F485244

General Info

Members Datasets Scaffolds Average Seq Length
903 427 1805 370

Family's Representative Sequence

Representative Sequence 3300028794|Ga0307515_10009315|Ga0307515_1000931512
Length 406
Sequence MVSTPTYDHTMWETLIFRWSSFRKSFIMISMAYDLTKISMTALMEPAFQAGIELARLDERVARSRVGQGWIERSHFTDACASLWIDGELVHLEDLVLHDATKDIRTPTHELTIARDVLRTRRRIAAQLPGWALSSDGLRSLRKTAEITTADTEEAQTIGAIRRAVTIDPEGEGDDADDVENLPGVDYAAIDAVLARSEAAIENATRPGRASAADRDALVYDLDWDEDARLEEWRGALRQAEKLPAVLQAIVALDAWNELSVLQHAPWLGRLLAASILRQAGVTSGAHLGAVNLGLKTIPVDRRRHRDRETRLLAIAHGLSAAAELGLKEHDRLALARSMFERKLDGRRTSSKLPELVDLVMAKPLVSAGMVAKTLEVTPQAARRIVLELGLREMTGRGRFRAWGIG

Samples

Sample ID Description Type Environment
1 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
2 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
3 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
4 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
5 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
6 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
7 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
8 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
9 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
10 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
11 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
12 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
13 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
14 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
15 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
16 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
17 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
18 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
19 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
20 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
21 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
22 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
23 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
24 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
25 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
26 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
27 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
28 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
29 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
30 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
31 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
32 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
33 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
34 3300009763 Root nodule microbial communities of legume samples collected from Mexico - Siratro Mexico nodule mix Metagenome Nodule
35 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
36 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
37 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
38 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
39 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
40 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
41 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
42 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
43 3300022739 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules Metagenome Nodule
44 3300022740 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules Metagenome Nodule
45 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
46 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
47 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
48 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
49 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
50 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
51 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
52 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
53 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
54 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
55 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
56 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
57 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
58 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
59 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
60 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
61 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
62 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
63 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
66 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
67 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
68 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
70 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
71 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
72 3300031967 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules Metagenome Nodule
73 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
74 3300033430 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules Metagenome Nodule
75 3300033464 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules Metagenome Nodule
76 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
77 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
78 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
79 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
80 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
81 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
82 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
83 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
84 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
85 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
86 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
87 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
88 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
89 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
90 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
91 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
92 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
93 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
94 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
95 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
96 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
97 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
98 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
99 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
100 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
101 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
102 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
103 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
104 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
105 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
106 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
107 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
108 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
109 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
110 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
111 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
112 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
113 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
114 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
115 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
116 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
117 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
118 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
119 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
120 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
121 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
122 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
123 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
124 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
125 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
126 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
127 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
128 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
129 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
130 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
131 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
132 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
133 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
134 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
135 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
136 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
137 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
138 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
139 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
140 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
141 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
142 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
143 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
144 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
145 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
146 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
147 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
148 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
149 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
150 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
151 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
152 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
153 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
154 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
155 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
156 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
157 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
158 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
159 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
160 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
161 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
162 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
163 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
164 3300053141 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere Metagenome Endosphere
165 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
166 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
167 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
168 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
169 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
170 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
171 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
172 2509276019 Ensifer aridi TW10 Isolate Nodule
173 2509276021 Rhizobium leguminosarum bv. trifolii WSM597 Isolate Nodule
174 2509276033 Rhizobium leguminosarum bv. trifolii WSM2012 Isolate Nodule
175 2510065019 Rhizobium leguminosarum bv. trifolii WSM1689 Isolate Nodule
176 2510461069 Rhizobium sp. PDO1-076 Isolate Rhizosphere
177 2511231052 Sinorhizobium meliloti AK58 Isolate Nodule
178 2512047086 Sinorhizobium arboris LMG 14919 Isolate Nodule
179 2512875026 Sinorhizobium medicae WSM1115 Isolate Nodule
180 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
181 2513237086 Sinorhizobium meliloti MVII-I Isolate Nodule
182 2513237089 Sinorhizobium medicae DI28 Isolate Nodule
183 2513237091 Sinorhizobium meliloti RRI128 Isolate Nodule
184 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
185 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
186 2513237138 Rhizobium favelukesii OR191 Isolate Nodule
187 2513237140 Sinorhizobium meliloti GVPV12 Isolate Nodule
188 2513237143 Sinorhizobium meliloti Mlalz-1 Isolate Nodule
189 2513237146 Rhizobium mongolense USDA 1844 (Illumina) Isolate Nodule
190 2513237159 Rhizobium giardinii bv. giardinii H152 Isolate Nodule
191 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
192 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
193 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
194 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
195 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
196 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
197 2524023209 Rhizobium leucaenae USDA 9039 Isolate Nodule
198 2529292951 Rhizobium sp. CCGE 510 Isolate Nodule
199 2551306087 Sinorhizobium meliloti A0643DD Isolate Nodule
200 2551306089 Sinorhizobium meliloti 1A42 Isolate Nodule
201 2554235003 Agrobacterium tumefaciens WRT31 Isolate Rhizosphere
202 2558860100 Sinorhizobium sp. PC2 Isolate Nodule
203 2558860242 Agrobacterium fabacearum P4 Isolate Rhizosphere
204 2582581283 Rhizobium sp. OK665 Isolate Rhizosphere
205 2582581304 Rhizobium sp. YR519 Isolate Rhizosphere
206 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
207 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
208 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
209 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
210 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
211 2585427594 Rhizobium sp. YR528 Isolate Rhizosphere
212 2585427609 Agrobacterium rhizogenes CF263 Isolate Rhizosphere
213 2585428125 Agrobacterium rhizogenes CF262 Isolate Rhizosphere
214 2599185156 Rhizobium sp. NFR03 Isolate Rhizoplane
215 2599185170 Rhizobium mongolense USDA 1844 (PacBio) Isolate Nodule
216 2599185210 Rhizobium sp. NFACC06-2 Isolate Rhizoplane
217 2599185236 Rhizobium sp. NFR07 Isolate Rhizoplane
218 2599185352 Sinorhizobium sp. NFACC03 Isolate Rhizoplane
219 2600255279 Rhizobium sp. NFIX01 Isolate Rhizoplane
220 2600255308 Rhizobium sp. NFIX02 Isolate Rhizoplane
221 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
222 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
223 2643221558 Rhizobium sp. Root149 Isolate Unclassified
224 2643221568 Rhizobium sp. Root564 Isolate Unclassified
225 2643221582 Rhizobium sp. Root651 Isolate Unclassified
226 2643221599 Rhizobium sp. Root708 Isolate Unclassified
227 2643221607 Rhizobium sp. Root73 Isolate Unclassified
228 2643221634 Rhizobium sp. Root1203 Isolate Unclassified
229 2643221636 Rhizobium sp. Root1204 Isolate Unclassified
230 2643221637 Rhizobium sp. Root1212 Isolate Unclassified
231 2643221643 Rhizobium sp. Root1220 Isolate Unclassified
232 2643221653 Rhizobium sp. Root1240 Isolate Unclassified
233 2643221659 Ensifer sp. Root127 Isolate Unclassified
234 2643221686 Rhizobium sp. Root1334 Isolate Unclassified
235 2643221688 Rhizobium sp. Root482 Isolate Unclassified
236 2643221693 Rhizobium sp. Root491 Isolate Unclassified
237 2643221718 Rhizobium sp. Root268 Isolate Unclassified
238 2643221719 Rhizobium sp. Root274 Isolate Unclassified
239 2690316117 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
240 2718217927 Rhizobium sp. N324 Isolate Nodule
241 2718217997 Rhizobium phaseoli sv. phaseoli R723 Isolate Nodule
242 2718218199 Rhizobium phaseoli sv. phaseoli N261 Isolate Nodule
243 2718218235 Rhizobium phaseoli sv. phaseoli R620 Isolate Nodule
244 2718218269 Rhizobium phaseoli sv. phaseoli N671 Isolate Nodule
245 2721755819 Rhizobium phaseoli sv. phaseoli N771 Isolate Nodule
246 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
247 2738541293 Rhizobium sp. GV031 Isolate Unclassified
248 2738541317 Rhizobium halophytocola DSM 21600 Isolate Unclassified
249 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
250 2751185821 Ensifer shofinae CCBAU 251167 Isolate Unclassified
251 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
252 2775507266 Rhizobium tropici PRF 81 Isolate Nodule
253 2791355091 Sinorhizobium sp. FG01 Isolate Nodule
254 2791355092 Sinorhizobium sp. NG07B Isolate Nodule
255 2791355094 Sinorhizobium sp. BJ1 Isolate Nodule
256 2791355253 Rhizobium rhizosphaerae RD15 Isolate Rhizosphere
257 2791355256 Rhizobium sp. M10 Isolate Nodule
258 2791355260 Rhizobium sp. L9 Isolate Nodule
259 2791355261 Rhizobium sp. J15 Isolate Nodule
260 2791355263 Rhizobium chutanense C5 Isolate Nodule
261 2791355264 Rhizobium sp. S9 Isolate Nodule
262 2791355266 Rhizobium sp. L43 Isolate Nodule
263 2791355267 Rhizobium sp. L18 Isolate Nodule
264 2802429605 Rhizobium sophoriradicis L101 Isolate Nodule
265 2802429633 Rhizobium anhuiense J3 Isolate Nodule
266 2802429634 Rhizobium anhuiense S10 Isolate Nodule
267 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
268 2802429637 Rhizobium anhuiense C15 Isolate Nodule
269 2808606387 Rhizobium sp. SJZ105 Isolate Rhizosphere
270 2818991272 Rhizobium sp. SLBN-4 Isolate Unclassified
271 2818991439 Agrobacterium tumefaciens 1187 Isolate Unclassified
272 2818991461 Neorhizobium alkalisoli 1225 Isolate Unclassified
273 2821123053 Rhizobium cellulosilyticum 1193 Isolate Unclassified
274 2838029111 Rhizobium tropici SEMIA 4079 Isolate Nodule
275 2838035591 Rhizobium mongolense SEMIA 4087 Isolate Nodule
276 2838048938 Rhizobium pisi 27/80 Isolate Nodule
277 2838668709 Rhizobium sophoriradicis SEMIA 403 Isolate Nodule
278 2838680041 Rhizobium leguminosarum SEMIA 415 Isolate Nodule
279 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
280 2838694306 Rhizobium leguminosarum SEMIA 421 Isolate Nodule
281 2838701080 Rhizobium aethiopicum SEMIA 428 Isolate Nodule
282 2838707686 Rhizobium leguminosarum SEMIA 430 Isolate Nodule
283 2838714209 Agrobacterium radiobacter SEMIA 435 Isolate Nodule
284 2838719591 Agrobacterium radiobacter SEMIA 436 Isolate Nodule
285 2838736955 Rhizobium cellulosilyticum SEMIA 448 Isolate Nodule
286 2841840854 Rhizobium cellulosilyticum SEMIA 444 Isolate Nodule
287 2841846520 Agrobacterium radiobacter SEMIA 440 Isolate Nodule
288 2841859092 Agrobacterium radiobacter SEMIA 4026 Isolate Nodule
289 2841864319 Rhizobium leguminosarum SEMIA 4052 Isolate Nodule
290 2842077413 Rhizobium leguminosarum SEMIA 422 Isolate Nodule
291 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
292 2842118031 Rhizobium esperanzae SEMIA 420 Isolate Nodule
293 2842124991 Agrobacterium radiobacter SEMIA 434 Isolate Nodule
294 2842140634 Rhizobium cellulosilyticum SEMIA 452 Isolate Nodule
295 2842146304 Rhizobium sophoriradicis SEMIA 454 Isolate Nodule
296 2842170452 Agrobacterium radiobacter SEMIA 461 Isolate Nodule
297 2842187318 Agrobacterium radiobacter SEMIA 464 Isolate Nodule
298 2842198810 Rhizobium aethiopicum SEMIA 470 Isolate Nodule
299 2842211629 Agrobacterium radiobacter SEMIA 472 Isolate Nodule
300 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
301 2842224351 Agrobacterium radiobacter SEMIA 480 Isolate Nodule
302 2842237096 Rhizobium leguminosarum SEMIA 482 Isolate Nodule
303 2842250916 Rhizobium etli SEMIA 484 Isolate Nodule
304 2842264693 Rhizobium phaseoli SEMIA 487 Isolate Nodule
305 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
306 2842285085 Rhizobium lentis SEMIA 490 Isolate Nodule
307 2842291075 Rhizobium leguminosarum SEMIA 491 Isolate Nodule
308 2842298080 Rhizobium leucaenae SEMIA 492 Isolate Nodule
309 2842370503 Rhizobium leguminosarum SEMIA 4022 Isolate Nodule
310 2842377471 Rhizobium leguminosarum SEMIA 4024 Isolate Nodule
311 2842384541 Rhizobium leguminosarum SEMIA 4025 Isolate Nodule
312 2842395702 Rhizobium ecuadorense SEMIA 4029 Isolate Nodule
313 2842402390 Rhizobium lentis SEMIA 4033 Isolate Nodule
314 2842409023 Rhizobium lentis SEMIA 4034 Isolate Nodule
315 2842415677 Rhizobium lentis SEMIA 4036 Isolate Nodule
316 2842428310 Rhizobium phaseoli SEMIA 4050 Isolate Nodule
317 2842434925 Rhizobium esperanzae SEMIA 4051 Isolate Nodule
318 2842441272 Rhizobium esperanzae SEMIA 4053 Isolate Nodule
319 2842447887 Rhizobium esperanzae SEMIA 4055 Isolate Nodule
320 2842469257 Rhizobium phaseoli SEMIA 4058 Isolate Nodule
321 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
322 2842482326 Rhizobium lusitanum SEMIA 4060 Isolate Nodule
323 2842495871 Rhizobium etli SEMIA 4062 Isolate Nodule
324 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
325 2842509118 Rhizobium paranaense SEMIA 4064 Isolate Nodule
326 2842515876 Agrobacterium radiobacter SEMIA 4072 Isolate Nodule
327 2842521101 Rhizobium giardinii SEMIA 4084 Isolate Nodule
328 2844163670 Ensifer sp. 1H6 Isolate Unclassified
329 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
330 2847417321 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
331 2850079185 Ensifer aridi JNVU TP6 Isolate Unclassified
332 2854896431 Neorhizobium alkalisoli DSM 21826 Isolate Unclassified
333 2854916844 Neorhizobium huautlense DSM 21817 Isolate Unclassified
334 2855872281 Sinorhizobium fredii PCH1 Isolate Nodule
335 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
336 2857531043 Neorhizobium sp. R-72160 Isolate Unclassified
337 2896384573 Ensifer sp. MPMI2T Isolate Unclassified
338 2899845264 Agrobacterium fabacearum CNPSo 675 Isolate Unclassified
339 2913295892 Sinorhizobium kostiensis DSM 13372 Isolate Nodule
340 2913308742 Rhizobium halophytocola DSM 21600 Isolate Unclassified
341 2915980308 Sinorhizobium medicae USDA1149 Isolate Nodule
342 2919114240 Agrobacterium tumefaciens 1457 Isolate Rhizosphere
343 2919166419 Agrobacterium cavarae 2074 Isolate Unclassified
344 2919171160 Neorhizobium sp. 2083 Isolate Unclassified
345 2920760137 Ensifer psoraleae CCBAU 65732 Isolate Unclassified
346 2921289301 Sinorhizobium meliloti USDA1730 Isolate Nodule
347 2923556063 Rhizobium tibeticum 3740 Isolate Unclassified
348 2924165586 Sinorhizobium meliloti USDA1264 Isolate Nodule
349 2924193448 Sinorhizobium meliloti USDA1158 Isolate Nodule
350 2924221636 Sinorhizobium meliloti USDA1416 Isolate Nodule
351 2924228884 Sinorhizobium meliloti USDA1581 Isolate Nodule
352 2926754445 Agrobacterium radiobacter SLBN-94 Isolate Rhizosphere
353 2926760298 Agrobacterium tumefaciens SLBN-170 Isolate Rhizosphere
354 2929138655 Agrobacterium sp. R-72433 Hybrid assembly Isolate Unclassified
355 2933011516 Rhizobium sp. SEMIA 4032 Isolate Unclassified
356 2933016740 Rhizobium sp. SEMIA 4085 Isolate Nodule
357 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
358 2933594066 Agrobacterium fabrum 35/80 Isolate Nodule
359 2935894831 Rhizobium leguminosarum SEMIA 419 Isolate Nodule
360 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
361 2936381700 Rhizobium chutanense C16 Isolate Unclassified
362 2937009748 Sinorhizobium meliloti USDA1162 Isolate Nodule
363 2937029754 Sinorhizobium medicae USDA1624 Isolate Nodule
364 2937036028 Sinorhizobium medicae USDA1608 Isolate Nodule
365 2937084907 Sinorhizobium medicae USDA1664 Isolate Nodule
366 2957422303 Sinorhizobium meliloti USDA1497 Isolate Nodule
367 2957484790 Sinorhizobium meliloti USDA1464 Isolate Nodule
368 2960597568 Sinorhizobium meliloti 3085 Isolate Nodule
369 2960610863 Sinorhizobium meliloti USDA1792 Isolate Nodule
370 2960645483 Sinorhizobium meliloti USDA1703 Isolate Nodule
371 2960680706 Sinorhizobium medicae USDA1150 Isolate Nodule
372 2960693952 Sinorhizobium medicae USDA1630 Isolate Nodule
373 2964698721 Sinorhizobium meliloti USDA1656 Isolate Nodule
374 2967706974 Sinorhizobium meliloti USDA1206 Isolate Nodule
375 2967728569 Sinorhizobium medicae USDA1607 Isolate Nodule
376 2970136068 Sinorhizobium meliloti USDA1699 Isolate Nodule
377 2977530762 Sinorhizobium medicae USDA1606 Isolate Nodule
378 2977544691 Sinorhizobium medicae USDA1631 Isolate Nodule
379 2979089926 Agrobacterium sp. SORGH_AS 745 Isolate Unclassified
380 2979095461 Agrobacterium tumefaciens SORGH_AS 749 Isolate Unclassified
381 2979100975 Agrobacterium pusense SORGH_AS 755 Isolate Unclassified
382 2984509177 Agrobacterium pusense SORGH_AS260 Isolate Aerial Root
383 2984518228 Agrobacterium pusense SORGH_AS285 Isolate Aerial Root
384 2984537506 Agrobacterium sp. SORGH_AS440 Isolate Aerial Root
385 2984587000 Agrobacterium larrymoorei SORGH_AS974 Isolate Aerial Root
386 2984601300 Rhizobium pusense SORGH_AS1083 Isolate Aerial Root
387 2989349275 Shinella kummerowiae CCBAU 25048 Isolate Unclassified
388 2989771324 Rhizobium rhizolycopersici DBTS2 Isolate Rhizosphere
389 2989776772 Rhizobium glycinendophyticum CL12 Isolate Unclassified
390 2996310559 Mesorhizobium zhangyense CGMCC 1.15528 Isolate Unclassified
391 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
392 3005445848 Rhizobium sp. WYJ-E13 Isolate Unclassified
393 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
394 643692032 Sinorhizobium fredii NGR234 Isolate Nodule
395 650716007 Agrobacterium fabacearum H13-3 Isolate Rhizosphere
396 8003570095 Agrobacterium rhizogenes GBBC3284 Isolate Unclassified
397 8003992118 Sinorhizobium meliloti RRI128 Isolate Nodule
398 8003999396 Sinorhizobium medicae WSM1115 Isolate Nodule
399 8005246636 Rhizobium wuzhouense W44 Isolate Rhizosphere
400 8005258706 Rhizobium sp. R693 Isolate Nodule
401 8005275841 Rhizobium sp. N4311 Isolate Nodule
402 8005282627 Rhizobium phaseoli NC1 Isolate Nodule
403 8005289223 Rhizobium bangladeshense 1002 Isolate Nodule
404 8005301065 Rhizobium bangladeshense 1017 Isolate Nodule
405 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
406 8005382845 Rhizobium sp. R634 Isolate Nodule
407 8005395548 Rhizobium sp. R339 Isolate Nodule
408 8005460587 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
409 8005497431 Rhizobium phaseoli CCGM8 Isolate Unclassified
410 8005542996 Rhizobium grahamii CCGM3 Isolate Unclassified
411 8005619151 Rhizobium phaseoli CCGM2 Isolate Unclassified
412 8005668836 Rhizobium phaseoli CCGM9 Isolate Unclassified
413 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified
414 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule
415 8018127388 Rhizobium aegyptiacum 950 Isolate Nodule
416 8018150411 Rhizobium straminoryzae SM12 Isolate Rhizosphere
417 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
418 8018176218 Rhizobium sp. N122 Isolate Nodule
419 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule
420 8024486573 Rhizobium tubonense CCBAU 85046 Isolate Nodule
421 8024501048 Rhizobium sp. H4 Isolate Nodule
422 8054460903 Agrobacterium vaccinii B7.6 Isolate Unclassified
423 8056375014 Rhizobium redzepovicii 18T Isolate Nodule
424 8056382006 Rhizobium croatiense 13T Isolate Nodule
425 8056875544 Rhizobium halophilum TRM95001 Isolate Rhizosphere
426 8057575449 Rhizobium mayense CCGE526 Isolate Nodule
427 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 64.01
Metatranscriptomes 0
Isolates 35.99

Biome Distribution

Category Percentage (%)
Aerial Root 0.66
Bulb 0
Endosphere 26.25
Nodule 28.68
Rhizoplane 1.55
Rhizosphere 15.5
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307515_10009315 3300028794 Bacteria 18999
2 JGI25158J39367_1000002 3300002739 Bacteria 73701
3 JGI25152J39213_1000088 3300002773 Bacteria 64052
4 JGI25152J39213_1000388 3300002773 Bacteria 26802
5 JGI25150J39212_1000058 3300002774 Bacteria 66130
6 JGI25150J39212_1000173 3300002774 Bacteria 36141
7 JGI25150J39212_1000263 3300002774 Bacteria 27939
8 JGI25159J45721_1000036 3300002987 Bacteria 76363
9 JGI25159J45721_1000133 3300002987 Bacteria 35035
10 JGI25159J45721_1000386 3300002987 Bacteria 20455
11 JGI25151J46595_10000053 3300003187 Bacteria 156841
12 JGI25151J46595_10000241 3300003187 Bacteria 64064
13 JGI25151J46595_10001708 3300003187 Bacteria 14340
14 JGI25151J46595_10018085 3300003187 Bacteria 3039
15 JGI25165J46597_1000238 3300003214 Bacteria 75282
16 JGI25153J46596_10000599 3300003215 Bacteria 22041
17 JGI25153J46596_10001077 3300003215 Bacteria 16641
18 JGI25153J46596_10001647 3300003215 Bacteria 13244
19 JGI25153J46596_10002006 3300003215 Bacteria 12021
20 JGI25153J46596_10002081 3300003215 Bacteria 11765
21 JGI25153J46596_10021347 3300003215 Bacteria 2416
22 rootH1_10035514 3300003316 Bacteria 24001
23 rootH1_10035514 3300003323 Bacteria 18338
24 rootH2_10009192 3300003320 Bacteria 23233
25 JGI25160J50197_1000060 3300003354 Bacteria 116870
26 JGI25160J50197_1000300 3300003354 Bacteria 34955
27 JGI25160J50197_1000435 3300003354 Bacteria 26202
28 JGI25160J50197_1005359 3300003354 Bacteria 5353
29 JGI25161J50226_1000026 3300003374 Bacteria 146134
30 JGI25161J50226_1003705 3300003374 Bacteria 3408
31 Ga0055526_1000385 3300003771 Bacteria 35743
32 Ga0055526_1000402 3300003771 Bacteria 35007
33 Ga0055526_1003682 3300003771 Bacteria 9585
34 Ga0055524_1000289 3300003775 Bacteria 48781
35 Ga0055524_1001026 3300003775 Bacteria 17259
36 Ga0055524_1002547 3300003775 Bacteria 9317
37 Ga0055524_1003262 3300003775 Bacteria 7944
38 Ga0055524_1004337 3300003775 Bacteria 6566
39 Ga0055524_1018360 3300003775 Bacteria 2431
40 Ga0055528_1000018 3300003790 Bacteria 155302
41 Ga0055528_1000200 3300003790 Bacteria 50985
42 Ga0055528_1000294 3300003790 Bacteria 42308
43 Ga0055528_1000544 3300003790 Bacteria 28745
44 Ga0055528_1005772 3300003790 Bacteria 5699
45 Ga0055540_1000117 3300003792 Bacteria 83139
46 Ga0055540_1000273 3300003792 Bacteria 46613
47 Ga0055540_1000347 3300003792 Bacteria 39251
48 Ga0055540_1000864 3300003792 Bacteria 20110
49 Ga0055540_1003092 3300003792 Bacteria 8270
50 Ga0055531_10000098 3300003794 Bacteria 95134
51 Ga0055531_10000106 3300003794 Bacteria 91868
52 Ga0055531_10001141 3300003794 Bacteria 20556
53 Ga0055531_10013957 3300003794 Bacteria 3660
54 Ga0058692_1002045 3300003856 Bacteria 6971
55 Ga0055543_1000085 3300004625 Bacteria 81274
56 Ga0055543_1000456 3300004625 Bacteria 24226
57 Ga0055543_1001086 3300004625 Bacteria 11867
58 Ga0065165_1000160 3300005262 Bacteria 116908
59 Ga0065165_1000349 3300005262 Bacteria 75492
60 Ga0065165_1000777 3300005262 Bacteria 42783
61 Ga0065165_1001509 3300005262 Bacteria 24602
62 Ga0065165_1009482 3300005262 Bacteria 4356
63 Ga0065165_1017848 3300005262 Bacteria 2596
64 Ga0070665_100044376 3300005548 Bacteria 4464
65 Ga0070665_100129548 3300005548 Bacteria 2525
66 Ga0075365_10000067 3300006038 Bacteria 31211
67 Ga0075365_10000304 3300006038 Bacteria 17216
68 Ga0075365_10001094 3300006038 Bacteria 11788
69 Ga0075365_10001161 3300006038 Bacteria 11560
70 Ga0075365_10001886 3300006038 Bacteria 9866
71 Ga0075365_10002599 3300006038 Bacteria 8931
72 Ga0075363_100000012 3300006048 Bacteria 42195
73 Ga0075363_100000179 3300006048 Bacteria 16652
74 Ga0075364_10000052 3300006051 Bacteria 42195
75 Ga0075364_10000069 3300006051 Bacteria 39713
76 Ga0075364_10000997 3300006051 Bacteria 14998
77 Ga0075364_10002776 3300006051 Bacteria 9838
78 Ga0075362_10000078 3300006177 Bacteria 26761
79 Ga0075362_10000205 3300006177 Bacteria 16450
80 Ga0075367_10001185 3300006178 Bacteria 10945
81 Ga0075367_10154125 3300006178 Bacteria 1427
82 Ga0075369_10000025 3300006186 Bacteria 43566
83 Ga0075369_10000385 3300006186 Bacteria 13301
84 Ga0075366_10001234 3300006195 Bacteria 12677
85 Ga0075370_10000172 3300006353 Bacteria 22450
86 Ga0075370_10000515 3300006353 Bacteria 14751
87 Ga0075370_10000963 3300006353 Bacteria 11879
88 Ga0075370_10038495 3300006353 Bacteria 2691
89 Ga0079104_1000077 3300006946 Bacteria 143153
90 Ga0079104_1000159 3300006946 Bacteria 95944
91 Ga0079104_1000779 3300006946 Bacteria 27137
92 Ga0099826_10000042 3300006948 Bacteria 92895
93 Ga0099826_10000174 3300006948 Bacteria 27046
94 Ga0099826_10000400 3300006948 Bacteria 20399
95 Ga0099826_10000587 3300006948 Bacteria 18391
96 Ga0105244_10020766 3300009036 Bacteria 3643
97 Ga0105237_10000038 3300009545 Bacteria 190707
98 Ga0123340_1000038 3300009763 Bacteria 41885
99 Ga0123341_1001185 3300009765 Bacteria 18902
100 Ga0123341_1002628 3300009765 Bacteria 14915
101 Ga0123341_1015275 3300009765 Bacteria 6848
102 Ga0123342_1001115 3300009766 Bacteria 44773
103 Ga0123342_1005676 3300009766 Bacteria 17880
104 Ga0123342_1006073 3300009766 Bacteria 16993
105 Ga0123342_1009382 3300009766 Bacteria 11751
106 Ga0123342_1014402 3300009766 Bacteria 7556
107 Ga0105239_10000065 3300010375 Bacteria 151224
108 Ga0157371_10000619 3300013102 Bacteria 42290
109 Ga0157371_10003124 3300013102 Bacteria 15308
110 Ga0157369_10008383 3300013105 Bacteria 11855
111 Ga0157369_10013894 3300013105 Bacteria 9095
112 Ga0214544_1000097 3300021320 Bacteria 116548
113 Ga0214544_1011809 3300021320 Bacteria 11815
114 Ga0214542_1000418 3300021321 Bacteria 75807
115 Ga0214543_1004049 3300021327 Bacteria 28048
116 Ga0214543_1004720 3300021327 Bacteria 25639
117 Ga0228711_1001962 3300022739 Bacteria 31117
118 Ga0228711_1003907 3300022739 Bacteria 23140
119 Ga0228711_1004556 3300022739 Bacteria 21286
120 Ga0228711_1013283 3300022739 Bacteria 9734
121 Ga0228711_1014195 3300022739 Bacteria 9129
122 Ga0228711_1014938 3300022739 Bacteria 8645
123 Ga0228711_1015600 3300022739 Bacteria 8203
124 Ga0228710_1001022 3300022740 Bacteria 40191
125 Ga0228710_1002079 3300022740 Bacteria 31125
126 Ga0228710_1004154 3300022740 Bacteria 22854
127 Ga0228710_1004792 3300022740 Bacteria 21286
128 Ga0228710_1006148 3300022740 Bacteria 18366
129 Ga0228710_1011708 3300022740 Bacteria 11204
130 Ga0228710_1013458 3300022740 Bacteria 9734
131 Ga0228710_1014290 3300022740 Bacteria 9142
132 Ga0228710_1025851 3300022740 Bacteria 3753
133 Ga0228710_1040392 3300022740 Bacteria 1413
134 Ga0209436_100016 3300025208 Bacteria 117496
135 Ga0209436_100055 3300025208 Bacteria 61770
136 Ga0209437_100250 3300025233 Bacteria 85166
137 Ga0207425_1000083 3300025245 Bacteria 96984
138 Ga0207425_1000104 3300025245 Bacteria 79793
139 Ga0209677_100569 3300025253 Bacteria 20397
140 Ga0209129_1000098 3300025258 Bacteria 163406
141 Ga0209129_1000149 3300025258 Bacteria 114222
142 Ga0209129_1000213 3300025258 Bacteria 67041
143 Ga0209129_1000821 3300025258 Bacteria 19527
144 Ga0209233_1000214 3300025261 Bacteria 108975
145 Ga0209233_1000238 3300025261 Bacteria 92087
146 Ga0209233_1001008 3300025261 Bacteria 12023
147 Ga0209455_1016450 3300025272 Bacteria 1588
148 Ga0209673_1000055 3300025273 Bacteria 272768
149 Ga0209673_1000086 3300025273 Bacteria 210101
150 Ga0209673_1000126 3300025273 Bacteria 167949
151 Ga0209673_1000573 3300025273 Bacteria 58647
152 Ga0209673_1000867 3300025273 Bacteria 39276
153 Ga0209673_1001071 3300025273 Bacteria 31050
154 Ga0209673_1001381 3300025273 Bacteria 23859
155 Ga0209673_1001681 3300025273 Bacteria 18889
156 Ga0209673_1005181 3300025273 Bacteria 6657
157 Ga0209130_1000073 3300025284 Bacteria 174439
158 Ga0209130_1000136 3300025284 Bacteria 116996
159 Ga0209130_1004991 3300025284 Bacteria 4791
160 Ga0209676_1000860 3300025292 Bacteria 39100
161 Ga0209676_1001831 3300025292 Bacteria 17585
162 Ga0209025_1000044 3300025294 Bacteria 349480
163 Ga0209025_1000142 3300025294 Bacteria 183903
164 Ga0209025_1000181 3300025294 Bacteria 156894
165 Ga0209025_1001870 3300025294 Bacteria 24666
166 Ga0209025_1001930 3300025294 Bacteria 24020
167 Ga0209025_1045650 3300025294 Bacteria 1813
168 Ga0209564_1000168 3300025295 Bacteria 158368
169 Ga0209564_1000368 3300025295 Bacteria 83910
170 Ga0209564_1000799 3300025295 Bacteria 43220
171 Ga0209564_1000879 3300025295 Bacteria 39962
172 Ga0209564_1001155 3300025295 Bacteria 30794
173 Ga0209564_1010175 3300025295 Bacteria 4369
174 Ga0209564_1018050 3300025295 Bacteria 2713
175 Ga0209564_1023475 3300025295 Bacteria 2141
176 Ga0209564_1035741 3300025295 Bacteria 1433
177 Ga0209758_1000076 3300025297 Bacteria 270615
178 Ga0209758_1000156 3300025297 Bacteria 156894
179 Ga0209758_1000300 3300025297 Bacteria 97000
180 Ga0209758_1000374 3300025297 Bacteria 78052
181 Ga0209758_1000527 3300025297 Bacteria 61122
182 Ga0209758_1001917 3300025297 Bacteria 22638
183 Ga0209758_1002339 3300025297 Bacteria 19559
184 Ga0209758_1003608 3300025297 Bacteria 13854
185 Ga0209050_1001764 3300025298 Bacteria 21406
186 Ga0209050_1008223 3300025298 Bacteria 5630
187 Ga0209050_1019731 3300025298 Bacteria 2545
188 Ga0209256_1000147 3300025299 Bacteria 149002
189 Ga0209256_1000228 3300025299 Bacteria 102990
190 Ga0209256_1000429 3300025299 Bacteria 65911
191 Ga0209256_1001033 3300025299 Bacteria 32690
192 Ga0209256_1001075 3300025299 Bacteria 31597
193 Ga0209256_1001203 3300025299 Bacteria 28988
194 Ga0209256_1001269 3300025299 Bacteria 27559
195 Ga0209256_1012257 3300025299 Bacteria 3310
196 Ga0207426_1000140 3300025302 Bacteria 195664
197 Ga0207426_1000253 3300025302 Bacteria 116996
198 Ga0207426_1000283 3300025302 Bacteria 103487
199 Ga0207426_1000298 3300025302 Bacteria 97889
200 Ga0207426_1001295 3300025302 Bacteria 21607
201 Ga0207426_1002538 3300025302 Bacteria 11459
202 Ga0209051_1000032 3300025303 Bacteria 383445
203 Ga0209051_1000132 3300025303 Bacteria 139145
204 Ga0209051_1000192 3300025303 Bacteria 108667
205 Ga0209051_1000223 3300025303 Bacteria 95695
206 Ga0209051_1001407 3300025303 Bacteria 20678
207 Ga0209051_1002366 3300025303 Bacteria 13638
208 Ga0209051_1009302 3300025303 Bacteria 5077
209 Ga0209051_1021342 3300025303 Bacteria 2761
210 Ga0209051_1042721 3300025303 Bacteria 1599
211 Ga0209257_1000209 3300025304 Bacteria 141383
212 Ga0209257_1000300 3300025304 Bacteria 108786
213 Ga0209257_1000651 3300025304 Bacteria 55163
214 Ga0209257_1001498 3300025304 Bacteria 27458
215 Ga0209257_1001518 3300025304 Bacteria 27211
216 Ga0209257_1001594 3300025304 Bacteria 25966
217 Ga0209257_1002215 3300025304 Bacteria 20029
218 Ga0209257_1002726 3300025304 Bacteria 16789
219 Ga0207671_10000418 3300025914 Bacteria 58941
220 Ga0207640_10101895 3300025981 Bacteria 2016
221 Ga0209281_1000035 3300027111 Bacteria 382327
222 Ga0209281_1000282 3300027111 Bacteria 95961
223 Ga0209281_1000831 3300027111 Bacteria 27747
224 Ga0209371_1000280 3300027312 Bacteria 58641
225 Ga0209371_1001859 3300027312 Bacteria 12997
226 Ga0209371_1003523 3300027312 Bacteria 7531
227 Ga0209371_1004410 3300027312 Bacteria 6153
228 Ga0209282_1000065 3300027666 Bacteria 91676
229 Ga0209282_1000177 3300027666 Bacteria 35170
230 Ga0209282_1000442 3300027666 Bacteria 20414
231 Ga0268266_10005108 3300028379 Bacteria 12371
232 Ga0268266_10008874 3300028379 Bacteria 8900
233 Ga0268266_10113293 3300028379 Bacteria 2405
234 Ga0307515_10008808 3300028794 Bacteria 19597
235 Ga0268256_1000234 3300030500 Bacteria 58641
236 Ga0268256_1002202 3300030500 Bacteria 10273
237 Ga0268256_1003728 3300030500 Bacteria 6702
238 Ga0268256_1004454 3300030500 Bacteria 5798
239 Ga0307513_10008087 3300031456 Bacteria 13500
240 Ga0307513_10021712 3300031456 Bacteria 7573
241 Ga0307406_10014500 3300031901 Bacteria 4537
242 Ga0307406_10056777 3300031901 Bacteria 2509
243 Ga0307406_10117239 3300031901 Bacteria 1844
244 Ga0315914_1000040 3300031967 Bacteria 95961
245 Ga0315914_1002592 3300031967 Bacteria 27650
246 Ga0315914_1004661 3300031967 Bacteria 20408
247 Ga0315914_1005491 3300031967 Bacteria 18398
248 Ga0307510_10001375 3300033180 Bacteria 26622
249 Ga0315913_1000020 3300033430 Bacteria 95961
250 Ga0315913_1001204 3300033430 Bacteria 27652
251 Ga0315913_1002090 3300033430 Bacteria 23027
252 Ga0315913_1003695 3300033430 Bacteria 18397
253 Ga0315915_1000027 3300033464 Bacteria 95961
254 Ga0315915_1001697 3300033464 Bacteria 27047
255 Ga0315915_1003326 3300033464 Bacteria 20407
256 Ga0373927_0000795 3300035695 Bacteria 24089
257 Ga0373927_0001042 3300035695 Bacteria 21090
258 Ga0373925_0000579 3300037068 Bacteria 35494
259 Ga0395905_0001478 3300037471 Bacteria 28142
260 Ga0439465_0000924 3300041413 Bacteria 9303
261 Ga0451802_1639378 3300041460 Bacteria 1394
262 Ga0451833_0510751 3300041491 Bacteria 9774
263 Ga0451833_0616654 3300041491 Bacteria 6136
264 Ga0451833_1035954 3300041491 Bacteria 20183
265 Ga0451835_0135293 3300041492 Bacteria 22901
266 Ga0451835_0805993 3300041492 Bacteria 21422
267 Ga0451837_0223534 3300041494 Bacteria 8645
268 Ga0451839_0624728 3300041496 Bacteria 2281
269 Ga0451841_0374479 3300041498 Bacteria 4542
270 Ga0451847_0846976 3300041503 Bacteria 34931
271 Ga0451849_0103780 3300041505 Bacteria 21361
272 Ga0451849_0719155 3300041505 Bacteria 1948
273 Ga0451849_0790399 3300041505 Bacteria 5416
274 Ga0451851_0007264 3300041507 Bacteria 31915
275 Ga0451851_0008851 3300041507 Bacteria 15695
276 Ga0451851_0077690 3300041507 Bacteria 2065
277 Ga0451851_1261333 3300041507 Bacteria 14126
278 Ga0451843_0530825 3300041509 Bacteria 19013
279 Ga0451843_0923495 3300041509 Bacteria 13660
280 Ga0451843_1101749 3300041509 Bacteria 2451
281 Ga0451843_1373731 3300041509 Bacteria 1521
282 Ga0451855_0142693 3300041511 Bacteria 9745
283 Ga0451855_1544233 3300041511 Bacteria 1764
284 Ga0451853_0015460 3300041512 Bacteria 19784
285 Ga0451853_0330971 3300041512 Bacteria 11849
286 Ga0451853_1979795 3300041512 Bacteria 6111
287 Ga0451853_2031544 3300041512 Bacteria 12886
288 Ga0495617_029416 3300046452 Bacteria 1847
289 Ga0495629_0012590 3300046459 Bacteria 6126
290 Ga0495638_0000077 3300046460 Bacteria 158724
291 Ga0495638_0000181 3300046460 Bacteria 96473
292 Ga0495638_0000420 3300046460 Bacteria 51327
293 Ga0495638_0001889 3300046460 Bacteria 18098
294 Ga0495607_0000367 3300046501 Bacteria 46456
295 Ga0495607_0107414 3300046501 Bacteria 1484
296 Ga0495607_0117913 3300046501 Bacteria 1398
297 Ga0495583_0002816 3300046506 Bacteria 14222
298 Ga0495606_0042664 3300046507 Bacteria 3032
299 Ga0495610_0001873 3300046512 Bacteria 18176
300 Ga0495610_0002851 3300046512 Bacteria 14067
301 Ga0495610_0003544 3300046512 Bacteria 12092
302 Ga0495610_0005549 3300046512 Bacteria 8931
303 Ga0495620_0000489 3300046515 Bacteria 25698
304 Ga0495620_0058480 3300046515 Bacteria 1613
305 Ga0495620_0070615 3300046515 Bacteria 1430
306 Ga0495632_0000386 3300046519 Bacteria 42002
307 Ga0495643_0000485 3300046522 Bacteria 50393
308 Ga0495643_0002049 3300046522 Bacteria 16734
309 Ga0495643_0039710 3300046522 Bacteria 2573
310 Ga0495648_0000838 3300046524 Bacteria 32444
311 Ga0495648_0001751 3300046524 Bacteria 20988
312 Ga0495648_0018593 3300046524 Bacteria 4914
313 Ga0495648_0153241 3300046524 Bacteria 1200
314 Ga0495663_0000326 3300046525 Bacteria 17858
315 Ga0495663_0004624 3300046525 Bacteria 3858
316 Ga0495663_0045847 3300046525 Bacteria 1341
317 Ga0495611_0000364 3300046648 Bacteria 29296
318 Ga0495611_0000829 3300046648 Bacteria 17049
319 Ga0495611_0018105 3300046648 Bacteria 3019
320 Ga0495611_0032447 3300046648 Bacteria 2301
321 Ga0495625_0001036 3300046660 Bacteria 36593
322 Ga0495625_0051601 3300046660 Bacteria 2948
323 Ga0495661_0062036 3300046665 Bacteria 2216
324 Ga0495588_0000720 3300046674 Bacteria 15153
325 Ga0495588_0002839 3300046674 Bacteria 7454
326 Ga0495588_0004231 3300046674 Bacteria 6331
327 Ga0495670_0001841 3300046691 Bacteria 10430
328 Ga0495670_0122495 3300046691 Bacteria 1351
329 Ga0495671_0001668 3300046692 Bacteria 14528
330 Ga0495671_0012222 3300046692 Bacteria 4693
331 Ga0495649_0005013 3300046694 Bacteria 8514
332 Ga0495649_0084287 3300046694 Bacteria 1697
333 Ga0495589_0076171 3300046794 Bacteria 1636
334 Ga0495660_0010902 3300046810 Bacteria 5281
335 Ga0495687_000105 3300047443 Bacteria 128239
336 Ga0495687_000954 3300047443 Bacteria 29670
337 Ga0495687_000955 3300047443 Bacteria 29649
338 Ga0495687_030246 3300047443 Bacteria 2495
339 Ga0495681_0000112 3300047470 Bacteria 70292
340 Ga0495681_0000415 3300047470 Bacteria 32710
341 Ga0495686_0000851 3300047472 Bacteria 39194
342 Ga0495686_0001213 3300047472 Bacteria 29610
343 Ga0495686_0047109 3300047472 Bacteria 2723
344 Ga0496104_0128253 3300048907 Bacteria 2436
345 Ga0496104_0137990 3300048907 Bacteria 2343
346 Ga0496106_0000529 3300048909 Bacteria 27067
347 Ga0496111_0001354 3300048914 Bacteria 13861
348 Ga0496116_0000309 3300048919 Bacteria 81667
349 Ga0496116_0000649 3300048919 Bacteria 45467
350 Ga0496116_0000703 3300048919 Bacteria 43195
351 Ga0496116_0001292 3300048919 Bacteria 28759
352 Ga0496116_0001860 3300048919 Bacteria 22844
353 Ga0496116_0002710 3300048919 Bacteria 18242
354 Ga0496116_0004988 3300048919 Bacteria 12503
355 Ga0496116_0011024 3300048919 Bacteria 7521
356 Ga0496116_0022588 3300048919 Bacteria 4710
357 Ga0496116_0100610 3300048919 Bacteria 1728
358 Ga0496117_0000105 3300048920 Bacteria 188970
359 Ga0496117_0000277 3300048920 Bacteria 95538
360 Ga0496117_0001285 3300048920 Bacteria 37005
361 Ga0496117_0003010 3300048920 Bacteria 20250
362 Ga0496117_0003993 3300048920 Bacteria 16654
363 Ga0496117_0004628 3300048920 Bacteria 14990
364 Ga0496117_0016964 3300048920 Bacteria 6103
365 Ga0496117_0063553 3300048920 Bacteria 2522
366 Ga0496117_0071307 3300048920 Bacteria 2329
367 Ga0496117_0102111 3300048920 Bacteria 1811
368 Ga0496118_0000168 3300048921 Bacteria 118938
369 Ga0496118_0000518 3300048921 Bacteria 63367
370 Ga0496118_0005024 3300048921 Bacteria 15268
371 Ga0496118_0007709 3300048921 Bacteria 11316
372 Ga0496118_0013862 3300048921 Bacteria 7586
373 Ga0496118_0051177 3300048921 Bacteria 3161
374 Ga0496118_0062357 3300048921 Bacteria 2753
375 Ga0496118_0098222 3300048921 Bacteria 1989
376 Ga0496118_0137107 3300048921 Bacteria 1559
377 Ga0496118_0208740 3300048921 Bacteria 1148
378 Ga0496119_0000500 3300048922 Bacteria 53419
379 Ga0496119_0000870 3300048922 Bacteria 39669
380 Ga0496119_0001142 3300048922 Bacteria 33317
381 Ga0496119_0002658 3300048922 Bacteria 19341
382 Ga0496119_0002755 3300048922 Bacteria 18904
383 Ga0496119_0004711 3300048922 Bacteria 13417
384 Ga0496119_0006234 3300048922 Bacteria 11141
385 Ga0496119_0039459 3300048922 Bacteria 3034
386 Ga0496119_0071654 3300048922 Bacteria 2028
387 Ga0496119_0091781 3300048922 Bacteria 1724
388 Ga0496120_0000532 3300048923 Bacteria 58625
389 Ga0496120_0000629 3300048923 Bacteria 52595
390 Ga0496120_0000818 3300048923 Bacteria 44506
391 Ga0496120_0001909 3300048923 Bacteria 23063
392 Ga0496120_0002366 3300048923 Bacteria 19300
393 Ga0496120_0007575 3300048923 Bacteria 8054
394 Ga0496120_0021418 3300048923 Bacteria 4087
395 Ga0496120_0037621 3300048923 Bacteria 2870
396 Ga0496120_0039440 3300048923 Bacteria 2786
397 Ga0496120_0085835 3300048923 Bacteria 1693
398 Ga0496121_0000033 3300048924 Bacteria 377542
399 Ga0496121_0000836 3300048924 Bacteria 55869
400 Ga0496121_0000936 3300048924 Bacteria 52789
401 Ga0496121_0002586 3300048924 Bacteria 27364
402 Ga0496121_0004086 3300048924 Bacteria 20041
403 Ga0496121_0004675 3300048924 Bacteria 18177
404 Ga0496121_0012372 3300048924 Bacteria 9322
405 Ga0496121_0042168 3300048924 Bacteria 3975
406 Ga0496121_0050477 3300048924 Bacteria 3514
407 Ga0496121_0059020 3300048924 Bacteria 3166
408 Ga0496121_0073393 3300048924 Bacteria 2742
409 Ga0496121_0111054 3300048924 Bacteria 2091
410 Ga0496122_0000193 3300048925 Bacteria 139724
411 Ga0496122_0000300 3300048925 Bacteria 109765
412 Ga0496122_0000868 3300048925 Bacteria 56966
413 Ga0496122_0000870 3300048925 Bacteria 56865
414 Ga0496122_0000972 3300048925 Bacteria 51449
415 Ga0496122_0001241 3300048925 Bacteria 43048
416 Ga0496122_0001563 3300048925 Bacteria 36172
417 Ga0496122_0002116 3300048925 Bacteria 29353
418 Ga0496122_0003762 3300048925 Bacteria 19554
419 Ga0496122_0011427 3300048925 Bacteria 8989
420 Ga0496122_0012759 3300048925 Bacteria 8316
421 Ga0496122_0014036 3300048925 Bacteria 7779
422 Ga0496122_0021629 3300048925 Bacteria 5750
423 Ga0496122_0021871 3300048925 Bacteria 5705
424 Ga0496122_0039919 3300048925 Bacteria 3737
425 Ga0496122_0049472 3300048925 Bacteria 3218
426 Ga0496122_0053087 3300048925 Bacteria 3059
427 Ga0496122_0054115 3300048925 Bacteria 3017
428 Ga0496122_0058206 3300048925 Bacteria 2863
429 Ga0496122_0062790 3300048925 Bacteria 2717
430 Ga0496122_0171830 3300048925 Bacteria 1305
431 Ga0496123_0000018 3300048926 Bacteria 404553
432 Ga0496123_0000154 3300048926 Bacteria 139724
433 Ga0496123_0000664 3300048926 Bacteria 56865
434 Ga0496123_0000682 3300048926 Bacteria 55995
435 Ga0496123_0000823 3300048926 Bacteria 49835
436 Ga0496123_0001704 3300048926 Bacteria 29372
437 Ga0496123_0004051 3300048926 Bacteria 15793
438 Ga0496123_0006398 3300048926 Bacteria 11424
439 Ga0496123_0014890 3300048926 Bacteria 6414
440 Ga0496123_0019734 3300048926 Bacteria 5302
441 Ga0496123_0020643 3300048926 Bacteria 5147
442 Ga0496123_0023344 3300048926 Bacteria 4736
443 Ga0496123_0044100 3300048926 Bacteria 3053
444 Ga0496123_0044175 3300048926 Bacteria 3050
445 Ga0496123_0101705 3300048926 Bacteria 1670
446 Ga0496124_0000184 3300048927 Bacteria 123894
447 Ga0496124_0000758 3300048927 Bacteria 52830
448 Ga0496124_0001005 3300048927 Bacteria 44697
449 Ga0496124_0001655 3300048927 Bacteria 31821
450 Ga0496124_0002108 3300048927 Bacteria 26827
451 Ga0496124_0002173 3300048927 Bacteria 26224
452 Ga0496124_0002207 3300048927 Bacteria 25931
453 Ga0496124_0002595 3300048927 Bacteria 23383
454 Ga0496124_0005493 3300048927 Bacteria 14227
455 Ga0496124_0006535 3300048927 Bacteria 12682
456 Ga0496124_0012572 3300048927 Bacteria 8338
457 Ga0496124_0024665 3300048927 Bacteria 5462
458 Ga0496124_0032790 3300048927 Bacteria 4581
459 Ga0496124_0075492 3300048927 Bacteria 2784
460 Ga0496124_0098262 3300048927 Bacteria 2376
461 Ga0496124_0175103 3300048927 Bacteria 1657
462 Ga0496124_0179478 3300048927 Bacteria 1631
463 Ga0496124_0234845 3300048927 Bacteria 1368
464 Ga0496125_0000034 3300048928 Bacteria 348231
465 Ga0496125_0000152 3300048928 Bacteria 153295
466 Ga0496125_0002100 3300048928 Bacteria 26751
467 Ga0496125_0004668 3300048928 Bacteria 15623
468 Ga0496125_0008428 3300048928 Bacteria 10792
469 Ga0496125_0017522 3300048928 Bacteria 6823
470 Ga0496125_0039446 3300048928 Bacteria 4066
471 Ga0496125_0067801 3300048928 Bacteria 2809
472 Ga0496125_0083078 3300048928 Bacteria 2438
473 Ga0496125_0084216 3300048928 Bacteria 2415
474 Ga0496125_0101374 3300048928 Bacteria 2119
475 Ga0496125_0128462 3300048928 Bacteria 1790
476 Ga0496126_0000243 3300048929 Bacteria 117685
477 Ga0496126_0000271 3300048929 Bacteria 110289
478 Ga0496126_0000559 3300048929 Bacteria 71584
479 Ga0496126_0001377 3300048929 Bacteria 38426
480 Ga0496126_0002639 3300048929 Bacteria 23809
481 Ga0496126_0004820 3300048929 Bacteria 15826
482 Ga0496126_0008060 3300048929 Bacteria 11416
483 Ga0496126_0017157 3300048929 Bacteria 7219
484 Ga0496126_0017557 3300048929 Bacteria 7127
485 Ga0496126_0043360 3300048929 Bacteria 4150
486 Ga0496126_0075415 3300048929 Bacteria 2993
487 Ga0496126_0088984 3300048929 Bacteria 2718
488 Ga0496126_0208507 3300048929 Bacteria 1646
489 Ga0496126_0325160 3300048929 Bacteria 1263
490 Ga0495678_000295 3300049459 Bacteria 54788
491 Ga0495678_000877 3300049459 Bacteria 26790
492 Ga0501031_0005085 3300049568 Bacteria 8558
493 Ga0501032_0012143 3300049569 Bacteria 6166
494 Ga0501033_0000054 3300049570 Bacteria 108163
495 Ga0501033_0002813 3300049570 Bacteria 14563
496 Ga0501033_0013840 3300049570 Bacteria 6138
497 Ga0501034_0024273 3300049571 Bacteria 6166
498 Ga0501034_0195432 3300049571 Bacteria 1983
499 Ga0501036_0016513 3300049572 Bacteria 6166
500 Ga0501037_0013013 3300049573 Bacteria 6133
501 Ga0501038_0019191 3300049574 Bacteria 6166
502 Ga0501039_0013864 3300049575 Bacteria 6166
503 Ga0501047_0005149 3300049581 Bacteria 12272
504 Ga0501035_0000231 3300049822 Bacteria 66354
505 Ga0501035_0001626 3300049822 Bacteria 22754
506 Ga0501035_0019917 3300049822 Bacteria 6162
507 Ga0501044_0026265 3300049823 Bacteria 6166
508 Ga0501045_0262145 3300049824 Bacteria 1286
509 nmdc:mga03683_118_c1 3300050489 Bacteria 26749
510 nmdc:mga03n38_15_c1 3300050490 Bacteria 42485
511 nmdc:mga03n38_4343_c1 3300050490 Bacteria 4682
512 nmdc:mga03n38_94_c1 3300050490 Bacteria 19624
513 nmdc:mga00v17_1015_c1 3300050491 Bacteria 15012
514 nmdc:mga00v17_1_c1 3300050491 Bacteria 292294
515 nmdc:mga00v17_28061_c1 3300050491 Bacteria 3293
516 nmdc:mga00v17_4382_c1 3300050491 Bacteria 7336
517 nmdc:mga00v17_49_c1 3300050491 Bacteria 74057
518 nmdc:mga0yw44_105_c1 3300050492 Bacteria 29307
519 nmdc:mga0yw44_341_c1 3300050492 Bacteria 16365
520 nmdc:mga0yw44_56_c1 3300050492 Bacteria 40187
521 nmdc:mga0yw44_833_c1 3300050492 Bacteria 11543
522 nmdc:mga0yw44_85_c1 3300050492 Bacteria 33391
523 nmdc:mga0yw44_92_c1 3300050492 Bacteria 31200
524 nmdc:mga0k408_1039_c1 3300050493 Bacteria 15224
525 nmdc:mga0k408_434_c1 3300050493 Bacteria 22864
526 nmdc:mga06z11_10566_c1 3300050494 Bacteria 3941
527 nmdc:mga07m45_134_c1 3300050496 Bacteria 29386
528 nmdc:mga07m45_40902_c1 3300050496 Bacteria 2595
529 nmdc:mga07m45_651_c1 3300050496 Bacteria 14758
530 nmdc:mga07m45_676_c1 3300050496 Bacteria 14508
531 nmdc:mga07m45_88_c1 3300050496 Bacteria 34971
532 nmdc:mga0sz30_52_c1 3300050516 Bacteria 43058
533 nmdc:mga0sz30_7442_c1 3300050516 Bacteria 4106
534 Ga0500578_0002023 3300053086 Bacteria 18236
535 Ga0500578_0007500 3300053086 Bacteria 7201
536 Ga0500583_0000267 3300053092 Bacteria 18504
537 Ga0500583_0001881 3300053092 Bacteria 6140
538 Ga0500651_0030225 3300053093 Bacteria 3408
539 Ga0500555_005812 3300053103 Bacteria 3500
540 Ga0500560_000391 3300053107 Bacteria 5889
541 Ga0500572_014614 3300053111 Bacteria 1965
542 Ga0500608_000517 3300053122 Bacteria 14455
543 Ga0500608_000528 3300053122 Bacteria 14293
544 Ga0500608_045486 3300053122 Bacteria 2108
545 Ga0500618_000097 3300053125 Bacteria 71932
546 Ga0500618_000303 3300053125 Bacteria 36839
547 Ga0500618_000400 3300053125 Bacteria 29831
548 Ga0500618_000464 3300053125 Bacteria 26377
549 Ga0500618_001453 3300053125 Bacteria 10525
550 Ga0500618_002840 3300053125 Bacteria 6238
551 Ga0500658_0000065 3300053134 Bacteria 49371
552 Ga0500561_0000084 3300053137 Bacteria 18691
553 Ga0500564_004742 3300053138 Bacteria 5481
554 Ga0500568_0000578 3300053139 Bacteria 26786
555 Ga0500568_0000791 3300053139 Bacteria 22316
556 Ga0500568_0055408 3300053139 Bacteria 1548
557 Ga0500573_0012369 3300053140 Bacteria 4791
558 Ga0500573_0035132 3300053140 Bacteria 2891
559 Ga0500573_0040514 3300053140 Bacteria 2690
560 Ga0500574_000012 3300053141 Bacteria 46179
561 Ga0500574_000028 3300053141 Bacteria 20931
562 Ga0500590_001200 3300053148 Bacteria 10302
563 Ga0500616_0002538 3300053153 Bacteria 15079
564 Ga0500622_0000037 3300053156 Bacteria 179427
565 Ga0500622_0000278 3300053156 Bacteria 52272
566 Ga0500624_001280 3300053157 Bacteria 4355
567 Ga0500624_004001 3300053157 Bacteria 1933
568 Ga0500634_0103901 3300053161 Bacteria 1416
569 Ga0500638_000034 3300053162 Bacteria 44726
570 Ga0500636_0000083 3300053177 Bacteria 47142
571 Ga0500636_0000091 3300053177 Bacteria 45101
572 Ga0500636_0000096 3300053177 Bacteria 44837
573 Ga0500636_0003024 3300053177 Bacteria 9426
574 Ga0500636_0010421 3300053177 Bacteria 5423
575 Ga0500636_0017470 3300053177 Bacteria 4239
576 Ga0500636_0082153 3300053177 Bacteria 1855
577 Ga0500636_0105569 3300053177 Bacteria 1597
578 Ga0500636_0141832 3300053177 Bacteria 1329
579 2509378658 2509276019 Bacteria 6802256
580 2509386513 2509276021 Bacteria 7634384
581 2509392753 2509276021 Bacteria 7634384
582 2509441446 2509276033 Bacteria 7180565
583 2510137256 2510065019 Bacteria 6903379
584 2510841525 2510461069 Bacteria 5505000
585 2511499274 2511231052 Bacteria 6974333
586 2512531237 2512047086 Bacteria 6850303
587 2512974369 2512875026 Bacteria 6861065
588 2513573033 2513237084 Bacteria 7231967
589 2513586392 2513237086 Bacteria 7265287
590 2513607147 2513237089 Bacteria 6553624
591 2513620643 2513237091 Bacteria 6900273
592 2513635503 2513237093 Bacteria 7545552
593 2513713560 2513237103 Bacteria 7647401
594 2513869930 2513237138 Bacteria 7368160
595 2513881828 2513237140 Bacteria 7076289
596 2513886365 2513237140 Bacteria 7076289
597 2513902690 2513237143 Bacteria 6664116
598 2513929571 2513237146 Bacteria 7166346
599 2513929584 2513237146 Bacteria 7166346
600 2514001413 2513237159 Bacteria 6810126
601 2514002123 2513237159 Bacteria 6810126
602 2515109942 2515075009 Bacteria 7288508
603 2515634239 2515154113 Bacteria 7807172
604 2515635663 2515154113 Bacteria 7807172
605 2515646414 2515154114 Bacteria 7848616
606 2515657741 2515154116 Bacteria 7552979
607 2517041031 2516653077 Bacteria 7555578
608 2517042930 2516653077 Bacteria 7555578
609 2517099923 2517093000 Bacteria 7412387
610 2524460880 2524023209 Bacteria 6679728
611 2524463114 2524023209 Bacteria 6679728
612 2524463451 2524023209 Bacteria 6679728
613 2530649481 2529292951 Bacteria 6916614
614 2551697903 2551306087 Bacteria 7351905
615 2551713885 2551306089 Bacteria 7162724
616 2554246076 2554235003 Bacteria 5877155
617 2554249058 2554235003 Bacteria 5877155
618 2554249778 2554235003 Bacteria 5877155
619 2558862544 2558860100 Bacteria 8458965
620 2559298609 2558860242 Bacteria 5568029
621 2585168798 2582581283 Bacteria 6030556
622 2585258080 2582581304 Bacteria 5831370
623 2585281765 2582581308 Bacteria 7413247
624 2585282737 2582581308 Bacteria 7413247
625 2585336051 2582581316 Bacteria 7774528
626 2585553954 2585427530 Bacteria 7383882
627 2585563696 2585427531 Bacteria 6992870
628 2585564501 2585427531 Bacteria 6992870
629 2585840881 2585427593 Bacteria 7141551
630 2585846210 2585427594 Bacteria 6180594
631 2585846880 2585427594 Bacteria 6180594
632 2585908910 2585427609 Bacteria 6667127
633 2587984233 2585428125 Bacteria 6662905
634 2599335652 2599185156 Bacteria 5403036
635 2599336143 2599185156 Bacteria 5403036
636 2599413893 2599185170 Bacteria 7295545
637 2599413908 2599185170 Bacteria 7295545
638 2599606445 2599185210 Bacteria 5624189
639 2599606637 2599185210 Bacteria 5624189
640 2599722957 2599185236 Bacteria 6875203
641 2599723370 2599185236 Bacteria 6875203
642 2600197003 2599185352 Bacteria 7228948
643 2601612508 2600255279 Bacteria 5605316
644 2601749375 2600255308 Bacteria 5611129
645 2616310029 2615840626 Bacteria 7921970
646 2616311744 2615840626 Bacteria 7921970
647 2616550863 2615840698 Bacteria 7319877
648 2643810572 2643221558 Bacteria 5460675
649 2643810888 2643221558 Bacteria 5460675
650 2643815063 2643221558 Bacteria 5460675
651 2643858438 2643221568 Bacteria 5187270
652 2643918216 2643221582 Bacteria 5804683
653 2644008179 2643221599 Bacteria 6292121
654 2644047846 2643221607 Bacteria 6314006
655 2644194998 2643221634 Bacteria 6705461
656 2644195637 2643221634 Bacteria 6705461
657 2644200536 2643221636 Bacteria 6583769
658 2644208037 2643221637 Bacteria 5345260
659 2644240129 2643221643 Bacteria 5749658
660 2644300806 2643221653 Bacteria 4569637
661 2644332311 2643221659 Bacteria 7890716
662 2644485001 2643221686 Bacteria 6310811
663 2644496213 2643221688 Bacteria 5260751
664 2644520040 2643221693 Bacteria 5513853
665 2644522995 2643221693 Bacteria 5513853
666 2644651439 2643221718 Bacteria 5345506
667 2644659028 2643221719 Bacteria 4568197
668 2692317873 2690316117 Bacteria 6800650
669 2692320857 2690316117 Bacteria 6800650
670 2719383321 2718217927 Bacteria 6972593
671 2719669139 2718217997 Bacteria 6740740
672 2720489833 2718218199 Bacteria 6740745
673 2720629083 2718218235 Bacteria 6630699
674 2720773156 2718218269 Bacteria 6906114
675 2720777904 2718218269 Bacteria 6906114
676 2724087646 2721755819 Bacteria 6906405
677 2724093185 2721755819 Bacteria 6906405
678 2725949128 2724679232 Bacteria 7646494
679 2738799645 2738541293 Bacteria 7065685
680 2738805183 2738541293 Bacteria 7065685
681 2738948076 2738541317 Bacteria 5340176
682 2739037605 2738541333 Bacteria 7106503
683 2753462859 2751185821 Bacteria 6189929
684 2766062419 2765235942 Bacteria 7445910
685 2778176787 2775507266 Bacteria 7392367
686 2778179753 2775507266 Bacteria 7392367
687 2778179977 2775507266 Bacteria 7392367
688 2778180059 2775507266 Bacteria 7392367
689 2778180283 2775507266 Bacteria 7392367
690 2792623767 2791355091 Bacteria 6135441
691 2792630000 2791355092 Bacteria 6248105
692 2792641078 2791355094 Bacteria 7011481
693 2793283192 2791355253 Bacteria 5171699
694 2793298086 2791355256 Bacteria 6798008
695 2793324198 2791355260 Bacteria 6598818
696 2793328639 2791355261 Bacteria 6661293
697 2793343389 2791355263 Bacteria 6872478
698 2793345208 2791355264 Bacteria 6429314
699 2793363462 2791355266 Bacteria 7116587
700 2793365185 2791355267 Bacteria 7222458
701 2793370601 2791355267 Bacteria 7222458
702 2805931277 2802429605 Bacteria 6875453
703 2806048236 2802429633 Bacteria 7341974
704 2806051201 2802429634 Bacteria 7083200
705 2806057627 2802429635 Bacteria 7650140
706 2806062411 2802429635 Bacteria 7650140
707 2806076275 2802429637 Bacteria 7067217
708 2808990131 2808606387 Bacteria 5697198
709 2819244879 2818991272 Bacteria 4622173
710 2819561574 2818991439 Bacteria 6907412
711 2819688105 2818991461 Bacteria 7026071
712 2821129693 2821123053 Bacteria 7836056
713 2838034540 2838029111 Bacteria 6603031
714 2838042159 2838035591 Bacteria 7166484
715 2838042172 2838035591 Bacteria 7166484
716 2838054694 2838048938 Bacteria 6044578
717 2838669208 2838668709 Bacteria 6671819
718 2838685866 2838680041 Bacteria 6545511
719 2838687754 2838686498 Bacteria 7807632
720 2838691045 2838686498 Bacteria 7807632
721 2838699376 2838694306 Bacteria 6853137
722 2838701131 2838701080 Bacteria 6669771
723 2838712857 2838707686 Bacteria 6619912
724 2838718599 2838714209 Bacteria 5525906
725 2838723597 2838719591 Bacteria 5523910
726 2838742333 2838736955 Bacteria 5760694
727 2841846248 2841840854 Bacteria 5761912
728 2841851684 2841846520 Bacteria 5345850
729 2841862804 2841859092 Bacteria 5436171
730 2841862820 2841859092 Bacteria 5436171
731 2841870159 2841864319 Bacteria 6742987
732 2842082490 2842077413 Bacteria 6508645
733 2842111841 2842110456 Bacteria 7656360
734 2842117283 2842110456 Bacteria 7656360
735 2842123375 2842118031 Bacteria 7033875
736 2842130121 2842124991 Bacteria 5346824
737 2842146012 2842140634 Bacteria 5759631
738 2842146804 2842146304 Bacteria 5957337
739 2842174804 2842170452 Bacteria 5525737
740 2842191285 2842187318 Bacteria 5524014
741 2842202696 2842198810 Bacteria 6608673
742 2842215641 2842211629 Bacteria 5523832
743 2842222587 2842217011 Bacteria 7497767
744 2842228362 2842224351 Bacteria 5524473
745 2842242447 2842237096 Bacteria 6620661
746 2842250966 2842250916 Bacteria 6579627
747 2842265492 2842264693 Bacteria 6472963
748 2842272214 2842271015 Bacteria 7807131
749 2842275520 2842271015 Bacteria 7807131
750 2842290205 2842285085 Bacteria 6011953
751 2842296514 2842291075 Bacteria 7076806
752 2842302320 2842298080 Bacteria 6123127
753 2842304065 2842298080 Bacteria 6123127
754 2842375463 2842370503 Bacteria 7038661
755 2842382797 2842377471 Bacteria 7140707
756 2842389488 2842384541 Bacteria 7057858
757 2842400979 2842395702 Bacteria 6780583
758 2842401500 2842395702 Bacteria 6780583
759 2842407939 2842402390 Bacteria 6681310
760 2842408287 2842402390 Bacteria 6681310
761 2842414526 2842409023 Bacteria 6687331
762 2842414649 2842409023 Bacteria 6687331
763 2842421038 2842415677 Bacteria 6596907
764 2842421596 2842415677 Bacteria 6596907
765 2842428457 2842428310 Bacteria 6767288
766 2842435071 2842434925 Bacteria 6502746
767 2842442066 2842441272 Bacteria 6769273
768 2842453701 2842447887 Bacteria 6754142
769 2842469403 2842469257 Bacteria 6752936
770 2842481287 2842475841 Bacteria 6603183
771 2842488225 2842482326 Bacteria 7212537
772 2842488535 2842482326 Bacteria 7212537
773 2842499029 2842495871 Bacteria 6820686
774 2842500720 2842495871 Bacteria 6820686
775 2842508128 2842502639 Bacteria 6604161
776 2842513987 2842509118 Bacteria 6850950
777 2842514800 2842509118 Bacteria 6850950
778 2842519662 2842515876 Bacteria 5436280
779 2842519678 2842515876 Bacteria 5436280
780 2842524242 2842521101 Bacteria 6569494
781 2842526957 2842521101 Bacteria 6569494
782 2844169315 2844163670 Bacteria 7266046
783 2844462232 2844454524 Bacteria 7952546
784 2844462327 2844454524 Bacteria 7952546
785 2847423628 2847417321 Bacteria 6913799
786 2847423762 2847417321 Bacteria 6913799
787 2850083366 2850079185 Bacteria 6848280
788 2854896637 2854896431 Bacteria 5869725
789 2854917907 2854916844 Bacteria 5725939
790 2855878316 2855872281 Bacteria 6964271
791 2857524017 2857516855 Bacteria 7787325
792 2857537569 2857531043 Bacteria 6754041
793 2896387912 2896384573 Bacteria 7700774
794 2899848141 2899845264 Bacteria 5672268
795 2913298751 2913295892 Bacteria 6333755
796 2913313084 2913308742 Bacteria 5350706
797 2915985616 2915980308 Bacteria 6624279
798 2919119042 2919114240 Bacteria 5700270
799 2919170855 2919166419 Bacteria 4952238
800 2919177365 2919171160 Bacteria 6499771
801 2919177436 2919171160 Bacteria 6499771
802 2920762479 2920760137 Bacteria 7427611
803 2921290332 2921289301 Bacteria 7316391
804 2923562322 2923556063 Bacteria 6793593
805 2924171053 2924165586 Bacteria 7260590
806 2924198213 2924193448 Bacteria 6955718
807 2924226694 2924221636 Bacteria 7113495
808 2924230982 2924228884 Bacteria 6633132
809 2926759474 2926754445 Bacteria 5964435
810 2926760199 2926754445 Bacteria 5964435
811 2926765363 2926760298 Bacteria 5505990
812 2929142711 2929138655 Bacteria 5810547
813 2929143538 2929138655 Bacteria 5810547
814 2933011964 2933011516 Bacteria 5439334
815 2933011980 2933011516 Bacteria 5439334
816 2933020824 2933016740 Bacteria 6355406
817 2933588117 2933586486 Bacteria 7667493
818 2933590035 2933586486 Bacteria 7667493
819 2933598427 2933594066 Bacteria 5594265
820 2933598812 2933594066 Bacteria 5594265
821 2933599336 2933594066 Bacteria 5594265
822 2935899407 2935894831 Bacteria 6620579
823 2936373860 2936367885 Bacteria 7324495
824 2936386377 2936381700 Bacteria 7006523
825 2937011978 2937009748 Bacteria 6746052
826 2937033794 2937029754 Bacteria 6424026
827 2937039851 2937036028 Bacteria 6846469
828 2937090321 2937084907 Bacteria 6618516
829 2957425349 2957422303 Bacteria 7172205
830 2957491068 2957484790 Bacteria 6703082
831 2960599097 2960597568 Bacteria 6550735
832 2960615032 2960610863 Bacteria 6691244
833 2960651011 2960645483 Bacteria 7211087
834 2960686362 2960680706 Bacteria 6624464
835 2960694458 2960693952 Bacteria 6749742
836 2964701000 2964698721 Bacteria 6765331
837 2967713023 2967706974 Bacteria 7186053
838 2967732180 2967728569 Bacteria 6641507
839 2970141397 2970136068 Bacteria 7207982
840 2977536695 2977530762 Bacteria 6951399
841 2977537098 2977530762 Bacteria 6951399
842 2977550901 2977544691 Bacteria 6875412
843 2979095388 2979089926 Bacteria 5670289
844 2979097640 2979095461 Bacteria 5669583
845 2979103076 2979100975 Bacteria 5423623
846 2984513884 2984509177 Bacteria 5274802
847 2984523431 2984518228 Bacteria 5277463
848 2984542548 2984537506 Bacteria 5277481
849 2984587013 2984587000 Bacteria 5263363
850 2984588982 2984587000 Bacteria 5263363
851 2984606524 2984601300 Bacteria 5455244
852 2989350240 2989349275 Bacteria 6349068
853 2989350729 2989349275 Bacteria 6349068
854 2989776470 2989771324 Bacteria 5605128
855 2989780853 2989776772 Bacteria 4843317
856 2989781162 2989776772 Bacteria 4843317
857 2989781399 2989776772 Bacteria 4843317
858 2996313703 2996310559 Bacteria 6357320
859 3005421887 3005416602 Bacteria 7064308
860 3005452529 3005445848 Bacteria 6906074
861 639650640 639633055 Bacteria 7751309
862 643692037 643692032 Bacteria 6891900
863 650741334 650716007 Bacteria 5573770
864 8003574997 8003570095 Bacteria 5747666
865 8003999227 8003992118 Bacteria 7266902
866 8004006269 8003999396 Bacteria 7063185
867 8005249970 8005246636 Bacteria 4933972
868 8005250542 8005246636 Bacteria 4933972
869 8005259864 8005258706 Bacteria 6184835
870 8005276543 8005275841 Bacteria 6929066
871 8005284939 8005282627 Bacteria 6675747
872 8005293772 8005289223 Bacteria 6634003
873 8005301763 8005301065 Bacteria 6614431
874 8005301978 8005301065 Bacteria 6614431
875 8005321162 8005314921 Bacteria 7072929
876 8005386532 8005382845 Bacteria 6732062
877 8005386798 8005382845 Bacteria 6732062
878 8005402193 8005395548 Bacteria 6806915
879 8005465760 8005460587 Bacteria 7157962
880 8005503822 8005497431 Bacteria 6477605
881 8005549954 8005542996 Bacteria 7077758
882 8005624694 8005619151 Bacteria 7030230
883 8005674530 8005668836 Bacteria 6953162
884 8005675601 8005668836 Bacteria 6953162
885 8005688511 8005682033 Bacteria 6726518
886 8005693087 8005688590 Bacteria 6610080
887 8018131697 8018127388 Bacteria 7351159
888 8018151686 8018150411 Bacteria 5549903
889 8018152363 8018150411 Bacteria 5549903
890 8018154304 8018150411 Bacteria 5549903
891 8018163454 8018163183 Bacteria 7277977
892 8018169600 8018163183 Bacteria 7277977
893 8018180598 8018176218 Bacteria 6896178
894 8023682484 8023680758 Bacteria 7729763
895 8023685714 8023680758 Bacteria 7729763
896 8024491999 8024486573 Bacteria 6540512
897 8024504125 8024501048 Bacteria 6427847
898 8054465648 8054460903 Bacteria 4872905
899 8056377646 8056375014 Bacteria 7006639
900 8056384351 8056382006 Bacteria 6408074
901 8056877946 8056875544 Bacteria 4355797
902 8057580183 8057575449 Bacteria 7367519
903 8057880185 8057874678 Bacteria 7494653
904 Ga0307515_10009315
905 JGI25158J39367_1000002
906 JGI25152J39213_1000088
907 JGI25152J39213_1000388
908 JGI25150J39212_1000058
909 JGI25150J39212_1000173
910 JGI25150J39212_1000263
911 JGI25159J45721_1000036
912 JGI25159J45721_1000133
913 JGI25159J45721_1000386
914 JGI25151J46595_10000053
915 JGI25151J46595_10000241
916 JGI25151J46595_10001708
917 JGI25151J46595_10018085
918 JGI25165J46597_1000238
919 JGI25153J46596_10000599
920 JGI25153J46596_10001077
921 JGI25153J46596_10001647
922 JGI25153J46596_10002006
923 JGI25153J46596_10002081
924 JGI25153J46596_10021347
925 rootH1_10035514
926 rootH2_10009192
927 JGI25160J50197_1000060
928 JGI25160J50197_1000300
929 JGI25160J50197_1000435
930 JGI25160J50197_1005359
931 JGI25161J50226_1000026
932 JGI25161J50226_1003705
933 Ga0055526_1000385
934 Ga0055526_1000402
935 Ga0055526_1003682
936 Ga0055524_1000289
937 Ga0055524_1001026
938 Ga0055524_1002547
939 Ga0055524_1003262
940 Ga0055524_1004337
941 Ga0055524_1018360
942 Ga0055528_1000018
943 Ga0055528_1000200
944 Ga0055528_1000294
945 Ga0055528_1000544
946 Ga0055528_1005772
947 Ga0055540_1000117
948 Ga0055540_1000273
949 Ga0055540_1000347
950 Ga0055540_1000864
951 Ga0055540_1003092
952 Ga0055531_10000098
953 Ga0055531_10000106
954 Ga0055531_10001141
955 Ga0055531_10013957
956 Ga0058692_1002045
957 Ga0055543_1000085
958 Ga0055543_1000456
959 Ga0055543_1001086
960 Ga0065165_1000160
961 Ga0065165_1000349
962 Ga0065165_1000777
963 Ga0065165_1001509
964 Ga0065165_1009482
965 Ga0065165_1017848
966 Ga0070665_100044376
967 Ga0070665_100129548
968 Ga0075365_10000067
969 Ga0075365_10000304
970 Ga0075365_10001094
971 Ga0075365_10001161
972 Ga0075365_10001886
973 Ga0075365_10002599
974 Ga0075363_100000012
975 Ga0075363_100000179
976 Ga0075364_10000052
977 Ga0075364_10000069
978 Ga0075364_10000997
979 Ga0075364_10002776
980 Ga0075362_10000078
981 Ga0075362_10000205
982 Ga0075367_10001185
983 Ga0075367_10154125
984 Ga0075369_10000025
985 Ga0075369_10000385
986 Ga0075366_10001234
987 Ga0075370_10000172
988 Ga0075370_10000515
989 Ga0075370_10000963
990 Ga0075370_10038495
991 Ga0079104_1000077
992 Ga0079104_1000159
993 Ga0079104_1000779
994 Ga0099826_10000042
995 Ga0099826_10000174
996 Ga0099826_10000400
997 Ga0099826_10000587
998 Ga0105244_10020766
999 Ga0105237_10000038
1000 Ga0123340_1000038
1001 Ga0123341_1001185
1002 Ga0123341_1002628
1003 Ga0123341_1015275
1004 Ga0123342_1001115
1005 Ga0123342_1005676
1006 Ga0123342_1006073
1007 Ga0123342_1009382
1008 Ga0123342_1014402
1009 Ga0105239_10000065
1010 Ga0157371_10000619
1011 Ga0157371_10003124
1012 Ga0157369_10008383
1013 Ga0157369_10013894
1014 Ga0214544_1000097
1015 Ga0214544_1011809
1016 Ga0214542_1000418
1017 Ga0214543_1004049
1018 Ga0214543_1004720
1019 Ga0228711_1001962
1020 Ga0228711_1003907
1021 Ga0228711_1004556
1022 Ga0228711_1013283
1023 Ga0228711_1014195
1024 Ga0228711_1014938
1025 Ga0228711_1015600
1026 Ga0228710_1001022
1027 Ga0228710_1002079
1028 Ga0228710_1004154
1029 Ga0228710_1004792
1030 Ga0228710_1006148
1031 Ga0228710_1011708
1032 Ga0228710_1013458
1033 Ga0228710_1014290
1034 Ga0228710_1025851
1035 Ga0228710_1040392
1036 Ga0209436_100016
1037 Ga0209436_100055
1038 Ga0209437_100250
1039 Ga0207425_1000083
1040 Ga0207425_1000104
1041 Ga0209677_100569
1042 Ga0209129_1000098
1043 Ga0209129_1000149
1044 Ga0209129_1000213
1045 Ga0209129_1000821
1046 Ga0209233_1000214
1047 Ga0209233_1000238
1048 Ga0209233_1001008
1049 Ga0209455_1016450
1050 Ga0209673_1000055
1051 Ga0209673_1000086
1052 Ga0209673_1000126
1053 Ga0209673_1000573
1054 Ga0209673_1000867
1055 Ga0209673_1001071
1056 Ga0209673_1001381
1057 Ga0209673_1001681
1058 Ga0209673_1005181
1059 Ga0209130_1000073
1060 Ga0209130_1000136
1061 Ga0209130_1004991
1062 Ga0209676_1000860
1063 Ga0209676_1001831
1064 Ga0209025_1000044
1065 Ga0209025_1000142
1066 Ga0209025_1000181
1067 Ga0209025_1001870
1068 Ga0209025_1001930
1069 Ga0209025_1045650
1070 Ga0209564_1000168
1071 Ga0209564_1000368
1072 Ga0209564_1000799
1073 Ga0209564_1000879
1074 Ga0209564_1001155
1075 Ga0209564_1010175
1076 Ga0209564_1018050
1077 Ga0209564_1023475
1078 Ga0209564_1035741
1079 Ga0209758_1000076
1080 Ga0209758_1000156
1081 Ga0209758_1000300
1082 Ga0209758_1000374
1083 Ga0209758_1000527
1084 Ga0209758_1001917
1085 Ga0209758_1002339
1086 Ga0209758_1003608
1087 Ga0209050_1001764
1088 Ga0209050_1008223
1089 Ga0209050_1019731
1090 Ga0209256_1000147
1091 Ga0209256_1000228
1092 Ga0209256_1000429
1093 Ga0209256_1001033
1094 Ga0209256_1001075
1095 Ga0209256_1001203
1096 Ga0209256_1001269
1097 Ga0209256_1012257
1098 Ga0207426_1000140
1099 Ga0207426_1000253
1100 Ga0207426_1000283
1101 Ga0207426_1000298
1102 Ga0207426_1001295
1103 Ga0207426_1002538
1104 Ga0209051_1000032
1105 Ga0209051_1000132
1106 Ga0209051_1000192
1107 Ga0209051_1000223
1108 Ga0209051_1001407
1109 Ga0209051_1002366
1110 Ga0209051_1009302
1111 Ga0209051_1021342
1112 Ga0209051_1042721
1113 Ga0209257_1000209
1114 Ga0209257_1000300
1115 Ga0209257_1000651
1116 Ga0209257_1001498
1117 Ga0209257_1001518
1118 Ga0209257_1001594
1119 Ga0209257_1002215
1120 Ga0209257_1002726
1121 Ga0207671_10000418
1122 Ga0207640_10101895
1123 Ga0209281_1000035
1124 Ga0209281_1000282
1125 Ga0209281_1000831
1126 Ga0209371_1000280
1127 Ga0209371_1001859
1128 Ga0209371_1003523
1129 Ga0209371_1004410
1130 Ga0209282_1000065
1131 Ga0209282_1000177
1132 Ga0209282_1000442
1133 Ga0268266_10005108
1134 Ga0268266_10008874
1135 Ga0268266_10113293
1136 Ga0307515_10008808
1137 Ga0268256_1000234
1138 Ga0268256_1002202
1139 Ga0268256_1003728
1140 Ga0268256_1004454
1141 Ga0307513_10008087
1142 Ga0307513_10021712
1143 Ga0307406_10014500
1144 Ga0307406_10056777
1145 Ga0307406_10117239
1146 Ga0315914_1000040
1147 Ga0315914_1002592
1148 Ga0315914_1004661
1149 Ga0315914_1005491
1150 Ga0307510_10001375
1151 Ga0315913_1000020
1152 Ga0315913_1001204
1153 Ga0315913_1002090
1154 Ga0315913_1003695
1155 Ga0315915_1000027
1156 Ga0315915_1001697
1157 Ga0315915_1003326
1158 Ga0373927_0000795
1159 Ga0373927_0001042
1160 Ga0373925_0000579
1161 Ga0395905_0001478
1162 Ga0439465_0000924
1163 Ga0451802_1639378
1164 Ga0451833_0510751
1165 Ga0451833_0616654
1166 Ga0451833_1035954
1167 Ga0451835_0135293
1168 Ga0451835_0805993
1169 Ga0451837_0223534
1170 Ga0451839_0624728
1171 Ga0451841_0374479
1172 Ga0451847_0846976
1173 Ga0451849_0103780
1174 Ga0451849_0719155
1175 Ga0451849_0790399
1176 Ga0451851_0007264
1177 Ga0451851_0008851
1178 Ga0451851_0077690
1179 Ga0451851_1261333
1180 Ga0451843_0530825
1181 Ga0451843_0923495
1182 Ga0451843_1101749
1183 Ga0451843_1373731
1184 Ga0451855_0142693
1185 Ga0451855_1544233
1186 Ga0451853_0015460
1187 Ga0451853_0330971
1188 Ga0451853_1979795
1189 Ga0451853_2031544
1190 Ga0495617_029416
1191 Ga0495629_0012590
1192 Ga0495638_0000077
1193 Ga0495638_0000181
1194 Ga0495638_0000420
1195 Ga0495638_0001889
1196 Ga0495607_0000367
1197 Ga0495607_0107414
1198 Ga0495607_0117913
1199 Ga0495583_0002816
1200 Ga0495606_0042664
1201 Ga0495610_0001873
1202 Ga0495610_0002851
1203 Ga0495610_0003544
1204 Ga0495610_0005549
1205 Ga0495620_0000489
1206 Ga0495620_0058480
1207 Ga0495620_0070615
1208 Ga0495632_0000386
1209 Ga0495643_0000485
1210 Ga0495643_0002049
1211 Ga0495643_0039710
1212 Ga0495648_0000838
1213 Ga0495648_0001751
1214 Ga0495648_0018593
1215 Ga0495648_0153241
1216 Ga0495663_0000326
1217 Ga0495663_0004624
1218 Ga0495663_0045847
1219 Ga0495611_0000364
1220 Ga0495611_0000829
1221 Ga0495611_0018105
1222 Ga0495611_0032447
1223 Ga0495625_0001036
1224 Ga0495625_0051601
1225 Ga0495661_0062036
1226 Ga0495588_0000720
1227 Ga0495588_0002839
1228 Ga0495588_0004231
1229 Ga0495670_0001841
1230 Ga0495670_0122495
1231 Ga0495671_0001668
1232 Ga0495671_0012222
1233 Ga0495649_0005013
1234 Ga0495649_0084287
1235 Ga0495589_0076171
1236 Ga0495660_0010902
1237 Ga0495687_000105
1238 Ga0495687_000954
1239 Ga0495687_000955
1240 Ga0495687_030246
1241 Ga0495681_0000112
1242 Ga0495681_0000415
1243 Ga0495686_0000851
1244 Ga0495686_0001213
1245 Ga0495686_0047109
1246 Ga0496104_0128253
1247 Ga0496104_0137990
1248 Ga0496106_0000529
1249 Ga0496111_0001354
1250 Ga0496116_0000309
1251 Ga0496116_0000649
1252 Ga0496116_0000703
1253 Ga0496116_0001292
1254 Ga0496116_0001860
1255 Ga0496116_0002710
1256 Ga0496116_0004988
1257 Ga0496116_0011024
1258 Ga0496116_0022588
1259 Ga0496116_0100610
1260 Ga0496117_0000105
1261 Ga0496117_0000277
1262 Ga0496117_0001285
1263 Ga0496117_0003010
1264 Ga0496117_0003993
1265 Ga0496117_0004628
1266 Ga0496117_0016964
1267 Ga0496117_0063553
1268 Ga0496117_0071307
1269 Ga0496117_0102111
1270 Ga0496118_0000168
1271 Ga0496118_0000518
1272 Ga0496118_0005024
1273 Ga0496118_0007709
1274 Ga0496118_0013862
1275 Ga0496118_0051177
1276 Ga0496118_0062357
1277 Ga0496118_0098222
1278 Ga0496118_0137107
1279 Ga0496118_0208740
1280 Ga0496119_0000500
1281 Ga0496119_0000870
1282 Ga0496119_0001142
1283 Ga0496119_0002658
1284 Ga0496119_0002755
1285 Ga0496119_0004711
1286 Ga0496119_0006234
1287 Ga0496119_0039459
1288 Ga0496119_0071654
1289 Ga0496119_0091781
1290 Ga0496120_0000532
1291 Ga0496120_0000629
1292 Ga0496120_0000818
1293 Ga0496120_0001909
1294 Ga0496120_0002366
1295 Ga0496120_0007575
1296 Ga0496120_0021418
1297 Ga0496120_0037621
1298 Ga0496120_0039440
1299 Ga0496120_0085835
1300 Ga0496121_0000033
1301 Ga0496121_0000836
1302 Ga0496121_0000936
1303 Ga0496121_0002586
1304 Ga0496121_0004086
1305 Ga0496121_0004675
1306 Ga0496121_0012372
1307 Ga0496121_0042168
1308 Ga0496121_0050477
1309 Ga0496121_0059020
1310 Ga0496121_0073393
1311 Ga0496121_0111054
1312 Ga0496122_0000193
1313 Ga0496122_0000300
1314 Ga0496122_0000868
1315 Ga0496122_0000870
1316 Ga0496122_0000972
1317 Ga0496122_0001241
1318 Ga0496122_0001563
1319 Ga0496122_0002116
1320 Ga0496122_0003762
1321 Ga0496122_0011427
1322 Ga0496122_0012759
1323 Ga0496122_0014036
1324 Ga0496122_0021629
1325 Ga0496122_0021871
1326 Ga0496122_0039919
1327 Ga0496122_0049472
1328 Ga0496122_0053087
1329 Ga0496122_0054115
1330 Ga0496122_0058206
1331 Ga0496122_0062790
1332 Ga0496122_0171830
1333 Ga0496123_0000018
1334 Ga0496123_0000154
1335 Ga0496123_0000664
1336 Ga0496123_0000682
1337 Ga0496123_0000823
1338 Ga0496123_0001704
1339 Ga0496123_0004051
1340 Ga0496123_0006398
1341 Ga0496123_0014890
1342 Ga0496123_0019734
1343 Ga0496123_0020643
1344 Ga0496123_0023344
1345 Ga0496123_0044100
1346 Ga0496123_0044175
1347 Ga0496123_0101705
1348 Ga0496124_0000184
1349 Ga0496124_0000758
1350 Ga0496124_0001005
1351 Ga0496124_0001655
1352 Ga0496124_0002108
1353 Ga0496124_0002173
1354 Ga0496124_0002207
1355 Ga0496124_0002595
1356 Ga0496124_0005493
1357 Ga0496124_0006535
1358 Ga0496124_0012572
1359 Ga0496124_0024665
1360 Ga0496124_0032790
1361 Ga0496124_0075492
1362 Ga0496124_0098262
1363 Ga0496124_0175103
1364 Ga0496124_0179478
1365 Ga0496124_0234845
1366 Ga0496125_0000034
1367 Ga0496125_0000152
1368 Ga0496125_0002100
1369 Ga0496125_0004668
1370 Ga0496125_0008428
1371 Ga0496125_0017522
1372 Ga0496125_0039446
1373 Ga0496125_0067801
1374 Ga0496125_0083078
1375 Ga0496125_0084216
1376 Ga0496125_0101374
1377 Ga0496125_0128462
1378 Ga0496126_0000243
1379 Ga0496126_0000271
1380 Ga0496126_0000559
1381 Ga0496126_0001377
1382 Ga0496126_0002639
1383 Ga0496126_0004820
1384 Ga0496126_0008060
1385 Ga0496126_0017157
1386 Ga0496126_0017557
1387 Ga0496126_0043360
1388 Ga0496126_0075415
1389 Ga0496126_0088984
1390 Ga0496126_0208507
1391 Ga0496126_0325160
1392 Ga0495678_000295
1393 Ga0495678_000877
1394 Ga0501031_0005085
1395 Ga0501032_0012143
1396 Ga0501033_0000054
1397 Ga0501033_0002813
1398 Ga0501033_0013840
1399 Ga0501034_0024273
1400 Ga0501034_0195432
1401 Ga0501036_0016513
1402 Ga0501037_0013013
1403 Ga0501038_0019191
1404 Ga0501039_0013864
1405 Ga0501047_0005149
1406 Ga0501035_0000231
1407 Ga0501035_0001626
1408 Ga0501035_0019917
1409 Ga0501044_0026265
1410 Ga0501045_0262145
1411 nmdc:mga03683_118_c1
1412 nmdc:mga03n38_15_c1
1413 nmdc:mga03n38_4343_c1
1414 nmdc:mga03n38_94_c1
1415 nmdc:mga00v17_1015_c1
1416 nmdc:mga00v17_1_c1
1417 nmdc:mga00v17_28061_c1
1418 nmdc:mga00v17_4382_c1
1419 nmdc:mga00v17_49_c1
1420 nmdc:mga0yw44_105_c1
1421 nmdc:mga0yw44_341_c1
1422 nmdc:mga0yw44_56_c1
1423 nmdc:mga0yw44_833_c1
1424 nmdc:mga0yw44_85_c1
1425 nmdc:mga0yw44_92_c1
1426 nmdc:mga0k408_1039_c1
1427 nmdc:mga0k408_434_c1
1428 nmdc:mga06z11_10566_c1
1429 nmdc:mga07m45_134_c1
1430 nmdc:mga07m45_40902_c1
1431 nmdc:mga07m45_651_c1
1432 nmdc:mga07m45_676_c1
1433 nmdc:mga07m45_88_c1
1434 nmdc:mga0sz30_52_c1
1435 nmdc:mga0sz30_7442_c1
1436 Ga0500578_0002023
1437 Ga0500578_0007500
1438 Ga0500583_0000267
1439 Ga0500583_0001881
1440 Ga0500651_0030225
1441 Ga0500555_005812
1442 Ga0500560_000391
1443 Ga0500572_014614
1444 Ga0500608_000517
1445 Ga0500608_000528
1446 Ga0500608_045486
1447 Ga0500618_000097
1448 Ga0500618_000303
1449 Ga0500618_000400
1450 Ga0500618_000464
1451 Ga0500618_001453
1452 Ga0500618_002840
1453 Ga0500658_0000065
1454 Ga0500561_0000084
1455 Ga0500564_004742
1456 Ga0500568_0000578
1457 Ga0500568_0000791
1458 Ga0500568_0055408
1459 Ga0500573_0012369
1460 Ga0500573_0035132
1461 Ga0500573_0040514
1462 Ga0500574_000012
1463 Ga0500574_000028
1464 Ga0500590_001200
1465 Ga0500616_0002538
1466 Ga0500622_0000037
1467 Ga0500622_0000278
1468 Ga0500624_001280
1469 Ga0500624_004001
1470 Ga0500634_0103901
1471 Ga0500638_000034
1472 Ga0500636_0000083
1473 Ga0500636_0000091
1474 Ga0500636_0000096
1475 Ga0500636_0003024
1476 Ga0500636_0010421
1477 Ga0500636_0017470
1478 Ga0500636_0082153
1479 Ga0500636_0105569
1480 Ga0500636_0141832
1481 2509378658
1482 2509386513
1483 2509392753
1484 2509441446
1485 2510137256
1486 2510841525
1487 2511499274
1488 2512531237
1489 2512974369
1490 2513573033
1491 2513586392
1492 2513607147
1493 2513620643
1494 2513635503
1495 2513713560
1496 2513869930
1497 2513881828
1498 2513886365
1499 2513902690
1500 2513929571
1501 2513929584
1502 2514001413
1503 2514002123
1504 2515109942
1505 2515634239
1506 2515635663
1507 2515646414
1508 2515657741
1509 2517041031
1510 2517042930
1511 2517099923
1512 2524460880
1513 2524463114
1514 2524463451
1515 2530649481
1516 2551697903
1517 2551713885
1518 2554246076
1519 2554249058
1520 2554249778
1521 2558862544
1522 2559298609
1523 2585168798
1524 2585258080
1525 2585281765
1526 2585282737
1527 2585336051
1528 2585553954
1529 2585563696
1530 2585564501
1531 2585840881
1532 2585846210
1533 2585846880
1534 2585908910
1535 2587984233
1536 2599335652
1537 2599336143
1538 2599413893
1539 2599413908
1540 2599606445
1541 2599606637
1542 2599722957
1543 2599723370
1544 2600197003
1545 2601612508
1546 2601749375
1547 2616310029
1548 2616311744
1549 2616550863
1550 2643810572
1551 2643810888
1552 2643815063
1553 2643858438
1554 2643918216
1555 2644008179
1556 2644047846
1557 2644194998
1558 2644195637
1559 2644200536
1560 2644208037
1561 2644240129
1562 2644300806
1563 2644332311
1564 2644485001
1565 2644496213
1566 2644520040
1567 2644522995
1568 2644651439
1569 2644659028
1570 2692317873
1571 2692320857
1572 2719383321
1573 2719669139
1574 2720489833
1575 2720629083
1576 2720773156
1577 2720777904
1578 2724087646
1579 2724093185
1580 2725949128
1581 2738799645
1582 2738805183
1583 2738948076
1584 2739037605
1585 2753462859
1586 2766062419
1587 2778176787
1588 2778179753
1589 2778179977
1590 2778180059
1591 2778180283
1592 2792623767
1593 2792630000
1594 2792641078
1595 2793283192
1596 2793298086
1597 2793324198
1598 2793328639
1599 2793343389
1600 2793345208
1601 2793363462
1602 2793365185
1603 2793370601
1604 2805931277
1605 2806048236
1606 2806051201
1607 2806057627
1608 2806062411
1609 2806076275
1610 2808990131
1611 2819244879
1612 2819561574
1613 2819688105
1614 2821129693
1615 2838034540
1616 2838042159
1617 2838042172
1618 2838054694
1619 2838669208
1620 2838685866
1621 2838687754
1622 2838691045
1623 2838699376
1624 2838701131
1625 2838712857
1626 2838718599
1627 2838723597
1628 2838742333
1629 2841846248
1630 2841851684
1631 2841862804
1632 2841862820
1633 2841870159
1634 2842082490
1635 2842111841
1636 2842117283
1637 2842123375
1638 2842130121
1639 2842146012
1640 2842146804
1641 2842174804
1642 2842191285
1643 2842202696
1644 2842215641
1645 2842222587
1646 2842228362
1647 2842242447
1648 2842250966
1649 2842265492
1650 2842272214
1651 2842275520
1652 2842290205
1653 2842296514
1654 2842302320
1655 2842304065
1656 2842375463
1657 2842382797
1658 2842389488
1659 2842400979
1660 2842401500
1661 2842407939
1662 2842408287
1663 2842414526
1664 2842414649
1665 2842421038
1666 2842421596
1667 2842428457
1668 2842435071
1669 2842442066
1670 2842453701
1671 2842469403
1672 2842481287
1673 2842488225
1674 2842488535
1675 2842499029
1676 2842500720
1677 2842508128
1678 2842513987
1679 2842514800
1680 2842519662
1681 2842519678
1682 2842524242
1683 2842526957
1684 2844169315
1685 2844462232
1686 2844462327
1687 2847423628
1688 2847423762
1689 2850083366
1690 2854896637
1691 2854917907
1692 2855878316
1693 2857524017
1694 2857537569
1695 2896387912
1696 2899848141
1697 2913298751
1698 2913313084
1699 2915985616
1700 2919119042
1701 2919170855
1702 2919177365
1703 2919177436
1704 2920762479
1705 2921290332
1706 2923562322
1707 2924171053
1708 2924198213
1709 2924226694
1710 2924230982
1711 2926759474
1712 2926760199
1713 2926765363
1714 2929142711
1715 2929143538
1716 2933011964
1717 2933011980
1718 2933020824
1719 2933588117
1720 2933590035
1721 2933598427
1722 2933598812
1723 2933599336
1724 2935899407
1725 2936373860
1726 2936386377
1727 2937011978
1728 2937033794
1729 2937039851
1730 2937090321
1731 2957425349
1732 2957491068
1733 2960599097
1734 2960615032
1735 2960651011
1736 2960686362
1737 2960694458
1738 2964701000
1739 2967713023
1740 2967732180
1741 2970141397
1742 2977536695
1743 2977537098
1744 2977550901
1745 2979095388
1746 2979097640
1747 2979103076
1748 2984513884
1749 2984523431
1750 2984542548
1751 2984587013
1752 2984588982
1753 2984606524
1754 2989350240
1755 2989350729
1756 2989776470
1757 2989780853
1758 2989781162
1759 2989781399
1760 2996313703
1761 3005421887
1762 3005452529
1763 639650640
1764 643692037
1765 650741334
1766 8003574997
1767 8003999227
1768 8004006269
1769 8005249970
1770 8005250542
1771 8005259864
1772 8005276543
1773 8005284939
1774 8005293772
1775 8005301763
1776 8005301978
1777 8005321162
1778 8005386532
1779 8005386798
1780 8005402193
1781 8005465760
1782 8005503822
1783 8005549954
1784 8005624694
1785 8005674530
1786 8005675601
1787 8005688511
1788 8005693087
1789 8018131697
1790 8018151686
1791 8018152363
1792 8018154304
1793 8018163454
1794 8018169600
1795 8018180598
1796 8023682484
1797 8023685714
1798 8024491999
1799 8024504125
1800 8054465648
1801 8056377646
1802 8056384351
1803 8056877946
1804 8057580183
1805 8057880185

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF11972

HTH_13

HTH DNA binding domain

353

405

0.99

PF07756

DUF1612

Protein of unknown function (DUF1612)

218

345

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
7cb8-assembly2.cif.gz_B structure of a fic-domain protein from mycobacterium marinum in complex with cdp 0.6853 203 379
8b9x-assembly2.cif.gz_B chimeric protein of human ufm1 e3 ligase, ufl1, and ddrgk1 0.6694 321 378
3f72-assembly3.cif.gz_E crystal structure of the staphylococcus aureus pi258 cadc metal binding site 2 mutant 0.6517 311 381
1u2w-assembly2.cif.gz_C crystal structure of the staphylococcus aureus pi258 cadc 0.6487 311 382
7cb8-assembly1.cif.gz_A structure of a fic-domain protein from mycobacterium marinum in complex with cdp 0.6133 12 379
ID Description Score Start End Superfamily
af_Q54E53_292_358_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.792 327 383 1.10.10.10
af_Q54E53_292_358_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.681 327 383 1.10.10.10
1u2wC00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.6487 311 382 1.10.10.10
af_A4HZ77_361_438_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.605 308 383 1.10.10.10
af_Q8IJM0_344_421_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.5905 303 383 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A1U9Z9T6-F1-model_v4 DUF1612 domain-containing protein 0.9763 195 305
AF-A0A1U9Z9T6-F1-model_v4 DUF1612 domain-containing protein 0.9511 195 305
AF-A0A7X0DEG0-F1-model_v4 DNA mismatch repair protein MutH 0.8821 196 383
AF-A0A7X0DEG0-F1-model_v4 DNA mismatch repair protein MutH 0.8778 196 383
AF-A0A7W5RL48-F1-model_v4 deleted 0.8669 195 383

Map