
| 197 | Ga0111539_10011337 | 3300009094 | Bacteria | 11196 |
| 198 | Ga0111539_10040887 | 3300009094 | Bacteria | 5579 |
| 199 | Ga0111539_10966657 | 3300009094 | Unclassified | 990 |
| 200 | Ga0111539_11978653 | 3300009094 | Bacteria | 676 |
| 201 | Ga0105245_10122828 | 3300009098 | Bacteria | 2427 |
| 202 | Ga0105245_10137493 | 3300009098 | Bacteria | 2298 |
| 203 | Ga0105245_10211852 | 3300009098 | Bacteria | 1865 |
| 204 | Ga0105245_10251480 | 3300009098 | Bacteria | 1717 |
| 205 | Ga0105245_10259335 | 3300009098 | Bacteria | 1691 |
| 206 | Ga0105245_10348748 | 3300009098 | Bacteria | 1466 |
| 207 | Ga0105245_11862597 | 3300009098 | Bacteria | 655 |
| 208 | Ga0114129_10000727 | 3300009147 | Bacteria | 41768 |
| 209 | Ga0114129_10012477 | 3300009147 | Bacteria | 12097 |
| 210 | Ga0114129_10024257 | 3300009147 | Bacteria | 8593 |
| 211 | Ga0114129_10170675 | 3300009147 | Bacteria | 2966 |
| 212 | Ga0114129_10327639 | 3300009147 | Bacteria | 2034 |
| 213 | Ga0114129_10919239 | 3300009147 | Bacteria | 1107 |
| 214 | Ga0114129_11431861 | 3300009147 | Bacteria | 852 |
| 215 | Ga0114129_13133112 | 3300009147 | Unclassified | 540 |
| 216 | Ga0105243_10054496 | 3300009148 | Bacteria | 3175 |
| 217 | Ga0105243_10109909 | 3300009148 | Bacteria | 2304 |
| 218 | Ga0105243_10374651 | 3300009148 | Bacteria | 1314 |
| 219 | Ga0105243_12750862 | 3300009148 | Bacteria | 532 |
| 220 | Ga0105241_10829209 | 3300009174 | Bacteria | 854 |
| 221 | Ga0105242_10083979 | 3300009176 | Bacteria | 2667 |
| 222 | Ga0105242_10134171 | 3300009176 | Bacteria | 2141 |
| 223 | Ga0105242_10329695 | 3300009176 | Bacteria | 1403 |
| 224 | Ga0105242_10934870 | 3300009176 | Bacteria | 870 |
| 225 | Ga0105242_11306124 | 3300009176 | Bacteria | 749 |
| 226 | Ga0105242_11383508 | 3300009176 | Bacteria | 730 |
| 227 | Ga0105248_10160218 | 3300009177 | Bacteria | 2538 |
| 228 | Ga0105248_11006895 | 3300009177 | Bacteria | 941 |
| 229 | Ga0105237_10974551 | 3300009545 | Bacteria | 855 |
| 230 | Ga0105238_10996094 | 3300009551 | Bacteria | 859 |
| 231 | Ga0105249_10624440 | 3300009553 | Bacteria | 1134 |
| 232 | Ga0105239_10221657 | 3300010375 | Bacteria | 2121 |
| 233 | Ga0105239_10362957 | 3300010375 | Bacteria | 1636 |
| 234 | Ga0105239_13244118 | 3300010375 | Bacteria | 530 |
| 235 | Ga0105246_10969760 | 3300011119 | Unclassified | 767 |
| 236 | Ga0157370_10093330 | 3300013104 | Bacteria | 2824 |
| 237 | Ga0157370_10372328 | 3300013104 | Bacteria | 1316 |
| 238 | Ga0157370_10611214 | 3300013104 | Bacteria | 998 |
| 239 | Ga0157370_11539966 | 3300013104 | Bacteria | 598 |
| 240 | Ga0157369_10006794 | 3300013105 | Bacteria | 13198 |
| 241 | Ga0157369_10732870 | 3300013105 | Bacteria | 1017 |
| 242 | Ga0157369_11690269 | 3300013105 | Bacteria | 643 |
| 243 | Ga0157374_10128262 | 3300013296 | Bacteria | 2453 |
| 244 | Ga0157374_11043122 | 3300013296 | Bacteria | 837 |
| 245 | Ga0157374_11300703 | 3300013296 | Bacteria | 749 |
| 246 | Ga0157378_10101928 | 3300013297 | Bacteria | 2622 |
| 247 | Ga0157378_10275550 | 3300013297 | Bacteria | 1620 |
| 248 | Ga0157378_12248028 | 3300013297 | Bacteria | 597 |
| 249 | Ga0163162_10093384 | 3300013306 | Bacteria | 3093 |
| 250 | Ga0157372_10287435 | 3300013307 | Bacteria | 1912 |
| 251 | Ga0157372_10830094 | 3300013307 | Bacteria | 1073 |
| 252 | Ga0157372_11319231 | 3300013307 | Bacteria | 833 |
| 253 | Ga0157372_12120176 | 3300013307 | Bacteria | 646 |
| 254 | Ga0157372_13018400 | 3300013307 | Bacteria | 538 |
| 255 | Ga0157375_10297023 | 3300013308 | Bacteria | 1779 |
| 256 | Ga0157375_10790965 | 3300013308 | Bacteria | 1098 |
| 257 | Ga0157375_11036210 | 3300013308 | Bacteria | 959 |
| 258 | Ga0157375_11204406 | 3300013308 | Bacteria | 888 |
| 259 | Ga0163163_10164086 | 3300014325 | Bacteria | 2267 |
| 260 | Ga0163163_12034623 | 3300014325 | Bacteria | 634 |
| 261 | Ga0182008_10250564 | 3300014497 | Bacteria | 913 |
| 262 | Ga0182008_10845273 | 3300014497 | Bacteria | 535 |
| 263 | Ga0157377_10030329 | 3300014745 | Bacteria | 2928 |
| 264 | Ga0157377_10313810 | 3300014745 | Unclassified | 1039 |
| 265 | Ga0157379_10256715 | 3300014968 | Bacteria | 1588 |
| 266 | Ga0157376_10094137 | 3300014969 | Bacteria | 2602 |
| 267 | Ga0157376_10254312 | 3300014969 | Bacteria | 1642 |
| 268 | Ga0157376_10464925 | 3300014969 | Bacteria | 1237 |
| 269 | Ga0157376_10704573 | 3300014969 | Bacteria | 1015 |
| 270 | Ga0157376_11751010 | 3300014969 | Bacteria | 657 |
| 271 | Ga0182007_10280670 | 3300015262 | Bacteria | 606 |
| 272 | Ga0163161_10342206 | 3300017792 | Bacteria | 1187 |
| 273 | Ga0197907_10799915 | 3300020069 | Bacteria | 1483 |
| 274 | Ga0206353_10259235 | 3300020082 | Bacteria | 769 |
| 275 | Ga0206353_11073166 | 3300020082 | Bacteria | 4497 |
| 276 | Ga0224712_10422282 | 3300022467 | Bacteria | 638 |
| 277 | Ga0207692_10063853 | 3300025898 | Bacteria | 1915 |
| 278 | Ga0207692_10125979 | 3300025898 | Bacteria | 1441 |
| 279 | Ga0207642_10329929 | 3300025899 | Bacteria | 894 |
| 280 | Ga0207688_10091228 | 3300025901 | Bacteria | 1750 |
| 281 | Ga0207688_10490131 | 3300025901 | Bacteria | 769 |
| 282 | Ga0207647_10234741 | 3300025904 | Bacteria | 1055 |
| 283 | Ga0207685_10451309 | 3300025905 | Bacteria | 668 |
| 284 | Ga0207705_10019314 | 3300025909 | Bacteria | 4873 |
| 285 | Ga0207705_10045782 | 3300025909 | Bacteria | 3144 |
| 286 | Ga0207684_10441074 | 3300025910 | Bacteria | 1118 |
| 287 | Ga0207654_10455777 | 3300025911 | Bacteria | 897 |
| 288 | Ga0207707_10030088 | 3300025912 | Bacteria | 4747 |
| 289 | Ga0207707_10031620 | 3300025912 | Bacteria | 4632 |
| 290 | Ga0207695_10138907 | 3300025913 | Bacteria | 2381 |
| 291 | Ga0207695_10365656 | 3300025913 | Bacteria | 1329 |
| 292 | Ga0207693_10006225 | 3300025915 | Bacteria | 9898 |
| 293 | Ga0207693_10023433 | 3300025915 | Bacteria | 4902 |
| 294 | Ga0207693_10252700 | 3300025915 | Bacteria | 1383 |
| 295 | Ga0207663_10059220 | 3300025916 | Bacteria | 2422 |
| 296 | Ga0207663_10285045 | 3300025916 | Bacteria | 1228 |
| 297 | Ga0207663_10689903 | 3300025916 | Bacteria | 808 |
| 298 | Ga0207660_10140212 | 3300025917 | Bacteria | 1848 |
| 299 | Ga0207660_11160961 | 3300025917 | Unclassified | 629 |
| 300 | Ga0207662_10352534 | 3300025918 | Bacteria | 989 |
| 301 | Ga0207657_10002271 | 3300025919 | Bacteria | 20838 |
| 302 | Ga0207657_10342322 | 3300025919 | Unclassified | 1180 |
| 303 | Ga0207657_10731425 | 3300025919 | Bacteria | 767 |
| 304 | Ga0207649_11234295 | 3300025920 | Bacteria | 591 |
| 305 | Ga0207652_10006892 | 3300025921 | Bacteria | 9156 |
| 306 | Ga0207652_10020012 | 3300025921 | Bacteria | 5510 |
| 307 | Ga0207646_10489785 | 3300025922 | Bacteria | 1108 |
| 308 | Ga0207646_10718454 | 3300025922 | Bacteria | 893 |
| 309 | Ga0207681_10001013 | 3300025923 | Bacteria | 18329 |
| 310 | Ga0207681_11778714 | 3300025923 | Bacteria | 514 |
| 311 | Ga0207650_11333318 | 3300025925 | Bacteria | 611 |
| 312 | Ga0207659_10359004 | 3300025926 | Bacteria | 1211 |
| 313 | Ga0207687_10049998 | 3300025927 | Bacteria | 2909 |
| 314 | Ga0207687_10100296 | 3300025927 | Bacteria | 2129 |
| 315 | Ga0207687_10681934 | 3300025927 | Bacteria | 871 |
| 316 | Ga0207687_10682290 | 3300025927 | Bacteria | 871 |
| 317 | Ga0207687_10864587 | 3300025927 | Unclassified | 773 |
| 318 | Ga0207687_11003703 | 3300025927 | Bacteria | 716 |
| 319 | Ga0207687_11205023 | 3300025927 | Bacteria | 651 |
| 320 | Ga0207700_10296300 | 3300025928 | Bacteria | 1395 |
| 321 | Ga0207700_10608149 | 3300025928 | Bacteria | 973 |
| 322 | Ga0207700_10666842 | 3300025928 | Unclassified | 928 |
| 323 | Ga0207700_10781608 | 3300025928 | Bacteria | 854 |
| 324 | Ga0207700_11069270 | 3300025928 | Bacteria | 722 |
| 325 | Ga0207664_10339744 | 3300025929 | Bacteria | 1327 |
| 326 | Ga0207664_10565140 | 3300025929 | Bacteria | 1021 |
| 327 | Ga0207644_10199581 | 3300025931 | Bacteria | 1577 |
| 328 | Ga0207644_10326211 | 3300025931 | Bacteria | 1242 |
| 329 | Ga0207644_10860961 | 3300025931 | Bacteria | 759 |
| 330 | Ga0207690_10653091 | 3300025932 | Bacteria | 862 |
| 331 | Ga0207690_11077391 | 3300025932 | Bacteria | 670 |
| 332 | Ga0207706_10219535 | 3300025933 | Bacteria | 1665 |
| 333 | Ga0207686_10312281 | 3300025934 | Bacteria | 1171 |
| 334 | Ga0207686_10364590 | 3300025934 | Bacteria | 1091 |
| 335 | Ga0207686_10504363 | 3300025934 | Bacteria | 939 |
| 336 | Ga0207686_10588042 | 3300025934 | Bacteria | 874 |
| 337 | Ga0207709_10091967 | 3300025935 | Bacteria | 1985 |
| 338 | Ga0207709_10110243 | 3300025935 | Bacteria | 1839 |
| 339 | Ga0207709_10958849 | 3300025935 | Bacteria | 698 |
| 340 | Ga0207709_11631939 | 3300025935 | Bacteria | 536 |
| 341 | Ga0207669_11933980 | 3300025937 | Bacteria | 504 |
| 342 | Ga0207704_10440476 | 3300025938 | Bacteria | 1038 |
| 343 | Ga0207665_10007335 | 3300025939 | Bacteria | 7294 |
| 344 | Ga0207665_10154222 | 3300025939 | Bacteria | 1647 |
| 345 | Ga0207711_10753361 | 3300025941 | Bacteria | 908 |
| 346 | Ga0207689_11041366 | 3300025942 | Bacteria | 690 |
| 347 | Ga0207661_10003778 | 3300025944 | Bacteria | 10556 |
| 348 | Ga0207661_10019199 | 3300025944 | Bacteria | 5092 |
| 349 | Ga0207661_10094389 | 3300025944 | Bacteria | 2499 |
| 350 | Ga0207661_10229811 | 3300025944 | Bacteria | 1642 |
| 351 | Ga0207661_10632168 | 3300025944 | Bacteria | 983 |
| 352 | Ga0207679_10042141 | 3300025945 | Bacteria | 3279 |
| 353 | Ga0207679_10130440 | 3300025945 | Bacteria | 2016 |
| 354 | Ga0207667_10062476 | 3300025949 | Bacteria | 3894 |
| 355 | Ga0207667_10151667 | 3300025949 | Bacteria | 2385 |
| 356 | Ga0207667_10438227 | 3300025949 | Bacteria | 1328 |
| 357 | Ga0207712_10129121 | 3300025961 | Bacteria | 1923 |
| 358 | Ga0207668_10061896 | 3300025972 | Bacteria | 2634 |
| 359 | Ga0207668_10106338 | 3300025972 | Bacteria | 2096 |
| 360 | Ga0207668_10152887 | 3300025972 | Bacteria | 1789 |
| 361 | Ga0207668_11239844 | 3300025972 | Bacteria | 671 |
| 362 | Ga0207677_10627762 | 3300026023 | Bacteria | 946 |
| 363 | Ga0207678_10342509 | 3300026067 | Bacteria | 1288 |
| 364 | Ga0207678_10826813 | 3300026067 | Bacteria | 818 |
| 365 | Ga0207708_11121002 | 3300026075 | Bacteria | 686 |
| 366 | Ga0207702_10026096 | 3300026078 | Bacteria | 4851 |
| 367 | Ga0207702_10055906 | 3300026078 | Bacteria | 3349 |
| 368 | Ga0207702_11244373 | 3300026078 | Bacteria | 738 |
| 369 | Ga0207648_10039412 | 3300026089 | Bacteria | 4155 |
| 370 | Ga0207676_10838310 | 3300026095 | Bacteria | 899 |
| 371 | Ga0207674_10103020 | 3300026116 | Bacteria | 2834 |
| 372 | Ga0207674_10108055 | 3300026116 | Bacteria | 2759 |
| 373 | Ga0207675_100088997 | 3300026118 | Bacteria | 2900 |
| 374 | Ga0207675_101388605 | 3300026118 | Bacteria | 723 |
| 375 | Ga0207683_11329260 | 3300026121 | Bacteria | 665 |
| 376 | Ga0207683_11684754 | 3300026121 | Bacteria | 583 |
| 377 | Ga0268266_10252098 | 3300028379 | Bacteria | 1633 |
| 378 | Ga0268265_10998321 | 3300028380 | Bacteria | 827 |
| 379 | Ga0268264_10596134 | 3300028381 | Bacteria | 1088 |
| 380 | Ga0265319_1025488 | 3300028563 | Bacteria | 2116 |
| 381 | Ga0265318_10052499 | 3300028577 | Bacteria | 1530 |
| 382 | Ga0265318_10078356 | 3300028577 | Bacteria | 1221 |
| 383 | Ga0265318_10087716 | 3300028577 | Bacteria | 1146 |
| 384 | Ga0265322_10054404 | 3300028654 | Unclassified | 1135 |
| 385 | Ga0265338_10007064 | 3300028800 | Bacteria | 14079 |
| 386 | Ga0265338_10382411 | 3300028800 | Unclassified | 1006 |
| 387 | Ga0265338_10506487 | 3300028800 | Bacteria | 849 |
| 388 | Ga0265320_10070894 | 3300031240 | Bacteria | 1642 |
| 389 | Ga0265327_10017969 | 3300031251 | Bacteria | 4405 |
| 390 | Ga0265327_10088501 | 3300031251 | Bacteria | 1514 |
| 391 | Ga0307405_10128514 | 3300031731 | Bacteria | 1747 |
| 392 | Ga0307413_10453533 | 3300031824 | Bacteria | 1018 |
| 393 | Ga0307410_10346642 | 3300031852 | Bacteria | 1185 |
| 394 | Ga0307410_11576523 | 3300031852 | Bacteria | 580 |
| 395 | Ga0307406_10218345 | 3300031901 | Bacteria | 1415 |
| 396 | Ga0307407_11274296 | 3300031903 | Bacteria | 576 |
| 397 | Ga0307412_10295070 | 3300031911 | Bacteria | 1279 |
| 398 | Ga0307409_100413067 | 3300031995 | Bacteria | 1292 |
| 399 | Ga0307409_101331804 | 3300031995 | Bacteria | 743 |
| 400 | Ga0307416_100051442 | 3300032002 | Bacteria | 3291 |
| 401 | Ga0307416_100260956 | 3300032002 | Bacteria | 1693 |
| 402 | Ga0307416_101081339 | 3300032002 | Bacteria | 906 |
| 403 | Ga0307416_101655456 | 3300032002 | Unclassified | 745 |
| 404 | Ga0307414_10493413 | 3300032004 | Bacteria | 1082 |
| 405 | Ga0307415_100038491 | 3300032126 | Bacteria | 3152 |
| 406 | Ga0307415_100305203 | 3300032126 | Bacteria | 1320 |
| 407 | Ga0307415_100650673 | 3300032126 | Bacteria | 945 |
| 408 | Ga0307415_101497355 | 3300032126 | Bacteria | 645 |
| 409 | Ga0373926_0059401 | 3300035083 | Unclassified | 1392 |
| 410 | Ga0373944_0010616 | 3300035089 | Bacteria | 2512 |
| 411 | Ga0373941_0417103 | 3300035115 | Bacteria | 558 |
| 412 | Ga0373945_0012208 | 3300035116 | Bacteria | 2849 |
| 413 | Ga0373956_0159685 | 3300035119 | Bacteria | 1062 |
| 414 | Ga0373943_0000112 | 3300035170 | Bacteria | 30215 |
| 415 | Ga0373943_0069862 | 3300035170 | Bacteria | 1776 |
| 416 | Ga0373943_0409292 | 3300035170 | Bacteria | 784 |
| 417 | Ga0373946_0008171 | 3300035171 | Bacteria | 3840 |
| 418 | Ga0373955_0134969 | 3300035172 | Bacteria | 1443 |
| 419 | Ga0373931_0512209 | 3300035691 | Bacteria | 775 |
| 420 | Ga0373935_0091508 | 3300035692 | Bacteria | 1992 |
| 421 | Ga0373927_0021849 | 3300035695 | Bacteria | 4194 |
| 422 | Ga0373933_0413786 | 3300035724 | Bacteria | 880 |
| 423 | Ga0373947_0000600 | 3300035725 | Bacteria | 21231 |
| 424 | Ga0373947_0205433 | 3300035725 | Bacteria | 1290 |
| 425 | Ga0373937_0709846 | 3300036401 | Bacteria | 952 |
| 426 | Ga0373937_0940959 | 3300036401 | Bacteria | 813 |
| 427 | Ga0316584_0500003 | 3300036712 | Bacteria | 854 |
| 428 | Ga0373925_0009167 | 3300037068 | Bacteria | 7203 |
| 429 | Ga0395899_0001446 | 3300037312 | Bacteria | 20244 |
| 430 | Ga0395899_0013404 | 3300037312 | Bacteria | 6272 |
| 431 | Ga0395899_0019546 | 3300037312 | Bacteria | 5144 |
| 432 | Ga0395899_0020632 | 3300037312 | Bacteria | 4995 |
| 433 | Ga0395899_0029130 | 3300037312 | Bacteria | 4152 |
| 434 | Ga0395899_0062762 | 3300037312 | Bacteria | 2735 |
| 435 | Ga0395899_0084198 | 3300037312 | Bacteria | 2311 |
| 436 | Ga0395899_0156099 | 3300037312 | Bacteria | 1615 |
| 437 | Ga0395899_0246384 | 3300037312 | Bacteria | 1228 |
| 438 | Ga0395899_0272482 | 3300037312 | Bacteria | 1154 |
| 439 | Ga0395900_0000871 | 3300037418 | Bacteria | 39650 |
| 440 | Ga0395900_0001970 | 3300037418 | Bacteria | 23182 |
| 441 | Ga0395900_0008763 | 3300037418 | Bacteria | 10393 |
| 442 | Ga0395900_0013678 | 3300037418 | Bacteria | 8285 |
| 443 | Ga0395900_0024341 | 3300037418 | Bacteria | 6200 |
| 444 | Ga0395900_0041807 | 3300037418 | Bacteria | 4724 |
| 445 | Ga0395900_0043734 | 3300037418 | Bacteria | 4617 |
| 446 | Ga0395900_0188662 | 3300037418 | Bacteria | 2092 |
| 447 | Ga0395900_0203195 | 3300037418 | Bacteria | 2004 |
| 448 | Ga0395900_0227314 | 3300037418 | Bacteria | 1878 |
| 449 | Ga0395900_0324415 | 3300037418 | Bacteria | 1519 |
| 450 | Ga0395900_0364281 | 3300037418 | Bacteria | 1416 |
| 451 | Ga0395900_0391491 | 3300037418 | Bacteria | 1356 |
| 452 | Ga0395900_0633137 | 3300037418 | Bacteria | 1007 |
| 453 | Ga0395898_0003281 | 3300037466 | Bacteria | 18190 |
| 454 | Ga0395898_0003578 | 3300037466 | Bacteria | 17318 |
| 455 | Ga0395898_0011698 | 3300037466 | Bacteria | 9099 |
| 456 | Ga0395898_0017911 | 3300037466 | Bacteria | 7227 |
| 457 | Ga0395898_0039798 | 3300037466 | Bacteria | 4651 |
| 458 | Ga0395898_0058640 | 3300037466 | Bacteria | 3747 |
| 459 | Ga0395898_0069093 | 3300037466 | Bacteria | 3418 |
| 460 | Ga0395898_0069994 | 3300037466 | Bacteria | 3393 |
| 461 | Ga0395898_0077875 | 3300037466 | Bacteria | 3200 |
| 462 | Ga0395898_0102181 | 3300037466 | Bacteria | 2752 |
| 463 | Ga0395898_0163183 | 3300037466 | Bacteria | 2131 |
| 464 | Ga0395898_0196377 | 3300037466 | Bacteria | 1927 |
| 465 | Ga0395898_0482248 | 3300037466 | Bacteria | 1180 |
| 466 | Ga0395898_0499507 | 3300037466 | Bacteria | 1157 |
| 467 | Ga0395898_0590056 | 3300037466 | Bacteria | 1054 |
| 468 | Ga0395898_0603532 | 3300037466 | Bacteria | 1040 |
| 469 | Ga0395898_0634691 | 3300037466 | Bacteria | 1011 |
| 470 | Ga0395898_0774995 | 3300037466 | Bacteria | 900 |
| 471 | Ga0395905_0001130 | 3300037471 | Bacteria | 33392 |
| 472 | Ga0395905_0002425 | 3300037471 | Bacteria | 20684 |
| 473 | Ga0395905_0006790 | 3300037471 | Bacteria | 11468 |
| 474 | Ga0395905_0034713 | 3300037471 | Bacteria | 4737 |
| 475 | Ga0395905_0085832 | 3300037471 | Bacteria | 2949 |
| 476 | Ga0395905_0178137 | 3300037471 | Bacteria | 1995 |
| 477 | Ga0395905_0345195 | 3300037471 | Bacteria | 1380 |
| 478 | Ga0395905_0612284 | 3300037471 | Bacteria | 991 |
| 479 | Ga0395905_1288090 | 3300037471 | Bacteria | 634 |
| 480 | Ga0395905_1795841 | 3300037471 | Bacteria | 519 |
| 481 | Ga0395901_0004009 | 3300038443 | Bacteria | 14831 |
| 482 | Ga0395901_0005447 | 3300038443 | Bacteria | 12885 |
| 483 | Ga0395901_0006956 | 3300038443 | Bacteria | 11428 |
| 484 | Ga0395901_0007511 | 3300038443 | Bacteria | 11008 |
| 485 | Ga0395901_0016021 | 3300038443 | Bacteria | 7637 |
| 486 | Ga0395901_0038828 | 3300038443 | Bacteria | 4924 |
| 487 | Ga0395901_0061730 | 3300038443 | Bacteria | 3900 |
| 488 | Ga0395901_0062370 | 3300038443 | Bacteria | 3879 |
| 489 | Ga0395901_0093813 | 3300038443 | Bacteria | 3143 |
| 490 | Ga0395901_0118265 | 3300038443 | Bacteria | 2784 |
| 491 | Ga0395901_0127957 | 3300038443 | Bacteria | 2669 |
| 492 | Ga0395901_0144701 | 3300038443 | Bacteria | 2499 |
| 493 | Ga0395901_0239619 | 3300038443 | Bacteria | 1892 |
| 494 | Ga0395901_0267913 | 3300038443 | Bacteria | 1777 |
| 495 | Ga0395901_0383850 | 3300038443 | Bacteria | 1445 |
| 496 | Ga0395901_0434513 | 3300038443 | Bacteria | 1344 |
| 497 | Ga0395901_0516672 | 3300038443 | Bacteria | 1214 |
| 498 | Ga0395901_0706815 | 3300038443 | Bacteria | 1005 |
| 499 | Ga0395901_1356169 | 3300038443 | Unclassified | 671 |
| 500 | Ga0395901_1934535 | 3300038443 | Bacteria | 537 |
| 501 | Ga0242419_009978 | 3300038698 | Bacteria | 723 |
| 502 | Ga0242422_03412 | 3300038699 | Bacteria | 1040 |
| 503 | Ga0436363_0452021 | 3300039450 | Bacteria | 770 |
| 504 | Ga0451835_0186085 | 3300041492 | Unclassified | 1001 |
| 505 | Ga0451839_1214626 | 3300041496 | Unclassified | 677 |
| 506 | Ga0451853_2305819 | 3300041512 | Bacteria | 1007 |
| 507 | Ga0466969_0337257 | 3300044656 | Bacteria | 682 |
| 508 | Ga0453683_0557697 | 3300044673 | Bacteria | 746 |
| 509 | Ga0466965_0428286 | 3300044683 | Bacteria | 734 |
| 510 | Ga0466966_0131090 | 3300044684 | Bacteria | 1535 |
| 511 | Ga0466966_0723016 | 3300044684 | Bacteria | 600 |
| 512 | Ga0466961_0330984 | 3300044693 | Bacteria | 928 |
| 513 | Ga0466963_0006377 | 3300044694 | Bacteria | 6980 |
| 514 | Ga0466963_0009698 | 3300044694 | Bacteria | 5808 |
| 515 | Ga0466963_0288214 | 3300044694 | Bacteria | 1154 |
| 516 | Ga0466963_0331079 | 3300044694 | Bacteria | 1072 |
| 517 | Ga0466968_0600552 | 3300044735 | Unclassified | 556 |
| 518 | Ga0466959_0640218 | 3300045049 | Bacteria | 714 |
| 519 | Ga0466967_0035947 | 3300045976 | Bacteria | 4223 |
| 520 | Ga0466967_0046714 | 3300045976 | Bacteria | 3771 |
| 521 | Ga0466967_0046844 | 3300045976 | Bacteria | 3767 |
| 522 | Ga0466967_0062330 | 3300045976 | Bacteria | 3310 |
| 523 | Ga0466967_0249412 | 3300045976 | Bacteria | 1695 |
| 524 | Ga0466967_0409917 | 3300045976 | Bacteria | 1320 |
| 525 | Ga0466967_1112655 | 3300045976 | Bacteria | 787 |
| 526 | Ga0466967_2277628 | 3300045976 | Unclassified | 537 |
| 527 | Ga0495592_0165482 | 3300046454 | Bacteria | 1518 |
| 528 | Ga0495592_0291818 | 3300046454 | Bacteria | 1063 |
| 529 | Ga0495603_0254211 | 3300046455 | Bacteria | 1012 |
| 530 | Ga0495603_0768697 | 3300046455 | Bacteria | 550 |
| 531 | Ga0495629_0000593 | 3300046459 | Bacteria | 29449 |
| 532 | Ga0495629_0011270 | 3300046459 | Bacteria | 6495 |
| 533 | Ga0495629_0222495 | 3300046459 | Bacteria | 1302 |
| 534 | Ga0495641_0000529 | 3300046461 | Bacteria | 32060 |
| 535 | Ga0495641_0019594 | 3300046461 | Bacteria | 3455 |
| 536 | Ga0495641_0063366 | 3300046461 | Bacteria | 1666 |
| 537 | Ga0495641_0120231 | 3300046461 | Bacteria | 1172 |
| 538 | Ga0495641_0320446 | 3300046461 | Bacteria | 699 |
| 539 | Ga0495651_0082191 | 3300046462 | Bacteria | 2430 |
| 540 | Ga0495651_0170718 | 3300046462 | Bacteria | 1549 |
| 541 | Ga0495653_0006289 | 3300046463 | Bacteria | 9743 |
| 542 | Ga0495653_0115903 | 3300046463 | Bacteria | 1917 |
| 543 | Ga0495653_0178742 | 3300046463 | Unclassified | 1458 |
| 544 | Ga0495653_0181433 | 3300046463 | Bacteria | 1444 |
| 545 | Ga0495582_0000056 | 3300046473 | Bacteria | 57084 |
| 546 | Ga0495582_0106181 | 3300046473 | Bacteria | 1575 |
| 547 | Ga0495582_0151341 | 3300046473 | Bacteria | 1317 |
| 548 | Ga0495605_0068460 | 3300046474 | Bacteria | 1682 |
| 549 | Ga0495639_0003603 | 3300046475 | Bacteria | 6681 |
| 550 | Ga0495662_0015110 | 3300046476 | Bacteria | 3750 |
| 551 | Ga0495662_0058719 | 3300046476 | Bacteria | 1858 |
| 552 | Ga0495662_0572808 | 3300046476 | Bacteria | 553 |
| 553 | Ga0495664_0111202 | 3300046477 | Bacteria | 1653 |
| 554 | Ga0495584_0123605 | 3300046491 | Bacteria | 1311 |
| 555 | Ga0495584_0303429 | 3300046491 | Bacteria | 811 |
| 556 | Ga0495608_0012356 | 3300046511 | Bacteria | 5929 |
| 557 | Ga0495608_0263552 | 3300046511 | Bacteria | 1072 |
| 558 | Ga0495618_0218025 | 3300046514 | Bacteria | 1204 |
| 559 | Ga0495628_0580398 | 3300046516 | Bacteria | 802 |
| 560 | Ga0495630_0005694 | 3300046517 | Bacteria | 8809 |
| 561 | Ga0495630_0297650 | 3300046517 | Bacteria | 1233 |
| 562 | Ga0495663_0100296 | 3300046525 | Bacteria | 953 |
| 563 | Ga0495666_0041659 | 3300046526 | Bacteria | 2223 |
| 564 | Ga0495666_0223944 | 3300046526 | Bacteria | 861 |
| 565 | Ga0495652_0215186 | 3300046529 | Bacteria | 1447 |
| 566 | Ga0495665_0000910 | 3300046531 | Bacteria | 15584 |
| 567 | Ga0495665_0360023 | 3300046531 | Bacteria | 740 |
| 568 | Ga0495665_0395869 | 3300046531 | Bacteria | 701 |
| 569 | Ga0495640_0017849 | 3300046533 | Bacteria | 5278 |
| 570 | Ga0495640_0074570 | 3300046533 | Bacteria | 2268 |
| 571 | Ga0495587_0115628 | 3300046536 | Bacteria | 1539 |
| 572 | Ga0495609_0215392 | 3300046538 | Bacteria | 799 |
| 573 | Ga0495645_0390316 | 3300046543 | Unclassified | 889 |
| 574 | Ga0495645_0489058 | 3300046543 | Bacteria | 771 |
| 575 | Ga0495667_0047005 | 3300046559 | Bacteria | 2852 |
| 576 | Ga0495667_0228023 | 3300046559 | Bacteria | 1188 |
| 577 | Ga0495656_0020716 | 3300046615 | Bacteria | 2553 |
| 578 | Ga0495656_0069782 | 3300046615 | Bacteria | 1558 |
| 579 | Ga0495668_0843772 | 3300046616 | Bacteria | 508 |
| 580 | Ga0495634_0026999 | 3300046642 | Bacteria | 4000 |
| 581 | Ga0495634_0059917 | 3300046642 | Bacteria | 2534 |
| 582 | Ga0495634_0129034 | 3300046642 | Bacteria | 1613 |
| 583 | Ga0495634_0293268 | 3300046642 | Bacteria | 985 |
| 584 | Ga0495635_0062901 | 3300046663 | Bacteria | 2548 |
| 585 | Ga0495635_0068001 | 3300046663 | Bacteria | 2443 |
| 586 | Ga0495661_0506470 | 3300046665 | Bacteria | 575 |
| 587 | Ga0495657_0141611 | 3300046675 | Bacteria | 1498 |
| 588 | Ga0495657_0419244 | 3300046675 | Bacteria | 786 |
| 589 | Ga0495599_0472628 | 3300046678 | Unclassified | 740 |
| 590 | Ga0495646_0176412 | 3300046680 | Bacteria | 1175 |
| 591 | Ga0495647_0036946 | 3300046681 | Bacteria | 1841 |
| 592 | Ga0495647_0039362 | 3300046681 | Bacteria | 1792 |
| 593 | Ga0495658_0000204 | 3300046683 | Bacteria | 34365 |
| 594 | Ga0495658_0023753 | 3300046683 | Bacteria | 3258 |
| 595 | Ga0495658_0656960 | 3300046683 | Bacteria | 672 |
| 596 | Ga0495613_0000401 | 3300046689 | Bacteria | 37127 |
| 597 | Ga0495613_0028490 | 3300046689 | Bacteria | 4154 |
| 598 | Ga0495613_0142879 | 3300046689 | Bacteria | 1709 |
| 599 | Ga0495624_0006658 | 3300046690 | Bacteria | 8170 |
| 600 | Ga0495624_0596970 | 3300046690 | Bacteria | 658 |
| 601 | Ga0495589_0297348 | 3300046794 | Bacteria | 749 |
| 602 | Ga0495600_0030104 | 3300046809 | Bacteria | 3515 |
| 603 | Ga0495600_0344849 | 3300046809 | Bacteria | 934 |
| 604 | Ga0495600_0957011 | 3300046809 | Bacteria | 503 |
| 605 | Ga0495581_0000517 | 3300047315 | Bacteria | 19788 |
| 606 | Ga0495581_0009359 | 3300047315 | Bacteria | 5669 |
| 607 | Ga0495581_0213008 | 3300047315 | Bacteria | 1130 |
| 608 | Ga0495604_0074351 | 3300047317 | Bacteria | 2561 |
| 609 | Ga0495604_0148497 | 3300047317 | Bacteria | 1668 |
| 610 | Ga0495674_0029603 | 3300047319 | Bacteria | 4985 |
| 611 | Ga0495674_1054872 | 3300047319 | Unclassified | 620 |
| 612 | Ga0495676_0010912 | 3300047321 | Bacteria | 8212 |
| 613 | Ga0495676_0026584 | 3300047321 | Bacteria | 4980 |
| 614 | Ga0495676_0027069 | 3300047321 | Bacteria | 4924 |
| 615 | Ga0495680_0004651 | 3300047322 | Bacteria | 13073 |
| 616 | Ga0495680_0008870 | 3300047322 | Bacteria | 9095 |
| 617 | Ga0495680_0019712 | 3300047322 | Bacteria | 5690 |
| 618 | Ga0495680_0317005 | 3300047322 | Bacteria | 1092 |
| 619 | Ga0495675_0260164 | 3300047444 | Bacteria | 1040 |
| 620 | Ga0495684_0020222 | 3300047471 | Bacteria | 5128 |
| 621 | Ga0495684_0233497 | 3300047471 | Unclassified | 1344 |
| 622 | Ga0495684_0834263 | 3300047471 | Bacteria | 599 |
| 623 | Ga0495593_0001987 | 3300047673 | Bacteria | 12195 |
| 624 | Ga0495593_0099580 | 3300047673 | Bacteria | 1492 |
| 625 | Ga0495614_0026119 | 3300048089 | Bacteria | 2517 |
| 626 | Ga0496100_0002141 | 3300048903 | Bacteria | 9943 |
| 627 | Ga0496100_0044261 | 3300048903 | Bacteria | 2850 |
| 628 | Ga0496100_0048104 | 3300048903 | Bacteria | 2752 |
| 629 | Ga0496100_0068131 | 3300048903 | Bacteria | 2366 |
| 630 | Ga0496100_0081240 | 3300048903 | Bacteria | 2189 |
| 631 | Ga0496100_0791936 | 3300048903 | Bacteria | 742 |
| 632 | Ga0496101_0018182 | 3300048904 | Bacteria | 4776 |
| 633 | Ga0496101_0029430 | 3300048904 | Bacteria | 3841 |
| 634 | Ga0496101_0074736 | 3300048904 | Bacteria | 2493 |
| 635 | Ga0496101_0121800 | 3300048904 | Bacteria | 1972 |
| 636 | Ga0496101_0133624 | 3300048904 | Bacteria | 1886 |
| 637 | Ga0496101_0154321 | 3300048904 | Bacteria | 1758 |
| 638 | Ga0496101_0158421 | 3300048904 | Bacteria | 1735 |
| 639 | Ga0496101_0178505 | 3300048904 | Bacteria | 1634 |
| 640 | Ga0496101_0326361 | 3300048904 | Bacteria | 1204 |
| 641 | Ga0496101_0764501 | 3300048904 | Bacteria | 762 |
| 642 | Ga0496102_0015240 | 3300048905 | Bacteria | 6693 |
| 643 | Ga0496102_0023826 | 3300048905 | Bacteria | 5439 |
| 644 | Ga0496102_0081453 | 3300048905 | Bacteria | 2984 |
| 645 | Ga0496102_0172819 | 3300048905 | Bacteria | 2034 |
| 646 | Ga0496102_0225713 | 3300048905 | Bacteria | 1766 |
| 647 | Ga0496102_0337572 | 3300048905 | Bacteria | 1419 |
| 648 | Ga0496102_0610899 | 3300048905 | Bacteria | 1013 |
| 649 | Ga0496102_0646653 | 3300048905 | Bacteria | 981 |
| 650 | Ga0496102_1549033 | 3300048905 | Bacteria | 581 |
| 651 | Ga0496103_0009328 | 3300048906 | Bacteria | 5813 |
| 652 | Ga0496103_0081294 | 3300048906 | Bacteria | 2038 |
| 653 | Ga0496103_0103250 | 3300048906 | Bacteria | 1806 |
| 654 | Ga0496103_0143006 | 3300048906 | Bacteria | 1530 |
| 655 | Ga0496103_0147150 | 3300048906 | Bacteria | 1508 |
| 656 | Ga0496104_0000571 | 3300048907 | Bacteria | 31432 |
| 657 | Ga0496104_0004078 | 3300048907 | Bacteria | 12675 |
| 658 | Ga0496104_0013102 | 3300048907 | Bacteria | 7472 |
| 659 | Ga0496104_0063550 | 3300048907 | Bacteria | 3501 |
| 660 | Ga0496104_0477178 | 3300048907 | Bacteria | 1158 |
| 661 | Ga0496105_0019907 | 3300048908 | Bacteria | 5415 |
| 662 | Ga0496105_0021402 | 3300048908 | Bacteria | 5233 |
| 663 | Ga0496105_0102434 | 3300048908 | Bacteria | 2364 |
| 664 | Ga0496105_0240795 | 3300048908 | Bacteria | 1468 |
| 665 | Ga0496105_0340463 | 3300048908 | Bacteria | 1199 |
| 666 | Ga0496105_0582406 | 3300048908 | Bacteria | 870 |
| 667 | Ga0496105_0660240 | 3300048908 | Bacteria | 806 |
| 668 | Ga0496106_0001809 | 3300048909 | Bacteria | 15988 |
| 669 | Ga0496106_0061267 | 3300048909 | Bacteria | 2854 |
| 670 | Ga0496106_0212736 | 3300048909 | Bacteria | 1540 |
| 671 | Ga0496106_0249434 | 3300048909 | Bacteria | 1419 |
| 672 | Ga0496106_0268126 | 3300048909 | Bacteria | 1367 |
| 673 | Ga0496107_0029831 | 3300048910 | Bacteria | 3884 |
| 674 | Ga0496107_0053635 | 3300048910 | Bacteria | 2908 |
| 675 | Ga0496107_0180795 | 3300048910 | Bacteria | 1566 |
| 676 | Ga0496107_0198279 | 3300048910 | Bacteria | 1492 |
| 677 | Ga0496107_0491331 | 3300048910 | Bacteria | 910 |
| 678 | Ga0496107_0570107 | 3300048910 | Bacteria | 838 |
| 679 | Ga0496108_0006700 | 3300048911 | Bacteria | 9326 |
| 680 | Ga0496108_0015055 | 3300048911 | Bacteria | 6315 |
| 681 | Ga0496108_0037194 | 3300048911 | Bacteria | 4053 |
| 682 | Ga0496108_0098939 | 3300048911 | Bacteria | 2486 |
| 683 | Ga0496108_0213516 | 3300048911 | Bacteria | 1675 |
| 684 | Ga0496108_0286532 | 3300048911 | Bacteria | 1434 |
| 685 | Ga0496108_0602890 | 3300048911 | Bacteria | 957 |
| 686 | Ga0496108_0913356 | 3300048911 | Unclassified | 753 |
| 687 | Ga0496109_0000638 | 3300048912 | Bacteria | 29181 |
| 688 | Ga0496109_0000992 | 3300048912 | Bacteria | 23409 |
| 689 | Ga0496109_0017313 | 3300048912 | Bacteria | 6314 |
| 690 | Ga0496109_0236587 | 3300048912 | Bacteria | 1718 |
| 691 | Ga0496109_0255488 | 3300048912 | Bacteria | 1650 |
| 692 | Ga0496109_0292057 | 3300048912 | Bacteria | 1537 |
| 693 | Ga0496109_0834842 | 3300048912 | Bacteria | 859 |
| 694 | Ga0496109_0882527 | 3300048912 | Bacteria | 832 |
| 695 | Ga0496109_1794561 | 3300048912 | Bacteria | 547 |
| 696 | Ga0496110_0001697 | 3300048913 | Bacteria | 16194 |
| 697 | Ga0496110_0004437 | 3300048913 | Bacteria | 10877 |
| 698 | Ga0496110_0030272 | 3300048913 | Bacteria | 4665 |
| 699 | Ga0496110_0163250 | 3300048913 | Bacteria | 2019 |
| 700 | Ga0496110_0280503 | 3300048913 | Bacteria | 1517 |
| 701 | Ga0496110_0601741 | 3300048913 | Bacteria | 997 |
| 702 | Ga0496110_0635728 | 3300048913 | Bacteria | 966 |
| 703 | Ga0496110_0883451 | 3300048913 | Bacteria | 799 |
| 704 | Ga0496111_0000025 | 3300048914 | Bacteria | 62100 |
| 705 | Ga0496111_0000598 | 3300048914 | Bacteria | 19022 |
| 706 | Ga0496111_0019783 | 3300048914 | Bacteria | 4682 |
| 707 | Ga0496111_0027978 | 3300048914 | Bacteria | 3993 |
| 708 | Ga0496111_0058238 | 3300048914 | Bacteria | 2797 |
| 709 | Ga0496111_0194638 | 3300048914 | Bacteria | 1507 |
| 710 | Ga0496111_0265303 | 3300048914 | Bacteria | 1274 |
| 711 | Ga0496111_0347061 | 3300048914 | Bacteria | 1099 |
| 712 | Ga0496112_0001024 | 3300048915 | Bacteria | 20548 |
| 713 | Ga0496112_0185421 | 3300048915 | Bacteria | 2044 |
| 714 | Ga0496112_0253100 | 3300048915 | Bacteria | 1712 |
| 715 | Ga0496112_0488967 | 3300048915 | Bacteria | 1167 |
| 716 | Ga0496112_0530166 | 3300048915 | Unclassified | 1112 |
| 717 | Ga0496112_0717772 | 3300048915 | Bacteria | 927 |
| 718 | Ga0496112_0818207 | 3300048915 | Bacteria | 856 |
| 719 | Ga0496113_0207636 | 3300048916 | Bacteria | 1558 |
| 720 | Ga0496113_0418151 | 3300048916 | Bacteria | 1077 |
| 721 | Ga0496114_0001903 | 3300048917 | Bacteria | 15881 |
| 722 | Ga0496114_0019534 | 3300048917 | Bacteria | 5490 |
| 723 | Ga0496114_0039807 | 3300048917 | Bacteria | 3890 |
| 724 | Ga0496114_0045742 | 3300048917 | Bacteria | 3637 |
| 725 | Ga0496114_0093503 | 3300048917 | Bacteria | 2556 |
| 726 | Ga0496114_0094560 | 3300048917 | Bacteria | 2542 |
| 727 | Ga0496114_0116801 | 3300048917 | Bacteria | 2291 |
| 728 | Ga0496114_0147736 | 3300048917 | Bacteria | 2038 |
| 729 | Ga0496114_0429351 | 3300048917 | Bacteria | 1170 |
| 730 | Ga0496114_0555414 | 3300048917 | Bacteria | 1014 |
| 731 | Ga0496115_0005415 | 3300048918 | Bacteria | 9283 |
| 732 | Ga0496115_0035750 | 3300048918 | Bacteria | 3932 |
| 733 | Ga0496115_0298254 | 3300048918 | Bacteria | 1321 |
| 734 | Ga0496115_0546724 | 3300048918 | Bacteria | 926 |
| 735 | Ga0501031_0002836 | 3300049568 | Bacteria | 11064 |
| 736 | Ga0501031_0215861 | 3300049568 | Bacteria | 1249 |
| 737 | Ga0501032_0023044 | 3300049569 | Bacteria | 4310 |
| 738 | Ga0501032_0590662 | 3300049569 | Bacteria | 707 |
| 739 | Ga0501034_0064118 | 3300049571 | Bacteria | 3688 |
| 740 | Ga0501036_0006773 | 3300049572 | Bacteria | 9303 |
| 741 | Ga0501036_0073602 | 3300049572 | Bacteria | 2888 |
| 742 | Ga0501036_0301277 | 3300049572 | Bacteria | 1341 |
| 743 | Ga0501036_0764951 | 3300049572 | Bacteria | 796 |
| 744 | Ga0501036_0992622 | 3300049572 | Bacteria | 687 |
| 745 | Ga0501036_1314319 | 3300049572 | Bacteria | 587 |
| 746 | Ga0501037_0103140 | 3300049573 | Bacteria | 2057 |
| 747 | Ga0501037_0228977 | 3300049573 | Unclassified | 1305 |
| 748 | Ga0501038_0024691 | 3300049574 | Bacteria | 5359 |
| 749 | Ga0501038_0129474 | 3300049574 | Bacteria | 2074 |
| 750 | Ga0501038_0401156 | 3300049574 | Bacteria | 1061 |
| 751 | Ga0501039_0004746 | 3300049575 | Bacteria | 10292 |
| 752 | Ga0501039_0181537 | 3300049575 | Bacteria | 1655 |
| 753 | Ga0501039_0394550 | 3300049575 | Bacteria | 1087 |
| 754 | Ga0501040_0004225 | 3300049576 | Bacteria | 9349 |
| 755 | Ga0501040_0052394 | 3300049576 | Bacteria | 2793 |
| 756 | Ga0501041_0004653 | 3300049577 | Bacteria | 7961 |
| 757 | Ga0501041_0089853 | 3300049577 | Bacteria | 1896 |
| 758 | Ga0501042_0008074 | 3300049578 | Bacteria | 6926 |
| 759 | Ga0501042_0009416 | 3300049578 | Bacteria | 6508 |
| 760 | Ga0501042_0090944 | 3300049578 | Bacteria | 2190 |
| 761 | Ga0501042_0184233 | 3300049578 | Bacteria | 1506 |
| 762 | Ga0501042_0573871 | 3300049578 | Unclassified | 820 |
| 763 | Ga0501043_0049092 | 3300049579 | Bacteria | 3317 |
| 764 | Ga0501043_0784959 | 3300049579 | Bacteria | 690 |
| 765 | Ga0501046_0001448 | 3300049580 | Bacteria | 22833 |
| 766 | Ga0501046_0132061 | 3300049580 | Bacteria | 1893 |
| 767 | Ga0501046_0328974 | 3300049580 | Bacteria | 1112 |
| 768 | Ga0501046_0708062 | 3300049580 | Bacteria | 709 |
| 769 | Ga0501047_0230687 | 3300049581 | Bacteria | 1705 |
| 770 | Ga0501047_0502347 | 3300049581 | Bacteria | 1039 |
| 771 | Ga0501047_0646821 | 3300049581 | Bacteria | 877 |
| 772 | Ga0501047_0742354 | 3300049581 | Bacteria | 798 |
| 773 | Ga0501048_0003992 | 3300049582 | Bacteria | 11203 |
| 774 | Ga0501048_0119455 | 3300049582 | Bacteria | 1862 |
| 775 | Ga0501048_0236980 | 3300049582 | Bacteria | 1295 |
| 776 | Ga0501067_0086276 | 3300049583 | Bacteria | 1742 |
| 777 | Ga0501067_0223945 | 3300049583 | Bacteria | 1047 |
| 778 | Ga0501067_0224914 | 3300049583 | Bacteria | 1045 |
| 779 | Ga0501067_0231389 | 3300049583 | Bacteria | 1029 |
| 780 | Ga0501068_0377105 | 3300049584 | Bacteria | 913 |
| 781 | Ga0501068_0600260 | 3300049584 | Bacteria | 717 |
| 782 | Ga0501069_0059219 | 3300049585 | Bacteria | 2137 |
| 783 | Ga0501069_0075565 | 3300049585 | Bacteria | 1892 |
| 784 | Ga0501069_0128744 | 3300049585 | Bacteria | 1449 |
| 785 | Ga0501069_0149679 | 3300049585 | Bacteria | 1341 |
| 786 | Ga0501069_0257508 | 3300049585 | Bacteria | 1018 |
| 787 | Ga0501069_0638757 | 3300049585 | Bacteria | 640 |
| 788 | Ga0501070_0003866 | 3300049586 | Bacteria | 12917 |
| 789 | Ga0501070_0128150 | 3300049586 | Bacteria | 2097 |
| 790 | Ga0501070_0273348 | 3300049586 | Unclassified | 1379 |
| 791 | Ga0501070_0315070 | 3300049586 | Bacteria | 1273 |
| 792 | Ga0501070_0517461 | 3300049586 | Bacteria | 957 |
| 793 | Ga0501070_0697168 | 3300049586 | Bacteria | 803 |
| 794 | Ga0501071_0026636 | 3300049587 | Bacteria | 4059 |
| 795 | Ga0501071_1021160 | 3300049587 | Bacteria | 639 |
| 796 | Ga0501071_1115318 | 3300049587 | Bacteria | 609 |
| 797 | Ga0501072_0011874 | 3300049588 | Bacteria | 6653 |
| 798 | Ga0501072_0026024 | 3300049588 | Bacteria | 4559 |
| 799 | Ga0501072_0034638 | 3300049588 | Bacteria | 3957 |
| 800 | Ga0501073_0006969 | 3300049589 | Bacteria | 8417 |
| 801 | Ga0501073_0020460 | 3300049589 | Bacteria | 4772 |
| 802 | Ga0501074_0018234 | 3300049590 | Bacteria | 5099 |
| 803 | Ga0501074_0035342 | 3300049590 | Bacteria | 3620 |
| 804 | Ga0501074_0063116 | 3300049590 | Bacteria | 2668 |
| 805 | Ga0501075_0006432 | 3300049591 | Bacteria | 8087 |
| 806 | Ga0501075_0027647 | 3300049591 | Bacteria | 4181 |
| 807 | Ga0501075_0260221 | 3300049591 | Bacteria | 1322 |
| 808 | Ga0501075_0787888 | 3300049591 | Bacteria | 723 |
| 809 | Ga0501076_0008714 | 3300049592 | Bacteria | 7448 |
| 810 | Ga0501076_0124959 | 3300049592 | Bacteria | 2084 |
| 811 | Ga0501076_0674294 | 3300049592 | Bacteria | 853 |
| 812 | Ga0501077_0010250 | 3300049593 | Bacteria | 5833 |
| 813 | Ga0501077_0989404 | 3300049593 | Bacteria | 541 |
| 814 | Ga0501242_029051 | 3300049674 | Bacteria | 741 |
| 815 | Ga0501243_066454 | 3300049675 | Bacteria | 678 |
| 816 | Ga0501079_0010771 | 3300049741 | Bacteria | 6961 |
| 817 | Ga0501079_0109663 | 3300049741 | Bacteria | 2144 |
| 818 | Ga0501079_0145539 | 3300049741 | Bacteria | 1846 |
| 819 | Ga0501079_1569962 | 3300049741 | Unclassified | 518 |
| 820 | Ga0501080_0007957 | 3300049742 | Bacteria | 9606 |
| 821 | Ga0501080_0070880 | 3300049742 | Bacteria | 3241 |
| 822 | Ga0501080_0209697 | 3300049742 | Bacteria | 1786 |
| 823 | Ga0501081_0011195 | 3300049743 | Bacteria | 5865 |
| 824 | Ga0501081_0035504 | 3300049743 | Bacteria | 3394 |
| 825 | Ga0501081_0036002 | 3300049743 | Bacteria | 3372 |
| 826 | Ga0501081_0047344 | 3300049743 | Bacteria | 2959 |
| 827 | Ga0501083_0033307 | 3300049744 | Bacteria | 3529 |
| 828 | Ga0501283_098101 | 3300049779 | Bacteria | 568 |
| 829 | Ga0501035_0008623 | 3300049822 | Bacteria | 9486 |
| 830 | Ga0501035_0014191 | 3300049822 | Bacteria | 7352 |
| 831 | Ga0501035_0458567 | 3300049822 | Bacteria | 1054 |
| 832 | Ga0501035_0734223 | 3300049822 | Bacteria | 794 |
| 833 | Ga0501044_0078509 | 3300049823 | Bacteria | 3345 |
| 834 | Ga0501044_0162808 | 3300049823 | Bacteria | 2206 |
| 835 | Ga0501044_0808063 | 3300049823 | Bacteria | 817 |
| 836 | Ga0501045_0005742 | 3300049824 | Bacteria | 8593 |
| 837 | Ga0501045_0033361 | 3300049824 | Bacteria | 3732 |
| 838 | Ga0501045_0047826 | 3300049824 | Bacteria | 3116 |
| 839 | nmdc:mga03n38_844024_c1 | 3300050490 | Bacteria | 535 |
| 840 | nmdc:mga00v17_127916_c1 | 3300050491 | Bacteria | 1622 |
| 841 | nmdc:mga00v17_144754_c1 | 3300050491 | Bacteria | 1525 |
| 842 | nmdc:mga00v17_259255_c1 | 3300050491 | Bacteria | 1128 |
| 843 | nmdc:mga00v17_632437_c1 | 3300050491 | Bacteria | 689 |
| 844 | nmdc:mga0yw44_273301_c1 | 3300050492 | Bacteria | 1128 |
| 845 | nmdc:mga0yw44_328455_c1 | 3300050492 | Bacteria | 1028 |
| 846 | nmdc:mga0yw44_47913_c1 | 3300050492 | Bacteria | 2575 |
| 847 | nmdc:mga0yw44_946406_c1 | 3300050492 | Bacteria | 584 |
| 848 | nmdc:mga0yw44_996418_c1 | 3300050492 | Bacteria | 567 |
| 849 | nmdc:mga06z11_156255_c1 | 3300050494 | Bacteria | 1300 |
| 850 | nmdc:mga06z11_187276_c1 | 3300050494 | Bacteria | 1196 |
| 851 | nmdc:mga06z11_200348_c1 | 3300050494 | Bacteria | 1159 |
| 852 | nmdc:mga05p37_205574_c1 | 3300050507 | Bacteria | 2382 |
| 853 | nmdc:mga05p37_206353_c1 | 3300050507 | Bacteria | 2377 |
| 854 | nmdc:mga05p37_59740_c1 | 3300050507 | Bacteria | 4695 |
| 855 | nmdc:mga05p37_718187_c1 | 3300050507 | Bacteria | 1107 |
| 856 | nmdc:mga06r32_125637_c1 | 3300050510 | Bacteria | 2533 |
| 857 | nmdc:mga06r32_289020_c1 | 3300050510 | Bacteria | 1626 |
| 858 | nmdc:mga08y16_77841_c1 | 3300050511 | Bacteria | 3457 |
| 859 | nmdc:mga0n895_11302_c1 | 3300050512 | Bacteria | 7956 |
| 860 | nmdc:mga0n895_1512414_c1 | 3300050512 | Bacteria | 637 |
| 861 | nmdc:mga0n895_418012_c1 | 3300050512 | Bacteria | 1355 |
| 862 | nmdc:mga0n895_77600_c1 | 3300050512 | Bacteria | 3305 |
| 863 | nmdc:mga0n895_91185_c1 | 3300050512 | Bacteria | 3050 |
| 864 | nmdc:mga0n895_99622_c1 | 3300050512 | Bacteria | 2914 |
| 865 | nmdc:mga0rr50_101254_c1 | 3300050513 | Bacteria | 2264 |
| 866 | nmdc:mga0rr50_328964_c1 | 3300050513 | Bacteria | 1282 |
| 867 | nmdc:mga0rr50_4672_c1 | 3300050513 | Bacteria | 8072 |
| 868 | nmdc:mga0rr50_468178_c1 | 3300050513 | Bacteria | 1069 |
| 869 | nmdc:mga0rr50_702115_c1 | 3300050513 | Bacteria | 863 |
| 870 | nmdc:mga08x19_59131_c1 | 3300050514 | Bacteria | 2481 |
| 871 | nmdc:mga0a205_22729_c1 | 3300050515 | Bacteria | 5945 |
| 872 | nmdc:mga0a205_39954_c1 | 3300050515 | Bacteria | 4517 |
| 873 | nmdc:mga0a205_50115_c1 | 3300050515 | Bacteria | 4031 |
| 874 | nmdc:mga0a205_758204_c1 | 3300050515 | Unclassified | 819 |
| 875 | Ga0495601_0101811 | 3300053077 | Bacteria | 1855 |
| 876 | Ga0495601_0151594 | 3300053077 | Bacteria | 1513 |
| 877 | Ga0495601_0175373 | 3300053077 | Bacteria | 1401 |
| 878 | Ga0495601_0459364 | 3300053077 | Unclassified | 823 |
| 879 | Ga0495601_0991394 | 3300053077 | Unclassified | 528 |
| 880 | Ga0495612_0055292 | 3300053078 | Bacteria | 1636 |
| 881 | Ga0495595_0009175 | 3300053084 | Bacteria | 4086 |
| 882 | Ga0495595_0023650 | 3300053084 | Bacteria | 2708 |
| 883 | Ga0495619_0001914 | 3300053085 | Bacteria | 13865 |
| 884 | Ga0495619_0008233 | 3300053085 | Bacteria | 6597 |
| 885 | Ga0495619_0019321 | 3300053085 | Bacteria | 4329 |
| 886 | Ga0495619_0063338 | 3300053085 | Bacteria | 2463 |
| 887 | Ga0495619_0075685 | 3300053085 | Bacteria | 2259 |
| 888 | Ga0501084_0013416 | 3300054114 | Bacteria | 6780 |
| 889 | Ga0501084_0072442 | 3300054114 | Bacteria | 2885 |
| 890 | Ga0501084_0219343 | 3300054114 | Bacteria | 1605 |
| 891 | Ga0501084_0776493 | 3300054114 | Bacteria | 807 |
| 892 | Ga0501084_0892034 | 3300054114 | Bacteria | 748 |
| 893 | Ga0587070_135859 | 3300059491 | Bacteria | 603 |
| 894 | Ga0587073_0218009 | 3300059492 | Unclassified | 581 |
| 895 | Ga0587077_196937 | 3300059493 | Bacteria | 555 |
| 896 | Ga0587067_179603 | 3300059640 | Bacteria | 550 |
| 897 | Ga0501082_0037616 | 3300060353 | Bacteria | 4173 |
| 898 | Ga0466962_0367385 | 3300061719 | Bacteria | 718 |
| 899 | Ga0530510_0018249 | 3300061734 | Bacteria | 4974 |
| 900 | Ga0530510_0171003 | 3300061734 | Bacteria | 1609 |
| 901 | Ga0530510_0519490 | 3300061734 | Bacteria | 903 |
| 902 | Ga0530510_0605013 | 3300061734 | Bacteria | 834 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300048918 | Ga0496115_0298254 | Ga0496115_0298254_301_675 | 124 |
| 2 | 3300003203 | JGI25406J46586_10170740 | JGI25406J46586_101707401 | 126 |
| 3 | 3300005985 | Ga0081539_10042610 | Ga0081539_100426102 | 126 |
| 4 | 3300006038 | Ga0075365_10015202 | Ga0075365_100152023 | 128 |
| 5 | 3300006038 | Ga0075365_10153616 | Ga0075365_101536162 | 128 |
| 6 | 3300006038 | Ga0075365_10171956 | Ga0075365_101719562 | 128 |
| 7 | 3300006048 | Ga0075363_100298189 | Ga0075363_1002981892 | 128 |
| 8 | 3300006051 | Ga0075364_10123730 | Ga0075364_101237302 | 128 |
| 9 | 3300006051 | Ga0075364_10125182 | Ga0075364_101251822 | 128 |
| 10 | 3300006051 | Ga0075364_10455044 | Ga0075364_104550442 | 128 |
| 11 | 3300006178 | Ga0075367_10133745 | Ga0075367_101337452 | 128 |
| 12 | 3300037466 | Ga0395898_0603532 | Ga0395898_0603532_327_713 | 128 |
| 13 | 3300038443 | Ga0395901_0267913 | Ga0395901_0267913_148_534 | 128 |
| 14 | 3300044694 | Ga0466963_0006377 | Ga0466963_0006377_3081_3467 | 128 |
| 15 | 3300044694 | Ga0466963_0331079 | Ga0466963_0331079_525_911 | 128 |
| 16 | 3300045976 | Ga0466967_0062330 | Ga0466967_0062330_1761_2147 | 128 |
| 17 | 3300045976 | Ga0466967_0249412 | Ga0466967_0249412_219_605 | 128 |
| 18 | 3300049581 | Ga0501047_0230687 | Ga0501047_0230687_33_419 | 128 |
| 19 | 3300049583 | Ga0501067_0086276 | Ga0501067_0086276_305_691 | 128 |
| 20 | 3300050491 | nmdc:mga00v17_127916_c1 | nmdc:mga00v17_127916_c1_1116_1502 | 128 |
| 21 | 3300050491 | nmdc:mga00v17_259255_c1 | nmdc:mga00v17_259255_c1_657_1043 | 128 |
| 22 | 3300050492 | nmdc:mga0yw44_273301_c1 | nmdc:mga0yw44_273301_c1_723_1109 | 128 |
| 23 | 3300050492 | nmdc:mga0yw44_946406_c1 | nmdc:mga0yw44_946406_c1_169_555 | 128 |
| 24 | 3300050494 | nmdc:mga06z11_200348_c1 | nmdc:mga06z11_200348_c1_375_761 | 128 |
| 25 | 3300005339 | Ga0070660_100680924 | Ga0070660_1006809242 | 129 |
| 26 | 3300005436 | Ga0070713_100947523 | Ga0070713_1009475232 | 129 |
| 27 | 3300005439 | Ga0070711_100202229 | Ga0070711_1002022292 | 129 |
| 28 | 3300005468 | Ga0070707_101886825 | Ga0070707_1018868251 | 129 |
| 29 | 3300005985 | Ga0081539_10237100 | Ga0081539_102371002 | 129 |
| 30 | 3300005985 | Ga0081539_10284082 | Ga0081539_102840821 | 129 |
| 31 | 3300006028 | Ga0070717_10588683 | Ga0070717_105886832 | 129 |
| 32 | 3300006038 | Ga0075365_10003891 | Ga0075365_100038912 | 129 |
| 33 | 3300006051 | Ga0075364_10132352 | Ga0075364_101323521 | 129 |
| 34 | 3300006175 | Ga0070712_100615216 | Ga0070712_1006152162 | 129 |
| 35 | 3300006175 | Ga0070712_100952525 | Ga0070712_1009525251 | 129 |
| 36 | 3300025904 | Ga0207647_10234741 | Ga0207647_102347412 | 129 |
| 37 | 3300025915 | Ga0207693_10252700 | Ga0207693_102527002 | 129 |
| 38 | 3300025916 | Ga0207663_10059220 | Ga0207663_100592203 | 129 |
| 39 | 3300025922 | Ga0207646_10718454 | Ga0207646_107184542 | 129 |
| 40 | 3300025923 | Ga0207681_10001013 | Ga0207681_1000101312 | 129 |
| 41 | 3300025928 | Ga0207700_10666842 | Ga0207700_106668422 | 129 |
| 42 | 3300025942 | Ga0207689_11041366 | Ga0207689_110413662 | 129 |
| 43 | 3300028379 | Ga0268266_10252098 | Ga0268266_102520982 | 129 |
| 44 | 3300035083 | Ga0373926_0059401 | Ga0373926_0059401_376_765 | 129 |
| 45 | 3300035089 | Ga0373944_0010616 | Ga0373944_0010616_1379_1768 | 129 |
| 46 | 3300035116 | Ga0373945_0012208 | Ga0373945_0012208_1145_1534 | 129 |
| 47 | 3300035170 | Ga0373943_0000112 | Ga0373943_0000112_22858_23247 | 129 |
| 48 | 3300035171 | Ga0373946_0008171 | Ga0373946_0008171_3313_3702 | 129 |
| 49 | 3300035692 | Ga0373935_0091508 | Ga0373935_0091508_1235_1624 | 129 |
| 50 | 3300035695 | Ga0373927_0021849 | Ga0373927_0021849_2093_2482 | 129 |
| 51 | 3300035725 | Ga0373947_0000600 | Ga0373947_0000600_6797_7186 | 129 |
| 52 | 3300036712 | Ga0316584_0500003 | Ga0316584_0500003_224_616 | 129 |
| 53 | 3300037068 | Ga0373925_0009167 | Ga0373925_0009167_4258_4647 | 129 |
| 54 | 3300037312 | Ga0395899_0246384 | Ga0395899_0246384_169_558 | 129 |
| 55 | 3300037418 | Ga0395900_0227314 | Ga0395900_0227314_746_1135 | 129 |
| 56 | 3300037466 | Ga0395898_0058640 | Ga0395898_0058640_3134_3523 | 129 |
| 57 | 3300037466 | Ga0395898_0163183 | Ga0395898_0163183_969_1358 | 129 |
| 58 | 3300037471 | Ga0395905_0345195 | Ga0395905_0345195_140_529 | 129 |
| 59 | 3300038443 | Ga0395901_0062370 | Ga0395901_0062370_796_1185 | 129 |
| 60 | 3300038443 | Ga0395901_0383850 | Ga0395901_0383850_487_876 | 129 |
| 61 | 3300046454 | Ga0495592_0165482 | Ga0495592_0165482_72_461 | 129 |
| 62 | 3300046459 | Ga0495629_0000593 | Ga0495629_0000593_3301_3690 | 129 |
| 63 | 3300046461 | Ga0495641_0000529 | Ga0495641_0000529_25433_25822 | 129 |
| 64 | 3300046462 | Ga0495651_0082191 | Ga0495651_0082191_1980_2369 | 129 |
| 65 | 3300046463 | Ga0495653_0006289 | Ga0495653_0006289_9294_9683 | 129 |
| 66 | 3300046463 | Ga0495653_0178742 | Ga0495653_0178742_194_583 | 129 |
| 67 | 3300046473 | Ga0495582_0000056 | Ga0495582_0000056_33889_34278 | 129 |
| 68 | 3300046475 | Ga0495639_0003603 | Ga0495639_0003603_1889_2278 | 129 |
| 69 | 3300046476 | Ga0495662_0015110 | Ga0495662_0015110_1357_1746 | 129 |
| 70 | 3300046477 | Ga0495664_0111202 | Ga0495664_0111202_470_859 | 129 |
| 71 | 3300046511 | Ga0495608_0263552 | Ga0495608_0263552_375_764 | 129 |
| 72 | 3300046514 | Ga0495618_0218025 | Ga0495618_0218025_101_490 | 129 |
| 73 | 3300046516 | Ga0495628_0580398 | Ga0495628_0580398_182_571 | 129 |
| 74 | 3300046517 | Ga0495630_0005694 | Ga0495630_0005694_4203_4592 | 129 |
| 75 | 3300046526 | Ga0495666_0041659 | Ga0495666_0041659_1475_1864 | 129 |
| 76 | 3300046529 | Ga0495652_0215186 | Ga0495652_0215186_419_808 | 129 |
| 77 | 3300046531 | Ga0495665_0000910 | Ga0495665_0000910_14280_14669 | 129 |
| 78 | 3300046533 | Ga0495640_0017849 | Ga0495640_0017849_1179_1568 | 129 |
| 79 | 3300046533 | Ga0495640_0074570 | Ga0495640_0074570_1794_2183 | 129 |
| 80 | 3300046559 | Ga0495667_0047005 | Ga0495667_0047005_1248_1637 | 129 |
| 81 | 3300046642 | Ga0495634_0026999 | Ga0495634_0026999_1275_1664 | 129 |
| 82 | 3300046642 | Ga0495634_0129034 | Ga0495634_0129034_109_498 | 129 |
| 83 | 3300046663 | Ga0495635_0062901 | Ga0495635_0062901_734_1123 | 129 |
| 84 | 3300046663 | Ga0495635_0068001 | Ga0495635_0068001_24_413 | 129 |
| 85 | 3300046675 | Ga0495657_0419244 | Ga0495657_0419244_329_718 | 129 |
| 86 | 3300046678 | Ga0495599_0472628 | Ga0495599_0472628_299_688 | 129 |
| 87 | 3300046680 | Ga0495646_0176412 | Ga0495646_0176412_339_728 | 129 |
| 88 | 3300046681 | Ga0495647_0039362 | Ga0495647_0039362_1156_1545 | 129 |
| 89 | 3300046683 | Ga0495658_0000204 | Ga0495658_0000204_22970_23359 | 129 |
| 90 | 3300046689 | Ga0495613_0000401 | Ga0495613_0000401_13815_14204 | 129 |
| 91 | 3300046690 | Ga0495624_0006658 | Ga0495624_0006658_2987_3376 | 129 |
| 92 | 3300046809 | Ga0495600_0030104 | Ga0495600_0030104_931_1320 | 129 |
| 93 | 3300047315 | Ga0495581_0000517 | Ga0495581_0000517_8167_8556 | 129 |
| 94 | 3300047317 | Ga0495604_0074351 | Ga0495604_0074351_1178_1567 | 129 |
| 95 | 3300047319 | Ga0495674_0029603 | Ga0495674_0029603_3125_3514 | 129 |
| 96 | 3300047319 | Ga0495674_1054872 | Ga0495674_1054872_36_425 | 129 |
| 97 | 3300047321 | Ga0495676_0010912 | Ga0495676_0010912_2347_2736 | 129 |
| 98 | 3300047322 | Ga0495680_0008870 | Ga0495680_0008870_1243_1632 | 129 |
| 99 | 3300047322 | Ga0495680_0019712 | Ga0495680_0019712_1735_2124 | 129 |
| 100 | 3300047444 | Ga0495675_0260164 | Ga0495675_0260164_241_630 | 129 |
| 101 | 3300047471 | Ga0495684_0020222 | Ga0495684_0020222_3736_4125 | 129 |
| 102 | 3300047673 | Ga0495593_0001987 | Ga0495593_0001987_1304_1693 | 129 |
| 103 | 3300048089 | Ga0495614_0026119 | Ga0495614_0026119_109_498 | 129 |
| 104 | 3300048917 | Ga0496114_0093503 | Ga0496114_0093503_1768_2157 | 129 |
| 105 | 3300048918 | Ga0496115_0035750 | Ga0496115_0035750_1730_2119 | 129 |
| 106 | 3300049571 | Ga0501034_0064118 | Ga0501034_0064118_2132_2524 | 129 |
| 107 | 3300049572 | Ga0501036_0301277 | Ga0501036_0301277_546_938 | 129 |
| 108 | 3300049581 | Ga0501047_0646821 | Ga0501047_0646821_81_473 | 129 |
| 109 | 3300049586 | Ga0501070_0003866 | Ga0501070_0003866_11325_11714 | 129 |
| 110 | 3300050491 | nmdc:mga00v17_144754_c1 | nmdc:mga00v17_144754_c1_371_763 | 129 |
| 111 | 3300050492 | nmdc:mga0yw44_328455_c1 | nmdc:mga0yw44_328455_c1_300_692 | 129 |
| 112 | 3300050492 | nmdc:mga0yw44_47913_c1 | nmdc:mga0yw44_47913_c1_791_1183 | 129 |
| 113 | 3300053077 | Ga0495601_0151594 | Ga0495601_0151594_211_600 | 129 |
| 114 | 3300053077 | Ga0495601_0991394 | Ga0495601_0991394_105_494 | 129 |
| 115 | 3300053084 | Ga0495595_0009175 | Ga0495595_0009175_2361_2750 | 129 |
| 116 | 3300053085 | Ga0495619_0001914 | Ga0495619_0001914_5589_5978 | 129 |
| 117 | 3300053085 | Ga0495619_0008233 | Ga0495619_0008233_2362_2751 | 129 |
| 118 | 3300005329 | Ga0070683_100005095 | Ga0070683_1000050959 | 130 |
| 119 | 3300005329 | Ga0070683_102099234 | Ga0070683_1020992342 | 130 |
| 120 | 3300005330 | Ga0070690_101253862 | Ga0070690_1012538621 | 130 |
| 121 | 3300005335 | Ga0070666_10142825 | Ga0070666_101428252 | 130 |
| 122 | 3300005336 | Ga0070680_100712558 | Ga0070680_1007125581 | 130 |
| 123 | 3300005336 | Ga0070680_101544923 | Ga0070680_1015449231 | 130 |
| 124 | 3300005336 | Ga0070680_101658759 | Ga0070680_1016587591 | 130 |
| 125 | 3300005337 | Ga0070682_100232060 | Ga0070682_1002320602 | 130 |
| 126 | 3300005337 | Ga0070682_100531497 | Ga0070682_1005314972 | 130 |
| 127 | 3300005339 | Ga0070660_100077437 | Ga0070660_1000774373 | 130 |
| 128 | 3300005339 | Ga0070660_100826626 | Ga0070660_1008266262 | 130 |
| 129 | 3300005344 | Ga0070661_100206900 | Ga0070661_1002069002 | 130 |
| 130 | 3300005344 | Ga0070661_101010636 | Ga0070661_1010106361 | 130 |
| 131 | 3300005345 | Ga0070692_10632675 | Ga0070692_106326751 | 130 |
| 132 | 3300005355 | Ga0070671_102038603 | Ga0070671_1020386031 | 130 |
| 133 | 3300005356 | Ga0070674_100216807 | Ga0070674_1002168072 | 130 |
| 134 | 3300005364 | Ga0070673_100855926 | Ga0070673_1008559262 | 130 |
| 135 | 3300005365 | Ga0070688_100173502 | Ga0070688_1001735022 | 130 |
| 136 | 3300005366 | Ga0070659_100280626 | Ga0070659_1002806262 | 130 |
| 137 | 3300005436 | Ga0070713_100202845 | Ga0070713_1002028452 | 130 |
| 138 | 3300005441 | Ga0070700_101125289 | Ga0070700_1011252891 | 130 |
| 139 | 3300005456 | Ga0070678_100228885 | Ga0070678_1002288852 | 130 |
| 140 | 3300005458 | Ga0070681_10111187 | Ga0070681_101111871 | 130 |
| 141 | 3300005530 | Ga0070679_100007568 | Ga0070679_1000075683 | 130 |
| 142 | 3300005535 | Ga0070684_100000286 | Ga0070684_1000002866 | 130 |
| 143 | 3300005535 | Ga0070684_100758427 | Ga0070684_1007584272 | 130 |
| 144 | 3300005536 | Ga0070697_101173066 | Ga0070697_1011730662 | 130 |
| 145 | 3300005544 | Ga0070686_100171734 | Ga0070686_1001717342 | 130 |
| 146 | 3300005544 | Ga0070686_101384173 | Ga0070686_1013841731 | 130 |
| 147 | 3300005545 | Ga0070695_100483213 | Ga0070695_1004832132 | 130 |
| 148 | 3300005546 | Ga0070696_100534900 | Ga0070696_1005349002 | 130 |
| 149 | 3300005547 | Ga0070693_100510772 | Ga0070693_1005107722 | 130 |
| 150 | 3300005548 | Ga0070665_100459721 | Ga0070665_1004597212 | 130 |
| 151 | 3300005563 | Ga0068855_100077276 | Ga0068855_1000772763 | 130 |
| 152 | 3300005564 | Ga0070664_100137055 | Ga0070664_1001370553 | 130 |
| 153 | 3300005614 | Ga0068856_100054954 | Ga0068856_1000549544 | 130 |
| 154 | 3300005615 | Ga0070702_100848141 | Ga0070702_1008481411 | 130 |
| 155 | 3300005617 | Ga0068859_102150856 | Ga0068859_1021508561 | 130 |
| 156 | 3300005840 | Ga0068870_10114627 | Ga0068870_101146272 | 130 |
| 157 | 3300005840 | Ga0068870_10561980 | Ga0068870_105619802 | 130 |
| 158 | 3300005937 | Ga0081455_10112401 | Ga0081455_101124012 | 130 |
| 159 | 3300005937 | Ga0081455_10123075 | Ga0081455_101230752 | 130 |
| 160 | 3300005937 | Ga0081455_10376675 | Ga0081455_103766752 | 130 |
| 161 | 3300005937 | Ga0081455_10852386 | Ga0081455_108523861 | 130 |
| 162 | 3300006038 | Ga0075365_10415227 | Ga0075365_104152272 | 130 |
| 163 | 3300006051 | Ga0075364_10497899 | Ga0075364_104978992 | 130 |
| 164 | 3300006175 | Ga0070712_100593532 | Ga0070712_1005935322 | 130 |
| 165 | 3300006178 | Ga0075367_10999641 | Ga0075367_109996412 | 130 |
| 166 | 3300006237 | Ga0097621_100213116 | Ga0097621_1002131162 | 130 |
| 167 | 3300006237 | Ga0097621_100363984 | Ga0097621_1003639842 | 130 |
| 168 | 3300006358 | Ga0068871_101750675 | Ga0068871_1017506751 | 130 |
| 169 | 3300006844 | Ga0075428_100007984 | Ga0075428_1000079849 | 130 |
| 170 | 3300006844 | Ga0075428_100583764 | Ga0075428_1005837641 | 130 |
| 171 | 3300006852 | Ga0075433_10756443 | Ga0075433_107564432 | 130 |
| 172 | 3300006880 | Ga0075429_100314316 | Ga0075429_1003143162 | 130 |
| 173 | 3300006914 | Ga0075436_100369654 | Ga0075436_1003696542 | 130 |
| 174 | 3300006931 | Ga0097620_102150825 | Ga0097620_1021508252 | 130 |
| 175 | 3300007076 | Ga0075435_100055348 | Ga0075435_1000553484 | 130 |
| 176 | 3300009094 | Ga0111539_10040887 | Ga0111539_100408876 | 130 |
| 177 | 3300009098 | Ga0105245_10122828 | Ga0105245_101228284 | 130 |
| 178 | 3300009098 | Ga0105245_10137493 | Ga0105245_101374932 | 130 |
| 179 | 3300009098 | Ga0105245_10348748 | Ga0105245_103487482 | 130 |
| 180 | 3300009098 | Ga0105245_11862597 | Ga0105245_118625972 | 130 |
| 181 | 3300009147 | Ga0114129_10000727 | Ga0114129_1000072742 | 130 |
| 182 | 3300009147 | Ga0114129_10170675 | Ga0114129_101706753 | 130 |
| 183 | 3300009147 | Ga0114129_11431861 | Ga0114129_114318612 | 130 |
| 184 | 3300009148 | Ga0105243_10109909 | Ga0105243_101099092 | 130 |
| 185 | 3300009174 | Ga0105241_10829209 | Ga0105241_108292091 | 130 |
| 186 | 3300009176 | Ga0105242_10329695 | Ga0105242_103296952 | 130 |
| 187 | 3300009176 | Ga0105242_11306124 | Ga0105242_113061242 | 130 |
| 188 | 3300009177 | Ga0105248_10160218 | Ga0105248_101602182 | 130 |
| 189 | 3300009177 | Ga0105248_11006895 | Ga0105248_110068952 | 130 |
| 190 | 3300009545 | Ga0105237_10974551 | Ga0105237_109745512 | 130 |
| 191 | 3300009551 | Ga0105238_10996094 | Ga0105238_109960942 | 130 |
| 192 | 3300010375 | Ga0105239_10221657 | Ga0105239_102216572 | 130 |
| 193 | 3300011119 | Ga0105246_10969760 | Ga0105246_109697602 | 130 |
| 194 | 3300013296 | Ga0157374_10128262 | Ga0157374_101282622 | 130 |
| 195 | 3300013296 | Ga0157374_11043122 | Ga0157374_110431221 | 130 |
| 196 | 3300013297 | Ga0157378_10275550 | Ga0157378_102755502 | 130 |
| 197 | 3300013306 | Ga0163162_10093384 | Ga0163162_100933842 | 130 |
| 198 | 3300013307 | Ga0157372_12120176 | Ga0157372_121201762 | 130 |
| 199 | 3300013308 | Ga0157375_10297023 | Ga0157375_102970232 | 130 |
| 200 | 3300013308 | Ga0157375_11204406 | Ga0157375_112044062 | 130 |
| 201 | 3300014325 | Ga0163163_10164086 | Ga0163163_101640862 | 130 |
| 202 | 3300014325 | Ga0163163_12034623 | Ga0163163_120346232 | 130 |
| 203 | 3300014497 | Ga0182008_10845273 | Ga0182008_108452731 | 130 |
| 204 | 3300014745 | Ga0157377_10030329 | Ga0157377_100303292 | 130 |
| 205 | 3300014969 | Ga0157376_10254312 | Ga0157376_102543122 | 130 |
| 206 | 3300014969 | Ga0157376_10464925 | Ga0157376_104649251 | 130 |
| 207 | 3300014969 | Ga0157376_10704573 | Ga0157376_107045732 | 130 |
| 208 | 3300017792 | Ga0163161_10342206 | Ga0163161_103422062 | 130 |
| 209 | 3300020082 | Ga0206353_10259235 | Ga0206353_102592352 | 130 |
| 210 | 3300025899 | Ga0207642_10329929 | Ga0207642_103299292 | 130 |
| 211 | 3300025901 | Ga0207688_10490131 | Ga0207688_104901311 | 130 |
| 212 | 3300025911 | Ga0207654_10455777 | Ga0207654_104557772 | 130 |
| 213 | 3300025912 | Ga0207707_10031620 | Ga0207707_100316201 | 130 |
| 214 | 3300025916 | Ga0207663_10689903 | Ga0207663_106899031 | 130 |
| 215 | 3300025917 | Ga0207660_11160961 | Ga0207660_111609612 | 130 |
| 216 | 3300025919 | Ga0207657_10731425 | Ga0207657_107314252 | 130 |
| 217 | 3300025921 | Ga0207652_10006892 | Ga0207652_100068924 | 130 |
| 218 | 3300025925 | Ga0207650_11333318 | Ga0207650_113333182 | 130 |
| 219 | 3300025926 | Ga0207659_10359004 | Ga0207659_103590042 | 130 |
| 220 | 3300025927 | Ga0207687_10049998 | Ga0207687_100499983 | 130 |
| 221 | 3300025927 | Ga0207687_10100296 | Ga0207687_101002964 | 130 |
| 222 | 3300025927 | Ga0207687_10864587 | Ga0207687_108645872 | 130 |
| 223 | 3300025927 | Ga0207687_11003703 | Ga0207687_110037032 | 130 |
| 224 | 3300025927 | Ga0207687_11205023 | Ga0207687_112050232 | 130 |
| 225 | 3300025928 | Ga0207700_10608149 | Ga0207700_106081491 | 130 |
| 226 | 3300025931 | Ga0207644_10860961 | Ga0207644_108609612 | 130 |
| 227 | 3300025932 | Ga0207690_10653091 | Ga0207690_106530911 | 130 |
| 228 | 3300025934 | Ga0207686_10588042 | Ga0207686_105880422 | 130 |
| 229 | 3300025935 | Ga0207709_10091967 | Ga0207709_100919672 | 130 |
| 230 | 3300025935 | Ga0207709_10958849 | Ga0207709_109588492 | 130 |
| 231 | 3300025938 | Ga0207704_10440476 | Ga0207704_104404762 | 130 |
| 232 | 3300025941 | Ga0207711_10753361 | Ga0207711_107533612 | 130 |
| 233 | 3300025944 | Ga0207661_10003778 | Ga0207661_100037789 | 130 |
| 234 | 3300025944 | Ga0207661_10094389 | Ga0207661_100943893 | 130 |
| 235 | 3300025945 | Ga0207679_10042141 | Ga0207679_100421414 | 130 |
| 236 | 3300025949 | Ga0207667_10438227 | Ga0207667_104382272 | 130 |
| 237 | 3300025961 | Ga0207712_10129121 | Ga0207712_101291213 | 130 |
| 238 | 3300025972 | Ga0207668_10152887 | Ga0207668_101528872 | 130 |
| 239 | 3300025972 | Ga0207668_11239844 | Ga0207668_112398441 | 130 |
| 240 | 3300026067 | Ga0207678_10826813 | Ga0207678_108268132 | 130 |
| 241 | 3300026078 | Ga0207702_10026096 | Ga0207702_100260962 | 130 |
| 242 | 3300026078 | Ga0207702_11244373 | Ga0207702_112443732 | 130 |
| 243 | 3300026095 | Ga0207676_10838310 | Ga0207676_108383102 | 130 |
| 244 | 3300026118 | Ga0207675_101388605 | Ga0207675_1013886052 | 130 |
| 245 | 3300028380 | Ga0268265_10998321 | Ga0268265_109983212 | 130 |
| 246 | 3300028577 | Ga0265318_10078356 | Ga0265318_100783562 | 130 |
| 247 | 3300031824 | Ga0307413_10453533 | Ga0307413_104535332 | 130 |
| 248 | 3300031852 | Ga0307410_10346642 | Ga0307410_103466422 | 130 |
| 249 | 3300031852 | Ga0307410_11576523 | Ga0307410_115765232 | 130 |
| 250 | 3300031901 | Ga0307406_10218345 | Ga0307406_102183452 | 130 |
| 251 | 3300031995 | Ga0307409_100413067 | Ga0307409_1004130672 | 130 |
| 252 | 3300031995 | Ga0307409_101331804 | Ga0307409_1013318042 | 130 |
| 253 | 3300032002 | Ga0307416_100260956 | Ga0307416_1002609562 | 130 |
| 254 | 3300032004 | Ga0307414_10493413 | Ga0307414_104934132 | 130 |
| 255 | 3300032126 | Ga0307415_100305203 | Ga0307415_1003052031 | 130 |
| 256 | 3300032126 | Ga0307415_101497355 | Ga0307415_1014973551 | 130 |
| 257 | 3300037312 | Ga0395899_0062762 | Ga0395899_0062762_1991_2383 | 130 |
| 258 | 3300037312 | Ga0395899_0272482 | Ga0395899_0272482_418_813 | 130 |
| 259 | 3300037418 | Ga0395900_0041807 | Ga0395900_0041807_1290_1682 | 130 |
| 260 | 3300037418 | Ga0395900_0043734 | Ga0395900_0043734_975_1367 | 130 |
| 261 | 3300037418 | Ga0395900_0188662 | Ga0395900_0188662_491_886 | 130 |
| 262 | 3300037418 | Ga0395900_0203195 | Ga0395900_0203195_1031_1426 | 130 |
| 263 | 3300037466 | Ga0395898_0039798 | Ga0395898_0039798_1147_1539 | 130 |
| 264 | 3300037466 | Ga0395898_0102181 | Ga0395898_0102181_1712_2107 | 130 |
| 265 | 3300037466 | Ga0395898_0634691 | Ga0395898_0634691_35_430 | 130 |
| 266 | 3300037471 | Ga0395905_0612284 | Ga0395905_0612284_521_916 | 130 |
| 267 | 3300037471 | Ga0395905_1288090 | Ga0395905_1288090_14_409 | 130 |
| 268 | 3300037471 | Ga0395905_1795841 | Ga0395905_1795841_61_453 | 130 |
| 269 | 3300038443 | Ga0395901_0016021 | Ga0395901_0016021_5123_5518 | 130 |
| 270 | 3300038443 | Ga0395901_0061730 | Ga0395901_0061730_735_1127 | 130 |
| 271 | 3300038443 | Ga0395901_0093813 | Ga0395901_0093813_500_892 | 130 |
| 272 | 3300038443 | Ga0395901_0144701 | Ga0395901_0144701_1927_2322 | 130 |
| 273 | 3300038443 | Ga0395901_0239619 | Ga0395901_0239619_1441_1836 | 130 |
| 274 | 3300044684 | Ga0466966_0723016 | Ga0466966_0723016_148_540 | 130 |
| 275 | 3300045976 | Ga0466967_0035947 | Ga0466967_0035947_2113_2505 | 130 |
| 276 | 3300046455 | Ga0495603_0254211 | Ga0495603_0254211_161_553 | 130 |
| 277 | 3300046474 | Ga0495605_0068460 | Ga0495605_0068460_86_478 | 130 |
| 278 | 3300046476 | Ga0495662_0058719 | Ga0495662_0058719_1005_1397 | 130 |
| 279 | 3300046491 | Ga0495584_0303429 | Ga0495584_0303429_293_685 | 130 |
| 280 | 3300046525 | Ga0495663_0100296 | Ga0495663_0100296_70_462 | 130 |
| 281 | 3300046543 | Ga0495645_0390316 | Ga0495645_0390316_332_724 | 130 |
| 282 | 3300046615 | Ga0495656_0020716 | Ga0495656_0020716_1459_1851 | 130 |
| 283 | 3300046615 | Ga0495656_0069782 | Ga0495656_0069782_537_929 | 130 |
| 284 | 3300046642 | Ga0495634_0293268 | Ga0495634_0293268_264_656 | 130 |
| 285 | 3300046681 | Ga0495647_0036946 | Ga0495647_0036946_1337_1729 | 130 |
| 286 | 3300046794 | Ga0495589_0297348 | Ga0495589_0297348_57_449 | 130 |
| 287 | 3300047322 | Ga0495680_0317005 | Ga0495680_0317005_189_581 | 130 |
| 288 | 3300048903 | Ga0496100_0044261 | Ga0496100_0044261_1322_1714 | 130 |
| 289 | 3300048903 | Ga0496100_0068131 | Ga0496100_0068131_188_580 | 130 |
| 290 | 3300048904 | Ga0496101_0018182 | Ga0496101_0018182_2598_2990 | 130 |
| 291 | 3300048904 | Ga0496101_0029430 | Ga0496101_0029430_3256_3648 | 130 |
| 292 | 3300048904 | Ga0496101_0121800 | Ga0496101_0121800_1402_1794 | 130 |
| 293 | 3300048904 | Ga0496101_0154321 | Ga0496101_0154321_19_411 | 130 |
| 294 | 3300048905 | Ga0496102_0015240 | Ga0496102_0015240_393_785 | 130 |
| 295 | 3300048905 | Ga0496102_0337572 | Ga0496102_0337572_867_1259 | 130 |
| 296 | 3300048905 | Ga0496102_0646653 | Ga0496102_0646653_522_914 | 130 |
| 297 | 3300048906 | Ga0496103_0143006 | Ga0496103_0143006_355_747 | 130 |
| 298 | 3300048907 | Ga0496104_0000571 | Ga0496104_0000571_22462_22854 | 130 |
| 299 | 3300048907 | Ga0496104_0013102 | Ga0496104_0013102_6706_7098 | 130 |
| 300 | 3300048908 | Ga0496105_0240795 | Ga0496105_0240795_206_598 | 130 |
| 301 | 3300048908 | Ga0496105_0340463 | Ga0496105_0340463_415_807 | 130 |
| 302 | 3300048908 | Ga0496105_0582406 | Ga0496105_0582406_207_599 | 130 |
| 303 | 3300048908 | Ga0496105_0660240 | Ga0496105_0660240_384_776 | 130 |
| 304 | 3300048909 | Ga0496106_0249434 | Ga0496106_0249434_465_857 | 130 |
| 305 | 3300048909 | Ga0496106_0268126 | Ga0496106_0268126_942_1337 | 130 |
| 306 | 3300048910 | Ga0496107_0180795 | Ga0496107_0180795_912_1307 | 130 |
| 307 | 3300048910 | Ga0496107_0198279 | Ga0496107_0198279_1035_1427 | 130 |
| 308 | 3300048910 | Ga0496107_0491331 | Ga0496107_0491331_181_573 | 130 |
| 309 | 3300048911 | Ga0496108_0037194 | Ga0496108_0037194_2318_2710 | 130 |
| 310 | 3300048911 | Ga0496108_0286532 | Ga0496108_0286532_377_769 | 130 |
| 311 | 3300048912 | Ga0496109_0000638 | Ga0496109_0000638_28151_28543 | 130 |
| 312 | 3300048912 | Ga0496109_0292057 | Ga0496109_0292057_501_893 | 130 |
| 313 | 3300048912 | Ga0496109_0882527 | Ga0496109_0882527_337_735 | 130 |
| 314 | 3300048912 | Ga0496109_1794561 | Ga0496109_1794561_35_427 | 130 |
| 315 | 3300048913 | Ga0496110_0001697 | Ga0496110_0001697_2418_2810 | 130 |
| 316 | 3300048913 | Ga0496110_0280503 | Ga0496110_0280503_821_1213 | 130 |
| 317 | 3300048913 | Ga0496110_0635728 | Ga0496110_0635728_538_933 | 130 |
| 318 | 3300048914 | Ga0496111_0000025 | Ga0496111_0000025_52962_53354 | 130 |
| 319 | 3300048914 | Ga0496111_0027978 | Ga0496111_0027978_2335_2727 | 130 |
| 320 | 3300048914 | Ga0496111_0194638 | Ga0496111_0194638_540_935 | 130 |
| 321 | 3300048914 | Ga0496111_0347061 | Ga0496111_0347061_15_407 | 130 |
| 322 | 3300048915 | Ga0496112_0253100 | Ga0496112_0253100_836_1231 | 130 |
| 323 | 3300048915 | Ga0496112_0530166 | Ga0496112_0530166_543_935 | 130 |
| 324 | 3300048915 | Ga0496112_0717772 | Ga0496112_0717772_43_435 | 130 |
| 325 | 3300048917 | Ga0496114_0001903 | Ga0496114_0001903_4374_4766 | 130 |
| 326 | 3300048917 | Ga0496114_0039807 | Ga0496114_0039807_848_1240 | 130 |
| 327 | 3300048917 | Ga0496114_0045742 | Ga0496114_0045742_1460_1852 | 130 |
| 328 | 3300048917 | Ga0496114_0116801 | Ga0496114_0116801_75_467 | 130 |
| 329 | 3300048917 | Ga0496114_0555414 | Ga0496114_0555414_135_527 | 130 |
| 330 | 3300048918 | Ga0496115_0546724 | Ga0496115_0546724_296_688 | 130 |
| 331 | 3300049569 | Ga0501032_0590662 | Ga0501032_0590662_86_478 | 130 |
| 332 | 3300049572 | Ga0501036_0764951 | Ga0501036_0764951_295_687 | 130 |
| 333 | 3300049574 | Ga0501038_0401156 | Ga0501038_0401156_84_476 | 130 |
| 334 | 3300049578 | Ga0501042_0184233 | Ga0501042_0184233_599_991 | 130 |
| 335 | 3300049578 | Ga0501042_0573871 | Ga0501042_0573871_308_700 | 130 |
| 336 | 3300049579 | Ga0501043_0784959 | Ga0501043_0784959_112_504 | 130 |
| 337 | 3300049581 | Ga0501047_0502347 | Ga0501047_0502347_368_760 | 130 |
| 338 | 3300049581 | Ga0501047_0742354 | Ga0501047_0742354_353_745 | 130 |
| 339 | 3300049582 | Ga0501048_0236980 | Ga0501048_0236980_540_932 | 130 |
| 340 | 3300049583 | Ga0501067_0223945 | Ga0501067_0223945_639_1031 | 130 |
| 341 | 3300049583 | Ga0501067_0231389 | Ga0501067_0231389_340_732 | 130 |
| 342 | 3300049584 | Ga0501068_0377105 | Ga0501068_0377105_83_475 | 130 |
| 343 | 3300049585 | Ga0501069_0128744 | Ga0501069_0128744_152_544 | 130 |
| 344 | 3300049585 | Ga0501069_0149679 | Ga0501069_0149679_740_1132 | 130 |
| 345 | 3300049585 | Ga0501069_0638757 | Ga0501069_0638757_39_431 | 130 |
| 346 | 3300049586 | Ga0501070_0128150 | Ga0501070_0128150_488_880 | 130 |
| 347 | 3300049586 | Ga0501070_0517461 | Ga0501070_0517461_51_443 | 130 |
| 348 | 3300049587 | Ga0501071_1021160 | Ga0501071_1021160_195_587 | 130 |
| 349 | 3300049590 | Ga0501074_0018234 | Ga0501074_0018234_4401_4793 | 130 |
| 350 | 3300049674 | Ga0501242_029051 | Ga0501242_029051_142_534 | 130 |
| 351 | 3300049675 | Ga0501243_066454 | Ga0501243_066454_16_408 | 130 |
| 352 | 3300049741 | Ga0501079_0109663 | Ga0501079_0109663_943_1335 | 130 |
| 353 | 3300049741 | Ga0501079_0145539 | Ga0501079_0145539_45_437 | 130 |
| 354 | 3300049742 | Ga0501080_0070880 | Ga0501080_0070880_1051_1443 | 130 |
| 355 | 3300049743 | Ga0501081_0035504 | Ga0501081_0035504_271_663 | 130 |
| 356 | 3300049779 | Ga0501283_098101 | Ga0501283_098101_37_429 | 130 |
| 357 | 3300049822 | Ga0501035_0734223 | Ga0501035_0734223_272_664 | 130 |
| 358 | 3300049823 | Ga0501044_0808063 | Ga0501044_0808063_188_580 | 130 |
| 359 | 3300049824 | Ga0501045_0047826 | Ga0501045_0047826_2168_2560 | 130 |
| 360 | 3300050490 | nmdc:mga03n38_844024_c1 | nmdc:mga03n38_844024_c1_62_454 | 130 |
| 361 | 3300050491 | nmdc:mga00v17_632437_c1 | nmdc:mga00v17_632437_c1_91_489 | 130 |
| 362 | 3300050494 | nmdc:mga06z11_156255_c1 | nmdc:mga06z11_156255_c1_401_793 | 130 |
| 363 | 3300050507 | nmdc:mga05p37_206353_c1 | nmdc:mga05p37_206353_c1_1195_1593 | 130 |
| 364 | 3300050510 | nmdc:mga06r32_125637_c1 | nmdc:mga06r32_125637_c1_520_912 | 130 |
| 365 | 3300050511 | nmdc:mga08y16_77841_c1 | nmdc:mga08y16_77841_c1_495_893 | 130 |
| 366 | 3300050512 | nmdc:mga0n895_418012_c1 | nmdc:mga0n895_418012_c1_231_623 | 130 |
| 367 | 3300050512 | nmdc:mga0n895_99622_c1 | nmdc:mga0n895_99622_c1_1132_1524 | 130 |
| 368 | 3300050513 | nmdc:mga0rr50_468178_c1 | nmdc:mga0rr50_468178_c1_243_635 | 130 |
| 369 | 3300050513 | nmdc:mga0rr50_702115_c1 | nmdc:mga0rr50_702115_c1_60_452 | 130 |
| 370 | 3300050515 | nmdc:mga0a205_50115_c1 | nmdc:mga0a205_50115_c1_1010_1408 | 130 |
| 371 | 3300053077 | Ga0495601_0459364 | Ga0495601_0459364_326_718 | 130 |
| 372 | 3300054114 | Ga0501084_0776493 | Ga0501084_0776493_31_423 | 130 |
| 373 | 3300054114 | Ga0501084_0892034 | Ga0501084_0892034_234_626 | 130 |
| 374 | 3300059491 | Ga0587070_135859 | Ga0587070_135859_101_493 | 130 |
| 375 | 3300059492 | Ga0587073_0218009 | Ga0587073_0218009_148_540 | 130 |
| 376 | 3300059640 | Ga0587067_179603 | Ga0587067_179603_105_497 | 130 |
| 377 | 3300060353 | Ga0501082_0037616 | Ga0501082_0037616_547_939 | 130 |
| 378 | 3300061734 | Ga0530510_0519490 | Ga0530510_0519490_98_490 | 130 |
| 379 | 3300003203 | JGI25406J46586_10036185 | JGI25406J46586_100361852 | 131 |
| 380 | 3300005327 | Ga0070658_10008240 | Ga0070658_100082408 | 131 |
| 381 | 3300005327 | Ga0070658_10512798 | Ga0070658_105127981 | 131 |
| 382 | 3300005329 | Ga0070683_100008967 | Ga0070683_1000089672 | 131 |
| 383 | 3300005329 | Ga0070683_100147264 | Ga0070683_1001472642 | 131 |
| 384 | 3300005329 | Ga0070683_100210639 | Ga0070683_1002106392 | 131 |
| 385 | 3300005336 | Ga0070680_100061784 | Ga0070680_1000617842 | 131 |
| 386 | 3300005336 | Ga0070680_101043513 | Ga0070680_1010435132 | 131 |
| 387 | 3300005338 | Ga0068868_100775841 | Ga0068868_1007758412 | 131 |
| 388 | 3300005339 | Ga0070660_100045171 | Ga0070660_1000451713 | 131 |
| 389 | 3300005339 | Ga0070660_100670785 | Ga0070660_1006707852 | 131 |
| 390 | 3300005341 | Ga0070691_10771556 | Ga0070691_107715561 | 131 |
| 391 | 3300005343 | Ga0070687_100381079 | Ga0070687_1003810791 | 131 |
| 392 | 3300005344 | Ga0070661_100583191 | Ga0070661_1005831912 | 131 |
| 393 | 3300005347 | Ga0070668_100097191 | Ga0070668_1000971913 | 131 |
| 394 | 3300005347 | Ga0070668_100306058 | Ga0070668_1003060582 | 131 |
| 395 | 3300005347 | Ga0070668_100309106 | Ga0070668_1003091062 | 131 |
| 396 | 3300005353 | Ga0070669_100457680 | Ga0070669_1004576802 | 131 |
| 397 | 3300005355 | Ga0070671_100386286 | Ga0070671_1003862862 | 131 |
| 398 | 3300005355 | Ga0070671_100559681 | Ga0070671_1005596812 | 131 |
| 399 | 3300005356 | Ga0070674_100233845 | Ga0070674_1002338452 | 131 |
| 400 | 3300005366 | Ga0070659_100056686 | Ga0070659_1000566861 | 131 |
| 401 | 3300005366 | Ga0070659_101009031 | Ga0070659_1010090312 | 131 |
| 402 | 3300005434 | Ga0070709_10063824 | Ga0070709_100638242 | 131 |
| 403 | 3300005435 | Ga0070714_100443034 | Ga0070714_1004430342 | 131 |
| 404 | 3300005435 | Ga0070714_101310714 | Ga0070714_1013107142 | 131 |
| 405 | 3300005436 | Ga0070713_100452660 | Ga0070713_1004526602 | 131 |
| 406 | 3300005436 | Ga0070713_100466729 | Ga0070713_1004667292 | 131 |
| 407 | 3300005436 | Ga0070713_100839756 | Ga0070713_1008397562 | 131 |
| 408 | 3300005436 | Ga0070713_101441098 | Ga0070713_1014410982 | 131 |
| 409 | 3300005437 | Ga0070710_10009026 | Ga0070710_100090263 | 131 |
| 410 | 3300005437 | Ga0070710_10099411 | Ga0070710_100994113 | 131 |
| 411 | 3300005437 | Ga0070710_10309267 | Ga0070710_103092672 | 131 |
| 412 | 3300005438 | Ga0070701_10085966 | Ga0070701_100859662 | 131 |
| 413 | 3300005439 | Ga0070711_100038326 | Ga0070711_1000383262 | 131 |
| 414 | 3300005439 | Ga0070711_100168410 | Ga0070711_1001684102 | 131 |
| 415 | 3300005440 | Ga0070705_100123792 | Ga0070705_1001237922 | 131 |
| 416 | 3300005440 | Ga0070705_100553676 | Ga0070705_1005536761 | 131 |
| 417 | 3300005440 | Ga0070705_101948893 | Ga0070705_1019488931 | 131 |
| 418 | 3300005444 | Ga0070694_100074768 | Ga0070694_1000747682 | 131 |
| 419 | 3300005444 | Ga0070694_100090238 | Ga0070694_1000902382 | 131 |
| 420 | 3300005445 | Ga0070708_100171666 | Ga0070708_1001716662 | 131 |
| 421 | 3300005445 | Ga0070708_100186023 | Ga0070708_1001860231 | 131 |
| 422 | 3300005445 | Ga0070708_100294220 | Ga0070708_1002942202 | 131 |
| 423 | 3300005445 | Ga0070708_100353176 | Ga0070708_1003531762 | 131 |
| 424 | 3300005445 | Ga0070708_100714660 | Ga0070708_1007146602 | 131 |
| 425 | 3300005445 | Ga0070708_102195912 | Ga0070708_1021959121 | 131 |
| 426 | 3300005455 | Ga0070663_100546089 | Ga0070663_1005460892 | 131 |
| 427 | 3300005456 | Ga0070678_100930602 | Ga0070678_1009306022 | 131 |
| 428 | 3300005458 | Ga0070681_10022081 | Ga0070681_100220818 | 131 |
| 429 | 3300005466 | Ga0070685_10852669 | Ga0070685_108526691 | 131 |
| 430 | 3300005467 | Ga0070706_100229391 | Ga0070706_1002293912 | 131 |
| 431 | 3300005467 | Ga0070706_100233059 | Ga0070706_1002330592 | 131 |
| 432 | 3300005468 | Ga0070707_100629281 | Ga0070707_1006292812 | 131 |
| 433 | 3300005468 | Ga0070707_100772166 | Ga0070707_1007721662 | 131 |
| 434 | 3300005471 | Ga0070698_100032881 | Ga0070698_1000328815 | 131 |
| 435 | 3300005471 | Ga0070698_100386912 | Ga0070698_1003869122 | 131 |
| 436 | 3300005518 | Ga0070699_100322895 | Ga0070699_1003228952 | 131 |
| 437 | 3300005530 | Ga0070679_100013106 | Ga0070679_1000131063 | 131 |
| 438 | 3300005535 | Ga0070684_100010068 | Ga0070684_1000100688 | 131 |
| 439 | 3300005535 | Ga0070684_100020927 | Ga0070684_1000209272 | 131 |
| 440 | 3300005535 | Ga0070684_100488073 | Ga0070684_1004880732 | 131 |
| 441 | 3300005536 | Ga0070697_100069763 | Ga0070697_1000697632 | 131 |
| 442 | 3300005536 | Ga0070697_100235797 | Ga0070697_1002357972 | 131 |
| 443 | 3300005545 | Ga0070695_100330904 | Ga0070695_1003309042 | 131 |
| 444 | 3300005546 | Ga0070696_100075073 | Ga0070696_1000750732 | 131 |
| 445 | 3300005547 | Ga0070693_101312426 | Ga0070693_1013124261 | 131 |
| 446 | 3300005549 | Ga0070704_100082166 | Ga0070704_1000821661 | 131 |
| 447 | 3300005563 | Ga0068855_100017076 | Ga0068855_1000170764 | 131 |
| 448 | 3300005563 | Ga0068855_100077741 | Ga0068855_1000777414 | 131 |
| 449 | 3300005563 | Ga0068855_102062937 | Ga0068855_1020629372 | 131 |
| 450 | 3300005564 | Ga0070664_100223690 | Ga0070664_1002236902 | 131 |
| 451 | 3300005577 | Ga0068857_100096601 | Ga0068857_1000966013 | 131 |
| 452 | 3300005577 | Ga0068857_100130441 | Ga0068857_1001304412 | 131 |
| 453 | 3300005614 | Ga0068856_100688561 | Ga0068856_1006885612 | 131 |
| 454 | 3300005614 | Ga0068856_100817094 | Ga0068856_1008170942 | 131 |
| 455 | 3300005615 | Ga0070702_100028067 | Ga0070702_1000280673 | 131 |
| 456 | 3300005719 | Ga0068861_100057930 | Ga0068861_1000579302 | 131 |
| 457 | 3300005844 | Ga0068862_100743184 | Ga0068862_1007431842 | 131 |
| 458 | 3300005937 | Ga0081455_10032931 | Ga0081455_100329314 | 131 |
| 459 | 3300005937 | Ga0081455_10148585 | Ga0081455_101485852 | 131 |
| 460 | 3300005937 | Ga0081455_10162975 | Ga0081455_101629752 | 131 |
| 461 | 3300005981 | Ga0081538_10022318 | Ga0081538_100223182 | 131 |
| 462 | 3300005985 | Ga0081539_10000041 | Ga0081539_10000041225 | 131 |
| 463 | 3300006028 | Ga0070717_10050974 | Ga0070717_100509742 | 131 |
| 464 | 3300006028 | Ga0070717_12051928 | Ga0070717_120519281 | 131 |
| 465 | 3300006048 | Ga0075363_100839151 | Ga0075363_1008391512 | 131 |
| 466 | 3300006058 | Ga0075432_10020848 | Ga0075432_100208482 | 131 |
| 467 | 3300006173 | Ga0070716_100111073 | Ga0070716_1001110733 | 131 |
| 468 | 3300006173 | Ga0070716_100169461 | Ga0070716_1001694612 | 131 |
| 469 | 3300006173 | Ga0070716_100971576 | Ga0070716_1009715762 | 131 |
| 470 | 3300006175 | Ga0070712_100015956 | Ga0070712_1000159563 | 131 |
| 471 | 3300006175 | Ga0070712_100062040 | Ga0070712_1000620403 | 131 |
| 472 | 3300006175 | Ga0070712_100978973 | Ga0070712_1009789731 | 131 |
| 473 | 3300006178 | Ga0075367_10216978 | Ga0075367_102169782 | 131 |
| 474 | 3300006358 | Ga0068871_101061968 | Ga0068871_1010619682 | 131 |
| 475 | 3300006844 | Ga0075428_100036324 | Ga0075428_1000363243 | 131 |
| 476 | 3300006844 | Ga0075428_100309683 | Ga0075428_1003096832 | 131 |
| 477 | 3300006844 | Ga0075428_100580490 | Ga0075428_1005804902 | 131 |
| 478 | 3300006844 | Ga0075428_102132311 | Ga0075428_1021323111 | 131 |
| 479 | 3300006847 | Ga0075431_100038295 | Ga0075431_1000382954 | 131 |
| 480 | 3300006847 | Ga0075431_100235771 | Ga0075431_1002357712 | 131 |
| 481 | 3300006852 | Ga0075433_10468092 | Ga0075433_104680922 | 131 |
| 482 | 3300006852 | Ga0075433_10987625 | Ga0075433_109876252 | 131 |
| 483 | 3300006871 | Ga0075434_100028518 | Ga0075434_1000285182 | 131 |
| 484 | 3300006871 | Ga0075434_100047775 | Ga0075434_1000477753 | 131 |
| 485 | 3300006871 | Ga0075434_100049169 | Ga0075434_1000491692 | 131 |
| 486 | 3300006880 | Ga0075429_100437594 | Ga0075429_1004375942 | 131 |
| 487 | 3300006881 | Ga0068865_101109617 | Ga0068865_1011096172 | 131 |
| 488 | 3300006914 | Ga0075436_100002183 | Ga0075436_1000021834 | 131 |
| 489 | 3300006914 | Ga0075436_100029390 | Ga0075436_1000293903 | 131 |
| 490 | 3300007076 | Ga0075435_100012599 | Ga0075435_1000125996 | 131 |
| 491 | 3300007076 | Ga0075435_100083256 | Ga0075435_1000832563 | 131 |
| 492 | 3300007076 | Ga0075435_100087463 | Ga0075435_1000874632 | 131 |
| 493 | 3300007076 | Ga0075435_100379651 | Ga0075435_1003796512 | 131 |
| 494 | 3300009093 | Ga0105240_10027311 | Ga0105240_100273117 | 131 |
| 495 | 3300009093 | Ga0105240_10492909 | Ga0105240_104929092 | 131 |
| 496 | 3300009094 | Ga0111539_10011337 | Ga0111539_100113373 | 131 |
| 497 | 3300009094 | Ga0111539_10966657 | Ga0111539_109666572 | 131 |
| 498 | 3300009094 | Ga0111539_11978653 | Ga0111539_119786531 | 131 |
| 499 | 3300009098 | Ga0105245_10211852 | Ga0105245_102118522 | 131 |
| 500 | 3300009098 | Ga0105245_10251480 | Ga0105245_102514802 | 131 |
| 501 | 3300009098 | Ga0105245_10259335 | Ga0105245_102593352 | 131 |
| 502 | 3300009147 | Ga0114129_10012477 | Ga0114129_100124773 | 131 |
| 503 | 3300009147 | Ga0114129_10024257 | Ga0114129_100242576 | 131 |
| 504 | 3300009147 | Ga0114129_10327639 | Ga0114129_103276392 | 131 |
| 505 | 3300009147 | Ga0114129_10919239 | Ga0114129_109192392 | 131 |
| 506 | 3300009147 | Ga0114129_13133112 | Ga0114129_131331122 | 131 |
| 507 | 3300009148 | Ga0105243_10054496 | Ga0105243_100544963 | 131 |
| 508 | 3300009148 | Ga0105243_10374651 | Ga0105243_103746512 | 131 |
| 509 | 3300009148 | Ga0105243_12750862 | Ga0105243_127508622 | 131 |
| 510 | 3300009176 | Ga0105242_10083979 | Ga0105242_100839792 | 131 |
| 511 | 3300009176 | Ga0105242_10134171 | Ga0105242_101341713 | 131 |
| 512 | 3300009176 | Ga0105242_10934870 | Ga0105242_109348702 | 131 |
| 513 | 3300009176 | Ga0105242_11383508 | Ga0105242_113835082 | 131 |
| 514 | 3300009553 | Ga0105249_10624440 | Ga0105249_106244402 | 131 |
| 515 | 3300010375 | Ga0105239_10362957 | Ga0105239_103629572 | 131 |
| 516 | 3300010375 | Ga0105239_13244118 | Ga0105239_132441181 | 131 |
| 517 | 3300013104 | Ga0157370_10093330 | Ga0157370_100933302 | 131 |
| 518 | 3300013104 | Ga0157370_10372328 | Ga0157370_103723282 | 131 |
| 519 | 3300013104 | Ga0157370_10611214 | Ga0157370_106112142 | 131 |
| 520 | 3300013104 | Ga0157370_11539966 | Ga0157370_115399662 | 131 |
| 521 | 3300013105 | Ga0157369_10006794 | Ga0157369_100067942 | 131 |
| 522 | 3300013105 | Ga0157369_10732870 | Ga0157369_107328702 | 131 |
| 523 | 3300013105 | Ga0157369_11690269 | Ga0157369_116902692 | 131 |
| 524 | 3300013296 | Ga0157374_11300703 | Ga0157374_113007032 | 131 |
| 525 | 3300013297 | Ga0157378_10101928 | Ga0157378_101019282 | 131 |
| 526 | 3300013297 | Ga0157378_12248028 | Ga0157378_122480282 | 131 |
| 527 | 3300013307 | Ga0157372_10287435 | Ga0157372_102874352 | 131 |
| 528 | 3300013307 | Ga0157372_10830094 | Ga0157372_108300942 | 131 |
| 529 | 3300013307 | Ga0157372_11319231 | Ga0157372_113192312 | 131 |
| 530 | 3300013307 | Ga0157372_13018400 | Ga0157372_130184002 | 131 |
| 531 | 3300013308 | Ga0157375_10790965 | Ga0157375_107909652 | 131 |
| 532 | 3300013308 | Ga0157375_11036210 | Ga0157375_110362102 | 131 |
| 533 | 3300014497 | Ga0182008_10250564 | Ga0182008_102505642 | 131 |
| 534 | 3300014745 | Ga0157377_10313810 | Ga0157377_103138101 | 131 |
| 535 | 3300014968 | Ga0157379_10256715 | Ga0157379_102567152 | 131 |
| 536 | 3300014969 | Ga0157376_10094137 | Ga0157376_100941373 | 131 |
| 537 | 3300014969 | Ga0157376_11751010 | Ga0157376_117510102 | 131 |
| 538 | 3300015262 | Ga0182007_10280670 | Ga0182007_102806701 | 131 |
| 539 | 3300020069 | Ga0197907_10799915 | Ga0197907_107999152 | 131 |
| 540 | 3300020082 | Ga0206353_11073166 | Ga0206353_110731661 | 131 |
| 541 | 3300022467 | Ga0224712_10422282 | Ga0224712_104222822 | 131 |
| 542 | 3300025898 | Ga0207692_10063853 | Ga0207692_100638532 | 131 |
| 543 | 3300025898 | Ga0207692_10125979 | Ga0207692_101259792 | 131 |
| 544 | 3300025901 | Ga0207688_10091228 | Ga0207688_100912282 | 131 |
| 545 | 3300025905 | Ga0207685_10451309 | Ga0207685_104513092 | 131 |
| 546 | 3300025909 | Ga0207705_10019314 | Ga0207705_100193145 | 131 |
| 547 | 3300025909 | Ga0207705_10045782 | Ga0207705_100457823 | 131 |
| 548 | 3300025910 | Ga0207684_10441074 | Ga0207684_104410742 | 131 |
| 549 | 3300025912 | Ga0207707_10030088 | Ga0207707_100300886 | 131 |
| 550 | 3300025913 | Ga0207695_10138907 | Ga0207695_101389072 | 131 |
| 551 | 3300025913 | Ga0207695_10365656 | Ga0207695_103656562 | 131 |
| 552 | 3300025915 | Ga0207693_10006225 | Ga0207693_100062257 | 131 |
| 553 | 3300025915 | Ga0207693_10023433 | Ga0207693_100234332 | 131 |
| 554 | 3300025916 | Ga0207663_10285045 | Ga0207663_102850452 | 131 |
| 555 | 3300025917 | Ga0207660_10140212 | Ga0207660_101402122 | 131 |
| 556 | 3300025918 | Ga0207662_10352534 | Ga0207662_103525342 | 131 |
| 557 | 3300025919 | Ga0207657_10002271 | Ga0207657_100022712 | 131 |
| 558 | 3300025919 | Ga0207657_10342322 | Ga0207657_103423222 | 131 |
| 559 | 3300025920 | Ga0207649_11234295 | Ga0207649_112342952 | 131 |
| 560 | 3300025921 | Ga0207652_10020012 | Ga0207652_100200125 | 131 |
| 561 | 3300025922 | Ga0207646_10489785 | Ga0207646_104897852 | 131 |
| 562 | 3300025923 | Ga0207681_11778714 | Ga0207681_117787141 | 131 |
| 563 | 3300025927 | Ga0207687_10681934 | Ga0207687_106819342 | 131 |
| 564 | 3300025927 | Ga0207687_10682290 | Ga0207687_106822901 | 131 |
| 565 | 3300025928 | Ga0207700_10296300 | Ga0207700_102963002 | 131 |
| 566 | 3300025928 | Ga0207700_10781608 | Ga0207700_107816082 | 131 |
| 567 | 3300025928 | Ga0207700_11069270 | Ga0207700_110692702 | 131 |
| 568 | 3300025929 | Ga0207664_10339744 | Ga0207664_103397442 | 131 |
| 569 | 3300025929 | Ga0207664_10565140 | Ga0207664_105651402 | 131 |
| 570 | 3300025931 | Ga0207644_10199581 | Ga0207644_101995812 | 131 |
| 571 | 3300025931 | Ga0207644_10326211 | Ga0207644_103262112 | 131 |
| 572 | 3300025932 | Ga0207690_11077391 | Ga0207690_110773911 | 131 |
| 573 | 3300025933 | Ga0207706_10219535 | Ga0207706_102195352 | 131 |
| 574 | 3300025934 | Ga0207686_10312281 | Ga0207686_103122812 | 131 |
| 575 | 3300025934 | Ga0207686_10364590 | Ga0207686_103645902 | 131 |
| 576 | 3300025934 | Ga0207686_10504363 | Ga0207686_105043632 | 131 |
| 577 | 3300025935 | Ga0207709_10110243 | Ga0207709_101102432 | 131 |
| 578 | 3300025935 | Ga0207709_11631939 | Ga0207709_116319392 | 131 |
| 579 | 3300025937 | Ga0207669_11933980 | Ga0207669_119339802 | 131 |
| 580 | 3300025939 | Ga0207665_10007335 | Ga0207665_100073354 | 131 |
| 581 | 3300025939 | Ga0207665_10154222 | Ga0207665_101542222 | 131 |
| 582 | 3300025944 | Ga0207661_10019199 | Ga0207661_100191993 | 131 |
| 583 | 3300025944 | Ga0207661_10229811 | Ga0207661_102298112 | 131 |
| 584 | 3300025944 | Ga0207661_10632168 | Ga0207661_106321682 | 131 |
| 585 | 3300025945 | Ga0207679_10130440 | Ga0207679_101304402 | 131 |
| 586 | 3300025949 | Ga0207667_10062476 | Ga0207667_100624763 | 131 |
| 587 | 3300025949 | Ga0207667_10151667 | Ga0207667_101516672 | 131 |
| 588 | 3300025972 | Ga0207668_10061896 | Ga0207668_100618962 | 131 |
| 589 | 3300025972 | Ga0207668_10106338 | Ga0207668_101063383 | 131 |
| 590 | 3300026023 | Ga0207677_10627762 | Ga0207677_106277622 | 131 |
| 591 | 3300026067 | Ga0207678_10342509 | Ga0207678_103425092 | 131 |
| 592 | 3300026075 | Ga0207708_11121002 | Ga0207708_111210022 | 131 |
| 593 | 3300026078 | Ga0207702_10055906 | Ga0207702_100559062 | 131 |
| 594 | 3300026089 | Ga0207648_10039412 | Ga0207648_100394125 | 131 |
| 595 | 3300026116 | Ga0207674_10103020 | Ga0207674_101030202 | 131 |
| 596 | 3300026116 | Ga0207674_10108055 | Ga0207674_101080552 | 131 |
| 597 | 3300026118 | Ga0207675_100088997 | Ga0207675_1000889973 | 131 |
| 598 | 3300026121 | Ga0207683_11329260 | Ga0207683_113292601 | 131 |
| 599 | 3300026121 | Ga0207683_11684754 | Ga0207683_116847542 | 131 |
| 600 | 3300028381 | Ga0268264_10596134 | Ga0268264_105961342 | 131 |
| 601 | 3300028563 | Ga0265319_1025488 | Ga0265319_10254882 | 131 |
| 602 | 3300028577 | Ga0265318_10052499 | Ga0265318_100524992 | 131 |
| 603 | 3300028577 | Ga0265318_10087716 | Ga0265318_100877162 | 131 |
| 604 | 3300028654 | Ga0265322_10054404 | Ga0265322_100544042 | 131 |
| 605 | 3300028800 | Ga0265338_10007064 | Ga0265338_1000706410 | 131 |
| 606 | 3300028800 | Ga0265338_10382411 | Ga0265338_103824112 | 131 |
| 607 | 3300028800 | Ga0265338_10506487 | Ga0265338_105064872 | 131 |
| 608 | 3300031240 | Ga0265320_10070894 | Ga0265320_100708942 | 131 |
| 609 | 3300031251 | Ga0265327_10017969 | Ga0265327_100179692 | 131 |
| 610 | 3300031251 | Ga0265327_10088501 | Ga0265327_100885012 | 131 |
| 611 | 3300031731 | Ga0307405_10128514 | Ga0307405_101285142 | 131 |
| 612 | 3300031903 | Ga0307407_11274296 | Ga0307407_112742961 | 131 |
| 613 | 3300031911 | Ga0307412_10295070 | Ga0307412_102950702 | 131 |
| 614 | 3300032002 | Ga0307416_100051442 | Ga0307416_1000514422 | 131 |
| 615 | 3300032002 | Ga0307416_101081339 | Ga0307416_1010813392 | 131 |
| 616 | 3300032002 | Ga0307416_101655456 | Ga0307416_1016554562 | 131 |
| 617 | 3300032126 | Ga0307415_100038491 | Ga0307415_1000384913 | 131 |
| 618 | 3300032126 | Ga0307415_100650673 | Ga0307415_1006506732 | 131 |
| 619 | 3300035115 | Ga0373941_0417103 | Ga0373941_0417103_139_537 | 131 |
| 620 | 3300035119 | Ga0373956_0159685 | Ga0373956_0159685_96_491 | 131 |
| 621 | 3300035170 | Ga0373943_0069862 | Ga0373943_0069862_618_1016 | 131 |
| 622 | 3300035170 | Ga0373943_0409292 | Ga0373943_0409292_194_589 | 131 |
| 623 | 3300035172 | Ga0373955_0134969 | Ga0373955_0134969_80_475 | 131 |
| 624 | 3300035691 | Ga0373931_0512209 | Ga0373931_0512209_252_650 | 131 |
| 625 | 3300035724 | Ga0373933_0413786 | Ga0373933_0413786_421_816 | 131 |
| 626 | 3300035725 | Ga0373947_0205433 | Ga0373947_0205433_702_1100 | 131 |
| 627 | 3300036401 | Ga0373937_0709846 | Ga0373937_0709846_408_803 | 131 |
| 628 | 3300036401 | Ga0373937_0940959 | Ga0373937_0940959_106_504 | 131 |
| 629 | 3300037312 | Ga0395899_0001446 | Ga0395899_0001446_5060_5455 | 131 |
| 630 | 3300037312 | Ga0395899_0013404 | Ga0395899_0013404_698_1093 | 131 |
| 631 | 3300037312 | Ga0395899_0019546 | Ga0395899_0019546_4224_4619 | 131 |
| 632 | 3300037312 | Ga0395899_0020632 | Ga0395899_0020632_2768_3163 | 131 |
| 633 | 3300037312 | Ga0395899_0029130 | Ga0395899_0029130_2742_3137 | 131 |
| 634 | 3300037312 | Ga0395899_0084198 | Ga0395899_0084198_873_1268 | 131 |
| 635 | 3300037312 | Ga0395899_0156099 | Ga0395899_0156099_365_760 | 131 |
| 636 | 3300037418 | Ga0395900_0000871 | Ga0395900_0000871_19253_19648 | 131 |
| 637 | 3300037418 | Ga0395900_0001970 | Ga0395900_0001970_22753_23148 | 131 |
| 638 | 3300037418 | Ga0395900_0008763 | Ga0395900_0008763_4178_4573 | 131 |
| 639 | 3300037418 | Ga0395900_0013678 | Ga0395900_0013678_7241_7636 | 131 |
| 640 | 3300037418 | Ga0395900_0024341 | Ga0395900_0024341_3800_4195 | 131 |
| 641 | 3300037418 | Ga0395900_0324415 | Ga0395900_0324415_703_1098 | 131 |
| 642 | 3300037418 | Ga0395900_0364281 | Ga0395900_0364281_747_1142 | 131 |
| 643 | 3300037418 | Ga0395900_0391491 | Ga0395900_0391491_405_800 | 131 |
| 644 | 3300037418 | Ga0395900_0633137 | Ga0395900_0633137_102_497 | 131 |
| 645 | 3300037466 | Ga0395898_0003281 | Ga0395898_0003281_15244_15639 | 131 |
| 646 | 3300037466 | Ga0395898_0003578 | Ga0395898_0003578_11858_12253 | 131 |
| 647 | 3300037466 | Ga0395898_0011698 | Ga0395898_0011698_7957_8352 | 131 |
| 648 | 3300037466 | Ga0395898_0017911 | Ga0395898_0017911_4333_4728 | 131 |
| 649 | 3300037466 | Ga0395898_0069093 | Ga0395898_0069093_1440_1835 | 131 |
| 650 | 3300037466 | Ga0395898_0069994 | Ga0395898_0069994_2322_2717 | 131 |
| 651 | 3300037466 | Ga0395898_0077875 | Ga0395898_0077875_1624_2019 | 131 |
| 652 | 3300037466 | Ga0395898_0196377 | Ga0395898_0196377_1285_1680 | 131 |
| 653 | 3300037466 | Ga0395898_0482248 | Ga0395898_0482248_396_791 | 131 |
| 654 | 3300037466 | Ga0395898_0499507 | Ga0395898_0499507_363_758 | 131 |
| 655 | 3300037466 | Ga0395898_0590056 | Ga0395898_0590056_174_614 | 131 |
| 656 | 3300037466 | Ga0395898_0774995 | Ga0395898_0774995_446_841 | 131 |
| 657 | 3300037471 | Ga0395905_0001130 | Ga0395905_0001130_9185_9580 | 131 |
| 658 | 3300037471 | Ga0395905_0002425 | Ga0395905_0002425_501_896 | 131 |
| 659 | 3300037471 | Ga0395905_0006790 | Ga0395905_0006790_102_497 | 131 |
| 660 | 3300037471 | Ga0395905_0034713 | Ga0395905_0034713_1523_1918 | 131 |
| 661 | 3300037471 | Ga0395905_0085832 | Ga0395905_0085832_939_1334 | 131 |
| 662 | 3300037471 | Ga0395905_0178137 | Ga0395905_0178137_17_412 | 131 |
| 663 | 3300038443 | Ga0395901_0004009 | Ga0395901_0004009_12770_13165 | 131 |
| 664 | 3300038443 | Ga0395901_0005447 | Ga0395901_0005447_11729_12124 | 131 |
| 665 | 3300038443 | Ga0395901_0006956 | Ga0395901_0006956_5566_5961 | 131 |
| 666 | 3300038443 | Ga0395901_0007511 | Ga0395901_0007511_3175_3570 | 131 |
| 667 | 3300038443 | Ga0395901_0038828 | Ga0395901_0038828_918_1313 | 131 |
| 668 | 3300038443 | Ga0395901_0118265 | Ga0395901_0118265_1869_2264 | 131 |
| 669 | 3300038443 | Ga0395901_0127957 | Ga0395901_0127957_253_648 | 131 |
| 670 | 3300038443 | Ga0395901_0434513 | Ga0395901_0434513_933_1328 | 131 |
| 671 | 3300038443 | Ga0395901_0516672 | Ga0395901_0516672_43_438 | 131 |
| 672 | 3300038443 | Ga0395901_0706815 | Ga0395901_0706815_214_609 | 131 |
| 673 | 3300038443 | Ga0395901_1356169 | Ga0395901_1356169_148_543 | 131 |
| 674 | 3300038443 | Ga0395901_1934535 | Ga0395901_1934535_72_467 | 131 |
| 675 | 3300038698 | Ga0242419_009978 | Ga0242419_009978_78_473 | 131 |
| 676 | 3300038699 | Ga0242422_03412 | Ga0242422_03412_491_886 | 131 |
| 677 | 3300039450 | Ga0436363_0452021 | Ga0436363_0452021_60_455 | 131 |
| 678 | 3300041492 | Ga0451835_0186085 | Ga0451835_0186085_14_409 | 131 |
| 679 | 3300041496 | Ga0451839_1214626 | Ga0451839_1214626_51_449 | 131 |
| 680 | 3300041512 | Ga0451853_2305819 | Ga0451853_2305819_371_766 | 131 |
| 681 | 3300044656 | Ga0466969_0337257 | Ga0466969_0337257_46_441 | 131 |
| 682 | 3300044673 | Ga0453683_0557697 | Ga0453683_0557697_295_690 | 131 |
| 683 | 3300044683 | Ga0466965_0428286 | Ga0466965_0428286_219_614 | 131 |
| 684 | 3300044684 | Ga0466966_0131090 | Ga0466966_0131090_335_730 | 131 |
| 685 | 3300044693 | Ga0466961_0330984 | Ga0466961_0330984_406_801 | 131 |
| 686 | 3300044694 | Ga0466963_0009698 | Ga0466963_0009698_1848_2243 | 131 |
| 687 | 3300044694 | Ga0466963_0288214 | Ga0466963_0288214_383_778 | 131 |
| 688 | 3300044735 | Ga0466968_0600552 | Ga0466968_0600552_133_531 | 131 |
| 689 | 3300045049 | Ga0466959_0640218 | Ga0466959_0640218_262_657 | 131 |
| 690 | 3300045976 | Ga0466967_0046714 | Ga0466967_0046714_1235_1630 | 131 |
| 691 | 3300045976 | Ga0466967_0046844 | Ga0466967_0046844_969_1364 | 131 |
| 692 | 3300045976 | Ga0466967_0409917 | Ga0466967_0409917_321_716 | 131 |
| 693 | 3300045976 | Ga0466967_1112655 | Ga0466967_1112655_380_775 | 131 |
| 694 | 3300045976 | Ga0466967_2277628 | Ga0466967_2277628_124_519 | 131 |
| 695 | 3300046454 | Ga0495592_0291818 | Ga0495592_0291818_76_471 | 131 |
| 696 | 3300046455 | Ga0495603_0768697 | Ga0495603_0768697_108_503 | 131 |
| 697 | 3300046459 | Ga0495629_0011270 | Ga0495629_0011270_4036_4434 | 131 |
| 698 | 3300046459 | Ga0495629_0222495 | Ga0495629_0222495_501_896 | 131 |
| 699 | 3300046461 | Ga0495641_0019594 | Ga0495641_0019594_2195_2590 | 131 |
| 700 | 3300046461 | Ga0495641_0063366 | Ga0495641_0063366_588_983 | 131 |
| 701 | 3300046461 | Ga0495641_0120231 | Ga0495641_0120231_127_525 | 131 |
| 702 | 3300046461 | Ga0495641_0320446 | Ga0495641_0320446_110_508 | 131 |
| 703 | 3300046462 | Ga0495651_0170718 | Ga0495651_0170718_437_835 | 131 |
| 704 | 3300046463 | Ga0495653_0115903 | Ga0495653_0115903_534_932 | 131 |
| 705 | 3300046463 | Ga0495653_0181433 | Ga0495653_0181433_418_813 | 131 |
| 706 | 3300046473 | Ga0495582_0106181 | Ga0495582_0106181_94_489 | 131 |
| 707 | 3300046473 | Ga0495582_0151341 | Ga0495582_0151341_137_535 | 131 |
| 708 | 3300046476 | Ga0495662_0572808 | Ga0495662_0572808_138_536 | 131 |
| 709 | 3300046491 | Ga0495584_0123605 | Ga0495584_0123605_315_710 | 131 |
| 710 | 3300046511 | Ga0495608_0012356 | Ga0495608_0012356_4780_5175 | 131 |
| 711 | 3300046517 | Ga0495630_0297650 | Ga0495630_0297650_469_867 | 131 |
| 712 | 3300046526 | Ga0495666_0223944 | Ga0495666_0223944_214_612 | 131 |
| 713 | 3300046531 | Ga0495665_0360023 | Ga0495665_0360023_294_689 | 131 |
| 714 | 3300046531 | Ga0495665_0395869 | Ga0495665_0395869_90_488 | 131 |
| 715 | 3300046536 | Ga0495587_0115628 | Ga0495587_0115628_443_841 | 131 |
| 716 | 3300046538 | Ga0495609_0215392 | Ga0495609_0215392_353_748 | 131 |
| 717 | 3300046543 | Ga0495645_0489058 | Ga0495645_0489058_30_428 | 131 |
| 718 | 3300046559 | Ga0495667_0228023 | Ga0495667_0228023_42_440 | 131 |
| 719 | 3300046616 | Ga0495668_0843772 | Ga0495668_0843772_21_416 | 131 |
| 720 | 3300046642 | Ga0495634_0059917 | Ga0495634_0059917_743_1141 | 131 |
| 721 | 3300046665 | Ga0495661_0506470 | Ga0495661_0506470_115_516 | 131 |
| 722 | 3300046675 | Ga0495657_0141611 | Ga0495657_0141611_70_465 | 131 |
| 723 | 3300046683 | Ga0495658_0023753 | Ga0495658_0023753_395_790 | 131 |
| 724 | 3300046683 | Ga0495658_0656960 | Ga0495658_0656960_69_464 | 131 |
| 725 | 3300046689 | Ga0495613_0028490 | Ga0495613_0028490_3471_3869 | 131 |
| 726 | 3300046689 | Ga0495613_0142879 | Ga0495613_0142879_965_1360 | 131 |
| 727 | 3300046690 | Ga0495624_0596970 | Ga0495624_0596970_48_443 | 131 |
| 728 | 3300046809 | Ga0495600_0344849 | Ga0495600_0344849_114_509 | 131 |
| 729 | 3300046809 | Ga0495600_0957011 | Ga0495600_0957011_57_452 | 131 |
| 730 | 3300047315 | Ga0495581_0009359 | Ga0495581_0009359_1187_1582 | 131 |
| 731 | 3300047315 | Ga0495581_0213008 | Ga0495581_0213008_379_774 | 131 |
| 732 | 3300047317 | Ga0495604_0148497 | Ga0495604_0148497_331_726 | 131 |
| 733 | 3300047321 | Ga0495676_0026584 | Ga0495676_0026584_3445_3843 | 131 |
| 734 | 3300047321 | Ga0495676_0027069 | Ga0495676_0027069_2818_3213 | 131 |
| 735 | 3300047322 | Ga0495680_0004651 | Ga0495680_0004651_604_999 | 131 |
| 736 | 3300047471 | Ga0495684_0233497 | Ga0495684_0233497_26_421 | 131 |
| 737 | 3300047471 | Ga0495684_0834263 | Ga0495684_0834263_165_563 | 131 |
| 738 | 3300047673 | Ga0495593_0099580 | Ga0495593_0099580_650_1048 | 131 |
| 739 | 3300048903 | Ga0496100_0002141 | Ga0496100_0002141_1347_1742 | 131 |
| 740 | 3300048903 | Ga0496100_0048104 | Ga0496100_0048104_344_739 | 131 |
| 741 | 3300048903 | Ga0496100_0081240 | Ga0496100_0081240_705_1100 | 131 |
| 742 | 3300048903 | Ga0496100_0791936 | Ga0496100_0791936_262_660 | 131 |
| 743 | 3300048904 | Ga0496101_0074736 | Ga0496101_0074736_1135_1530 | 131 |
| 744 | 3300048904 | Ga0496101_0133624 | Ga0496101_0133624_1104_1502 | 131 |
| 745 | 3300048904 | Ga0496101_0158421 | Ga0496101_0158421_1121_1516 | 131 |
| 746 | 3300048904 | Ga0496101_0178505 | Ga0496101_0178505_592_987 | 131 |
| 747 | 3300048904 | Ga0496101_0326361 | Ga0496101_0326361_380_775 | 131 |
| 748 | 3300048904 | Ga0496101_0764501 | Ga0496101_0764501_318_716 | 131 |
| 749 | 3300048905 | Ga0496102_0023826 | Ga0496102_0023826_3838_4233 | 131 |
| 750 | 3300048905 | Ga0496102_0081453 | Ga0496102_0081453_725_1120 | 131 |
| 751 | 3300048905 | Ga0496102_0172819 | Ga0496102_0172819_334_729 | 131 |
| 752 | 3300048905 | Ga0496102_0225713 | Ga0496102_0225713_81_479 | 131 |
| 753 | 3300048905 | Ga0496102_0610899 | Ga0496102_0610899_230_625 | 131 |
| 754 | 3300048905 | Ga0496102_1549033 | Ga0496102_1549033_155_553 | 131 |
| 755 | 3300048906 | Ga0496103_0009328 | Ga0496103_0009328_4289_4684 | 131 |
| 756 | 3300048906 | Ga0496103_0081294 | Ga0496103_0081294_1237_1632 | 131 |
| 757 | 3300048906 | Ga0496103_0103250 | Ga0496103_0103250_1005_1403 | 131 |
| 758 | 3300048906 | Ga0496103_0147150 | Ga0496103_0147150_940_1335 | 131 |
| 759 | 3300048907 | Ga0496104_0004078 | Ga0496104_0004078_10012_10407 | 131 |
| 760 | 3300048907 | Ga0496104_0063550 | Ga0496104_0063550_169_567 | 131 |
| 761 | 3300048907 | Ga0496104_0477178 | Ga0496104_0477178_246_644 | 131 |
| 762 | 3300048908 | Ga0496105_0019907 | Ga0496105_0019907_1893_2288 | 131 |
| 763 | 3300048908 | Ga0496105_0021402 | Ga0496105_0021402_1020_1418 | 131 |
| 764 | 3300048908 | Ga0496105_0102434 | Ga0496105_0102434_1733_2131 | 131 |
| 765 | 3300048909 | Ga0496106_0001809 | Ga0496106_0001809_5146_5541 | 131 |
| 766 | 3300048909 | Ga0496106_0061267 | Ga0496106_0061267_2236_2631 | 131 |
| 767 | 3300048909 | Ga0496106_0212736 | Ga0496106_0212736_497_892 | 131 |
| 768 | 3300048910 | Ga0496107_0029831 | Ga0496107_0029831_1890_2285 | 131 |
| 769 | 3300048910 | Ga0496107_0053635 | Ga0496107_0053635_2286_2681 | 131 |
| 770 | 3300048910 | Ga0496107_0570107 | Ga0496107_0570107_313_711 | 131 |
| 771 | 3300048911 | Ga0496108_0006700 | Ga0496108_0006700_5577_5975 | 131 |
| 772 | 3300048911 | Ga0496108_0015055 | Ga0496108_0015055_5672_6067 | 131 |
| 773 | 3300048911 | Ga0496108_0098939 | Ga0496108_0098939_1134_1529 | 131 |
| 774 | 3300048911 | Ga0496108_0213516 | Ga0496108_0213516_161_556 | 131 |
| 775 | 3300048911 | Ga0496108_0602890 | Ga0496108_0602890_432_830 | 131 |
| 776 | 3300048911 | Ga0496108_0913356 | Ga0496108_0913356_266_661 | 131 |
| 777 | 3300048912 | Ga0496109_0000992 | Ga0496109_0000992_2183_2581 | 131 |
| 778 | 3300048912 | Ga0496109_0017313 | Ga0496109_0017313_4021_4416 | 131 |
| 779 | 3300048912 | Ga0496109_0236587 | Ga0496109_0236587_519_917 | 131 |
| 780 | 3300048912 | Ga0496109_0255488 | Ga0496109_0255488_101_496 | 131 |
| 781 | 3300048912 | Ga0496109_0834842 | Ga0496109_0834842_107_505 | 131 |
| 782 | 3300048913 | Ga0496110_0004437 | Ga0496110_0004437_3149_3547 | 131 |
| 783 | 3300048913 | Ga0496110_0030272 | Ga0496110_0030272_3747_4142 | 131 |
| 784 | 3300048913 | Ga0496110_0163250 | Ga0496110_0163250_1301_1696 | 131 |
| 785 | 3300048913 | Ga0496110_0601741 | Ga0496110_0601741_230_625 | 131 |
| 786 | 3300048913 | Ga0496110_0883451 | Ga0496110_0883451_208_603 | 131 |
| 787 | 3300048914 | Ga0496111_0000598 | Ga0496111_0000598_11295_11693 | 131 |
| 788 | 3300048914 | Ga0496111_0019783 | Ga0496111_0019783_4069_4467 | 131 |
| 789 | 3300048914 | Ga0496111_0058238 | Ga0496111_0058238_1760_2155 | 131 |
| 790 | 3300048914 | Ga0496111_0265303 | Ga0496111_0265303_220_615 | 131 |
| 791 | 3300048915 | Ga0496112_0001024 | Ga0496112_0001024_19120_19515 | 131 |
| 792 | 3300048915 | Ga0496112_0185421 | Ga0496112_0185421_1538_1936 | 131 |
| 793 | 3300048915 | Ga0496112_0488967 | Ga0496112_0488967_240_635 | 131 |
| 794 | 3300048915 | Ga0496112_0818207 | Ga0496112_0818207_92_490 | 131 |
| 795 | 3300048916 | Ga0496113_0207636 | Ga0496113_0207636_76_474 | 131 |
| 796 | 3300048916 | Ga0496113_0418151 | Ga0496113_0418151_162_557 | 131 |
| 797 | 3300048917 | Ga0496114_0019534 | Ga0496114_0019534_2163_2558 | 131 |
| 798 | 3300048917 | Ga0496114_0094560 | Ga0496114_0094560_616_1014 | 131 |
| 799 | 3300048917 | Ga0496114_0147736 | Ga0496114_0147736_1045_1440 | 131 |
| 800 | 3300048917 | Ga0496114_0429351 | Ga0496114_0429351_50_445 | 131 |
| 801 | 3300048918 | Ga0496115_0005415 | Ga0496115_0005415_4867_5262 | 131 |
| 802 | 3300049568 | Ga0501031_0002836 | Ga0501031_0002836_8532_8927 | 131 |
| 803 | 3300049568 | Ga0501031_0215861 | Ga0501031_0215861_583_978 | 131 |
| 804 | 3300049569 | Ga0501032_0023044 | Ga0501032_0023044_3639_4034 | 131 |
| 805 | 3300049572 | Ga0501036_0006773 | Ga0501036_0006773_1159_1554 | 131 |
| 806 | 3300049572 | Ga0501036_0073602 | Ga0501036_0073602_1278_1673 | 131 |
| 807 | 3300049572 | Ga0501036_0992622 | Ga0501036_0992622_242_637 | 131 |
| 808 | 3300049572 | Ga0501036_1314319 | Ga0501036_1314319_25_420 | 131 |
| 809 | 3300049573 | Ga0501037_0103140 | Ga0501037_0103140_853_1248 | 131 |
| 810 | 3300049573 | Ga0501037_0228977 | Ga0501037_0228977_655_1050 | 131 |
| 811 | 3300049574 | Ga0501038_0024691 | Ga0501038_0024691_1002_1397 | 131 |
| 812 | 3300049574 | Ga0501038_0129474 | Ga0501038_0129474_1339_1734 | 131 |
| 813 | 3300049575 | Ga0501039_0004746 | Ga0501039_0004746_1087_1482 | 131 |
| 814 | 3300049575 | Ga0501039_0181537 | Ga0501039_0181537_50_445 | 131 |
| 815 | 3300049575 | Ga0501039_0394550 | Ga0501039_0394550_490_885 | 131 |
| 816 | 3300049576 | Ga0501040_0004225 | Ga0501040_0004225_2749_3144 | 131 |
| 817 | 3300049576 | Ga0501040_0052394 | Ga0501040_0052394_1525_1920 | 131 |
| 818 | 3300049577 | Ga0501041_0004653 | Ga0501041_0004653_3504_3899 | 131 |
| 819 | 3300049577 | Ga0501041_0089853 | Ga0501041_0089853_203_598 | 131 |
| 820 | 3300049578 | Ga0501042_0008074 | Ga0501042_0008074_6226_6621 | 131 |
| 821 | 3300049578 | Ga0501042_0009416 | Ga0501042_0009416_315_710 | 131 |
| 822 | 3300049578 | Ga0501042_0090944 | Ga0501042_0090944_220_615 | 131 |
| 823 | 3300049579 | Ga0501043_0049092 | Ga0501043_0049092_1301_1696 | 131 |
| 824 | 3300049580 | Ga0501046_0001448 | Ga0501046_0001448_7595_7990 | 131 |
| 825 | 3300049580 | Ga0501046_0132061 | Ga0501046_0132061_221_616 | 131 |
| 826 | 3300049580 | Ga0501046_0328974 | Ga0501046_0328974_637_1032 | 131 |
| 827 | 3300049580 | Ga0501046_0708062 | Ga0501046_0708062_81_476 | 131 |
| 828 | 3300049582 | Ga0501048_0003992 | Ga0501048_0003992_4943_5338 | 131 |
| 829 | 3300049582 | Ga0501048_0119455 | Ga0501048_0119455_1275_1670 | 131 |
| 830 | 3300049583 | Ga0501067_0224914 | Ga0501067_0224914_16_411 | 131 |
| 831 | 3300049584 | Ga0501068_0600260 | Ga0501068_0600260_261_656 | 131 |
| 832 | 3300049585 | Ga0501069_0059219 | Ga0501069_0059219_458_853 | 131 |
| 833 | 3300049585 | Ga0501069_0075565 | Ga0501069_0075565_684_1079 | 131 |
| 834 | 3300049585 | Ga0501069_0257508 | Ga0501069_0257508_85_480 | 131 |
| 835 | 3300049586 | Ga0501070_0273348 | Ga0501070_0273348_573_968 | 131 |
| 836 | 3300049586 | Ga0501070_0315070 | Ga0501070_0315070_701_1096 | 131 |
| 837 | 3300049586 | Ga0501070_0697168 | Ga0501070_0697168_75_470 | 131 |
| 838 | 3300049587 | Ga0501071_0026636 | Ga0501071_0026636_3617_4012 | 131 |
| 839 | 3300049587 | Ga0501071_1115318 | Ga0501071_1115318_136_531 | 131 |
| 840 | 3300049588 | Ga0501072_0011874 | Ga0501072_0011874_306_701 | 131 |
| 841 | 3300049588 | Ga0501072_0026024 | Ga0501072_0026024_2877_3272 | 131 |
| 842 | 3300049588 | Ga0501072_0034638 | Ga0501072_0034638_1606_2001 | 131 |
| 843 | 3300049589 | Ga0501073_0006969 | Ga0501073_0006969_809_1204 | 131 |
| 844 | 3300049589 | Ga0501073_0020460 | Ga0501073_0020460_4318_4713 | 131 |
| 845 | 3300049590 | Ga0501074_0035342 | Ga0501074_0035342_2179_2574 | 131 |
| 846 | 3300049590 | Ga0501074_0063116 | Ga0501074_0063116_1904_2299 | 131 |
| 847 | 3300049591 | Ga0501075_0006432 | Ga0501075_0006432_5736_6131 | 131 |
| 848 | 3300049591 | Ga0501075_0027647 | Ga0501075_0027647_1507_1902 | 131 |
| 849 | 3300049591 | Ga0501075_0260221 | Ga0501075_0260221_261_656 | 131 |
| 850 | 3300049591 | Ga0501075_0787888 | Ga0501075_0787888_25_420 | 131 |
| 851 | 3300049592 | Ga0501076_0008714 | Ga0501076_0008714_2262_2657 | 131 |
| 852 | 3300049592 | Ga0501076_0124959 | Ga0501076_0124959_1448_1843 | 131 |
| 853 | 3300049592 | Ga0501076_0674294 | Ga0501076_0674294_59_454 | 131 |
| 854 | 3300049593 | Ga0501077_0010250 | Ga0501077_0010250_4865_5260 | 131 |
| 855 | 3300049593 | Ga0501077_0989404 | Ga0501077_0989404_63_458 | 131 |
| 856 | 3300049741 | Ga0501079_0010771 | Ga0501079_0010771_4007_4402 | 131 |
| 857 | 3300049741 | Ga0501079_1569962 | Ga0501079_1569962_113_508 | 131 |
| 858 | 3300049742 | Ga0501080_0007957 | Ga0501080_0007957_4013_4408 | 131 |
| 859 | 3300049742 | Ga0501080_0209697 | Ga0501080_0209697_1131_1526 | 131 |
| 860 | 3300049743 | Ga0501081_0011195 | Ga0501081_0011195_3081_3476 | 131 |
| 861 | 3300049743 | Ga0501081_0036002 | Ga0501081_0036002_1299_1694 | 131 |
| 862 | 3300049743 | Ga0501081_0047344 | Ga0501081_0047344_1141_1536 | 131 |
| 863 | 3300049744 | Ga0501083_0033307 | Ga0501083_0033307_1129_1524 | 131 |
| 864 | 3300049822 | Ga0501035_0008623 | Ga0501035_0008623_6574_6969 | 131 |
| 865 | 3300049822 | Ga0501035_0014191 | Ga0501035_0014191_5079_5474 | 131 |
| 866 | 3300049822 | Ga0501035_0458567 | Ga0501035_0458567_141_536 | 131 |
| 867 | 3300049823 | Ga0501044_0078509 | Ga0501044_0078509_2518_2913 | 131 |
| 868 | 3300049823 | Ga0501044_0162808 | Ga0501044_0162808_804_1199 | 131 |
| 869 | 3300049824 | Ga0501045_0005742 | Ga0501045_0005742_2366_2761 | 131 |
| 870 | 3300049824 | Ga0501045_0033361 | Ga0501045_0033361_2078_2473 | 131 |
| 871 | 3300050492 | nmdc:mga0yw44_996418_c1 | nmdc:mga0yw44_996418_c1_19_417 | 131 |
| 872 | 3300050494 | nmdc:mga06z11_187276_c1 | nmdc:mga06z11_187276_c1_585_980 | 131 |
| 873 | 3300050507 | nmdc:mga05p37_205574_c1 | nmdc:mga05p37_205574_c1_1451_1846 | 131 |
| 874 | 3300050507 | nmdc:mga05p37_59740_c1 | nmdc:mga05p37_59740_c1_936_1331 | 131 |
| 875 | 3300050507 | nmdc:mga05p37_718187_c1 | nmdc:mga05p37_718187_c1_220_615 | 131 |
| 876 | 3300050510 | nmdc:mga06r32_289020_c1 | nmdc:mga06r32_289020_c1_1106_1501 | 131 |
| 877 | 3300050512 | nmdc:mga0n895_11302_c1 | nmdc:mga0n895_11302_c1_782_1177 | 131 |
| 878 | 3300050512 | nmdc:mga0n895_1512414_c1 | nmdc:mga0n895_1512414_c1_90_485 | 131 |
| 879 | 3300050512 | nmdc:mga0n895_77600_c1 | nmdc:mga0n895_77600_c1_2513_2908 | 131 |
| 880 | 3300050512 | nmdc:mga0n895_91185_c1 | nmdc:mga0n895_91185_c1_1059_1454 | 131 |
| 881 | 3300050513 | nmdc:mga0rr50_101254_c1 | nmdc:mga0rr50_101254_c1_305_700 | 131 |
| 882 | 3300050513 | nmdc:mga0rr50_328964_c1 | nmdc:mga0rr50_328964_c1_665_1060 | 131 |
| 883 | 3300050513 | nmdc:mga0rr50_4672_c1 | nmdc:mga0rr50_4672_c1_2513_2908 | 131 |
| 884 | 3300050514 | nmdc:mga08x19_59131_c1 | nmdc:mga08x19_59131_c1_1059_1454 | 131 |
| 885 | 3300050515 | nmdc:mga0a205_22729_c1 | nmdc:mga0a205_22729_c1_1758_2153 | 131 |
| 886 | 3300050515 | nmdc:mga0a205_39954_c1 | nmdc:mga0a205_39954_c1_2963_3358 | 131 |
| 887 | 3300050515 | nmdc:mga0a205_758204_c1 | nmdc:mga0a205_758204_c1_33_428 | 131 |
| 888 | 3300053077 | Ga0495601_0101811 | Ga0495601_0101811_334_732 | 131 |
| 889 | 3300053077 | Ga0495601_0175373 | Ga0495601_0175373_192_590 | 131 |
| 890 | 3300053078 | Ga0495612_0055292 | Ga0495612_0055292_829_1227 | 131 |
| 891 | 3300053084 | Ga0495595_0023650 | Ga0495595_0023650_1415_1813 | 131 |
| 892 | 3300053085 | Ga0495619_0019321 | Ga0495619_0019321_2499_2897 | 131 |
| 893 | 3300053085 | Ga0495619_0063338 | Ga0495619_0063338_1556_1954 | 131 |
| 894 | 3300053085 | Ga0495619_0075685 | Ga0495619_0075685_1759_2154 | 131 |
| 895 | 3300054114 | Ga0501084_0013416 | Ga0501084_0013416_5952_6347 | 131 |
| 896 | 3300054114 | Ga0501084_0072442 | Ga0501084_0072442_229_624 | 131 |
| 897 | 3300054114 | Ga0501084_0219343 | Ga0501084_0219343_871_1266 | 131 |
| 898 | 3300059493 | Ga0587077_196937 | Ga0587077_196937_141_539 | 131 |
| 899 | 3300061719 | Ga0466962_0367385 | Ga0466962_0367385_239_634 | 131 |
| 900 | 3300061734 | Ga0530510_0018249 | Ga0530510_0018249_3172_3567 | 131 |
| 901 | 3300061734 | Ga0530510_0171003 | Ga0530510_0171003_1156_1551 | 131 |
| 902 | 3300061734 | Ga0530510_0605013 | Ga0530510_0605013_380_775 | 131 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1htp-assembly1.cif.gz_A | refined structures at 2 angstroms and 2.2 angstroms of the two forms of the h-protein, a lipoamide-containing protein of the glycine decarboxylase complex | 0.9913 | 6 | 130 |
| 3wdn-assembly1.cif.gz_A | high-resolution x-ray crystal structure of bovine h-protein using a high-pressure cryocooling method | 0.98 | 11 | 130 |
| 1onl-assembly3.cif.gz_C | crystal structure of thermus thermophilus hb8 h-protein of the glycine cleavage system | 0.9712 | 6 | 130 |
| 3a7a-assembly1.cif.gz_B | crystal structure of e. coli lipoate-protein ligase a in complex with octyl-amp and apoh-protein | 0.9681 | 6 | 131 |
| 3a7a-assembly2.cif.gz_D | crystal structure of e. coli lipoate-protein ligase a in complex with octyl-amp and apoh-protein | 0.9621 | 6 | 131 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q20634_6_139_2.40.50.100 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain | 0.9851 | 10 | 127 | 2.40.50.100 |
| 3wdnA00 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain | 0.9791 | 11 | 130 | 2.40.50.100 |
| af_K7TZ76_31_128_2.40.50.100 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain | 0.9654 | 41 | 131 | 2.40.50.100 |
| af_A4IC11_1_107_2.40.50.100 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain | 0.9599 | 25 | 128 | 2.40.50.100 |
| 3a8jE00 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain | 0.9512 | 8 | 129 | 2.40.50.100 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A534S1C2-F1-model_v4 | Glycine cleavage system H protein | 0.9998 | 12 | 131 |
GO:0005829
GO:0005960 GO:0019464 |
| AF-A0A538FZ14-F1-model_v4 | Glycine cleavage system H protein | 0.9967 | 1 | 131 |
GO:0005829
GO:0005960 GO:0019464 |
| AF-A0A7W0RC94-F1-model_v4 | Glycine cleavage system H protein | 0.9964 | 3 | 128 |
GO:0005829
GO:0005960 GO:0019464 |
| AF-A0A532DA06-F1-model_v4 | Glycine cleavage system H protein | 0.9955 | 6 | 131 |
GO:0005829
GO:0005960 GO:0019464 |
| AF-A0A2K3NJQ1-F1-model_v4 | Glycine cleavage system H protein | 0.9952 | 9 | 130 |
GO:0005739
GO:0005960 GO:0019464 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar