F485261

General Info

Members Datasets Scaffolds Average Seq Length
903 768 1806 306

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2791355094|2792638591
Length 315
Sequence RTSFPRMTTHLYENALFQEHKVPEGHPERPDRLRALNLALEHPNFAPLKRVEASRGSEELVLLAHTEEHLRSIARAVPDDDISQIEADTYASPSSFEAALTGIGGAVAAIDAVFVGEADNAFVAARPPGHHAEKNKAMGFCFFNTIAIAARYAQKAHGVERVAIVDWDVHHGNGTQDIFWNDPSVLFCSTHQMPLYPGTGAKEETGVKHNIVNAPLSPNSGSEHFRDAFRTRVLSALDNFRPDLVLISAGFDSHYRDPLAQINLVAEDFDWATGRLMEAAGRSAGNRVVSMLEGGYDLQGLAESAAMHIMRLMRG

Samples

Sample ID Description Type Environment
1 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
4 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
5 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
6 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
7 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
8 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
9 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
10 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
11 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
12 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
13 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
14 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
15 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
16 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
17 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
18 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
19 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
20 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
23 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
24 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
25 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
26 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
27 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
28 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
29 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
30 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
31 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
32 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
33 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
34 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
35 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
36 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
37 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
38 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
39 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
40 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
41 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
42 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
43 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
44 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
45 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
46 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
47 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
48 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
49 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
50 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
51 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
52 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
53 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
54 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
55 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
56 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
57 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
58 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
59 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
60 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
61 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
62 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
63 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
64 3300022739 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules Metagenome Nodule
65 3300022740 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules Metagenome Nodule
66 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
67 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
68 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
69 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
70 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
71 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
72 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
73 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
74 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
75 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
76 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
77 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
78 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
79 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
80 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
81 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
82 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
100 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
101 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
102 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
103 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
106 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
107 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
108 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
109 3300031967 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules Metagenome Nodule
110 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
111 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
112 3300033430 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules Metagenome Nodule
113 3300033464 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules Metagenome Nodule
114 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
115 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
116 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
117 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
118 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
119 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
120 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
121 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
122 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
123 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
124 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
125 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
126 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
127 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
128 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
129 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
130 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
131 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
132 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
133 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
134 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
135 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
136 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
137 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
138 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
139 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
140 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
141 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
142 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
143 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
144 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
145 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
146 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
147 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
148 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
149 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
150 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
151 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
152 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
153 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
154 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
155 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
156 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
157 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
158 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
159 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
160 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
161 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
162 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
163 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
164 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
165 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
166 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
167 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
168 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
169 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
170 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
171 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
172 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
173 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
174 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
175 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
176 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
177 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
178 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
179 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
180 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
181 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
182 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
183 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
184 2791355094 Sinorhizobium sp. BJ1 Isolate Nodule
185 2503198000 Mesorhizobium opportunistum WSM2075 Isolate Nodule
186 2508501122 Ensifer yinggardensis WSM1721 Isolate Nodule
187 2508501123 Mesorhizobium sp. WSM3626 Isolate Nodule
188 2508501127 Mesorhizobium sp. WSM2561 Isolate Nodule
189 2509276018 Mesorhizobium ciceri CMG6 Isolate Nodule
190 2509276019 Ensifer aridi TW10 Isolate Nodule
191 2509276022 Mesorhizobium australicum WSM2073 Isolate Nodule
192 2510065057 Sinorhizobium meliloti WSM1022 Isolate Nodule
193 2510065059 Mesorhizobium ciceri WSM4083 Isolate Nodule
194 2511231027 Phyllobacterium sp. YR531 Isolate Rhizosphere
195 2511231052 Sinorhizobium meliloti AK58 Isolate Nodule
196 2512047086 Sinorhizobium arboris LMG 14919 Isolate Nodule
197 2512875016 Mesorhizobium japonicum R7A Isolate Nodule
198 2512875024
199 2512875026 Sinorhizobium medicae WSM1115 Isolate Nodule
200 2513237086 Sinorhizobium meliloti MVII-I Isolate Nodule
201 2513237089 Sinorhizobium medicae DI28 Isolate Nodule
202 2513237090 Mesorhizobium sp. WSM3224 Isolate Nodule
203 2513237091 Sinorhizobium meliloti RRI128 Isolate Nodule
204 2513237140 Sinorhizobium meliloti GVPV12 Isolate Nodule
205 2513237143 Sinorhizobium meliloti Mlalz-1 Isolate Nodule
206 2513237156 Sinorhizobium medicae WSM1369 Isolate Nodule
207 2513237159 Rhizobium giardinii bv. giardinii H152 Isolate Nodule
208 2513237160 Sinorhizobium medicae WSM244 Isolate Nodule
209 2513237164 Mesorhizobium loti CJ3sym Isolate Nodule
210 2513237305 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
211 2513237351 Mesorhizobium alhagi CCNWXJ12-2 Isolate Nodule
212 2515154107 Sinorhizobium meliloti 4H41 Isolate Nodule
213 2516143018 Ensifer sp. BR816 Isolate Nodule
214 2516653046 Sinorhizobium meliloti BO21CC Isolate Nodule
215 2517487022 Sinorhizobium medicae WSM4191 Isolate Nodule
216 2524023207 Ensifer sp. USDA 6670 Isolate Nodule
217 2537561587 Agrobacterium tumefaciens Cherry 2E-2-2 Isolate Rhizosphere
218 2551306084 Sinorhizobium meliloti 5A14 Isolate Nodule
219 2551306085 Sinorhizobium meliloti AE608H Isolate Nodule
220 2551306086 Sinorhizobium meliloti AK11 Isolate Nodule
221 2551306087 Sinorhizobium meliloti A0643DD Isolate Nodule
222 2551306089 Sinorhizobium meliloti 1A42 Isolate Nodule
223 2551306090 Sinorhizobium meliloti A0641M Isolate Nodule
224 2551306091 Sinorhizobium meliloti C0431A Isolate Nodule
225 2551306092 Sinorhizobium meliloti AK75 Isolate Nodule
226 2551306093 Sinorhizobium meliloti C0438LL Isolate Nodule
227 2554235003 Agrobacterium tumefaciens WRT31 Isolate Rhizosphere
228 2558860100 Sinorhizobium sp. PC2 Isolate Nodule
229 2558860242 Agrobacterium fabacearum P4 Isolate Rhizosphere
230 2582581283 Rhizobium sp. OK665 Isolate Rhizosphere
231 2582581306 Rhizobium sp. YR295 Isolate Rhizosphere
232 2582581865 Rhizobium sp. CF258 Isolate Rhizosphere
233 2582581866 Rhizobium sp. CF097 Isolate Rhizosphere
234 2588253730 Mesorhizobium huakuii 7653R Isolate Rhizosphere
235 2597489875 Mesorhizobium ciceri ca181 Isolate Unclassified
236 2599185210 Rhizobium sp. NFACC06-2 Isolate Rhizoplane
237 2599185301 Mesorhizobium sp. NFR06 Isolate Rhizoplane
238 2599185352 Sinorhizobium sp. NFACC03 Isolate Rhizoplane
239 2600255279 Rhizobium sp. NFIX01 Isolate Rhizoplane
240 2600255308 Rhizobium sp. NFIX02 Isolate Rhizoplane
241 2643221550 Mesorhizobium sp. Root552 Isolate Unclassified
242 2643221551 Mesorhizobium sp. Root1471 Isolate Unclassified
243 2643221555 Mesorhizobium sp. Root554 Isolate Unclassified
244 2643221557 Ensifer sp. Root558 Isolate Unclassified
245 2643221564 Mesorhizobium sp. Root157 Isolate Unclassified
246 2643221582 Rhizobium sp. Root651 Isolate Unclassified
247 2643221595 Mesorhizobium sp. Root695 Isolate Unclassified
248 2643221607 Rhizobium sp. Root73 Isolate Unclassified
249 2643221610 Ensifer sp. Root74 Isolate Unclassified
250 2643221618 Ensifer sp. Root231 Isolate Unclassified
251 2643221623 Aminobacter sp. DSM 101952 Root100 Isolate Unclassified
252 2643221626 Ensifer sp. Root31 Isolate Unclassified
253 2643221627 Mesorhizobium sp. Root102 Isolate Unclassified
254 2643221636 Rhizobium sp. Root1204 Isolate Unclassified
255 2643221637 Rhizobium sp. Root1212 Isolate Unclassified
256 2643221655 Ensifer sp. Root1252 Isolate Unclassified
257 2643221659 Ensifer sp. Root127 Isolate Unclassified
258 2643221668 Ensifer sp. Root423 Isolate Unclassified
259 2643221675 Ensifer sp. Root1298 Isolate Unclassified
260 2643221680 Ensifer sp. Root1312 Isolate Unclassified
261 2643221686 Rhizobium sp. Root1334 Isolate Unclassified
262 2643221688 Rhizobium sp. Root482 Isolate Unclassified
263 2643221689 Rhizobium sp. Root483D2 Isolate Unclassified
264 2643221693 Rhizobium sp. Root491 Isolate Unclassified
265 2643221698 Ensifer sp. Root142 Isolate Unclassified
266 2643221712 Ensifer sp. Root258 Isolate Unclassified
267 2643221718 Rhizobium sp. Root268 Isolate Unclassified
268 2643221723 Ensifer sp. Root278 Isolate Unclassified
269 2643221726 Ensifer sp. Root954 Isolate Unclassified
270 2657244999 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
271 2687453392 Mesorhizobium ciceri biserrulae WSM1284 Isolate Unclassified
272 2690316117 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
273 2693429783 Mesorhizobium sp. LCM 4577 Isolate Rhizosphere
274 2693429784 Mesorhizobium sp. LCM 4576 Isolate Rhizosphere
275 2721755686 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
276 2738543024 Aminobacter sp. AP02 Isolate Unclassified
277 2756170246 Mesorhizobium loti DSM 2626 Isolate Nodule
278 2765235802 Phyllobacterium bourgognense 31-25a Isolate Rhizoplane
279 2767802442 Phyllobacterium brassicacearum 29-15 Isolate Rhizoplane
280 2775506902 Phyllobacterium zundukense Tri-48 Isolate Unclassified
281 2775506904 Phyllobacterium zundukense Tri-38 Isolate Unclassified
282 2791355082 Ensifer alkalisoli YIC4027 Isolate Nodule
283 2791355091 Sinorhizobium sp. FG01 Isolate Nodule
284 2791355092 Sinorhizobium sp. NG07B Isolate Nodule
285 2791355123 Mesorhizobium sophorae ICMP 19535 Isolate Unclassified
286 2802428858 Sinorhizobium medicae M14-1 Isolate Nodule
287 2802428859 Sinorhizobium medicae SF3.41 Isolate Nodule
288 2802428860 Sinorhizobium medicae M19-1 Isolate Nodule
289 2802428861 Sinorhizobium medicae USDA1037 Isolate Nodule
290 2802428862 Sinorhizobium medicae M7-4 Isolate Nodule
291 2802428863 Sinorhizobium medicae M26-2 Isolate Nodule
292 2802429268 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
293 2808606387 Rhizobium sp. SJZ105 Isolate Rhizosphere
294 2818991439 Agrobacterium tumefaciens 1187 Isolate Unclassified
295 2837678835 Jiella endophytica CBS5Q-3 Isolate Unclassified
296 2838074704 Sinorhizobium terangae SEMIA 6460 Isolate Unclassified
297 2838675328 Agrobacterium radiobacter SEMIA 410 Isolate Nodule
298 2838714209 Agrobacterium radiobacter SEMIA 435 Isolate Nodule
299 2838719591 Agrobacterium radiobacter SEMIA 436 Isolate Nodule
300 2838724970 Agrobacterium radiobacter SEMIA 437 Isolate Nodule
301 2839993093 Phyllobacterium endophyticum PEPV15 Isolate Unclassified
302 2840764183 Phyllobacterium sophorae CCBAU 03422 Isolate Unclassified
303 2841734538 Mesorhizobium sp. M6A.T.Cr.TU.016.01.1.1 Isolate Nodule
304 2841846520 Agrobacterium radiobacter SEMIA 440 Isolate Nodule
305 2841859092 Agrobacterium radiobacter SEMIA 4026 Isolate Nodule
306 2842124991 Agrobacterium radiobacter SEMIA 434 Isolate Nodule
307 2842130223 Agrobacterium radiobacter SEMIA 441 Isolate Nodule
308 2842152218 Agrobacterium radiobacter SEMIA 457 Isolate Nodule
309 2842170452 Agrobacterium radiobacter SEMIA 461 Isolate Nodule
310 2842175837 Agrobacterium radiobacter SEMIA 462 Isolate Nodule
311 2842187318 Agrobacterium radiobacter SEMIA 464 Isolate Nodule
312 2842211629 Agrobacterium radiobacter SEMIA 472 Isolate Nodule
313 2842224351 Agrobacterium radiobacter SEMIA 480 Isolate Nodule
314 2842515876 Agrobacterium radiobacter SEMIA 4072 Isolate Nodule
315 2842521101 Rhizobium giardinii SEMIA 4084 Isolate Nodule
316 2842694124 Methylopila sp. R-72369 Isolate Unclassified
317 2842871566 Phyllobacterium sp. R-73111 Isolate Unclassified
318 2844002411 Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 Isolate Nodule
319 2844009547 Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1 Isolate Nodule
320 2844163670 Ensifer sp. 1H6 Isolate Unclassified
321 2847417321 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
322 2847670302 Mesorhizobium sp. M3A.F.Ca.ET.080.04.2.1 Isolate Nodule
323 2847686936 Mesorhizobium sp. M1A.F.Ca.IN.022.06.1.1 Isolate Nodule
324 2848992105 Sinorhizobium fredii CCBAU 25509 Isolate Unclassified
325 2850079185 Ensifer aridi JNVU TP6 Isolate Unclassified
326 2855825444 Sinorhizobium meliloti CXM1-105 Isolate Nodule
327 2855839649 Sinorhizobium meliloti AK555 Isolate Unclassified
328 2855872281 Sinorhizobium fredii PCH1 Isolate Nodule
329 2856314179 Mesorhizobium sp. M3A.F.Ca.ET.175.01.1.1 Isolate Nodule
330 2856320880 Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1 Isolate Nodule
331 2856328259 Mesorhizobium sp. Primo-B Isolate Nodule
332 2856334872 Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 Isolate Nodule
333 2856342000 Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 Isolate Nodule
334 2856349417 Mesorhizobium sp. M4A.F.Ca.ET.090.04.2.1 Isolate Nodule
335 2856364286 Mesorhizobium sp. M00.F.Ca.ET.151.01.1.1 Isolate Nodule
336 2857349434 Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 Isolate Nodule
337 2857367948 Mesorhizobium sp. M7A.F.Ca.US.002.01.1.1 Isolate Nodule
338 2858800743 Sinorhizobium meliloti AK170 Isolate Unclassified
339 2869162929 Mesorhizobium sanjuanii BSA136 Isolate Nodule
340 2869169390 Mesorhizobium sp. M7A.F.Ca.CA.001.10.2.1 Isolate Nodule
341 2869234852 Mesorhizobium sp. M7A.T.Ca.US.000.02.2.1 Isolate Nodule
342 2869242130 Mesorhizobium sp. M7A.F.Ca.CA.004.11.2.1 Isolate Nodule
343 2869249662 Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1 Isolate Nodule
344 2869256925 Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 Isolate Nodule
345 2869264136 Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 Isolate Nodule
346 2869271264 Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 Isolate Nodule
347 2869278585 Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 Isolate Nodule
348 2869285874 Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 Isolate Nodule
349 2871429161 Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 Isolate Nodule
350 2871435913 Mesorhizobium sp. M7A.F.Ca.MR.228.00.0.0 Isolate Nodule
351 2871444079 Mesorhizobium sp. M1A.F.Ca.IN.020.06.1.1 Isolate Nodule
352 2871451962 Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 Isolate Nodule
353 2871459585 Mesorhizobium sp. M7A.F.Ca.CA.001.09.1.1 Isolate Nodule
354 2871466892 Mesorhizobium sp. M7D.F.Ca.US.004.01.2.1 Isolate Nodule
355 2871474448 Mesorhizobium sp. M6A.T.Cr.TU.017.01.1.1 Isolate Nodule
356 2871481445 Mesorhizobium sp. M7A.F.Ca.CA.004.02.1.1 Isolate Nodule
357 2871488783 Mesorhizobium sp. M4B.F.Ca.ET.203.01.1.1 Isolate Nodule
358 2871495908 Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 Isolate Nodule
359 2874102143 Mesorhizobium sp. M1A.F.Ca.IN.022.04.1.1 Isolate Nodule
360 2874109183 Mesorhizobium sp. M7A.T.Ca.TU.009.02.1.1 Isolate Nodule
361 2874116593 Mesorhizobium sp. M7A.F.Ca.CA.004.08.2.1 Isolate Nodule
362 2874123672 Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 Isolate Nodule
363 2874131515 Mesorhizobium sp. M7A.F.Ca.CA.001.05.1.1 Isolate Nodule
364 2874139085 Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 Isolate Nodule
365 2874146452 Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 Isolate Nodule
366 2874155637 Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 Isolate Nodule
367 2874168670 Mesorhizobium kowhaii Ach-343 Isolate Nodule
368 2876363079 Mesorhizobium loti R7ANS::ICEMlSym2042 Isolate Nodule
369 2876369609 Mesorhizobium sp. USDA-HM6 Isolate Unclassified
370 2876377896 Mesorhizobium sp. M2C.T.Ca.TU.009.01.2.1 Isolate Nodule
371 2876386047 Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 Isolate Nodule
372 2876392853 Mesorhizobium sp. M1D.F.Ca.ET.234.01.1.1 Isolate Nodule
373 2876399893 Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 Isolate Nodule
374 2876413966 Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 Isolate Nodule
375 2876420981 Mesorhizobium sp. M7A.F.Ca.CA.004.08.1.1 Isolate Nodule
376 2878035449 Mesorhizobium sp. M3A.F.Ca.ET.201.01.1.1 Isolate Nodule
377 2878738818 Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 Isolate Nodule
378 2878745973 Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 Isolate Nodule
379 2878753008 Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1 Isolate Nodule
380 2878760144 Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 Isolate Nodule
381 2878767105 Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 Isolate Nodule
382 2878774303 Mesorhizobium sp. M7A.F.Ca.CA.002.15.1.1 Isolate Nodule
383 2881147464 Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 Isolate Nodule
384 2881155292 Mesorhizobium sp. M4B.F.Ca.ET.058.02.1.1 Isolate Nodule
385 2881161766 Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 Isolate Nodule
386 2881845957 Mesorhizobium sp. M4B.F.Ca.ET.019.03.1.1 Isolate Nodule
387 2881853255 Mesorhizobium sp. M4A.F.Ca.ET.020.02.1.1 Isolate Nodule
388 2881861095 Mesorhizobium sp. M4B.F.Ca.ET.049.02.1.2 Isolate Nodule
389 2882632389 Mesorhizobium waimense ICMP19557 Isolate Unclassified
390 2885305155 Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 Isolate Nodule
391 2885312484 Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 Isolate Nodule
392 2885318864 Mesorhizobium sp. M4B.F.Ca.ET.017.02.2.1 Isolate Nodule
393 2885326080 Mesorhizobium sp. M1E.F.Ca.ET.041.01.1.1 Isolate Nodule
394 2885334103 Mesorhizobium sp. M1E.F.Ca.ET.063.01.1.1 Isolate Nodule
395 2885350715 Mesorhizobium sp. M4A.F.Ca.ET.022.05.2.1 Isolate Nodule
396 2888337043 Mesorhizobium sp. M8A.F.Ca.ET.057.01.1.1 Isolate Nodule
397 2888343758 Mesorhizobium sp. AA22 Isolate Unclassified
398 2888350351 Mesorhizobium sp. M2A.F.Ca.ET.046.03.2.1 Isolate Nodule
399 2889010040 Mesorhizobium sp. M2A.F.Ca.ET.043.05.1.1 Isolate Nodule
400 2889016732 Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1 Isolate Nodule
401 2889790730 Chelativorans xinjiangense lm93 Isolate Rhizosphere
402 2889914905 Chelativorans alearense UJN715 Isolate Rhizosphere
403 2891373044 Shinella sp. AETb1-6 Isolate Rhizosphere
404 2894652903 Phyllobacterium sp. SYP-B3895 Isolate Rhizosphere
405 2894817345 Aureimonas psammosilenae YIM DR1026 Isolate Unclassified
406 2896384573 Ensifer sp. MPMI2T Isolate Unclassified
407 2899792073 Agrobacterium deltaense CNPSo 3391 Isolate Nodule
408 2899845264 Agrobacterium fabacearum CNPSo 675 Isolate Unclassified
409 2903448605 Mesorhizobium japonicum Opo-235 Isolate Nodule
410 2903492973 Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 Isolate Nodule
411 2903513507 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.2 Isolate Nodule
412 2903521522 Mesorhizobium loti R7ANS::ICEMlSym2014 Isolate Nodule
413 2903528002 Mesorhizobium loti R7ANS::ICEMlSym2037 Isolate Nodule
414 2903540706 Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 Isolate Nodule
415 2904578770 Phyllobacterium sp. 586 Isolate Unclassified
416 2904659560 Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1 Isolate Nodule
417 2906308376 Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 Isolate Nodule
418 2906321335 Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 Isolate Nodule
419 2906328253 Mesorhizobium sp. M1A.T.Ca.IN.004.03.1.1 Isolate Nodule
420 2906354277 Mesorhizobium sp. M2A.F.Ca.ET.040.01.1.1 Isolate Nodule
421 2906363423 Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1 Isolate Nodule
422 2906370794 Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1 Isolate Nodule
423 2906378014 Mesorhizobium sp. M7D.F.Ca.US.004.03.1.1 Isolate Nodule
424 2906386501 Mesorhizobium sp. M7A.F.Ca.CA.003.01.2.1 Isolate Nodule
425 2906393657 Mesorhizobium sp. M7A.F.Ca.CA.001.11.2.1 Isolate Nodule
426 2906401398 Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 Isolate Nodule
427 2906408224 Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 Isolate Nodule
428 2906414383 Mesorhizobium sp. M3A.F.Ca.ET.174.01.1.1 Isolate Nodule
429 2906427513 Mesorhizobium sp. M7A.F.Ca.CA.004.05.1.1 Isolate Nodule
430 2913295892 Sinorhizobium kostiensis DSM 13372 Isolate Nodule
431 2915980308 Sinorhizobium medicae USDA1149 Isolate Nodule
432 2915986958 Sinorhizobium meliloti USDA1659 Isolate Nodule
433 2915993759 Sinorhizobium meliloti USDA1336 Isolate Nodule
434 2916000859 Sinorhizobium meliloti USDA1562 Isolate Nodule
435 2916007675 Sinorhizobium meliloti USDA1289 Isolate Nodule
436 2916014648 Sinorhizobium meliloti USDA1583 Isolate Nodule
437 2916021584 Sinorhizobium meliloti USDA1550 Isolate Nodule
438 2916028427 Sinorhizobium meliloti USDA1613 Isolate Nodule
439 2916035215 Sinorhizobium meliloti 3011 Isolate Nodule
440 2916041962 Sinorhizobium meliloti USDA1795 Isolate Nodule
441 2916048683 Sinorhizobium meliloti USDA1796 Isolate Nodule
442 2916055098 Sinorhizobium meliloti USDA1770 Isolate Nodule
443 2916061851 Sinorhizobium medicae USDA1638 Isolate Nodule
444 2916068649 Sinorhizobium meliloti USDA1220 Isolate Nodule
445 2916076590 Sinorhizobium meliloti USDA1661 Isolate Nodule
446 2919114240 Agrobacterium tumefaciens 1457 Isolate Rhizosphere
447 2919119836 Phyllobacterium sp. 1468 Isolate Rhizosphere
448 2921201388 Sinorhizobium meliloti USDA1692 Isolate Nodule
449 2921208531 Sinorhizobium meliloti USDA1660 Isolate Nodule
450 2921237296 Sinorhizobium meliloti USDA1508 Isolate Nodule
451 2921244191 Sinorhizobium meliloti 2119 Isolate Nodule
452 2921250672 Sinorhizobium medicae USDA1169 Isolate Nodule
453 2921257292 Sinorhizobium meliloti USDA1320 Isolate Nodule
454 2921263974 Sinorhizobium meliloti USDA1107 Isolate Nodule
455 2921282425 Sinorhizobium meliloti USDA1203 Isolate Nodule
456 2921289301 Sinorhizobium meliloti USDA1730 Isolate Nodule
457 2921296804 Sinorhizobium meliloti USDA1200 Isolate Nodule
458 2922130491 Mesorhizobium sp. M00.F.Ca.ET.038.03.1.1 Isolate Nodule
459 2922151315 Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 Isolate Nodule
460 2922158528 Mesorhizobium sp. M1A.F.Ca.IN.022.05.2.1 Isolate Nodule
461 2922172374 Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 Isolate Nodule
462 2922178524 Mesorhizobium sp. M7A.F.Ca.CA.002.09.1.1 Isolate Nodule
463 2922185730 Mesorhizobium sp. M2A.F.Ca.ET.037.01.1.1 Isolate Nodule
464 2924144063 Sinorhizobium meliloti USDA1022 Isolate Nodule
465 2924150972 Sinorhizobium meliloti USDA1700 Isolate Nodule
466 2924158325 Sinorhizobium meliloti USDA1146 Isolate Nodule
467 2924165586 Sinorhizobium meliloti USDA1264 Isolate Nodule
468 2924172951 Sinorhizobium meliloti USDA1626 Isolate Nodule
469 2924179722 Sinorhizobium meliloti USDA1280 Isolate Nodule
470 2924186466 Sinorhizobium meliloti USDA1389 Isolate Nodule
471 2924193448 Sinorhizobium meliloti USDA1158 Isolate Nodule
472 2924200457 Sinorhizobium meliloti USDA1007 Isolate Nodule
473 2924207177 Sinorhizobium meliloti USDA1589 Isolate Nodule
474 2924214083 Sinorhizobium meliloti USDA1702 Isolate Nodule
475 2924221636 Sinorhizobium meliloti USDA1416 Isolate Nodule
476 2924228884 Sinorhizobium meliloti USDA1581 Isolate Nodule
477 2924726620 Mesorhizobium sp. M1A.F.Ca.IN.020.03.2.1 Isolate Nodule
478 2924733363 Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 Isolate Nodule
479 2924741084 Mesorhizobium sp. M7A.F.Ca.CA.004.09.1.2 Isolate Nodule
480 2924754689 Mesorhizobium sp. M5C.F.Ca.IN.020.32.2.1 Isolate Nodule
481 2924762789 Mesorhizobium sp. WSM4303 Isolate Unclassified
482 2924776078 Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 Isolate Nodule
483 2924784321 Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 Isolate Nodule
484 2926754445 Agrobacterium radiobacter SLBN-94 Isolate Rhizosphere
485 2926760298 Agrobacterium tumefaciens SLBN-170 Isolate Rhizosphere
486 2928521798 Phyllobacterium ifriqiyense 1451 Isolate Rhizosphere
487 2929138655 Agrobacterium sp. R-72433 Hybrid assembly Isolate Unclassified
488 2933006813 Rhizobium sp. SEMIA 439 Isolate Unclassified
489 2933011516 Rhizobium sp. SEMIA 4032 Isolate Unclassified
490 2933594066 Agrobacterium fabrum 35/80 Isolate Nodule
491 2936996657 Sinorhizobium meliloti USDA1025 Isolate Nodule
492 2937002841 Sinorhizobium meliloti USDA1006 Isolate Nodule
493 2937009748 Sinorhizobium meliloti USDA1162 Isolate Nodule
494 2937016420 Sinorhizobium meliloti USDA1027 Isolate Nodule
495 2937023124 Sinorhizobium meliloti USDA1335 Isolate Nodule
496 2937029754 Sinorhizobium medicae USDA1624 Isolate Nodule
497 2937036028 Sinorhizobium medicae USDA1608 Isolate Nodule
498 2937042894 Sinorhizobium meliloti USDA1687 Isolate Nodule
499 2937049772 Sinorhizobium meliloti USDA1691 Isolate Nodule
500 2937056579 Sinorhizobium meliloti USDA1357 Isolate Nodule
501 2937063883 Sinorhizobium meliloti USDA1808 Isolate Nodule
502 2937071275 Sinorhizobium meliloti USDA1623 Isolate Nodule
503 2937078374 Sinorhizobium medicae USDA1004 Isolate Nodule
504 2937084907 Sinorhizobium medicae USDA1664 Isolate Nodule
505 2937091812 Sinorhizobium meliloti USDA1221 Isolate Nodule
506 2937098957 Sinorhizobium meliloti USDA1519 Isolate Nodule
507 2937106411 Sinorhizobium meliloti USDA1214 Isolate Nodule
508 2937113482 Sinorhizobium meliloti USDA1180 Isolate Nodule
509 2937119839 Sinorhizobium meliloti USDA1790 Isolate Nodule
510 2937126314 Sinorhizobium meliloti USDA1612 Isolate Nodule
511 2937813078 Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 Isolate Nodule
512 2937822353 Mesorhizobium neociceri CCANP35 Isolate Nodule
513 2937836603 Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 Isolate Nodule
514 2937848649 Mesorhizobium sp. WSM4310 Isolate Unclassified
515 2937861824 Mesorhizobium sp. M7A.F.Ca.CA.001.07.2.1 Isolate Nodule
516 2937877337 Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 Isolate Nodule
517 2937891427 Mesorhizobium sp. M1A.F.Ca.IN.022.07.1.1 Isolate Nodule
518 2937972304 Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 Isolate Nodule
519 2937980651 Mesorhizobium sp. M7A.F.Ca.CA.004.04.2.1 Isolate Nodule
520 2937994558 Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 Isolate Nodule
521 2938014810 Mesorhizobium sp. M2C.T.Ca.TU.002.02.1.1 Isolate Nodule
522 2941499720 Ensifer sp. 4252 Isolate Rhizosphere
523 2954011201 Phyllobacterium ifrigiyense W4I11 Isolate Rhizosphere
524 2957375807 Sinorhizobium medicae USDA1632 Isolate Nodule
525 2957382221 Sinorhizobium meliloti USDA1919 Isolate Nodule
526 2957388812 Sinorhizobium meliloti USDA1195 Isolate Nodule
527 2957395598 Sinorhizobium meliloti USDA1237 Isolate Nodule
528 2957402308 Sinorhizobium meliloti USDA1794 Isolate Nodule
529 2957408893 Sinorhizobium meliloti USDA1163 Isolate Nodule
530 2957415311 Sinorhizobium meliloti USDA1724 Isolate Nodule
531 2957422303 Sinorhizobium meliloti USDA1497 Isolate Nodule
532 2957430029 Sinorhizobium meliloti USDA1590 Isolate Nodule
533 2957437181 Sinorhizobium medicae USDA1694 Isolate Nodule
534 2957443900 Sinorhizobium meliloti USDA1734 Isolate Nodule
535 2957450854 Sinorhizobium meliloti USDA1655 Isolate Nodule
536 2957457609 Sinorhizobium meliloti USDA1751 Isolate Nodule
537 2957464669 Sinorhizobium meliloti USDA1520 Isolate Nodule
538 2957471148 Sinorhizobium meliloti USDA1204 Isolate Nodule
539 2957478035 Sinorhizobium meliloti USDA1171 Isolate Nodule
540 2957484790 Sinorhizobium meliloti USDA1464 Isolate Nodule
541 2957491536 Sinorhizobium meliloti USDA1804 Isolate Nodule
542 2957498199 Sinorhizobium meliloti USDA1561 Isolate Nodule
543 2957505466 Sinorhizobium meliloti USDA1696 Isolate Nodule
544 2958034702 Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 Isolate Nodule
545 2958041894 Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 Isolate Nodule
546 2958064165 Mesorhizobium sp. SARCC-RB16n Isolate Unclassified
547 2958071322 Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 Isolate Nodule
548 2958084443 Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 Isolate Nodule
549 2958092219 Mesorhizobium sp. M8A.F.Ca.ET.059.01.1.1 Isolate Nodule
550 2958100919 Mesorhizobium sp. M2A.F.Ca.ET.015.02.1.1 Isolate Nodule
551 2958108152 Mesorhizobium sp. M7A.F.Ca.CA.004.11.1.1 Isolate Nodule
552 2958115193 Mesorhizobium sp. M00.F.Ca.ET.217.01.1.1 Isolate Nodule
553 2958122699 Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 Isolate Nodule
554 2958130278 Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 Isolate Nodule
555 2958137437 Mesorhizobium sp. M7A.F.Ca.CA.002.04.1.1 Isolate Nodule
556 2958144490 Mesorhizobium sp. M8A.F.Ca.ET.021.01.1.1 Isolate Nodule
557 2958158011 Mesorhizobium sp. M7A.F.Ca.CA.002.15.2.1 Isolate Nodule
558 2958165035 Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 Isolate Nodule
559 2958172287 Mesorhizobium sp. M2A.F.Ca.ET.029.05.1.1 Isolate Nodule
560 2958179912 Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 Isolate Nodule
561 2960584000 Sinorhizobium meliloti USDA1530 Isolate Nodule
562 2960591022 Sinorhizobium medicae USDA1066 Isolate Nodule
563 2960597568 Sinorhizobium meliloti 3085 Isolate Nodule
564 2960603979 Sinorhizobium meliloti USDA1580 Isolate Nodule
565 2960610863 Sinorhizobium meliloti USDA1792 Isolate Nodule
566 2960617483 Sinorhizobium meliloti USDA1719 Isolate Nodule
567 2960624210 Sinorhizobium meliloti USDA1415 Isolate Nodule
568 2960631154 Sinorhizobium medicae USDA1629 Isolate Nodule
569 2960637947 Sinorhizobium meliloti USDA1202 Isolate Nodule
570 2960645483 Sinorhizobium meliloti USDA1703 Isolate Nodule
571 2960652885 Sinorhizobium meliloti USDA1199 Isolate Nodule
572 2960660292 Sinorhizobium meliloti USDA1883 Isolate Nodule
573 2960667422 Sinorhizobium meliloti USDA1170 Isolate Nodule
574 2960674078 Sinorhizobium meliloti USDA1666 Isolate Nodule
575 2960680706 Sinorhizobium medicae USDA1150 Isolate Nodule
576 2960687367 Sinorhizobium meliloti USDA1462 Isolate Nodule
577 2960693952 Sinorhizobium medicae USDA1630 Isolate Nodule
578 2961077736 Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 Isolate Nodule
579 2961114664 Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 Isolate Nodule
580 2961127735 Mesorhizobium sp. M4A.F.Ca.ET.029.04.2.1 Isolate Nodule
581 2961136820 Mesorhizobium sp. M7A.F.Ca.AU.001.01.1.1 Isolate Nodule
582 2961163497 Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 Isolate Nodule
583 2961170736 Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 Isolate Nodule
584 2961183825 Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 Isolate Nodule
585 2963644680 Mesorhizobium japonicum R7A Isolate Nodule
586 2964607997 Sinorhizobium meliloti USDA1212 Isolate Nodule
587 2964615318 Sinorhizobium meliloti USDA1248 Isolate Nodule
588 2964621998 Sinorhizobium meliloti USDA1235 Isolate Nodule
589 2964628898 Sinorhizobium meliloti USDA1191 Isolate Nodule
590 2964636051 Sinorhizobium meliloti USDA1594 Isolate Nodule
591 2964643177 Sinorhizobium meliloti USDA1760 Isolate Nodule
592 2964649959 Sinorhizobium meliloti USDA1591 Isolate Nodule
593 2964656573 Sinorhizobium meliloti USDA1308 Isolate Nodule
594 2964663802 Sinorhizobium meliloti USDA1688 Isolate Nodule
595 2964670856 Sinorhizobium meliloti USDA1211 Isolate Nodule
596 2964678106 Sinorhizobium meliloti USDA1210 Isolate Nodule
597 2964685014 Sinorhizobium meliloti USDA1232 Isolate Nodule
598 2964691889 Sinorhizobium meliloti USDA1379 Isolate Nodule
599 2964698721 Sinorhizobium meliloti USDA1656 Isolate Nodule
600 2964705432 Sinorhizobium meliloti USDA1614 Isolate Nodule
601 2964712639 Sinorhizobium meliloti USDA1616 Isolate Nodule
602 2964719344 Sinorhizobium meliloti USDA1456 Isolate Nodule
603 2965018300 Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 Isolate Nodule
604 2965025482 Mesorhizobium sp. Primo-A Isolate Nodule
605 2965032056 Mesorhizobium sp. M7A.F.Ca.US.006.04.2.1 Isolate Nodule
606 2965040258 Mesorhizobium sp. M7A.F.Ca.CA.001.06.1.1 Isolate Nodule
607 2965047637 Mesorhizobium sp. M7A.F.Ca.US.014.04.1.1 Isolate Nodule
608 2965062239 Mesorhizobium sp. M1A.F.Ca.ET.072.01.1.1 Isolate Nodule
609 2965089291 Mesorhizobium sp. M7A.F.Ca.CA.001.04.1.1 Isolate Nodule
610 2965110997 Mesorhizobium sp. M7A.F.Ca.US.003.02.2.1 Isolate Nodule
611 2965119406 Mesorhizobium sp. M2A.F.Ca.ET.067.02.1.1 Isolate Nodule
612 2967664464 Sinorhizobium meliloti USDA1208 Isolate Nodule
613 2967671571 Sinorhizobium meliloti USDA1496 Isolate Nodule
614 2967678726 Sinorhizobium meliloti USDA1467 Isolate Nodule
615 2967686174 Sinorhizobium medicae USDA1641 Isolate Nodule
616 2967693043 Sinorhizobium meliloti USDA1183 Isolate Nodule
617 2967699805 Sinorhizobium meliloti USDA1695 Isolate Nodule
618 2967706974 Sinorhizobium meliloti USDA1206 Isolate Nodule
619 2967714385 Sinorhizobium meliloti USDA1023 Isolate Nodule
620 2967721400 Sinorhizobium meliloti USDA1742 Isolate Nodule
621 2967728569 Sinorhizobium medicae USDA1607 Isolate Nodule
622 2967735183 Sinorhizobium meliloti USDA1710 Isolate Nodule
623 2967742019 Sinorhizobium meliloti USDA1676 Isolate Nodule
624 2967748971 Sinorhizobium meliloti USDA1024A Isolate Nodule
625 2967755722 Sinorhizobium meliloti USDA1302 Isolate Nodule
626 2967762386 Sinorhizobium meliloti USDA1397 Isolate Nodule
627 2967769361 Sinorhizobium meliloti USDA1005 Isolate Nodule
628 2967996073 Mesorhizobium sp. M4B.F.Ca.ET.169.01.1.1 Isolate Nodule
629 2968003550 Mesorhizobium sp. M4B.F.Ca.ET.215.01.1.1 Isolate Nodule
630 2968016561 Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 Isolate Nodule
631 2968083720 Mesorhizobium erdmanii Opo-242 Isolate Unclassified
632 2968091066 Mesorhizobium sp. AA23 Isolate Unclassified
633 2968097103 Mesorhizobium sp. M1A.F.Ca.IN.020.30.1.1 Isolate Nodule
634 2968110612 Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 Isolate Nodule
635 2968117919 Mesorhizobium atlanticum CNPSo 3140 Isolate Unclassified
636 2968128360 Mesorhizobium sp. WSM3873 Isolate Unclassified
637 2968138860 Mesorhizobium sp. M7A.F.Ca.ET.027.03.2.1 Isolate Nodule
638 2968171901 Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 Isolate Nodule
639 2970019648 Sinorhizobium meliloti USDA1603 Isolate Nodule
640 2970026789 Sinorhizobium medicae USDA1611 Isolate Nodule
641 2970033650 Sinorhizobium meliloti USDA1565 Isolate Nodule
642 2970040964 Sinorhizobium meliloti USDA1501 Isolate Nodule
643 2970047711 Sinorhizobium meliloti USDA1793 Isolate Nodule
644 2970054988 Sinorhizobium meliloti USDA1031 Isolate Nodule
645 2970061556 Sinorhizobium meliloti USDA1810 Isolate Nodule
646 2970068827 Sinorhizobium meliloti USDA1227 Isolate Nodule
647 2970076120 Sinorhizobium meliloti USDA1706 Isolate Nodule
648 2970082768 Sinorhizobium meliloti USDA1803 Isolate Nodule
649 2970088815 Sinorhizobium meliloti USDA1819 Isolate Nodule
650 2970095765 Sinorhizobium meliloti USDA1225 Isolate Nodule
651 2970102677 Sinorhizobium meliloti USDA1325 Isolate Nodule
652 2970109326 Sinorhizobium meliloti USDA1186 Isolate Nodule
653 2970116247 Sinorhizobium meliloti USDA1566 Isolate Nodule
654 2970122695 Sinorhizobium medicae 3082 Isolate Nodule
655 2970129317 Sinorhizobium meliloti USDA1008 Isolate Nodule
656 2970136068 Sinorhizobium meliloti USDA1699 Isolate Nodule
657 2970143518 Sinorhizobium medicae USDA1652 Isolate Nodule
658 2970149975 Sinorhizobium meliloti USDA1215 Isolate Nodule
659 2970156795 Sinorhizobium meliloti USDA1491 Isolate Nodule
660 2970164137 Sinorhizobium meliloti USDA1018 Isolate Nodule
661 2970170962 Sinorhizobium meliloti USDA1571 Isolate Nodule
662 2970177841 Sinorhizobium meliloti USDA1533 Isolate Nodule
663 2970184632 Sinorhizobium meliloti USDA1593 Isolate Nodule
664 2970191845 Sinorhizobium meliloti USDA1187 Isolate Nodule
665 2970469710 Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 Isolate Nodule
666 2970489779 Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 Isolate Nodule
667 2970503327 Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 Isolate Nodule
668 2970510686 Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 Isolate Nodule
669 2970524798 Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1 Isolate Nodule
670 2970540015 Mesorhizobium sp. M5C.F.Ca.IN.020.29.1.1 Isolate Nodule
671 2970547951 Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 Isolate Nodule
672 2970554993 Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 Isolate Nodule
673 2970593180 Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 Isolate Nodule
674 2970619444 Mesorhizobium sp. M7A.F.Ca.ET.027.02.1.1 Isolate Nodule
675 2970627176 Mesorhizobium sp. M7A.F.Ca.US.006.01.2.1 Isolate Nodule
676 2977516862 Sinorhizobium meliloti USDA1791 Isolate Nodule
677 2977523885 Sinorhizobium meliloti USDA1777 Isolate Nodule
678 2977530762 Sinorhizobium medicae USDA1606 Isolate Nodule
679 2977537788 Sinorhizobium meliloti USDA1184 Isolate Nodule
680 2977544691 Sinorhizobium medicae USDA1631 Isolate Nodule
681 2977551784 Sinorhizobium meliloti USDA1035 Isolate Nodule
682 2977558990 Sinorhizobium meliloti USDA1222 Isolate Nodule
683 2977565890 Sinorhizobium meliloti USDA1617 Isolate Nodule
684 2977572785 Sinorhizobium meliloti USDA1767 Isolate Nodule
685 2977579622 Sinorhizobium meliloti USDA1161 Isolate Nodule
686 2977821940 Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1 Isolate Nodule
687 2977828996 Mesorhizobium sp. M4B.F.Ca.ET.089.01.1.1 Isolate Nodule
688 2977843712 Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 Isolate Nodule
689 2977851361 Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 Isolate Nodule
690 2977858184 Mesorhizobium sp. M1A.F.Ca.IN.020.03.1.1 Isolate Nodule
691 2977864932 Mesorhizobium tamadayense DSM 28320 Isolate Nodule
692 2977872689 Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 Isolate Nodule
693 2977907340 Mesorhizobium sp. M7A.F.Ca.CA.004.12.1.1 Isolate Nodule
694 2977915119 Mesorhizobium sp. M7A.F.Ca.CA.001.09.2.1 Isolate Nodule
695 2977922695 Mesorhizobium sp. WSM4305 Isolate Unclassified
696 2977935797 Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 Isolate Nodule
697 2977942078 Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 Isolate Nodule
698 2977950692 Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 Isolate Nodule
699 2977971508 Mesorhizobium sp. M2A.F.Ca.ET.039.01.1.1 Isolate Nodule
700 2977986579 Mesorhizobium intechi BD68 Isolate Unclassified
701 2979089926 Agrobacterium sp. SORGH_AS 745 Isolate Unclassified
702 2979095461 Agrobacterium tumefaciens SORGH_AS 749 Isolate Unclassified
703 2979100975 Agrobacterium pusense SORGH_AS 755 Isolate Unclassified
704 2979710463 Mesorhizobium sp. M2A.F.Ca.ET.017.03.2.1 Isolate Nodule
705 2979742915 Mesorhizobium sp. M2A.F.Ca.ET.046.02.1.1 Isolate Nodule
706 2979764755 Mesorhizobium sp. M7A.F.Ca.CA.004.05.2.1 Isolate Nodule
707 2979772303 Mesorhizobium sp. M7A.F.Ca.CA.004.04.1.1 Isolate Nodule
708 2979779861 Mesorhizobium sp. M1A.F.Ca.IN.022.02.1.1 Isolate Nodule
709 2979793036 Mesorhizobium sp. M7A.F.Ca.US.007.01.1.1 Isolate Nodule
710 2979808191 Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 Isolate Nodule
711 2984509177 Agrobacterium pusense SORGH_AS260 Isolate Aerial Root
712 2984518228 Agrobacterium pusense SORGH_AS285 Isolate Aerial Root
713 2984537506 Agrobacterium sp. SORGH_AS440 Isolate Aerial Root
714 2984601300 Rhizobium pusense SORGH_AS1083 Isolate Aerial Root
715 2987636660 Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 Isolate Nodule
716 2987645492 Mesorhizobium sp. M7A.F.Ca.CA.002.10.1.1 Isolate Nodule
717 2987652177 Mesorhizobium sp. M2A.F.Ca.ET.042.01.1.1 Isolate Nodule
718 2987659509 Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 Isolate Nodule
719 2987666974 Mesorhizobium sp. WSM4306 Isolate Unclassified
720 2987673487 Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1 Isolate Nodule
721 2989349275 Shinella kummerowiae CCBAU 25048 Isolate Unclassified
722 2989771324 Rhizobium rhizolycopersici DBTS2 Isolate Rhizosphere
723 2996310559 Mesorhizobium zhangyense CGMCC 1.15528 Isolate Unclassified
724 2996336353 Mesorhizobium sp. YM1C-6-2 Isolate Unclassified
725 2996341866 Mesorhizobium sp. M1A.F.Ca.IN.020.32.1.1 Isolate Nodule
726 2996348954 Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 Isolate Nodule
727 2996386984 Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 Isolate Nodule
728 3000135777 Unclassified bacterium M00.F.Ca.ET.205.01.1.1 Isolate Unclassified
729 3002141150 Phyllobacterium sp. 628 Isolate Unclassified
730 3003930520 Sinorhizobium sp. BG8 Isolate Unclassified
731 3004167301 Mesorhizobium loti 582 Isolate Unclassified
732 3004188549 Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 Isolate Nodule
733 3004195979 Mesorhizobium sp. M7A.F.Ca.CA.001.08.2.1 Isolate Nodule
734 3004203850 Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 Isolate Nodule
735 3004211236 Mesorhizobium sp. WSM4307 Isolate Unclassified
736 3004218560 Mesorhizobium sp. WSM4315 Isolate Unclassified
737 3004232784 Mesorhizobium sp. M7A.T.Ca.US.000.02.1.1 Isolate Nodule
738 3004239961 Mesorhizobium sp. M7A.F.Ca.US.005.03.2.1 Isolate Nodule
739 3004248173 Mesorhizobium sp. M7A.F.Ca.CA.004.06.1.1 Isolate Nodule
740 3004268573 Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1 Isolate Nodule
741 3004275668 Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 Isolate Nodule
742 3004289098 Mesorhizobium sp. M8A.F.Ca.ET.023.02.2.1 Isolate Nodule
743 3004334049 Mesorhizobium huakuii 583 Isolate Unclassified
744 637000159 Mesorhizobium japonicum MAFF 303099 Isolate Unclassified
745 643692032 Sinorhizobium fredii NGR234 Isolate Nodule
746 648276728 Sinorhizobium meliloti BL225C Isolate Nodule
747 649633066 Mesorhizobium ciceri bv. biserrulae WSM1271 Isolate Nodule
748 650716007 Agrobacterium fabacearum H13-3 Isolate Rhizosphere
749 8002285264 Aminobacter anthyllidis LMG 26462 Isolate Nodule
750 8003570095 Agrobacterium rhizogenes GBBC3284 Isolate Unclassified
751 8003992118 Sinorhizobium meliloti RRI128 Isolate Nodule
752 8003999396 Sinorhizobium medicae WSM1115 Isolate Nodule
753 8004300914 Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 Isolate Nodule
754 8004312739 Mesorhizobium sp. M7A.F.Ca.MR.362.00.0.0 Isolate Nodule
755 8004361976 Mesorhizobium sp. M7A.F.Ca.CA.001.08.1.1 Isolate Nodule
756 8004374579 Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1 Isolate Nodule
757 8004387939 Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 Isolate Nodule
758 8004445564 Mesorhizobium sp. M1A.F.Ca.IN.020.04.1.1 Isolate Nodule
759 8004633249 Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1 Isolate Nodule
760 8004640170 Mesorhizobium sp. GbtcB19 Isolate Unclassified
761 8004695233 Mesorhizobium sp. M7A.F.Ca.US.001.01.1.1 Isolate Nodule
762 8004703790 Mesorhizobium sp. M00.F.Ca.ET.158.01.1.1 Isolate Nodule
763 8004714634 Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 Isolate Nodule
764 8004727605 Mesorhizobium sp. M7A.F.Ca.CA.004.01.1.1 Isolate Nodule
765 8045864390 Aurantimonas endophytica KCTC 52296 Isolate Unclassified
766 8049293176 Ensifer alkalisoli YIC4027 Isolate Nodule
767 8054460903 Agrobacterium vaccinii B7.6 Isolate Unclassified
768 8055617313 Mesorhizobium onobrychidis OM4 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 34.99
Metatranscriptomes 0
Isolates 65.01

Biome Distribution

Category Percentage (%)
Aerial Root 0.44
Bulb 0
Endosphere 6.64
Nodule 53.05
Rhizoplane 1
Rhizosphere 25.25
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10003294 3300001979 Bacteria 7121
2 JGI24739J22299_10003614 3300001989 Bacteria 5907
3 JGI25158J39367_1002161 3300002739 Bacteria 3284
4 JGI25157J39369_1000925 3300002741 Bacteria 13939
5 JGI25159J45721_1000001 3300002987 Bacteria 303489
6 JGI25159J45721_1000021 3300002987 Bacteria 119754
7 JGI25151J46595_10015292 3300003187 Bacteria 3388
8 JGI25165J46597_1000016 3300003214 Bacteria 377866
9 JGI25160J50197_1000002 3300003354 Bacteria 561707
10 JGI25161J50226_1000636 3300003374 Bacteria 14220
11 Ga0055542_1000506 3300003762 Bacteria 35494
12 Ga0055526_1002789 3300003771 Bacteria 11566
13 Ga0055524_1022733 3300003775 Bacteria 2039
14 Ga0058692_1002893 3300003856 Bacteria 5559
15 Ga0055543_1000010 3300004625 Bacteria 198371
16 Ga0065165_1000004 3300005262 Bacteria 377081
17 Ga0070658_10192276 3300005327 Bacteria 1720
18 Ga0070680_100166596 3300005336 Bacteria 1853
19 Ga0068868_100118145 3300005338 Bacteria 2161
20 Ga0070661_100098833 3300005344 Bacteria 2168
21 Ga0070668_100014679 3300005347 Bacteria 5853
22 Ga0070667_100002516 3300005367 Bacteria 15986
23 Ga0070667_100022563 3300005367 Bacteria 5219
24 Ga0070667_100237451 3300005367 Bacteria 1627
25 Ga0070711_100111389 3300005439 Bacteria 2009
26 Ga0070681_10015698 3300005458 Bacteria 7546
27 Ga0068853_100023147 3300005539 Bacteria 5198
28 Ga0068853_100038553 3300005539 Bacteria 4071
29 Ga0068853_100131168 3300005539 Bacteria 2243
30 Ga0070665_100000026 3300005548 Bacteria 365176
31 Ga0070665_100251090 3300005548 Bacteria 1770
32 Ga0068855_100051351 3300005563 Bacteria 4857
33 Ga0068855_100463452 3300005563 Bacteria 1382
34 Ga0070664_100130589 3300005564 Bacteria 2206
35 Ga0068857_100062674 3300005577 Bacteria 3306
36 Ga0068856_100396704 3300005614 Bacteria 1399
37 Ga0068852_100010195 3300005616 Bacteria 7005
38 Ga0068859_100000948 3300005617 Bacteria 29677
39 Ga0068864_100079083 3300005618 Bacteria 2879
40 Ga0068851_10069946 3300005834 Bacteria 1814
41 Ga0068863_100430426 3300005841 Bacteria 1293
42 Ga0068858_100322534 3300005842 Bacteria 1476
43 Ga0068862_100000480 3300005844 Bacteria 42755
44 Ga0081540_1009714 3300005983 Bacteria 6602
45 Ga0075365_10005564 3300006038 Bacteria 6810
46 Ga0075365_10006421 3300006038 Bacteria 6469
47 Ga0075365_10094810 3300006038 Bacteria 2037
48 Ga0075365_10254985 3300006038 Bacteria 1233
49 Ga0075368_10065351 3300006042 Bacteria 1461
50 Ga0075363_100082888 3300006048 Bacteria 1756
51 Ga0075364_10004999 3300006051 Bacteria 7691
52 Ga0075364_10012398 3300006051 Bacteria 5213
53 Ga0075367_10019537 3300006178 Bacteria 3758
54 Ga0075369_10033787 3300006186 Bacteria 2169
55 Ga0075369_10080566 3300006186 Bacteria 1443
56 Ga0068871_100559567 3300006358 Bacteria 1036
57 Ga0068865_100002283 3300006881 Bacteria 11292
58 Ga0097620_100000948 3300006931 Bacteria 29677
59 Ga0079104_1000817 3300006946 Bacteria 26057
60 Ga0079104_1034368 3300006946 Bacteria 1231
61 Ga0099826_10001594 3300006948 Bacteria 13827
62 Ga0105240_10115975 3300009093 Bacteria 3232
63 Ga0105240_10127601 3300009093 Bacteria 3055
64 Ga0105243_10063806 3300009148 Bacteria 2953
65 Ga0105241_10120911 3300009174 Bacteria 2109
66 Ga0105237_10029631 3300009545 Bacteria 5561
67 Ga0105237_10178952 3300009545 Bacteria 2121
68 Ga0105238_10008113 3300009551 Bacteria 10502
69 Ga0105239_10112886 3300010375 Bacteria 3013
70 Ga0157371_10000058 3300013102 Bacteria 171756
71 Ga0157370_10000030 3300013104 Bacteria 145571
72 Ga0157369_10114120 3300013105 Bacteria 2869
73 Ga0157369_10200791 3300013105 Bacteria 2093
74 Ga0157369_10371987 3300013105 Bacteria 1483
75 Ga0157374_10055710 3300013296 Bacteria 3691
76 Ga0157372_10238857 3300013307 Bacteria 2108
77 Ga0157372_10460201 3300013307 Bacteria 1483
78 Ga0182008_10121728 3300014497 Bacteria 1297
79 Ga0214544_1000008 3300021320 Bacteria 326027
80 Ga0214542_1000010 3300021321 Bacteria 262816
81 Ga0214542_1020252 3300021321 Bacteria 4940
82 Ga0214543_1000003 3300021327 Bacteria 692327
83 Ga0214543_1000004 3300021327 Bacteria 527190
84 Ga0228711_1000001 3300022739 Bacteria 357377
85 Ga0228710_1000001 3300022740 Bacteria 314328
86 Ga0209436_101196 3300025208 Bacteria 9535
87 Ga0209646_1010395 3300025246 Bacteria 1459
88 Ga0209026_1000005 3300025250 Bacteria 731387
89 Ga0209148_1000057 3300025254 Bacteria 360463
90 Ga0209759_1000385 3300025256 Bacteria 55125
91 Ga0209233_1000068 3300025261 Bacteria 377969
92 Ga0209233_1008316 3300025261 Bacteria 3220
93 Ga0209455_1000231 3300025272 Bacteria 70607
94 Ga0209130_1000008 3300025284 Bacteria 581232
95 Ga0209676_1005700 3300025292 Bacteria 6404
96 Ga0209025_1000118 3300025294 Bacteria 214009
97 Ga0209025_1000425 3300025294 Bacteria 83943
98 Ga0209025_1000575 3300025294 Bacteria 66684
99 Ga0209564_1000104 3300025295 Bacteria 219017
100 Ga0209758_1011162 3300025297 Bacteria 5244
101 Ga0209050_1019196 3300025298 Bacteria 2611
102 Ga0209256_1000169 3300025299 Bacteria 131077
103 Ga0209256_1001767 3300025299 Bacteria 20526
104 Ga0207426_1000016 3300025302 Bacteria 581232
105 Ga0209257_1007542 3300025304 Bacteria 6532
106 Ga0207656_10031204 3300025321 Bacteria 2206
107 Ga0207647_10006448 3300025904 Bacteria 8527
108 Ga0207707_10035786 3300025912 Bacteria 4342
109 Ga0207671_10015211 3300025914 Bacteria 6041
110 Ga0207671_10081634 3300025914 Bacteria 2425
111 Ga0207660_10195066 3300025917 Bacteria 1579
112 Ga0207694_10018997 3300025924 Bacteria 5195
113 Ga0207694_10240910 3300025924 Bacteria 1478
114 Ga0207687_10374356 3300025927 Bacteria 1165
115 Ga0207704_10019603 3300025938 Bacteria 3556
116 Ga0207679_10213278 3300025945 Bacteria 1620
117 Ga0207667_10385606 3300025949 Bacteria 1427
118 Ga0207668_10110372 3300025972 Bacteria 2062
119 Ga0207658_10020885 3300025986 Bacteria 4537
120 Ga0207703_10105113 3300026035 Bacteria 2400
121 Ga0207678_10086090 3300026067 Bacteria 2686
122 Ga0207641_10022582 3300026088 Bacteria 5179
123 Ga0207674_10091598 3300026116 Bacteria 3030
124 Ga0207674_10193074 3300026116 Bacteria 1986
125 Ga0207698_10265094 3300026142 Bacteria 1580
126 Ga0209281_1000155 3300027111 Bacteria 164423
127 Ga0209281_1000215 3300027111 Bacteria 126639
128 Ga0209371_1000009 3300027312 Bacteria 963030
129 Ga0209371_1003293 3300027312 Bacteria 8001
130 Ga0209282_1000025 3300027666 Bacteria 168676
131 Ga0209282_1001731 3300027666 Bacteria 12202
132 Ga0209813_10005656 3300027866 Bacteria 3046
133 Ga0268266_10000001 3300028379 Bacteria 4040580
134 Ga0268266_10114793 3300028379 Bacteria 2390
135 Ga0268265_10000170 3300028380 Bacteria 78404
136 Ga0307515_10002178 3300028794 Bacteria 43027
137 Ga0307515_10021929 3300028794 Bacteria 11293
138 Ga0268256_1000010 3300030500 Bacteria 963034
139 Ga0268256_1002814 3300030500 Bacteria 8429
140 Ga0307513_10009761 3300031456 Bacteria 12121
141 Ga0307513_10144751 3300031456 Bacteria 2297
142 Ga0307412_10120664 3300031911 Bacteria 1887
143 Ga0315914_1000020 3300031967 Bacteria 121647
144 Ga0307416_100552847 3300032002 Bacteria 1225
145 Ga0307414_10102651 3300032004 Bacteria 2155
146 Ga0315913_1000013 3300033430 Bacteria 121559
147 Ga0315915_1000015 3300033464 Bacteria 168491
148 Ga0373927_0000727 3300035695 Bacteria 25196
149 Ga0373925_0003571 3300037068 Bacteria 11985
150 Ga0395899_0000030 3300037312 Bacteria 329063
151 Ga0395900_0000023 3300037418 Bacteria 336048
152 Ga0395900_0058442 3300037418 Bacteria 3970
153 Ga0395900_0158369 3300037418 Bacteria 2311
154 Ga0395898_0000038 3300037466 Bacteria 329063
155 Ga0395905_0000021 3300037471 Bacteria 329054
156 Ga0395901_0000018 3300038443 Bacteria 336048
157 Ga0395901_0058576 3300038443 Bacteria 4006
158 Ga0395901_0175290 3300038443 Bacteria 2249
159 Ga0451793_0171190 3300041452 Bacteria 6707
160 Ga0451807_2173661 3300041486 Bacteria 1073
161 Ga0451853_0533114 3300041512 Bacteria 2945
162 Ga0451853_0572152 3300041512 Bacteria 1910
163 Ga0439449_0028760 3300042007 Bacteria 2072
164 Ga0439458_0022351 3300042157 Bacteria 1469
165 Ga0466967_0319202 3300045976 Bacteria 1498
166 Ga0495638_0025041 3300046460 Bacteria 3883
167 Ga0495638_0029964 3300046460 Bacteria 3507
168 Ga0495638_0103097 3300046460 Bacteria 1704
169 Ga0495625_0192839 3300046660 Bacteria 1349
170 Ga0495588_0003015 3300046674 Bacteria 7286
171 Ga0495670_0110040 3300046691 Bacteria 1425
172 Ga0495681_0003362 3300047470 Bacteria 11135
173 Ga0495626_0031952 3300048091 Bacteria 2531
174 Ga0496117_0000002 3300048920 Bacteria 2483758
175 Ga0496117_0007726 3300048920 Bacteria 10396
176 Ga0496117_0023477 3300048920 Bacteria 4912
177 Ga0496118_0000483 3300048921 Bacteria 66119
178 Ga0496118_0040214 3300048921 Bacteria 3720
179 Ga0496119_0040196 3300048922 Bacteria 2995
180 Ga0496120_0000971 3300048923 Bacteria 39060
181 Ga0496120_0001519 3300048923 Bacteria 27337
182 Ga0496120_0016827 3300048923 Bacteria 4763
183 Ga0496120_0029419 3300048923 Bacteria 3354
184 Ga0496121_0000001 3300048924 Bacteria 1830318
185 Ga0496122_0000001 3300048925 Bacteria 1827766
186 Ga0496122_0000247 3300048925 Bacteria 121291
187 Ga0496122_0004617 3300048925 Bacteria 16949
188 Ga0496123_0000001 3300048926 Bacteria 1831497
189 Ga0496123_0000499 3300048926 Bacteria 68150
190 Ga0496124_0013622 3300048927 Bacteria 7927
191 Ga0496124_0096633 3300048927 Bacteria 2399
192 Ga0496125_0001802 3300048928 Bacteria 29580
193 Ga0496125_0016520 3300048928 Bacteria 7083
194 Ga0496125_0046342 3300048928 Bacteria 3648
195 Ga0496125_0046902 3300048928 Bacteria 3620
196 Ga0496126_0000438 3300048929 Bacteria 83060
197 Ga0496126_0183905 3300048929 Bacteria 1773
198 Ga0501031_0000015 3300049568 Bacteria 113809
199 Ga0501031_0010064 3300049568 Bacteria 6163
200 Ga0501031_0022147 3300049568 Bacteria 4140
201 Ga0501031_0060553 3300049568 Bacteria 2467
202 Ga0501032_0000008 3300049569 Bacteria 240313
203 Ga0501032_0000060 3300049569 Bacteria 95279
204 Ga0501032_0015384 3300049569 Bacteria 5400
205 Ga0501033_0000012 3300049570 Bacteria 241599
206 Ga0501033_0001335 3300049570 Bacteria 21910
207 Ga0501033_0002298 3300049570 Bacteria 16318
208 Ga0501033_0003698 3300049570 Bacteria 12442
209 Ga0501033_0011407 3300049570 Bacteria 6801
210 Ga0501033_0011641 3300049570 Bacteria 6727
211 Ga0501034_0000035 3300049571 Bacteria 241623
212 Ga0501034_0000262 3300049571 Bacteria 95293
213 Ga0501034_0005192 3300049571 Bacteria 14287
214 Ga0501034_0029231 3300049571 Bacteria 5603
215 Ga0501034_0030646 3300049571 Bacteria 5466
216 Ga0501034_0053596 3300049571 Bacteria 4061
217 Ga0501034_0064828 3300049571 Bacteria 3666
218 Ga0501034_0176533 3300049571 Bacteria 2102
219 Ga0501034_0213946 3300049571 Bacteria 1882
220 Ga0501036_0000006 3300049572 Bacteria 241623
221 Ga0501036_0014052 3300049572 Bacteria 6654
222 Ga0501036_0084183 3300049572 Bacteria 2689
223 Ga0501036_0280035 3300049572 Bacteria 1396
224 Ga0501037_0000076 3300049573 Bacteria 92049
225 Ga0501037_0000123 3300049573 Bacteria 72229
226 Ga0501037_0001856 3300049573 Bacteria 15330
227 Ga0501037_0018857 3300049573 Bacteria 5084
228 Ga0501037_0235487 3300049573 Bacteria 1285
229 Ga0501038_0000007 3300049574 Bacteria 210775
230 Ga0501038_0000051 3300049574 Bacteria 95293
231 Ga0501038_0002042 3300049574 Bacteria 18676
232 Ga0501038_0087718 3300049574 Bacteria 2613
233 Ga0501038_0096036 3300049574 Bacteria 2475
234 Ga0501038_0241063 3300049574 Bacteria 1435
235 Ga0501039_0000012 3300049575 Bacteria 241623
236 Ga0501039_0000051 3300049575 Bacteria 95293
237 Ga0501039_0009794 3300049575 Bacteria 7301
238 Ga0501039_0011165 3300049575 Bacteria 6844
239 Ga0501039_0148837 3300049575 Bacteria 1839
240 Ga0501043_0000039 3300049579 Bacteria 119155
241 Ga0501043_0001221 3300049579 Bacteria 22654
242 Ga0501043_0004079 3300049579 Bacteria 11929
243 Ga0501043_0014623 3300049579 Bacteria 6144
244 Ga0501043_0025064 3300049579 Bacteria 4679
245 Ga0501043_0180657 3300049579 Bacteria 1644
246 Ga0501046_0006208 3300049580 Bacteria 10609
247 Ga0501046_0033384 3300049580 Bacteria 4158
248 Ga0501047_0015616 3300049581 Bacteria 7235
249 Ga0501047_0017982 3300049581 Bacteria 6774
250 Ga0501047_0028848 3300049581 Bacteria 5353
251 Ga0501047_0163042 3300049581 Bacteria 2101
252 Ga0501047_0167970 3300049581 Bacteria 2064
253 Ga0501048_0042510 3300049582 Bacteria 3254
254 Ga0501048_0114792 3300049582 Bacteria 1902
255 Ga0501067_0016339 3300049583 Bacteria 4101
256 Ga0501068_0024507 3300049584 Bacteria 3544
257 Ga0501068_0048418 3300049584 Bacteria 2566
258 Ga0501068_0107774 3300049584 Bacteria 1730
259 Ga0501069_0000022 3300049585 Bacteria 119155
260 Ga0501069_0001371 3300049585 Bacteria 11947
261 Ga0501069_0001415 3300049585 Bacteria 11756
262 Ga0501069_0285831 3300049585 Bacteria 966
263 Ga0501070_0000080 3300049586 Bacteria 81734
264 Ga0501070_0002855 3300049586 Bacteria 15066
265 Ga0501070_0002946 3300049586 Bacteria 14821
266 Ga0501070_0114218 3300049586 Bacteria 2230
267 Ga0501071_0010517 3300049587 Bacteria 6205
268 Ga0501072_0036446 3300049588 Bacteria 3856
269 Ga0501073_0000442 3300049589 Bacteria 28617
270 Ga0501073_0064717 3300049589 Bacteria 2550
271 Ga0501074_0000046 3300049590 Bacteria 57165
272 Ga0501074_0000641 3300049590 Bacteria 21709
273 Ga0501074_0004584 3300049590 Bacteria 9899
274 Ga0501079_0003774 3300049741 Bacteria 11188
275 Ga0501080_0020842 3300049742 Bacteria 6067
276 Ga0501080_0021121 3300049742 Bacteria 6026
277 Ga0501080_0050611 3300049742 Bacteria 3866
278 Ga0501081_0040158 3300049743 Bacteria 3203
279 Ga0501083_0000050 3300049744 Bacteria 86199
280 Ga0501083_0002509 3300049744 Bacteria 12595
281 Ga0501083_0004324 3300049744 Bacteria 10004
282 Ga0501035_0000035 3300049822 Bacteria 166916
283 Ga0501035_0000119 3300049822 Bacteria 95271
284 Ga0501035_0000318 3300049822 Bacteria 55751
285 Ga0501035_0005255 3300049822 Bacteria 12252
286 Ga0501035_0044748 3300049822 Bacteria 3984
287 Ga0501044_0000015 3300049823 Bacteria 241623
288 Ga0501044_0000147 3300049823 Bacteria 86591
289 Ga0501044_0060367 3300049823 Bacteria 3883
290 Ga0501044_0072823 3300049823 Bacteria 3492
291 Ga0501045_0030631 3300049824 Bacteria 3894
292 Ga0501045_0035410 3300049824 Bacteria 3624
293 Ga0501045_0201394 3300049824 Bacteria 1483
294 nmdc:mga03n38_10345_c1 3300050490 Bacteria 3427
295 nmdc:mga03n38_18642_c1 3300050490 Bacteria 2744
296 nmdc:mga03n38_56903_c1 3300050490 Bacteria 1767
297 nmdc:mga00v17_30517_c1 3300050491 Bacteria 3173
298 nmdc:mga00v17_9111_c1 3300050491 Bacteria 5358
299 nmdc:mga0yw44_11446_c1 3300050492 Bacteria 4581
300 nmdc:mga0yw44_15055_c1 3300050492 Bacteria 4130
301 nmdc:mga0yw44_71550_c1 3300050492 Bacteria 2153
302 nmdc:mga06z11_93770_c1 3300050494 Bacteria 1635
303 nmdc:mga04h51_21783_c1 3300050495 Bacteria 1932
304 nmdc:mga07m45_42166_c1 3300050496 Bacteria 2558
305 nmdc:mga0sz30_16824_c1 3300050516 Bacteria 2909
306 nmdc:mga0sz30_41607_c1 3300050516 Bacteria 1932
307 Ga0500610_0103926 3300053079 Bacteria 1467
308 Ga0500651_0032404 3300053093 Bacteria 3293
309 Ga0500651_0067975 3300053093 Bacteria 2219
310 Ga0500561_0001611 3300053137 Bacteria 3692
311 Ga0500568_0000347 3300053139 Bacteria 35988
312 Ga0500624_000965 3300053157 Bacteria 5901
313 Ga0501084_0005409 3300054114 Bacteria 10469
314 Ga0501082_0008026 3300060353 Bacteria 9111
315 Ga0501082_0209317 3300060353 Bacteria 1697
316 Ga0501082_0309995 3300060353 Bacteria 1374
317 2792638591 2791355094 Bacteria 7011481
318 2503203687 2503198000 Bacteria 6884444
319 2509107284 2508501122 Bacteria 6292184
320 2509113950 2508501123 Bacteria 6283661
321 2509141083 2508501127 Bacteria 7037543
322 2509370832 2509276018 Bacteria 6910194
323 2509374750 2509276019 Bacteria 6802256
324 2509398051 2509276022 Bacteria 6200534
325 2510304966 2510065057 Bacteria 6649661
326 2510316623 2510065059 Bacteria 6847884
327 2511390658 2511231027 Bacteria 5013807
328 2511500760 2511231052 Bacteria 6974333
329 2512532174 2512047086 Bacteria 6850303
330 2512929502 2512875016 Bacteria 6529530
331 2512964295 2512875024 Bacteria 7195110
332 2512972489 2512875026 Bacteria 6861065
333 2513584953 2513237086 Bacteria 7265287
334 2513605512 2513237089 Bacteria 6553624
335 2513608112 2513237090 Bacteria 7096802
336 2513616750 2513237091 Bacteria 6900273
337 2513880836 2513237140 Bacteria 7076289
338 2513903830 2513237143 Bacteria 6664116
339 2513984898 2513237156 Bacteria 6402557
340 2513999938 2513237159 Bacteria 6810126
341 2514007487 2513237160 Bacteria 6650282
342 2514033955 2513237164 Bacteria 7563725
343 2514421017 2513237305 Bacteria 7293571
344 2514591481 2513237351 Bacteria 6968952
345 2515607890 2515154107 Bacteria 6795637
346 2516208632 2516143018 Bacteria 6951533
347 2516892031 2516653046 Bacteria 6989037
348 2517568846 2517487022 Bacteria 7227575
349 2524450084 2524023207 Bacteria 6813453
350 2537874403 2537561587 Bacteria 5425293
351 2551680163 2551306084 Bacteria 8942552
352 2551684259 2551306085 Bacteria 7347181
353 2551694094 2551306086 Bacteria 6843938
354 2551698404 2551306087 Bacteria 7351905
355 2551714556 2551306089 Bacteria 7162724
356 2551720757 2551306090 Bacteria 7953713
357 2551727589 2551306091 Bacteria 7086830
358 2551735500 2551306092 Bacteria 6992595
359 2551741320 2551306093 Bacteria 7064773
360 2554246774 2554235003 Bacteria 5877155
361 2558863742 2558860100 Bacteria 8458965
362 2559294001 2558860242 Bacteria 5568029
363 2585165206 2582581283 Bacteria 6030556
364 2585266580 2582581306 Bacteria 6450535
365 2585387596 2582581865 Bacteria 6644329
366 2585394200 2582581866 Bacteria 6859583
367 2588515078 2588253730 Bacteria 6881675
368 2597815790 2597489875 Bacteria 7010078
369 2599603675 2599185210 Bacteria 5624189
370 2599938649 2599185301 Bacteria 6161860
371 2600191633 2599185352 Bacteria 7228948
372 2601609022 2600255279 Bacteria 5605316
373 2601745797 2600255308 Bacteria 5611129
374 2643773952 2643221550 Bacteria 4619371
375 2643774680 2643221551 Bacteria 3750538
376 2643793125 2643221555 Bacteria 3749717
377 2643807512 2643221557 Bacteria 7184309
378 2643838499 2643221564 Bacteria 4193379
379 2643921008 2643221582 Bacteria 5804683
380 2643989149 2643221595 Bacteria 6565519
381 2644046939 2643221607 Bacteria 6314006
382 2644069923 2643221610 Bacteria 7480339
383 2644109306 2643221618 Bacteria 7717186
384 2644132649 2643221623 Bacteria 5239945
385 2644151827 2643221626 Bacteria 8069654
386 2644152346 2643221627 Bacteria 6761570
387 2644203622 2643221636 Bacteria 6583769
388 2644206510 2643221637 Bacteria 5345260
389 2644311961 2643221655 Bacteria 7722067
390 2644330235 2643221659 Bacteria 7890716
391 2644380895 2643221668 Bacteria 7306521
392 2644414799 2643221675 Bacteria 7473456
393 2644448456 2643221680 Bacteria 7473610
394 2644479728 2643221686 Bacteria 6310811
395 2644493674 2643221688 Bacteria 5260751
396 2644497269 2643221689 Bacteria 6042950
397 2644519084 2643221693 Bacteria 5513853
398 2644543012 2643221698 Bacteria 7756764
399 2644617759 2643221712 Bacteria 7729434
400 2644650157 2643221718 Bacteria 5345506
401 2644673853 2643221723 Bacteria 7095460
402 2644689237 2643221726 Bacteria 7455827
403 2657682066 2657244999 Bacteria 5946535
404 2688600449 2687453392 Bacteria 6880454
405 2692317079 2690316117 Bacteria 6800650
406 2694632613 2693429783 Bacteria 7019804
407 2694639658 2693429784 Bacteria 7241525
408 2723577723 2721755686 Bacteria 7343952
409 2739308666 2738543024 Bacteria 5603683
410 2756672994 2756170246 Bacteria 7451806
411 2765469080 2765235802 Bacteria 5618596
412 2770194886 2767802442 Bacteria 5747986
413 2776272332 2775506902 Bacteria 6208009
414 2776284271 2775506904 Bacteria 5954060
415 2792583920 2791355082 Bacteria 5973319
416 2792622282 2791355091 Bacteria 6135441
417 2792628152 2791355092 Bacteria 6248105
418 2792753106 2791355123 Bacteria 8049106
419 2802717487 2802428858 Bacteria 6636079
420 2802723584 2802428859 Bacteria 6667919
421 2802730966 2802428860 Bacteria 6525526
422 2802735972 2802428861 Bacteria 6534206
423 2802743819 2802428862 Bacteria 6633353
424 2802752964 2802428863 Bacteria 6410669
425 2804751084 2802429268 Bacteria 6094027
426 2808986223 2808606387 Bacteria 5697198
427 2819556353 2818991439 Bacteria 6907412
428 2837680582 2837678835 Bacteria 5252418
429 2838076165 2838074704 Bacteria 6785777
430 2838677080 2838675328 Bacteria 4909118
431 2838715967 2838714209 Bacteria 5525906
432 2838720231 2838719591 Bacteria 5523910
433 2838726720 2838724970 Bacteria 4908691
434 2839994438 2839993093 Bacteria 5512535
435 2840764972 2840764183 Bacteria 6358399
436 2841735092 2841734538 Bacteria 6784580
437 2841847165 2841846520 Bacteria 5345850
438 2841860302 2841859092 Bacteria 5436171
439 2842126805 2842124991 Bacteria 5346824
440 2842131973 2842130223 Bacteria 4909145
441 2842152857 2842152218 Bacteria 4908957
442 2842172212 2842170452 Bacteria 5525737
443 2842176476 2842175837 Bacteria 4908771
444 2842189076 2842187318 Bacteria 5524014
445 2842213389 2842211629 Bacteria 5523832
446 2842224993 2842224351 Bacteria 5524473
447 2842517087 2842515876 Bacteria 5436280
448 2842526514 2842521101 Bacteria 6569494
449 2842698022 2842694124 Bacteria 4063419
450 2842873641 2842871566 Bacteria 4827117
451 2844005455 2844002411 Bacteria 7168230
452 2844015771 2844009547 Bacteria 6728125
453 2844163677 2844163670 Bacteria 7266046
454 2847417852 2847417321 Bacteria 6913799
455 2847672115 2847670302 Bacteria 6165597
456 2847688444 2847686936 Bacteria 6278406
457 2848992694 2848992105 Bacteria 6810864
458 2850080221 2850079185 Bacteria 6848280
459 2855831952 2855825444 Bacteria 6785811
460 2855840237 2855839649 Bacteria 7135830
461 2855873246 2855872281 Bacteria 6964271
462 2856318075 2856314179 Bacteria 6477897
463 2856326608 2856320880 Bacteria 7263508
464 2856330883 2856328259 Bacteria 6528202
465 2856339871 2856334872 Bacteria 7037011
466 2856346913 2856342000 Bacteria 7176905
467 2856355625 2856349417 Bacteria 6230045
468 2856365358 2856364286 Bacteria 6939991
469 2857354788 2857349434 Bacteria 7926032
470 2857368346 2857367948 Bacteria 6965560
471 2858800769 2858800743 Bacteria 6603254
472 2869168181 2869162929 Bacteria 6399702
473 2869172288 2869169390 Bacteria 6659796
474 2869237717 2869234852 Bacteria 6654993
475 2869247530 2869242130 Bacteria 6609239
476 2869252137 2869249662 Bacteria 6868783
477 2869261479 2869256925 Bacteria 6981691
478 2869270891 2869264136 Bacteria 6880765
479 2869271784 2869271264 Bacteria 6908218
480 2869280278 2869278585 Bacteria 7077053
481 2869289269 2869285874 Bacteria 6901219
482 2871431337 2871429161 Bacteria 6547891
483 2871438327 2871435913 Bacteria 6880295
484 2871445425 2871444079 Bacteria 6423508
485 2871452276 2871451962 Bacteria 7336357
486 2871460546 2871459585 Bacteria 6866887
487 2871467091 2871466892 Bacteria 6923287
488 2871478080 2871474448 Bacteria 6806570
489 2871484180 2871481445 Bacteria 6700002
490 2871492769 2871488783 Bacteria 6929816
491 2871497366 2871495908 Bacteria 6935695
492 2874102229 2874102143 Bacteria 6342645
493 2874111381 2874109183 Bacteria 6517025
494 2874119810 2874116593 Bacteria 6674494
495 2874125313 2874123672 Bacteria 7238285
496 2874134315 2874131515 Bacteria 6820270
497 2874144386 2874139085 Bacteria 7021506
498 2874148536 2874146452 Bacteria 7533118
499 2874156280 2874155637 Bacteria 6724144
500 2874173691 2874168670 Bacteria 8062617
501 2876366938 2876363079 Bacteria 6544991
502 2876374407 2876369609 Bacteria 6807521
503 2876379823 2876377896 Bacteria 6565995
504 2876388998 2876386047 Bacteria 6698674
505 2876398904 2876392853 Bacteria 6660880
506 2876404578 2876399893 Bacteria 6927900
507 2876415315 2876413966 Bacteria 6831344
508 2876421914 2876420981 Bacteria 6687741
509 2878037333 2878035449 Bacteria 6555736
510 2878744237 2878738818 Bacteria 7136951
511 2878747941 2878745973 Bacteria 6867388
512 2878758650 2878753008 Bacteria 6922523
513 2878761584 2878760144 Bacteria 6823465
514 2878768551 2878767105 Bacteria 6898628
515 2878780934 2878774303 Bacteria 6108671
516 2881154044 2881147464 Bacteria 7779814
517 2881157788 2881155292 Bacteria 6461656
518 2881163119 2881161766 Bacteria 7127907
519 2881849182 2881845957 Bacteria 6611900
520 2881855179 2881853255 Bacteria 6698367
521 2881862896 2881861095 Bacteria 7128710
522 2882640015 2882632389 Bacteria 8154593
523 2885312080 2885305155 Bacteria 7348390
524 2885315841 2885312484 Bacteria 6415165
525 2885319883 2885318864 Bacteria 6729568
526 2885329661 2885326080 Bacteria 7134805
527 2885337385 2885334103 Bacteria 7216818
528 2885350874 2885350715 Bacteria 6787678
529 2888341824 2888337043 Bacteria 6629336
530 2888349117 2888343758 Bacteria 6611049
531 2888351049 2888350351 Bacteria 7372807
532 2889013439 2889010040 Bacteria 6749192
533 2889021844 2889016732 Bacteria 6700763
534 2889794219 2889790730 Bacteria 5689708
535 2889920262 2889914905 Bacteria 5702301
536 2891376314 2891373044 Bacteria 5202277
537 2894655194 2894652903 Bacteria 4587256
538 2894817902 2894817345 Bacteria 4892941
539 2896385354 2896384573 Bacteria 7700774
540 2899792367 2899792073 Bacteria 4926588
541 2899846640 2899845264 Bacteria 5672268
542 2903453596 2903448605 Bacteria 7357801
543 2903496499 2903492973 Bacteria 13473544
544 2903505941 2903492973 Bacteria 13473544
545 2903514471 2903513507 Bacteria 6344008
546 2903524805 2903521522 Bacteria 6525694
547 2903530952 2903528002 Bacteria 6586099
548 2903542161 2903540706 Bacteria 7062119
549 2904578909 2904578770 Bacteria 5302906
550 2904665436 2904659560 Bacteria 6685615
551 2906311559 2906308376 Bacteria 6841989
552 2906323299 2906321335 Bacteria 6579571
553 2906331607 2906328253 Bacteria 6585166
554 2906359978 2906354277 Bacteria 6991324
555 2906364041 2906363423 Bacteria 6856682
556 2906377006 2906370794 Bacteria 6881062
557 2906384271 2906378014 Bacteria 6911440
558 2906387785 2906386501 Bacteria 5977019
559 2906394988 2906393657 Bacteria 6790866
560 2906404179 2906401398 Bacteria 6693206
561 2906409875 2906408224 Bacteria 6162342
562 2906418112 2906414383 Bacteria 6580790
563 2906433876 2906427513 Bacteria 6375796
564 2913297818 2913295892 Bacteria 6333755
565 2915982252 2915980308 Bacteria 6624279
566 2915989100 2915986958 Bacteria 6739310
567 2915998033 2915993759 Bacteria 7016183
568 2916001764 2916000859 Bacteria 6865702
569 2916010634 2916007675 Bacteria 6898660
570 2916020305 2916014648 Bacteria 6946486
571 2916024593 2916021584 Bacteria 6854472
572 2916028812 2916028427 Bacteria 6748433
573 2916041570 2916035215 Bacteria 6755766
574 2916045565 2916041962 Bacteria 6820487
575 2916051235 2916048683 Bacteria 6543552
576 2916059614 2916055098 Bacteria 6758838
577 2916062587 2916061851 Bacteria 6737736
578 2916069478 2916068649 Bacteria 6943657
579 2916079836 2916076590 Bacteria 6596108
580 2919116171 2919114240 Bacteria 5700270
581 2919122264 2919119836 Bacteria 5208557
582 2921201900 2921201388 Bacteria 6926299
583 2921213618 2921208531 Bacteria 6745326
584 2921240467 2921237296 Bacteria 6876710
585 2921250618 2921244191 Bacteria 6568419
586 2921250753 2921250672 Bacteria 6677771
587 2921261158 2921257292 Bacteria 6808382
588 2921268561 2921263974 Bacteria 6864552
589 2921287192 2921282425 Bacteria 6826397
590 2921290195 2921289301 Bacteria 7316391
591 2921303534 2921296804 Bacteria 7176999
592 2922139017 2922130491 Bacteria 7173936
593 2922153720 2922151315 Bacteria 6902399
594 2922164447 2922158528 Bacteria 6573167
595 2922178407 2922172374 Bacteria 6167644
596 2922178929 2922178524 Bacteria 6025201
597 2922187780 2922185730 Bacteria 7113964
598 2924147067 2924144063 Bacteria 6883928
599 2924151739 2924150972 Bacteria 7169444
600 2924164813 2924158325 Bacteria 7188855
601 2924166035 2924165586 Bacteria 7260590
602 2924177737 2924172951 Bacteria 6749356
603 2924180467 2924179722 Bacteria 6843264
604 2924187769 2924186466 Bacteria 6876637
605 2924198552 2924193448 Bacteria 6955718
606 2924204534 2924200457 Bacteria 6757188
607 2924211809 2924207177 Bacteria 6917007
608 2924218627 2924214083 Bacteria 7080103
609 2924222824 2924221636 Bacteria 7113495
610 2924235095 2924228884 Bacteria 6633132
611 2924728500 2924726620 Bacteria 6271473
612 2924738618 2924733363 Bacteria 7574837
613 2924743208 2924741084 Bacteria 6661321
614 2924755543 2924754689 Bacteria 6774424
615 2924764307 2924762789 Bacteria 6561353
616 2924782155 2924776078 Bacteria 7492003
617 2924788414 2924784321 Bacteria 7416538
618 2926757125 2926754445 Bacteria 5964435
619 2926761346 2926760298 Bacteria 5505990
620 2928526248 2928521798 Bacteria 4960112
621 2929139115 2929138655 Bacteria 5810547
622 2933007502 2933006813 Bacteria 4912075
623 2933012270 2933011516 Bacteria 5439334
624 2933594715 2933594066 Bacteria 5594265
625 2936999358 2936996657 Bacteria 6298727
626 2937007928 2937002841 Bacteria 6934057
627 2937016056 2937009748 Bacteria 6746052
628 2937016883 2937016420 Bacteria 6782579
629 2937027685 2937023124 Bacteria 6815156
630 2937030070 2937029754 Bacteria 6424026
631 2937037936 2937036028 Bacteria 6846469
632 2937044572 2937042894 Bacteria 6741576
633 2937050526 2937049772 Bacteria 6757901
634 2937057411 2937056579 Bacteria 7107896
635 2937064832 2937063883 Bacteria 7199456
636 2937076067 2937071275 Bacteria 6984483
637 2937080147 2937078374 Bacteria 6610289
638 2937085788 2937084907 Bacteria 6618516
639 2937092714 2937091812 Bacteria 6979387
640 2937099764 2937098957 Bacteria 7249374
641 2937107042 2937106411 Bacteria 6947143
642 2937119648 2937113482 Bacteria 6505872
643 2937124233 2937119839 Bacteria 6597547
644 2937130295 2937126314 Bacteria 6771275
645 2937818621 2937813078 Bacteria 7783518
646 2937828504 2937822353 Bacteria 7290551
647 2937838787 2937836603 Bacteria 6811263
648 2937850547 2937848649 Bacteria 6983481
649 2937868275 2937861824 Bacteria 6660327
650 2937877716 2937877337 Bacteria 7246526
651 2937895026 2937891427 Bacteria 6357007
652 2937977788 2937972304 Bacteria 7532020
653 2937984695 2937980651 Bacteria 6517427
654 2937996015 2937994558 Bacteria 7036190
655 2938015896 2938014810 Bacteria 6700592
656 2941500539 2941499720 Bacteria 7599444
657 2954014855 2954011201 Bacteria 4762601
658 2957379014 2957375807 Bacteria 6425588
659 2957387053 2957382221 Bacteria 6737050
660 2957393523 2957388812 Bacteria 6778072
661 2957400026 2957395598 Bacteria 6822399
662 2957402816 2957402308 Bacteria 6741770
663 2957413162 2957408893 Bacteria 6558585
664 2957415740 2957415311 Bacteria 6991633
665 2957429378 2957422303 Bacteria 7172205
666 2957436539 2957430029 Bacteria 7022557
667 2957443858 2957437181 Bacteria 6568994
668 2957450201 2957443900 Bacteria 6869977
669 2957455328 2957450854 Bacteria 6765715
670 2957458395 2957457609 Bacteria 6967680
671 2957469341 2957464669 Bacteria 6568877
672 2957471848 2957471148 Bacteria 6797643
673 2957483873 2957478035 Bacteria 6756658
674 2957485901 2957484790 Bacteria 6703082
675 2957494322 2957491536 Bacteria 6695180
676 2957499048 2957498199 Bacteria 7126688
677 2957506251 2957505466 Bacteria 7253085
678 2958036147 2958034702 Bacteria 6989922
679 2958047571 2958041894 Bacteria 13082850
680 2958051540 2958041894 Bacteria 13082850
681 2958066239 2958064165 Bacteria 7158582
682 2958074473 2958071322 Bacteria 6815895
683 2958084823 2958084443 Bacteria 7312792
684 2958096375 2958092219 Bacteria 6861151
685 2958107200 2958100919 Bacteria 6800575
686 2958109457 2958108152 Bacteria 6681128
687 2958115772 2958115193 Bacteria 6923548
688 2958124116 2958122699 Bacteria 7280457
689 2958133645 2958130278 Bacteria 6897202
690 2958143287 2958137437 Bacteria 6050276
691 2958150233 2958144490 Bacteria 6677056
692 2958163765 2958158011 Bacteria 6058449
693 2958166486 2958165035 Bacteria 6906348
694 2958173056 2958172287 Bacteria 6716688
695 2958183289 2958179912 Bacteria 6874908
696 2960585645 2960584000 Bacteria 6864594
697 2960593765 2960591022 Bacteria 6622873
698 2960600785 2960597568 Bacteria 6550735
699 2960604511 2960603979 Bacteria 6898737
700 2960613942 2960610863 Bacteria 6691244
701 2960617494 2960617483 Bacteria 6727748
702 2960628713 2960624210 Bacteria 6875384
703 2960632926 2960631154 Bacteria 6732508
704 2960638913 2960637947 Bacteria 7296468
705 2960646194 2960645483 Bacteria 7211087
706 2960653870 2960652885 Bacteria 7083688
707 2960663293 2960660292 Bacteria 7041660
708 2960672363 2960667422 Bacteria 6763020
709 2960677661 2960674078 Bacteria 6609048
710 2960685638 2960680706 Bacteria 6624464
711 2960690511 2960687367 Bacteria 6535474
712 2960695654 2960693952 Bacteria 6749742
713 2961081256 2961077736 Bacteria 7079850
714 2961120436 2961114664 Bacteria 6680456
715 2961130226 2961127735 Bacteria 7196641
716 2961138820 2961136820 Bacteria 6775228
717 2961164951 2961163497 Bacteria 6901077
718 2961173155 2961170736 Bacteria 7072258
719 2961188670 2961183825 Bacteria 6688536
720 2963649731 2963644680 Bacteria 6530403
721 2964610918 2964607997 Bacteria 7101408
722 2964617899 2964615318 Bacteria 6809089
723 2964622747 2964621998 Bacteria 6834995
724 2964629564 2964628898 Bacteria 7083044
725 2964636638 2964636051 Bacteria 7091832
726 2964647769 2964643177 Bacteria 6820887
727 2964654474 2964649959 Bacteria 6675118
728 2964657083 2964656573 Bacteria 7100150
729 2964670143 2964663802 Bacteria 7019362
730 2964677638 2964670856 Bacteria 6851364
731 2964682705 2964678106 Bacteria 6792020
732 2964685791 2964685014 Bacteria 6839111
733 2964692795 2964691889 Bacteria 6802758
734 2964702023 2964698721 Bacteria 6765331
735 2964710654 2964705432 Bacteria 7114648
736 2964717027 2964712639 Bacteria 6695970
737 2964721742 2964719344 Bacteria 7286602
738 2965019776 2965018300 Bacteria 6883036
739 2965026359 2965025482 Bacteria 6532201
740 2965032907 2965032056 Bacteria 6887443
741 2965045817 2965040258 Bacteria 6855979
742 2965050640 2965047637 Bacteria 6623551
743 2965066053 2965062239 Bacteria 7412989
744 2965092422 2965089291 Bacteria 6866420
745 2965116609 2965110997 Bacteria 6693150
746 2965126696 2965119406 Bacteria 6956431
747 2967665916 2967664464 Bacteria 6948836
748 2967676773 2967671571 Bacteria 7021409
749 2967679229 2967678726 Bacteria 7264382
750 2967686212 2967686174 Bacteria 6678622
751 2967698043 2967693043 Bacteria 6804451
752 2967702372 2967699805 Bacteria 6854538
753 2967712365 2967706974 Bacteria 7186053
754 2967714991 2967714385 Bacteria 7000047
755 2967724648 2967721400 Bacteria 7073753
756 2967729817 2967728569 Bacteria 6641507
757 2967739678 2967735183 Bacteria 6827012
758 2967747121 2967742019 Bacteria 6794534
759 2967751921 2967748971 Bacteria 6733771
760 2967756610 2967755722 Bacteria 6814706
761 2967764002 2967762386 Bacteria 6923502
762 2967773266 2967769361 Bacteria 6587838
763 2967998326 2967996073 Bacteria 6787468
764 2968006248 2968003550 Bacteria 6929263
765 2968022217 2968016561 Bacteria 7022047
766 2968086960 2968083720 Bacteria 7351627
767 2968095595 2968091066 Bacteria 6052692
768 2968100170 2968097103 Bacteria 6107094
769 2968116903 2968110612 Bacteria 6814636
770 2968118629 2968117919 Bacteria 6536078
771 2968131978 2968128360 Bacteria 6270294
772 2968146306 2968138860 Bacteria 6605449
773 2968173351 2968171901 Bacteria 6894245
774 2970020344 2970019648 Bacteria 7072033
775 2970032574 2970026789 Bacteria 6785236
776 2970038934 2970033650 Bacteria 7118744
777 2970044703 2970040964 Bacteria 6731123
778 2970048230 2970047711 Bacteria 7088379
779 2970059359 2970054988 Bacteria 6611507
780 2970065054 2970061556 Bacteria 7099761
781 2970074155 2970068827 Bacteria 7123112
782 2970080874 2970076120 Bacteria 6697332
783 2970083292 2970082768 Bacteria 6183754
784 2970093614 2970088815 Bacteria 6933825
785 2970096410 2970095765 Bacteria 6936963
786 2970108356 2970102677 Bacteria 6812532
787 2970112452 2970109326 Bacteria 6863976
788 2970120847 2970116247 Bacteria 6501857
789 2970123731 2970122695 Bacteria 6625855
790 2970134095 2970129317 Bacteria 6806560
791 2970141458 2970136068 Bacteria 7207982
792 2970145659 2970143518 Bacteria 6446480
793 2970154957 2970149975 Bacteria 6779706
794 2970157075 2970156795 Bacteria 7168044
795 2970169199 2970164137 Bacteria 6861252
796 2970175888 2970170962 Bacteria 6876229
797 2970182527 2970177841 Bacteria 6768001
798 2970185373 2970184632 Bacteria 7054431
799 2970197144 2970191845 Bacteria 7032787
800 2970474807 2970469710 Bacteria 6969209
801 2970494603 2970489779 Bacteria 6517260
802 2970505749 2970503327 Bacteria 7099517
803 2970511730 2970510686 Bacteria 7006402
804 2970529084 2970524798 Bacteria 6840927
805 2970544509 2970540015 Bacteria 6977556
806 2970550769 2970547951 Bacteria 6931819
807 2970556440 2970554993 Bacteria 6814252
808 2970594876 2970593180 Bacteria 7073582
809 2970624330 2970619444 Bacteria 6986144
810 2970633417 2970627176 Bacteria 6680862
811 2977521640 2977516862 Bacteria 6940108
812 2977528997 2977523885 Bacteria 6960446
813 2977537556 2977530762 Bacteria 6951399
814 2977540574 2977537788 Bacteria 6929320
815 2977544728 2977544691 Bacteria 6875412
816 2977558277 2977551784 Bacteria 7125765
817 2977563831 2977558990 Bacteria 6863948
818 2977570815 2977565890 Bacteria 6901543
819 2977577923 2977572785 Bacteria 6763888
820 2977581704 2977579622 Bacteria 6772100
821 2977827183 2977821940 Bacteria 6906439
822 2977832873 2977828996 Bacteria 7007971
823 2977844583 2977843712 Bacteria 6753583
824 2977856682 2977851361 Bacteria 6694324
825 2977860162 2977858184 Bacteria 6215359
826 2977870375 2977864932 Bacteria 7534097
827 2977876100 2977872689 Bacteria 7270173
828 2977912741 2977907340 Bacteria 6577984
829 2977920702 2977915119 Bacteria 6829656
830 2977927765 2977922695 Bacteria 6956781
831 2977939826 2977935797 Bacteria 6252826
832 2977946570 2977942078 Bacteria 7570577
833 2977956335 2977950692 Bacteria 6893264
834 2977977112 2977971508 Bacteria 7472917
835 2977989043 2977986579 Bacteria 6581278
836 2979093372 2979089926 Bacteria 5670289
837 2979099243 2979095461 Bacteria 5669583
838 2979105343 2979100975 Bacteria 5423623
839 2979712123 2979710463 Bacteria 6785254
840 2979743939 2979742915 Bacteria 7301278
841 2979765212 2979764755 Bacteria 6610066
842 2979777898 2979772303 Bacteria 6618277
843 2979782119 2979779861 Bacteria 6219781
844 2979795711 2979793036 Bacteria 6808957
845 2979810470 2979808191 Bacteria 7179355
846 2984512801 2984509177 Bacteria 5274802
847 2984520836 2984518228 Bacteria 5277463
848 2984540130 2984537506 Bacteria 5277481
849 2984602323 2984601300 Bacteria 5455244
850 2987643390 2987636660 Bacteria 8088555
851 2987651301 2987645492 Bacteria 6117018
852 2987658542 2987652177 Bacteria 6969023
853 2987660958 2987659509 Bacteria 6966464
854 2987672847 2987666974 Bacteria 6509233
855 2987678189 2987673487 Bacteria 6884027
856 2989355324 2989349275 Bacteria 6349068
857 2989774132 2989771324 Bacteria 5605128
858 2996313050 2996310559 Bacteria 6357320
859 2996340029 2996336353 Bacteria 5511628
860 2996347458 2996341866 Bacteria 6643098
861 2996354217 2996348954 Bacteria 7239054
862 2996391833 2996386984 Bacteria 6978667
863 3000136855 3000135777 Bacteria 6891109
864 3002142947 3002141150 Bacteria 5254435
865 3003932269 3003930520 Bacteria 5667563
866 3004171259 3004167301 Bacteria 8330599
867 3004190008 3004188549 Bacteria 6952365
868 3004201539 3004195979 Bacteria 6776956
869 3004206936 3004203850 Bacteria 7307914
870 3004213852 3004211236 Bacteria 7417683
871 3004223443 3004218560 Bacteria 7421728
872 3004233980 3004232784 Bacteria 6662140
873 3004246931 3004239961 Bacteria 6892290
874 3004248270 3004248173 Bacteria 6563236
875 3004270468 3004268573 Bacteria 7043476
876 3004280885 3004275668 Bacteria 7114440
877 3004296086 3004289098 Bacteria 6135450
878 3004339043 3004334049 Bacteria 8449246
879 637079250 637000159 Bacteria 7596297
880 643824707 643692032 Bacteria 6891900
881 648737652 648276728 Bacteria 6968865
882 649874898 649633066 Bacteria 6690028
883 650739192 650716007 Bacteria 5573770
884 8002288103 8002285264 Bacteria 6717907
885 8003570200 8003570095 Bacteria 5747666
886 8003992653 8003992118 Bacteria 7266902
887 8003999977 8003999396 Bacteria 7063185
888 8004306707 8004300914 Bacteria 6132239
889 8004319569 8004312739 Bacteria 7444653
890 8004364530 8004361976 Bacteria 6858373
891 8004380166 8004374579 Bacteria 6898112
892 8004391148 8004387939 Bacteria 7049250
893 8004449529 8004445564 Bacteria 6322258
894 8004635286 8004633249 Bacteria 6723080
895 8004646046 8004640170 Bacteria 6723001
896 8004701109 8004695233 Bacteria 6731676
897 8004704011 8004703790 Bacteria 8006957
898 8004716519 8004714634 Bacteria 6776161
899 8004728763 8004727605 Bacteria 6643904
900 8045866439 8045864390 Bacteria 5043873
901 8049293665 8049293176 Bacteria 6128433
902 8054461447 8054460903 Bacteria 4872905
903 8055623432 8055617313 Bacteria 7548464
904 JGI24740J21852_10003294
905 JGI24739J22299_10003614
906 JGI25158J39367_1002161
907 JGI25157J39369_1000925
908 JGI25159J45721_1000001
909 JGI25159J45721_1000021
910 JGI25151J46595_10015292
911 JGI25165J46597_1000016
912 JGI25160J50197_1000002
913 JGI25161J50226_1000636
914 Ga0055542_1000506
915 Ga0055526_1002789
916 Ga0055524_1022733
917 Ga0058692_1002893
918 Ga0055543_1000010
919 Ga0065165_1000004
920 Ga0070658_10192276
921 Ga0070680_100166596
922 Ga0068868_100118145
923 Ga0070661_100098833
924 Ga0070668_100014679
925 Ga0070667_100002516
926 Ga0070667_100022563
927 Ga0070667_100237451
928 Ga0070711_100111389
929 Ga0070681_10015698
930 Ga0068853_100023147
931 Ga0068853_100038553
932 Ga0068853_100131168
933 Ga0070665_100000026
934 Ga0070665_100251090
935 Ga0068855_100051351
936 Ga0068855_100463452
937 Ga0070664_100130589
938 Ga0068857_100062674
939 Ga0068856_100396704
940 Ga0068852_100010195
941 Ga0068859_100000948
942 Ga0068864_100079083
943 Ga0068851_10069946
944 Ga0068863_100430426
945 Ga0068858_100322534
946 Ga0068862_100000480
947 Ga0081540_1009714
948 Ga0075365_10005564
949 Ga0075365_10006421
950 Ga0075365_10094810
951 Ga0075365_10254985
952 Ga0075368_10065351
953 Ga0075363_100082888
954 Ga0075364_10004999
955 Ga0075364_10012398
956 Ga0075367_10019537
957 Ga0075369_10033787
958 Ga0075369_10080566
959 Ga0068871_100559567
960 Ga0068865_100002283
961 Ga0097620_100000948
962 Ga0079104_1000817
963 Ga0079104_1034368
964 Ga0099826_10001594
965 Ga0105240_10115975
966 Ga0105240_10127601
967 Ga0105243_10063806
968 Ga0105241_10120911
969 Ga0105237_10029631
970 Ga0105237_10178952
971 Ga0105238_10008113
972 Ga0105239_10112886
973 Ga0157371_10000058
974 Ga0157370_10000030
975 Ga0157369_10114120
976 Ga0157369_10200791
977 Ga0157369_10371987
978 Ga0157374_10055710
979 Ga0157372_10238857
980 Ga0157372_10460201
981 Ga0182008_10121728
982 Ga0214544_1000008
983 Ga0214542_1000010
984 Ga0214542_1020252
985 Ga0214543_1000003
986 Ga0214543_1000004
987 Ga0228711_1000001
988 Ga0228710_1000001
989 Ga0209436_101196
990 Ga0209646_1010395
991 Ga0209026_1000005
992 Ga0209148_1000057
993 Ga0209759_1000385
994 Ga0209233_1000068
995 Ga0209233_1008316
996 Ga0209455_1000231
997 Ga0209130_1000008
998 Ga0209676_1005700
999 Ga0209025_1000118
1000 Ga0209025_1000425
1001 Ga0209025_1000575
1002 Ga0209564_1000104
1003 Ga0209758_1011162
1004 Ga0209050_1019196
1005 Ga0209256_1000169
1006 Ga0209256_1001767
1007 Ga0207426_1000016
1008 Ga0209257_1007542
1009 Ga0207656_10031204
1010 Ga0207647_10006448
1011 Ga0207707_10035786
1012 Ga0207671_10015211
1013 Ga0207671_10081634
1014 Ga0207660_10195066
1015 Ga0207694_10018997
1016 Ga0207694_10240910
1017 Ga0207687_10374356
1018 Ga0207704_10019603
1019 Ga0207679_10213278
1020 Ga0207667_10385606
1021 Ga0207668_10110372
1022 Ga0207658_10020885
1023 Ga0207703_10105113
1024 Ga0207678_10086090
1025 Ga0207641_10022582
1026 Ga0207674_10091598
1027 Ga0207674_10193074
1028 Ga0207698_10265094
1029 Ga0209281_1000155
1030 Ga0209281_1000215
1031 Ga0209371_1000009
1032 Ga0209371_1003293
1033 Ga0209282_1000025
1034 Ga0209282_1001731
1035 Ga0209813_10005656
1036 Ga0268266_10000001
1037 Ga0268266_10114793
1038 Ga0268265_10000170
1039 Ga0307515_10002178
1040 Ga0307515_10021929
1041 Ga0268256_1000010
1042 Ga0268256_1002814
1043 Ga0307513_10009761
1044 Ga0307513_10144751
1045 Ga0307412_10120664
1046 Ga0315914_1000020
1047 Ga0307416_100552847
1048 Ga0307414_10102651
1049 Ga0315913_1000013
1050 Ga0315915_1000015
1051 Ga0373927_0000727
1052 Ga0373925_0003571
1053 Ga0395899_0000030
1054 Ga0395900_0000023
1055 Ga0395900_0058442
1056 Ga0395900_0158369
1057 Ga0395898_0000038
1058 Ga0395905_0000021
1059 Ga0395901_0000018
1060 Ga0395901_0058576
1061 Ga0395901_0175290
1062 Ga0451793_0171190
1063 Ga0451807_2173661
1064 Ga0451853_0533114
1065 Ga0451853_0572152
1066 Ga0439449_0028760
1067 Ga0439458_0022351
1068 Ga0466967_0319202
1069 Ga0495638_0025041
1070 Ga0495638_0029964
1071 Ga0495638_0103097
1072 Ga0495625_0192839
1073 Ga0495588_0003015
1074 Ga0495670_0110040
1075 Ga0495681_0003362
1076 Ga0495626_0031952
1077 Ga0496117_0000002
1078 Ga0496117_0007726
1079 Ga0496117_0023477
1080 Ga0496118_0000483
1081 Ga0496118_0040214
1082 Ga0496119_0040196
1083 Ga0496120_0000971
1084 Ga0496120_0001519
1085 Ga0496120_0016827
1086 Ga0496120_0029419
1087 Ga0496121_0000001
1088 Ga0496122_0000001
1089 Ga0496122_0000247
1090 Ga0496122_0004617
1091 Ga0496123_0000001
1092 Ga0496123_0000499
1093 Ga0496124_0013622
1094 Ga0496124_0096633
1095 Ga0496125_0001802
1096 Ga0496125_0016520
1097 Ga0496125_0046342
1098 Ga0496125_0046902
1099 Ga0496126_0000438
1100 Ga0496126_0183905
1101 Ga0501031_0000015
1102 Ga0501031_0010064
1103 Ga0501031_0022147
1104 Ga0501031_0060553
1105 Ga0501032_0000008
1106 Ga0501032_0000060
1107 Ga0501032_0015384
1108 Ga0501033_0000012
1109 Ga0501033_0001335
1110 Ga0501033_0002298
1111 Ga0501033_0003698
1112 Ga0501033_0011407
1113 Ga0501033_0011641
1114 Ga0501034_0000035
1115 Ga0501034_0000262
1116 Ga0501034_0005192
1117 Ga0501034_0029231
1118 Ga0501034_0030646
1119 Ga0501034_0053596
1120 Ga0501034_0064828
1121 Ga0501034_0176533
1122 Ga0501034_0213946
1123 Ga0501036_0000006
1124 Ga0501036_0014052
1125 Ga0501036_0084183
1126 Ga0501036_0280035
1127 Ga0501037_0000076
1128 Ga0501037_0000123
1129 Ga0501037_0001856
1130 Ga0501037_0018857
1131 Ga0501037_0235487
1132 Ga0501038_0000007
1133 Ga0501038_0000051
1134 Ga0501038_0002042
1135 Ga0501038_0087718
1136 Ga0501038_0096036
1137 Ga0501038_0241063
1138 Ga0501039_0000012
1139 Ga0501039_0000051
1140 Ga0501039_0009794
1141 Ga0501039_0011165
1142 Ga0501039_0148837
1143 Ga0501043_0000039
1144 Ga0501043_0001221
1145 Ga0501043_0004079
1146 Ga0501043_0014623
1147 Ga0501043_0025064
1148 Ga0501043_0180657
1149 Ga0501046_0006208
1150 Ga0501046_0033384
1151 Ga0501047_0015616
1152 Ga0501047_0017982
1153 Ga0501047_0028848
1154 Ga0501047_0163042
1155 Ga0501047_0167970
1156 Ga0501048_0042510
1157 Ga0501048_0114792
1158 Ga0501067_0016339
1159 Ga0501068_0024507
1160 Ga0501068_0048418
1161 Ga0501068_0107774
1162 Ga0501069_0000022
1163 Ga0501069_0001371
1164 Ga0501069_0001415
1165 Ga0501069_0285831
1166 Ga0501070_0000080
1167 Ga0501070_0002855
1168 Ga0501070_0002946
1169 Ga0501070_0114218
1170 Ga0501071_0010517
1171 Ga0501072_0036446
1172 Ga0501073_0000442
1173 Ga0501073_0064717
1174 Ga0501074_0000046
1175 Ga0501074_0000641
1176 Ga0501074_0004584
1177 Ga0501079_0003774
1178 Ga0501080_0020842
1179 Ga0501080_0021121
1180 Ga0501080_0050611
1181 Ga0501081_0040158
1182 Ga0501083_0000050
1183 Ga0501083_0002509
1184 Ga0501083_0004324
1185 Ga0501035_0000035
1186 Ga0501035_0000119
1187 Ga0501035_0000318
1188 Ga0501035_0005255
1189 Ga0501035_0044748
1190 Ga0501044_0000015
1191 Ga0501044_0000147
1192 Ga0501044_0060367
1193 Ga0501044_0072823
1194 Ga0501045_0030631
1195 Ga0501045_0035410
1196 Ga0501045_0201394
1197 nmdc:mga03n38_10345_c1
1198 nmdc:mga03n38_18642_c1
1199 nmdc:mga03n38_56903_c1
1200 nmdc:mga00v17_30517_c1
1201 nmdc:mga00v17_9111_c1
1202 nmdc:mga0yw44_11446_c1
1203 nmdc:mga0yw44_15055_c1
1204 nmdc:mga0yw44_71550_c1
1205 nmdc:mga06z11_93770_c1
1206 nmdc:mga04h51_21783_c1
1207 nmdc:mga07m45_42166_c1
1208 nmdc:mga0sz30_16824_c1
1209 nmdc:mga0sz30_41607_c1
1210 Ga0500610_0103926
1211 Ga0500651_0032404
1212 Ga0500651_0067975
1213 Ga0500561_0001611
1214 Ga0500568_0000347
1215 Ga0500624_000965
1216 Ga0501084_0005409
1217 Ga0501082_0008026
1218 Ga0501082_0209317
1219 Ga0501082_0309995
1220 2792638591
1221 2503203687
1222 2509107284
1223 2509113950
1224 2509141083
1225 2509370832
1226 2509374750
1227 2509398051
1228 2510304966
1229 2510316623
1230 2511390658
1231 2511500760
1232 2512532174
1233 2512929502
1234 2512964295
1235 2512972489
1236 2513584953
1237 2513605512
1238 2513608112
1239 2513616750
1240 2513880836
1241 2513903830
1242 2513984898
1243 2513999938
1244 2514007487
1245 2514033955
1246 2514421017
1247 2514591481
1248 2515607890
1249 2516208632
1250 2516892031
1251 2517568846
1252 2524450084
1253 2537874403
1254 2551680163
1255 2551684259
1256 2551694094
1257 2551698404
1258 2551714556
1259 2551720757
1260 2551727589
1261 2551735500
1262 2551741320
1263 2554246774
1264 2558863742
1265 2559294001
1266 2585165206
1267 2585266580
1268 2585387596
1269 2585394200
1270 2588515078
1271 2597815790
1272 2599603675
1273 2599938649
1274 2600191633
1275 2601609022
1276 2601745797
1277 2643773952
1278 2643774680
1279 2643793125
1280 2643807512
1281 2643838499
1282 2643921008
1283 2643989149
1284 2644046939
1285 2644069923
1286 2644109306
1287 2644132649
1288 2644151827
1289 2644152346
1290 2644203622
1291 2644206510
1292 2644311961
1293 2644330235
1294 2644380895
1295 2644414799
1296 2644448456
1297 2644479728
1298 2644493674
1299 2644497269
1300 2644519084
1301 2644543012
1302 2644617759
1303 2644650157
1304 2644673853
1305 2644689237
1306 2657682066
1307 2688600449
1308 2692317079
1309 2694632613
1310 2694639658
1311 2723577723
1312 2739308666
1313 2756672994
1314 2765469080
1315 2770194886
1316 2776272332
1317 2776284271
1318 2792583920
1319 2792622282
1320 2792628152
1321 2792753106
1322 2802717487
1323 2802723584
1324 2802730966
1325 2802735972
1326 2802743819
1327 2802752964
1328 2804751084
1329 2808986223
1330 2819556353
1331 2837680582
1332 2838076165
1333 2838677080
1334 2838715967
1335 2838720231
1336 2838726720
1337 2839994438
1338 2840764972
1339 2841735092
1340 2841847165
1341 2841860302
1342 2842126805
1343 2842131973
1344 2842152857
1345 2842172212
1346 2842176476
1347 2842189076
1348 2842213389
1349 2842224993
1350 2842517087
1351 2842526514
1352 2842698022
1353 2842873641
1354 2844005455
1355 2844015771
1356 2844163677
1357 2847417852
1358 2847672115
1359 2847688444
1360 2848992694
1361 2850080221
1362 2855831952
1363 2855840237
1364 2855873246
1365 2856318075
1366 2856326608
1367 2856330883
1368 2856339871
1369 2856346913
1370 2856355625
1371 2856365358
1372 2857354788
1373 2857368346
1374 2858800769
1375 2869168181
1376 2869172288
1377 2869237717
1378 2869247530
1379 2869252137
1380 2869261479
1381 2869270891
1382 2869271784
1383 2869280278
1384 2869289269
1385 2871431337
1386 2871438327
1387 2871445425
1388 2871452276
1389 2871460546
1390 2871467091
1391 2871478080
1392 2871484180
1393 2871492769
1394 2871497366
1395 2874102229
1396 2874111381
1397 2874119810
1398 2874125313
1399 2874134315
1400 2874144386
1401 2874148536
1402 2874156280
1403 2874173691
1404 2876366938
1405 2876374407
1406 2876379823
1407 2876388998
1408 2876398904
1409 2876404578
1410 2876415315
1411 2876421914
1412 2878037333
1413 2878744237
1414 2878747941
1415 2878758650
1416 2878761584
1417 2878768551
1418 2878780934
1419 2881154044
1420 2881157788
1421 2881163119
1422 2881849182
1423 2881855179
1424 2881862896
1425 2882640015
1426 2885312080
1427 2885315841
1428 2885319883
1429 2885329661
1430 2885337385
1431 2885350874
1432 2888341824
1433 2888349117
1434 2888351049
1435 2889013439
1436 2889021844
1437 2889794219
1438 2889920262
1439 2891376314
1440 2894655194
1441 2894817902
1442 2896385354
1443 2899792367
1444 2899846640
1445 2903453596
1446 2903496499
1447 2903505941
1448 2903514471
1449 2903524805
1450 2903530952
1451 2903542161
1452 2904578909
1453 2904665436
1454 2906311559
1455 2906323299
1456 2906331607
1457 2906359978
1458 2906364041
1459 2906377006
1460 2906384271
1461 2906387785
1462 2906394988
1463 2906404179
1464 2906409875
1465 2906418112
1466 2906433876
1467 2913297818
1468 2915982252
1469 2915989100
1470 2915998033
1471 2916001764
1472 2916010634
1473 2916020305
1474 2916024593
1475 2916028812
1476 2916041570
1477 2916045565
1478 2916051235
1479 2916059614
1480 2916062587
1481 2916069478
1482 2916079836
1483 2919116171
1484 2919122264
1485 2921201900
1486 2921213618
1487 2921240467
1488 2921250618
1489 2921250753
1490 2921261158
1491 2921268561
1492 2921287192
1493 2921290195
1494 2921303534
1495 2922139017
1496 2922153720
1497 2922164447
1498 2922178407
1499 2922178929
1500 2922187780
1501 2924147067
1502 2924151739
1503 2924164813
1504 2924166035
1505 2924177737
1506 2924180467
1507 2924187769
1508 2924198552
1509 2924204534
1510 2924211809
1511 2924218627
1512 2924222824
1513 2924235095
1514 2924728500
1515 2924738618
1516 2924743208
1517 2924755543
1518 2924764307
1519 2924782155
1520 2924788414
1521 2926757125
1522 2926761346
1523 2928526248
1524 2929139115
1525 2933007502
1526 2933012270
1527 2933594715
1528 2936999358
1529 2937007928
1530 2937016056
1531 2937016883
1532 2937027685
1533 2937030070
1534 2937037936
1535 2937044572
1536 2937050526
1537 2937057411
1538 2937064832
1539 2937076067
1540 2937080147
1541 2937085788
1542 2937092714
1543 2937099764
1544 2937107042
1545 2937119648
1546 2937124233
1547 2937130295
1548 2937818621
1549 2937828504
1550 2937838787
1551 2937850547
1552 2937868275
1553 2937877716
1554 2937895026
1555 2937977788
1556 2937984695
1557 2937996015
1558 2938015896
1559 2941500539
1560 2954014855
1561 2957379014
1562 2957387053
1563 2957393523
1564 2957400026
1565 2957402816
1566 2957413162
1567 2957415740
1568 2957429378
1569 2957436539
1570 2957443858
1571 2957450201
1572 2957455328
1573 2957458395
1574 2957469341
1575 2957471848
1576 2957483873
1577 2957485901
1578 2957494322
1579 2957499048
1580 2957506251
1581 2958036147
1582 2958047571
1583 2958051540
1584 2958066239
1585 2958074473
1586 2958084823
1587 2958096375
1588 2958107200
1589 2958109457
1590 2958115772
1591 2958124116
1592 2958133645
1593 2958143287
1594 2958150233
1595 2958163765
1596 2958166486
1597 2958173056
1598 2958183289
1599 2960585645
1600 2960593765
1601 2960600785
1602 2960604511
1603 2960613942
1604 2960617494
1605 2960628713
1606 2960632926
1607 2960638913
1608 2960646194
1609 2960653870
1610 2960663293
1611 2960672363
1612 2960677661
1613 2960685638
1614 2960690511
1615 2960695654
1616 2961081256
1617 2961120436
1618 2961130226
1619 2961138820
1620 2961164951
1621 2961173155
1622 2961188670
1623 2963649731
1624 2964610918
1625 2964617899
1626 2964622747
1627 2964629564
1628 2964636638
1629 2964647769
1630 2964654474
1631 2964657083
1632 2964670143
1633 2964677638
1634 2964682705
1635 2964685791
1636 2964692795
1637 2964702023
1638 2964710654
1639 2964717027
1640 2964721742
1641 2965019776
1642 2965026359
1643 2965032907
1644 2965045817
1645 2965050640
1646 2965066053
1647 2965092422
1648 2965116609
1649 2965126696
1650 2967665916
1651 2967676773
1652 2967679229
1653 2967686212
1654 2967698043
1655 2967702372
1656 2967712365
1657 2967714991
1658 2967724648
1659 2967729817
1660 2967739678
1661 2967747121
1662 2967751921
1663 2967756610
1664 2967764002
1665 2967773266
1666 2967998326
1667 2968006248
1668 2968022217
1669 2968086960
1670 2968095595
1671 2968100170
1672 2968116903
1673 2968118629
1674 2968131978
1675 2968146306
1676 2968173351
1677 2970020344
1678 2970032574
1679 2970038934
1680 2970044703
1681 2970048230
1682 2970059359
1683 2970065054
1684 2970074155
1685 2970080874
1686 2970083292
1687 2970093614
1688 2970096410
1689 2970108356
1690 2970112452
1691 2970120847
1692 2970123731
1693 2970134095
1694 2970141458
1695 2970145659
1696 2970154957
1697 2970157075
1698 2970169199
1699 2970175888
1700 2970182527
1701 2970185373
1702 2970197144
1703 2970474807
1704 2970494603
1705 2970505749
1706 2970511730
1707 2970529084
1708 2970544509
1709 2970550769
1710 2970556440
1711 2970594876
1712 2970624330
1713 2970633417
1714 2977521640
1715 2977528997
1716 2977537556
1717 2977540574
1718 2977544728
1719 2977558277
1720 2977563831
1721 2977570815
1722 2977577923
1723 2977581704
1724 2977827183
1725 2977832873
1726 2977844583
1727 2977856682
1728 2977860162
1729 2977870375
1730 2977876100
1731 2977912741
1732 2977920702
1733 2977927765
1734 2977939826
1735 2977946570
1736 2977956335
1737 2977977112
1738 2977989043
1739 2979093372
1740 2979099243
1741 2979105343
1742 2979712123
1743 2979743939
1744 2979765212
1745 2979777898
1746 2979782119
1747 2979795711
1748 2979810470
1749 2984512801
1750 2984520836
1751 2984540130
1752 2984602323
1753 2987643390
1754 2987651301
1755 2987658542
1756 2987660958
1757 2987672847
1758 2987678189
1759 2989355324
1760 2989774132
1761 2996313050
1762 2996340029
1763 2996347458
1764 2996354217
1765 2996391833
1766 3000136855
1767 3002142947
1768 3003932269
1769 3004171259
1770 3004190008
1771 3004201539
1772 3004206936
1773 3004213852
1774 3004223443
1775 3004233980
1776 3004246931
1777 3004248270
1778 3004270468
1779 3004280885
1780 3004296086
1781 3004339043
1782 637079250
1783 643824707
1784 648737652
1785 649874898
1786 650739192
1787 8002288103
1788 8003570200
1789 8003992653
1790 8003999977
1791 8004306707
1792 8004319569
1793 8004364530
1794 8004380166
1795 8004391148
1796 8004449529
1797 8004635286
1798 8004646046
1799 8004701109
1800 8004704011
1801 8004716519
1802 8004728763
1803 8045866439
1804 8049293665
1805 8054461447
1806 8055623432

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00850

Hist_deacetyl

Histone deacetylase domain

26

312

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
5g0y-assembly1.cif.gz_B pseudomonas aeruginosa hdah unliganded. 0.9549 1 301
5g13-assembly1.cif.gz_B pseudomonas aeruginosa hdah (h143a) unliganded. 0.9537 2 299
5g1a-assembly1.cif.gz_B bordetella alcaligenes hdah bound to pfsaha 0.9529 2 302
5g11-assembly1.cif.gz_B pseudomonas aeruginosa hdah bound to pfsaha. 0.9527 1 301
8szt-assembly1.cif.gz_C-2 structure of kdac1 from acinetobacter baumannii 0.9525 1 302
ID Description Score Start End Superfamily
af_A0A1D6N7T5_1_214_3.40.800.20 Alpha Beta;3-Layer(aba) Sandwich;Arginase; Chain A;Histone deacetylase domain 0.9624 126 301 3.40.800.20
5li3A00 Alpha Beta;3-Layer(aba) Sandwich;Arginase; Chain A;Histone deacetylase domain 0.9538 1 301 3.40.800.20
5ji5A00 Alpha Beta;3-Layer(aba) Sandwich;Arginase; Chain A;Histone deacetylase domain 0.9503 2 299 3.40.800.20
5g1cA00 Alpha Beta;3-Layer(aba) Sandwich;Arginase; Chain A;Histone deacetylase domain 0.9493 2 301 3.40.800.20
5li3A00 Alpha Beta;3-Layer(aba) Sandwich;Arginase; Chain A;Histone deacetylase domain 0.9476 1 301 3.40.800.20
ID Description Score Start End GO Terms
AF-A0A435AXE0-F1-model_v4 deleted 0.9827 88 302
AF-A0A258QZV9-F1-model_v4 Acetoin utilization protein 0.9797 99 302 GO:0004407
GO:0040029
AF-A0A832ALN7-F1-model_v4 Histone deacetylase family protein 0.9789 134 302 GO:0004407
GO:0040029
AF-I7FCL7-F1-model_v4 Histone deacetylase superfamily (EC 3.5.1.48) 0.9772 2 302 GO:0004407
GO:0040029
GO:0047611
AF-A0QNU9-F1-model_v4 Histone deacetylase superfamily protein 0.9771 1 302 GO:0004407
GO:0040029

Map