F485266

General Info

Members Datasets Scaffolds Average Seq Length
904 378 886 299

Family's Representative Sequence

Representative Sequence 3300005328|Ga0070676_10002095|Ga0070676_100020958
Length 321
Sequence MAGRAPGRSQAGPHPLGGPTNVPGGRGAPIRISDFGMDTISLAGTLPQKLAAIEGAGFSQVMLMARDLVGHAEGIDDAVRVVKASGLRVTGFQVLRDFEGLSGHLHDYKIDVAKSMLEMCRAVGATVLLVCSSTSTHASGDPDALARDLRKLAMLALPLGIRIAYEGLSWGRHVNEFTTAWDIVCRADAPNLGIGIDSFHAFATKTALVDLDVLDPDKIFLVQLADFMWNEIPSVEERIATARHFRVFPGEGVHSEALAELVMRLDRLGYRGDYSFEVFNDDYQQMPLPVVAERARRSAVWLGEDVLHRSVPLPGRMRLRR

Samples

Sample ID Description Type Environment
1 2511231002 Polaromonas sp. CF318 Isolate Rhizosphere
2 2547132374 Acidovorax radicis N35 Isolate Unclassified
3 2585428058 Methylibium sp. CF468 Isolate Rhizosphere
4 2585428062 Methylibium sp. CF059 Isolate Rhizosphere
5 2643221570 Acidovorax sp. Root568 Isolate Unclassified
6 2643221596 Acidovorax sp. Root70 Isolate Unclassified
7 2643221609 Acidovorax sp. Root217 Isolate Unclassified
8 2643221611 Acidovorax sp. Root219 Isolate Unclassified
9 2643221621 Achromobacter sp. Root83 Isolate Unclassified
10 2643221652 Acidovorax sp. Root402 Isolate Unclassified
11 2643221717 Acidovorax sp. Root267 Isolate Unclassified
12 2721755523 Delftia sp. HK171 Isolate Unclassified
13 2738543012 Acidovorax sp. CF301 Isolate Unclassified
14 2816332133 Acidovorax radicis 2721A Isolate Unclassified
15 2839138175 Delftia acidovorans B15 Isolate Rhizosphere
16 2881101125 Ramlibacter rhizophilus CCTCC AB2015357 Isolate Rhizosphere
17 2919704043 Hydrogenophaga palleronii 4249 Isolate Unclassified
18 2990710928 Acidovorax delafieldii SLBN-75 Isolate Rhizosphere
19 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
20 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
21 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
22 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
23 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
24 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
25 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
26 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
27 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
28 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
29 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
30 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
31 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
32 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
33 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
34 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
35 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
36 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
37 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
38 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
39 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
40 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
41 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
42 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
43 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
44 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
45 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
46 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
47 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
48 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
49 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
50 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
51 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
52 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
53 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
54 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
55 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
56 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
57 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
58 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
59 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
60 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
61 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
62 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
63 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
64 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
65 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
66 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
67 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
68 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
69 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
70 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
71 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
72 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
73 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
74 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
75 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
76 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
77 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
78 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
79 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
80 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
81 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
82 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
83 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
84 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
85 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
86 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
87 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
88 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
89 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
90 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
91 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
92 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
93 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
94 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
95 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
96 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
97 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
98 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
99 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
100 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
101 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
102 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
103 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
104 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
105 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
106 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
107 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
108 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
109 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
110 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
111 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
112 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
113 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
114 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
115 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
116 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
117 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
118 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
119 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
120 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
121 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
122 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
123 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
124 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
125 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
126 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
127 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
128 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
129 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
130 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
131 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
132 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
133 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
134 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
135 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
136 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
137 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
138 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
139 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
140 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
141 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
142 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
143 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
144 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
145 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
146 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
147 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
148 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
149 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
150 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
151 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
152 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
153 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
154 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
155 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
156 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
157 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
158 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
159 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
160 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
161 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
162 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
163 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
164 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
165 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
166 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
167 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
168 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
169 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
170 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
171 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
172 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
173 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
174 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
219 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
220 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
221 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
223 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
224 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
225 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
226 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
227 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
228 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
229 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
230 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
231 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
232 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
233 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
234 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
235 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
236 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
237 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
238 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
239 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
240 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
241 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
242 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
243 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
244 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
245 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
246 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
247 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
248 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
249 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
250 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
251 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
252 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
253 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
254 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
255 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
256 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
257 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
258 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
259 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
260 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
261 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
262 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
263 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
264 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
265 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
266 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
267 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
268 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
269 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
270 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
271 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
272 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
273 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
274 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
275 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
276 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
277 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
278 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
279 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
280 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
281 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
282 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
283 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
284 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
285 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
286 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
287 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
288 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
289 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
290 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
291 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
292 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
293 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
294 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
295 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
296 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
297 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
298 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
299 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
300 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
301 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
302 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
303 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
304 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
305 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
306 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
307 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
308 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
309 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
310 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
311 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
312 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
313 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
314 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
315 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
316 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
317 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
318 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
319 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
320 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
321 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
322 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
323 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
324 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
325 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
326 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
327 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
328 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
329 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
330 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
331 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
332 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
333 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
334 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
335 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
336 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
337 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
338 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
339 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
340 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
341 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
342 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
343 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
344 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
345 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
346 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
347 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
348 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
349 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
350 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
351 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
352 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
353 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
354 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
355 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
356 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
357 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
358 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
359 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
360 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
361 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
362 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
363 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
364 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
365 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
366 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
367 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
368 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
369 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
370 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
371 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
372 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
373 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
374 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
375 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
376 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
377 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
378 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.9
Metatranscriptomes 0.11
Isolates 1.99

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 13.61
Nodule 0.44
Rhizoplane 3.21
Rhizosphere 75
Stem 0
Stem Tuber 0
Unclassified 7.74

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25155J39150_1000090 3300002704 Bacteria 51836
2 JGI25156J39149_1000148 3300002705 Bacteria 51890
3 JGI25154J39366_1000155 3300002738 Bacteria 52889
4 JGI25157J39369_1000183 3300002741 Bacteria 52889
5 JGI25150J39212_1004158 3300002774 Bacteria 3262
6 JGI25150J39212_1004356 3300002774 Bacteria 3160
7 JGI25151J46595_10001873 3300003187 Bacteria 13428
8 JGI25151J46595_10009246 3300003187 Bacteria 4682
9 JGI25151J46595_10027293 3300003187 Bacteria 2291
10 JGI25406J46586_10032068 3300003203 Unclassified 1957
11 JGI25153J46596_10004275 3300003215 Bacteria 7724
12 rootH2_10050795 3300003320 Bacteria 5449
13 rootL2_10005678 3300003322 Bacteria 4807
14 JGI25160J50197_1000059 3300003354 Bacteria 116962
15 JGI25161J50226_1000008 3300003374 Bacteria 239245
16 Ga0055537_1000245 3300003773 Bacteria 39851
17 Ga0055537_1000249 3300003773 Bacteria 39449
18 Ga0055524_1000057 3300003775 Bacteria 139566
19 Ga0055536_1003494 3300003781 Bacteria 8425
20 Ga0055528_1000888 3300003790 Bacteria 20186
21 Ga0055530_10002076 3300003791 Bacteria 13433
22 Ga0055540_1001554 3300003792 Bacteria 13439
23 Ga0055531_10000281 3300003794 Bacteria 51971
24 Ga0055531_10002433 3300003794 Bacteria 12465
25 Ga0055531_10014357 3300003794 Bacteria 3570
26 Ga0055543_1000138 3300004625 Bacteria 60628
27 Ga0065165_1007150 3300005262 Bacteria 5586
28 Ga0065712_10099630 3300005290 Bacteria 2086
29 Ga0065715_10119990 3300005293 Bacteria 2271
30 Ga0065715_10126678 3300005293 Bacteria 2103
31 Ga0070676_10002095 3300005328 Bacteria 10149
32 Ga0070676_10012793 3300005328 Bacteria 4591
33 Ga0070676_10027724 3300005328 Bacteria 3214
34 Ga0070676_10030285 3300005328 Bacteria 3085
35 Ga0070683_100028689 3300005329 Bacteria 5031
36 Ga0070683_100087454 3300005329 Bacteria 2923
37 Ga0070690_100001452 3300005330 Bacteria 12372
38 Ga0070690_100047352 3300005330 Bacteria 2735
39 Ga0070670_100008053 3300005331 Bacteria 8967
40 Ga0070670_100029077 3300005331 Bacteria 4755
41 Ga0070670_100095055 3300005331 Bacteria 2563
42 Ga0070677_10003466 3300005333 Bacteria 5088
43 Ga0068869_100000481 3300005334 Bacteria 22080
44 Ga0068869_100002513 3300005334 Bacteria 11067
45 Ga0070666_10000745 3300005335 Bacteria 19736
46 Ga0070666_10090255 3300005335 Bacteria 2104
47 Ga0070666_10107516 3300005335 Bacteria 1927
48 Ga0070666_10195358 3300005335 Bacteria 1423
49 Ga0070680_100049561 3300005336 Bacteria 3424
50 Ga0068868_100000971 3300005338 Bacteria 19511
51 Ga0068868_100050030 3300005338 Bacteria 3281
52 Ga0068868_100061098 3300005338 Bacteria 2985
53 Ga0068868_100065210 3300005338 Bacteria 2893
54 Ga0068868_100130065 3300005338 Bacteria 2059
55 Ga0068868_100198559 3300005338 Bacteria 1671
56 Ga0068868_100284614 3300005338 Bacteria 1400
57 Ga0070660_100000483 3300005339 Bacteria 26582
58 Ga0070660_100003597 3300005339 Bacteria 10701
59 Ga0070660_100174322 3300005339 Bacteria 1738
60 Ga0070689_100002088 3300005340 Bacteria 12972
61 Ga0070689_100015294 3300005340 Bacteria 5592
62 Ga0070689_100054672 3300005340 Bacteria 3091
63 Ga0070689_100532457 3300005340 Bacteria 1010
64 Ga0070687_100017491 3300005343 Bacteria 3298
65 Ga0070687_100117256 3300005343 Bacteria 1517
66 Ga0070661_100042363 3300005344 Bacteria 3322
67 Ga0070661_100062174 3300005344 Bacteria 2741
68 Ga0070661_100243376 3300005344 Bacteria 1386
69 Ga0070668_100001533 3300005347 Bacteria 16665
70 Ga0070668_100049482 3300005347 Bacteria 3233
71 Ga0070668_100211549 3300005347 Bacteria 1595
72 Ga0070669_100004947 3300005353 Bacteria 9626
73 Ga0070675_100001174 3300005354 Bacteria 18990
74 Ga0070675_100023744 3300005354 Bacteria 4906
75 Ga0070675_100030891 3300005354 Bacteria 4327
76 Ga0070675_100033406 3300005354 Bacteria 4171
77 Ga0070675_100092616 3300005354 Bacteria 2534
78 Ga0070675_100364154 3300005354 Unclassified 1284
79 Ga0070671_100001053 3300005355 Bacteria 20340
80 Ga0070671_100002310 3300005355 Bacteria 14715
81 Ga0070671_100007296 3300005355 Bacteria 8829
82 Ga0070671_100010290 3300005355 Bacteria 7504
83 Ga0070671_100047279 3300005355 Bacteria 3579
84 Ga0070671_100060980 3300005355 Bacteria 3141
85 Ga0070671_100088195 3300005355 Bacteria 2596
86 Ga0070671_100098636 3300005355 Unclassified 2451
87 Ga0070671_100169992 3300005355 Bacteria 1843
88 Ga0070671_100241336 3300005355 Bacteria 1534
89 Ga0070674_100055090 3300005356 Bacteria 2752
90 Ga0070674_100060111 3300005356 Bacteria 2648
91 Ga0070674_100099699 3300005356 Bacteria 2114
92 Ga0070674_100145916 3300005356 Bacteria 1781
93 Ga0070674_100408572 3300005356 Bacteria 1111
94 Ga0070673_100007976 3300005364 Bacteria 7016
95 Ga0070673_100026546 3300005364 Bacteria 4279
96 Ga0070673_100048464 3300005364 Bacteria 3312
97 Ga0070673_100257003 3300005364 Bacteria 1525
98 Ga0070688_100002954 3300005365 Bacteria 8666
99 Ga0070688_100057346 3300005365 Bacteria 2448
100 Ga0070688_100089848 3300005365 Bacteria 2005
101 Ga0070659_100003296 3300005366 Bacteria 11497
102 Ga0070659_100051700 3300005366 Bacteria 3231
103 Ga0070667_100001469 3300005367 Bacteria 21118
104 Ga0070667_100004231 3300005367 Bacteria 12120
105 Ga0070667_100007604 3300005367 Bacteria 8987
106 Ga0070667_100020817 3300005367 Bacteria 5448
107 Ga0070667_100042389 3300005367 Bacteria 3819
108 Ga0070667_100054892 3300005367 Bacteria 3364
109 Ga0070667_100074494 3300005367 Bacteria 2896
110 Ga0070709_10043398 3300005434 Bacteria 2780
111 Ga0070701_10017069 3300005438 Bacteria 3388
112 Ga0070711_100004626 3300005439 Bacteria 8146
113 Ga0070711_100209686 3300005439 Bacteria 1508
114 Ga0070705_100004377 3300005440 Bacteria 6877
115 Ga0070694_100025464 3300005444 Bacteria 3827
116 Ga0070708_100000792 3300005445 Bacteria 23848
117 Ga0070663_100003912 3300005455 Bacteria 8683
118 Ga0070663_100004009 3300005455 Bacteria 8589
119 Ga0070663_100021054 3300005455 Bacteria 4330
120 Ga0070663_100107551 3300005455 Bacteria 2091
121 Ga0070663_100135412 3300005455 Bacteria 1875
122 Ga0070663_100155362 3300005455 Bacteria 1757
123 Ga0070663_100182684 3300005455 Bacteria 1628
124 Ga0070663_100252222 3300005455 Bacteria 1397
125 Ga0070678_100000242 3300005456 Bacteria 25045
126 Ga0070678_100002830 3300005456 Bacteria 9597
127 Ga0070678_100013194 3300005456 Bacteria 5170
128 Ga0070662_100001177 3300005457 Bacteria 16048
129 Ga0070662_100027749 3300005457 Bacteria 3934
130 Ga0070662_100048655 3300005457 Bacteria 3055
131 Ga0070662_100060606 3300005457 Bacteria 2760
132 Ga0070662_100260566 3300005457 Bacteria 1397
133 Ga0070662_100264038 3300005457 Bacteria 1388
134 Ga0070681_10076070 3300005458 Bacteria 3316
135 Ga0068867_100002983 3300005459 Bacteria 11932
136 Ga0068867_100004082 3300005459 Bacteria 10270
137 Ga0068867_100007271 3300005459 Bacteria 7832
138 Ga0068867_100044893 3300005459 Bacteria 3239
139 Ga0068867_100188620 3300005459 Bacteria 1644
140 Ga0068867_100292737 3300005459 Bacteria 1339
141 Ga0068867_100295992 3300005459 Bacteria 1332
142 Ga0068867_100329731 3300005459 Unclassified 1267
143 Ga0068867_100523140 3300005459 Bacteria 1023
144 Ga0070685_10003675 3300005466 Bacteria 7777
145 Ga0070685_10011495 3300005466 Bacteria 4634
146 Ga0070685_10259974 3300005466 Bacteria 1154
147 Ga0070706_100003222 3300005467 Bacteria 16122
148 Ga0070706_100015189 3300005467 Bacteria 7110
149 Ga0070706_100209206 3300005467 Bacteria 1822
150 Ga0070707_100033981 3300005468 Bacteria 4864
151 Ga0070707_100070778 3300005468 Bacteria 3360
152 Ga0070707_100241402 3300005468 Bacteria 1758
153 Ga0070699_100156957 3300005518 Bacteria 2013
154 Ga0070679_100037311 3300005530 Bacteria 4826
155 Ga0070697_100133293 3300005536 Bacteria 2085
156 Ga0070697_100149793 3300005536 Bacteria 1966
157 Ga0068853_100002005 3300005539 Bacteria 15041
158 Ga0068853_100098480 3300005539 Bacteria 2582
159 Ga0070672_100011595 3300005543 Bacteria 6150
160 Ga0070672_100083034 3300005543 Bacteria 2571
161 Ga0070672_100086923 3300005543 Bacteria 2515
162 Ga0070672_100091803 3300005543 Bacteria 2450
163 Ga0070686_100021664 3300005544 Bacteria 3825
164 Ga0070696_100067690 3300005546 Bacteria 2506
165 Ga0070696_100309732 3300005546 Bacteria 1212
166 Ga0070693_100002585 3300005547 Bacteria 8333
167 Ga0070693_100280213 3300005547 Bacteria 1116
168 Ga0070665_100001402 3300005548 Bacteria 28337
169 Ga0070665_100005336 3300005548 Bacteria 13281
170 Ga0070665_100007136 3300005548 Bacteria 11361
171 Ga0070665_100054460 3300005548 Bacteria 4012
172 Ga0070665_100057649 3300005548 Bacteria 3893
173 Ga0070665_100264556 3300005548 Bacteria 1721
174 Ga0070704_100084074 3300005549 Bacteria 2352
175 Ga0068855_100003898 3300005563 Bacteria 18217
176 Ga0068855_100028758 3300005563 Bacteria 6650
177 Ga0068855_100129567 3300005563 Bacteria 2882
178 Ga0070664_100045893 3300005564 Bacteria 3690
179 Ga0070664_100083739 3300005564 Bacteria 2752
180 Ga0070664_100084232 3300005564 Bacteria 2744
181 Ga0068857_100006391 3300005577 Bacteria 10098
182 Ga0068857_100007102 3300005577 Bacteria 9645
183 Ga0068857_100026898 3300005577 Bacteria 5072
184 Ga0068854_100047229 3300005578 Bacteria 3068
185 Ga0068854_100095261 3300005578 Bacteria 2222
186 Ga0068854_100290222 3300005578 Bacteria 1320
187 Ga0068856_100001796 3300005614 Bacteria 22411
188 Ga0068856_100068424 3300005614 Bacteria 3510
189 Ga0068856_100171183 3300005614 Bacteria 2184
190 Ga0068856_100235728 3300005614 Bacteria 1845
191 Ga0068856_100246726 3300005614 Bacteria 1801
192 Ga0068856_100543997 3300005614 Bacteria 1182
193 Ga0070702_100010808 3300005615 Bacteria 4514
194 Ga0070702_100141728 3300005615 Bacteria 1532
195 Ga0070702_100166995 3300005615 Bacteria 1428
196 Ga0068852_100008965 3300005616 Bacteria 7404
197 Ga0068852_100009773 3300005616 Bacteria 7131
198 Ga0068852_100069113 3300005616 Bacteria 3094
199 Ga0068852_100109419 3300005616 Bacteria 2509
200 Ga0068852_100110416 3300005616 Bacteria 2499
201 Ga0068859_100000893 3300005617 Bacteria 30367
202 Ga0068859_100001169 3300005617 Bacteria 26837
203 Ga0068859_100115911 3300005617 Bacteria 2744
204 Ga0068859_100228435 3300005617 Bacteria 1949
205 Ga0068859_100387167 3300005617 Bacteria 1494
206 Ga0068859_100519202 3300005617 Bacteria 1286
207 Ga0068859_100647164 3300005617 Bacteria 1149
208 Ga0068864_100001446 3300005618 Bacteria 19579
209 Ga0068864_100002752 3300005618 Bacteria 14500
210 Ga0068864_100008932 3300005618 Bacteria 8261
211 Ga0068864_100009929 3300005618 Bacteria 7852
212 Ga0068864_100053879 3300005618 Bacteria 3471
213 Ga0068864_100064654 3300005618 Bacteria 3173
214 Ga0068864_100170353 3300005618 Bacteria 1985
215 Ga0068866_10001177 3300005718 Bacteria 11439
216 Ga0068866_10068112 3300005718 Bacteria 1870
217 Ga0068861_100001611 3300005719 Bacteria 14383
218 Ga0068861_100017505 3300005719 Bacteria 5091
219 Ga0068861_100097514 3300005719 Bacteria 2332
220 Ga0068861_100127825 3300005719 Bacteria 2059
221 Ga0068851_10001091 3300005834 Bacteria 11776
222 Ga0068851_10005660 3300005834 Bacteria 5678
223 Ga0068851_10014288 3300005834 Bacteria 3769
224 Ga0068851_10029960 3300005834 Bacteria 2697
225 Ga0068851_10072861 3300005834 Bacteria 1780
226 Ga0068870_10022611 3300005840 Bacteria 3091
227 Ga0068870_10031568 3300005840 Bacteria 2685
228 Ga0068870_10037573 3300005840 Bacteria 2497
229 Ga0068870_10074828 3300005840 Bacteria 1856
230 Ga0068863_100000521 3300005841 Bacteria 39214
231 Ga0068863_100003595 3300005841 Bacteria 15301
232 Ga0068863_100053013 3300005841 Bacteria 3844
233 Ga0068863_100066801 3300005841 Bacteria 3401
234 Ga0068863_100094420 3300005841 Bacteria 2839
235 Ga0068863_100200108 3300005841 Bacteria 1921
236 Ga0068858_100003010 3300005842 Bacteria 16901
237 Ga0068858_100011160 3300005842 Bacteria 8493
238 Ga0068858_100012873 3300005842 Bacteria 7889
239 Ga0068858_100092887 3300005842 Bacteria 2809
240 Ga0068858_100275734 3300005842 Bacteria 1601
241 Ga0068860_100001084 3300005843 Bacteria 30014
242 Ga0068860_100003063 3300005843 Bacteria 17272
243 Ga0068860_100056774 3300005843 Bacteria 3721
244 Ga0068860_100063066 3300005843 Bacteria 3521
245 Ga0068860_100201500 3300005843 Bacteria 1929
246 Ga0068860_100222797 3300005843 Bacteria 1832
247 Ga0068862_100013035 3300005844 Bacteria 6877
248 Ga0068862_100022088 3300005844 Bacteria 5323
249 Ga0068862_100025057 3300005844 Bacteria 5007
250 Ga0081539_10004545 3300005985 Bacteria 15212
251 Ga0075365_10070468 3300006038 Bacteria 2351
252 Ga0075365_10094818 3300006038 Bacteria 2037
253 Ga0075363_100024927 3300006048 Bacteria 3045
254 Ga0075363_100046047 3300006048 Bacteria 2313
255 Ga0075363_100142151 3300006048 Bacteria 1352
256 Ga0075364_10061998 3300006051 Bacteria 2454
257 Ga0075432_10041461 3300006058 Bacteria 1608
258 Ga0070715_10072640 3300006163 Bacteria 1540
259 Ga0070716_100005733 3300006173 Bacteria 6032
260 Ga0070716_100018789 3300006173 Bacteria 3605
261 Ga0070712_100014560 3300006175 Bacteria 5048
262 Ga0075362_10064159 3300006177 Bacteria 1666
263 Ga0075362_10139001 3300006177 Bacteria 1160
264 Ga0075367_10033023 3300006178 Bacteria 2981
265 Ga0075367_10039603 3300006178 Bacteria 2748
266 Ga0075367_10044599 3300006178 Bacteria 2600
267 Ga0075367_10086488 3300006178 Bacteria 1903
268 Ga0075366_10016722 3300006195 Bacteria 4217
269 Ga0075366_10041574 3300006195 Bacteria 2722
270 Ga0075366_10084996 3300006195 Bacteria 1892
271 Ga0075366_10101706 3300006195 Bacteria 1725
272 Ga0075366_10122499 3300006195 Bacteria 1567
273 Ga0097621_100003129 3300006237 Bacteria 11355
274 Ga0097621_100003977 3300006237 Bacteria 10240
275 Ga0097621_100014273 3300006237 Bacteria 5941
276 Ga0097621_100178593 3300006237 Bacteria 1833
277 Ga0075370_10001742 3300006353 Bacteria 9690
278 Ga0075370_10002345 3300006353 Bacteria 8754
279 Ga0075370_10039044 3300006353 Bacteria 2674
280 Ga0075370_10092239 3300006353 Bacteria 1748
281 Ga0075370_10112178 3300006353 Bacteria 1584
282 Ga0075370_10233958 3300006353 Bacteria 1087
283 Ga0068871_100010510 3300006358 Bacteria 6761
284 Ga0068871_100017564 3300006358 Bacteria 5417
285 Ga0068871_100035783 3300006358 Bacteria 3948
286 Ga0068871_100451079 3300006358 Bacteria 1153
287 Ga0068871_100521336 3300006358 Unclassified 1073
288 Ga0075430_100219669 3300006846 Bacteria 1577
289 Ga0075433_10026406 3300006852 Bacteria 4917
290 Ga0075433_10109382 3300006852 Bacteria 2452
291 Ga0075434_100028620 3300006871 Bacteria 5477
292 Ga0075434_100248463 3300006871 Bacteria 1798
293 Ga0075434_100279067 3300006871 Bacteria 1690
294 Ga0075434_100379205 3300006871 Bacteria 1435
295 Ga0075436_100030838 3300006914 Bacteria 3690
296 Ga0097620_100000893 3300006931 Bacteria 30367
297 Ga0097620_100001169 3300006931 Bacteria 26837
298 Ga0097620_100115908 3300006931 Bacteria 2744
299 Ga0097620_100228431 3300006931 Bacteria 1949
300 Ga0097620_100387193 3300006931 Bacteria 1494
301 Ga0097620_100519138 3300006931 Bacteria 1286
302 Ga0097620_100647183 3300006931 Bacteria 1149
303 Ga0079104_1000007 3300006946 Bacteria 390531
304 Ga0079104_1000352 3300006946 Bacteria 55479
305 Ga0105240_10030931 3300009093 Bacteria 6952
306 Ga0105240_10038834 3300009093 Bacteria 6103
307 Ga0111539_10054115 3300009094 Bacteria 4776
308 Ga0111539_10073152 3300009094 Bacteria 4041
309 Ga0111539_10154655 3300009094 Bacteria 2684
310 Ga0105245_10001644 3300009098 Bacteria 20337
311 Ga0105245_10007857 3300009098 Bacteria 9331
312 Ga0105245_10057243 3300009098 Bacteria 3506
313 Ga0105245_10073690 3300009098 Bacteria 3105
314 Ga0105245_10197285 3300009098 Bacteria 1931
315 Ga0105245_10274845 3300009098 Bacteria 1644
316 Ga0105245_10388259 3300009098 Bacteria 1392
317 Ga0105245_10590041 3300009098 Bacteria 1136
318 Ga0105247_10064396 3300009101 Bacteria 2277
319 Ga0105247_10265757 3300009101 Bacteria 1178
320 Ga0114129_10045036 3300009147 Bacteria 6203
321 Ga0105243_10001888 3300009148 Bacteria 17864
322 Ga0105243_10014110 3300009148 Bacteria 6044
323 Ga0105241_10036396 3300009174 Bacteria 3704
324 Ga0105242_10005801 3300009176 Bacteria 9512
325 Ga0105242_10155557 3300009176 Bacteria 1997
326 Ga0105248_10008045 3300009177 Bacteria 11575
327 Ga0105248_10013123 3300009177 Bacteria 9124
328 Ga0105248_10035492 3300009177 Bacteria 5577
329 Ga0105248_10120513 3300009177 Bacteria 2960
330 Ga0105248_10254616 3300009177 Bacteria 1976
331 Ga0105237_10016342 3300009545 Bacteria 7713
332 Ga0105237_10197052 3300009545 Bacteria 2014
333 Ga0105239_10126723 3300010375 Bacteria 2838
334 Ga0105239_10408675 3300010375 Bacteria 1537
335 Ga0105239_10427391 3300010375 Bacteria 1501
336 Ga0105239_10449407 3300010375 Bacteria 1462
337 Ga0157326_1003869 3300012513 Bacteria 1572
338 Ga0157373_10006303 3300013100 Bacteria 8864
339 Ga0157371_10000194 3300013102 Bacteria 90011
340 Ga0157370_10135048 3300013104 Bacteria 2300
341 Ga0157370_10410735 3300013104 Bacteria 1246
342 Ga0157369_10198831 3300013105 Bacteria 2104
343 Ga0157374_10002838 3300013296 Bacteria 14535
344 Ga0157374_10007074 3300013296 Bacteria 9553
345 Ga0157378_10005473 3300013297 Bacteria 11126
346 Ga0157378_10007861 3300013297 Bacteria 9306
347 Ga0157378_10008585 3300013297 Bacteria 8891
348 Ga0157378_10039249 3300013297 Bacteria 4199
349 Ga0157378_10098132 3300013297 Bacteria 2671
350 Ga0157378_10199095 3300013297 Bacteria 1894
351 Ga0157378_10226200 3300013297 Bacteria 1780
352 Ga0157378_10696991 3300013297 Bacteria 1035
353 Ga0163162_10001908 3300013306 Bacteria 19644
354 Ga0163162_10118849 3300013306 Bacteria 2745
355 Ga0163162_10266096 3300013306 Bacteria 1846
356 Ga0157372_10005627 3300013307 Bacteria 13324
357 Ga0157372_10189961 3300013307 Bacteria 2379
358 Ga0157375_10009281 3300013308 Bacteria 8632
359 Ga0157375_10019566 3300013308 Bacteria 6162
360 Ga0157375_10025955 3300013308 Bacteria 5454
361 Ga0157375_10031086 3300013308 Bacteria 5041
362 Ga0157375_10228948 3300013308 Bacteria 2018
363 Ga0157375_10230351 3300013308 Bacteria 2012
364 Ga0157375_10873426 3300013308 Bacteria 1045
365 Ga0163163_10009939 3300014325 Bacteria 8532
366 Ga0163163_10083758 3300014325 Bacteria 3194
367 Ga0163163_10191833 3300014325 Bacteria 2092
368 Ga0163163_10826337 3300014325 Bacteria 990
369 Ga0157380_10003347 3300014326 Bacteria 10992
370 Ga0157380_10076760 3300014326 Bacteria 2720
371 Ga0157377_10000016 3300014745 Bacteria 190613
372 Ga0157377_10003307 3300014745 Bacteria 7281
373 Ga0157377_10164348 3300014745 Bacteria 1383
374 Ga0157379_10001362 3300014968 Bacteria 20016
375 Ga0157379_10002571 3300014968 Bacteria 15232
376 Ga0157379_10024832 3300014968 Bacteria 5320
377 Ga0157379_10121989 3300014968 Bacteria 2345
378 Ga0157376_10001750 3300014969 Bacteria 14458
379 Ga0157376_10100763 3300014969 Bacteria 2523
380 Ga0157376_10148985 3300014969 Bacteria 2108
381 Ga0157376_10334746 3300014969 Bacteria 1443
382 Ga0157376_10457661 3300014969 Bacteria 1246
383 Ga0157376_10603769 3300014969 Bacteria 1092
384 Ga0206356_10249116 3300020070 Bacteria 1874
385 Ga0209435_100014 3300025206 Bacteria 322129
386 Ga0209436_103628 3300025208 Bacteria 4030
387 Ga0207427_101622 3300025231 Bacteria 7628
388 Ga0207425_1001097 3300025245 Bacteria 12286
389 Ga0207425_1003608 3300025245 Bacteria 4891
390 Ga0209646_1000001 3300025246 Bacteria 3092932
391 Ga0209026_1000137 3300025250 Bacteria 116282
392 Ga0209759_1000013 3300025256 Bacteria 399300
393 Ga0209129_1006508 3300025258 Bacteria 3751
394 Ga0209129_1009153 3300025258 Bacteria 2650
395 Ga0209565_1000028 3300025263 Bacteria 348536
396 Ga0209565_1001085 3300025263 Bacteria 13573
397 Ga0209673_1000035 3300025273 Bacteria 328411
398 Ga0209130_1000052 3300025284 Bacteria 216971
399 Ga0209130_1002799 3300025284 Bacteria 8143
400 Ga0209130_1032622 3300025284 Bacteria 1060
401 Ga0207673_1010436 3300025290 Bacteria 1196
402 Ga0209675_1000313 3300025291 Bacteria 43444
403 Ga0209675_1001685 3300025291 Bacteria 12264
404 Ga0209675_1004248 3300025291 Bacteria 6454
405 Ga0209676_1000634 3300025292 Bacteria 50573
406 Ga0209676_1001748 3300025292 Bacteria 18540
407 Ga0209025_1004750 3300025294 Bacteria 11550
408 Ga0209025_1005213 3300025294 Bacteria 10723
409 Ga0209025_1006139 3300025294 Bacteria 9466
410 Ga0209564_1003759 3300025295 Bacteria 9912
411 Ga0209564_1010465 3300025295 Bacteria 4267
412 Ga0209564_1026419 3300025295 Bacteria 1918
413 Ga0209758_1000122 3300025297 Bacteria 190970
414 Ga0209758_1020430 3300025297 Bacteria 3133
415 Ga0209050_1000023 3300025298 Bacteria 537172
416 Ga0209050_1000677 3300025298 Bacteria 51357
417 Ga0209256_1000003 3300025299 Bacteria 1661127
418 Ga0209256_1000011 3300025299 Bacteria 865309
419 Ga0207426_1000306 3300025302 Bacteria 96112
420 Ga0209051_1000016 3300025303 Bacteria 541891
421 Ga0209051_1000017 3300025303 Bacteria 537172
422 Ga0209051_1000172 3300025303 Bacteria 117180
423 Ga0209257_1000015 3300025304 Bacteria 908141
424 Ga0209257_1000041 3300025304 Bacteria 537172
425 Ga0209257_1000102 3300025304 Bacteria 251074
426 Ga0209257_1000108 3300025304 Bacteria 240229
427 Ga0209257_1006401 3300025304 Bacteria 7604
428 Ga0207697_10000368 3300025315 Bacteria 25220
429 Ga0207697_10014744 3300025315 Bacteria 3237
430 Ga0207697_10121560 3300025315 Bacteria 1124
431 Ga0207656_10002724 3300025321 Bacteria 5997
432 Ga0207656_10040278 3300025321 Bacteria 1980
433 Ga0207656_10093521 3300025321 Bacteria 1368
434 Ga0207682_10000076 3300025893 Bacteria 43305
435 Ga0207682_10021526 3300025893 Bacteria 2537
436 Ga0207692_10147758 3300025898 Bacteria 1343
437 Ga0207642_10002217 3300025899 Bacteria 6027
438 Ga0207642_10118025 3300025899 Bacteria 1363
439 Ga0207688_10001459 3300025901 Bacteria 12388
440 Ga0207680_10000783 3300025903 Bacteria 15039
441 Ga0207680_10044358 3300025903 Bacteria 2614
442 Ga0207680_10074303 3300025903 Bacteria 2116
443 Ga0207685_10036827 3300025905 Bacteria 1797
444 Ga0207645_10001729 3300025907 Bacteria 17698
445 Ga0207645_10002521 3300025907 Bacteria 14336
446 Ga0207645_10004022 3300025907 Bacteria 10958
447 Ga0207645_10043798 3300025907 Bacteria 2864
448 Ga0207645_10046267 3300025907 Bacteria 2779
449 Ga0207643_10002053 3300025908 Bacteria 11102
450 Ga0207643_10005231 3300025908 Bacteria 6940
451 Ga0207643_10018090 3300025908 Bacteria 3861
452 Ga0207705_10029442 3300025909 Bacteria 3915
453 Ga0207684_10002424 3300025910 Bacteria 18808
454 Ga0207684_10046559 3300025910 Bacteria 3679
455 Ga0207684_10249722 3300025910 Bacteria 1531
456 Ga0207654_10058311 3300025911 Bacteria 2247
457 Ga0207695_10029322 3300025913 Bacteria 6083
458 Ga0207695_10107478 3300025913 Bacteria 2775
459 Ga0207695_10170355 3300025913 Bacteria 2103
460 Ga0207671_10014637 3300025914 Bacteria 6189
461 Ga0207671_10061758 3300025914 Bacteria 2781
462 Ga0207693_10001071 3300025915 Bacteria 24521
463 Ga0207663_10096972 3300025916 Bacteria 1971
464 Ga0207663_10273302 3300025916 Bacteria 1252
465 Ga0207662_10005162 3300025918 Bacteria 6927
466 Ga0207662_10051405 3300025918 Bacteria 2452
467 Ga0207657_10003940 3300025919 Bacteria 15763
468 Ga0207657_10005946 3300025919 Bacteria 12701
469 Ga0207657_10032680 3300025919 Bacteria 4698
470 Ga0207649_10361872 3300025920 Bacteria 1077
471 Ga0207646_10014290 3300025922 Bacteria 7548
472 Ga0207646_10047710 3300025922 Bacteria 3841
473 Ga0207681_10008779 3300025923 Bacteria 6175
474 Ga0207650_10003315 3300025925 Bacteria 11087
475 Ga0207650_10008631 3300025925 Bacteria 6958
476 Ga0207650_10024159 3300025925 Bacteria 4318
477 Ga0207650_10032706 3300025925 Bacteria 3763
478 Ga0207650_10069448 3300025925 Bacteria 2647
479 Ga0207659_10004952 3300025926 Bacteria 8077
480 Ga0207659_10008305 3300025926 Bacteria 6438
481 Ga0207659_10010070 3300025926 Bacteria 5924
482 Ga0207659_10029037 3300025926 Bacteria 3764
483 Ga0207659_10054439 3300025926 Bacteria 2858
484 Ga0207687_10000226 3300025927 Bacteria 38452
485 Ga0207687_10003096 3300025927 Bacteria 11280
486 Ga0207687_10020926 3300025927 Bacteria 4342
487 Ga0207687_10042968 3300025927 Bacteria 3113
488 Ga0207700_10029862 3300025928 Bacteria 3852
489 Ga0207700_10044625 3300025928 Bacteria 3265
490 Ga0207664_10009233 3300025929 Bacteria 6910
491 Ga0207644_10001985 3300025931 Bacteria 13227
492 Ga0207644_10006696 3300025931 Bacteria 7504
493 Ga0207644_10007852 3300025931 Bacteria 6970
494 Ga0207644_10012418 3300025931 Bacteria 5656
495 Ga0207644_10044136 3300025931 Bacteria 3166
496 Ga0207644_10057302 3300025931 Bacteria 2813
497 Ga0207644_10058835 3300025931 Bacteria 2778
498 Ga0207690_10006609 3300025932 Bacteria 6868
499 Ga0207690_10051206 3300025932 Bacteria 2760
500 Ga0207706_10000002 3300025933 Bacteria 360309
501 Ga0207706_10001944 3300025933 Bacteria 20292
502 Ga0207706_10002383 3300025933 Bacteria 18353
503 Ga0207706_10093004 3300025933 Bacteria 2652
504 Ga0207706_10109511 3300025933 Bacteria 2431
505 Ga0207686_10003018 3300025934 Bacteria 9072
506 Ga0207686_10178492 3300025934 Bacteria 1504
507 Ga0207709_10000172 3300025935 Bacteria 86654
508 Ga0207670_10028754 3300025936 Bacteria 3534
509 Ga0207670_10076474 3300025936 Bacteria 2329
510 Ga0207669_10037976 3300025937 Bacteria 2768
511 Ga0207669_10083381 3300025937 Bacteria 2055
512 Ga0207669_10146205 3300025937 Bacteria 1649
513 Ga0207665_10060503 3300025939 Bacteria 2565
514 Ga0207665_10084669 3300025939 Bacteria 2188
515 Ga0207691_10001090 3300025940 Bacteria 26989
516 Ga0207691_10036775 3300025940 Bacteria 4536
517 Ga0207691_10038608 3300025940 Bacteria 4419
518 Ga0207691_10062634 3300025940 Bacteria 3374
519 Ga0207691_10075440 3300025940 Bacteria 3040
520 Ga0207691_10102436 3300025940 Bacteria 2554
521 Ga0207711_10000654 3300025941 Bacteria 34558
522 Ga0207711_10008005 3300025941 Bacteria 8841
523 Ga0207711_10019605 3300025941 Bacteria 5630
524 Ga0207711_10028333 3300025941 Bacteria 4713
525 Ga0207711_10261104 3300025941 Bacteria 1592
526 Ga0207711_10310079 3300025941 Bacteria 1457
527 Ga0207689_10001081 3300025942 Bacteria 26272
528 Ga0207689_10002547 3300025942 Bacteria 16920
529 Ga0207689_10041723 3300025942 Bacteria 3796
530 Ga0207689_10159846 3300025942 Bacteria 1856
531 Ga0207679_10034512 3300025945 Bacteria 3570
532 Ga0207679_10172459 3300025945 Bacteria 1782
533 Ga0207679_10182538 3300025945 Bacteria 1737
534 Ga0207667_10002797 3300025949 Bacteria 21604
535 Ga0207667_10037728 3300025949 Bacteria 5165
536 Ga0207667_10314196 3300025949 Bacteria 1600
537 Ga0207651_10003398 3300025960 Bacteria 7818
538 Ga0207651_10007695 3300025960 Bacteria 5757
539 Ga0207651_10035662 3300025960 Bacteria 3238
540 Ga0207668_10002950 3300025972 Bacteria 9968
541 Ga0207668_10023608 3300025972 Bacteria 3956
542 Ga0207668_10034452 3300025972 Bacteria 3363
543 Ga0207668_10143555 3300025972 Bacteria 1839
544 Ga0207668_10215067 3300025972 Bacteria 1539
545 Ga0207668_10334024 3300025972 Bacteria 1262
546 Ga0207640_10022186 3300025981 Bacteria 3795
547 Ga0207640_10044617 3300025981 Bacteria 2842
548 Ga0207640_10130392 3300025981 Bacteria 1816
549 Ga0207640_10361999 3300025981 Bacteria 1169
550 Ga0207658_10003823 3300025986 Bacteria 10604
551 Ga0207658_10010563 3300025986 Bacteria 6273
552 Ga0207658_10020000 3300025986 Bacteria 4633
553 Ga0207658_10022771 3300025986 Bacteria 4364
554 Ga0207658_10046890 3300025986 Bacteria 3159
555 Ga0207658_10058879 3300025986 Bacteria 2861
556 Ga0207658_10079113 3300025986 Bacteria 2514
557 Ga0207658_10198489 3300025986 Bacteria 1673
558 Ga0207677_10000162 3300026023 Bacteria 53309
559 Ga0207677_10009582 3300026023 Bacteria 5451
560 Ga0207677_10020074 3300026023 Bacteria 4049
561 Ga0207677_10064404 3300026023 Bacteria 2553
562 Ga0207677_10078566 3300026023 Bacteria 2357
563 Ga0207677_10178645 3300026023 Bacteria 1667
564 Ga0207677_10234493 3300026023 Bacteria 1480
565 Ga0207703_10001919 3300026035 Bacteria 18425
566 Ga0207703_10006661 3300026035 Bacteria 9215
567 Ga0207703_10040095 3300026035 Bacteria 3746
568 Ga0207703_10076203 3300026035 Bacteria 2781
569 Ga0207703_10079646 3300026035 Bacteria 2726
570 Ga0207639_10005219 3300026041 Bacteria 8763
571 Ga0207639_10505094 3300026041 Bacteria 1105
572 Ga0207678_10000931 3300026067 Bacteria 26668
573 Ga0207678_10011127 3300026067 Bacteria 7905
574 Ga0207678_10032495 3300026067 Bacteria 4548
575 Ga0207678_10058265 3300026067 Bacteria 3323
576 Ga0207678_10107131 3300026067 Bacteria 2384
577 Ga0207678_10174340 3300026067 Bacteria 1836
578 Ga0207678_10339064 3300026067 Bacteria 1295
579 Ga0207708_10000418 3300026075 Bacteria 33340
580 Ga0207702_10006364 3300026078 Bacteria 10193
581 Ga0207702_10113781 3300026078 Bacteria 2411
582 Ga0207702_10134741 3300026078 Bacteria 2227
583 Ga0207702_10406848 3300026078 Bacteria 1313
584 Ga0207641_10001702 3300026088 Bacteria 21403
585 Ga0207641_10014054 3300026088 Bacteria 6563
586 Ga0207641_10025865 3300026088 Bacteria 4840
587 Ga0207641_10060777 3300026088 Bacteria 3221
588 Ga0207641_10118653 3300026088 Bacteria 2357
589 Ga0207648_10000343 3300026089 Bacteria 51081
590 Ga0207648_10002633 3300026089 Bacteria 19203
591 Ga0207648_10003584 3300026089 Bacteria 16250
592 Ga0207648_10013048 3300026089 Bacteria 7748
593 Ga0207648_10014979 3300026089 Bacteria 7142
594 Ga0207648_10035446 3300026089 Bacteria 4396
595 Ga0207648_10050801 3300026089 Bacteria 3625
596 Ga0207648_10105122 3300026089 Bacteria 2476
597 Ga0207648_10111508 3300026089 Bacteria 2401
598 Ga0207676_10000451 3300026095 Bacteria 34663
599 Ga0207676_10003663 3300026095 Bacteria 10865
600 Ga0207676_10008358 3300026095 Bacteria 7359
601 Ga0207676_10039402 3300026095 Bacteria 3614
602 Ga0207676_10187942 3300026095 Bacteria 1815
603 Ga0207676_10243898 3300026095 Bacteria 1613
604 Ga0207674_10003102 3300026116 Bacteria 20519
605 Ga0207674_10005989 3300026116 Bacteria 14387
606 Ga0207674_10018325 3300026116 Bacteria 7612
607 Ga0207674_10019808 3300026116 Bacteria 7281
608 Ga0207674_10026307 3300026116 Bacteria 6184
609 Ga0207674_10154073 3300026116 Bacteria 2254
610 Ga0207675_100003236 3300026118 Bacteria 15974
611 Ga0207675_100009614 3300026118 Bacteria 9046
612 Ga0207675_100165675 3300026118 Bacteria 2110
613 Ga0207675_100254085 3300026118 Bacteria 1702
614 Ga0207683_10000119 3300026121 Bacteria 64489
615 Ga0207683_10000694 3300026121 Bacteria 30870
616 Ga0207683_10004550 3300026121 Bacteria 11952
617 Ga0207683_10022179 3300026121 Bacteria 5450
618 Ga0207683_10085353 3300026121 Bacteria 2806
619 Ga0207683_10213973 3300026121 Bacteria 1755
620 Ga0207698_10032712 3300026142 Bacteria 3771
621 Ga0207698_10126519 3300026142 Bacteria 2174
622 Ga0207698_10177901 3300026142 Bacteria 1881
623 Ga0207698_10268979 3300026142 Bacteria 1570
624 Ga0209281_1000020 3300027111 Bacteria 575972
625 Ga0209281_1000454 3300027111 Bacteria 58234
626 Ga0209970_1001012 3300027614 Bacteria 4991
627 Ga0209983_1002922 3300027665 Bacteria 3693
628 Ga0209813_10005461 3300027866 Bacteria 3086
629 Ga0209974_10006322 3300027876 Bacteria 4141
630 Ga0207428_10003085 3300027907 Bacteria 16401
631 Ga0207428_10221717 3300027907 Bacteria 1417
632 Ga0268266_10004181 3300028379 Bacteria 13910
633 Ga0268266_10053676 3300028379 Bacteria 3463
634 Ga0268266_10102857 3300028379 Bacteria 2520
635 Ga0268266_10147323 3300028379 Bacteria 2118
636 Ga0268266_10207087 3300028379 Bacteria 1797
637 Ga0268265_10006699 3300028380 Bacteria 7798
638 Ga0268265_10117454 3300028380 Bacteria 2185
639 Ga0268264_10001000 3300028381 Bacteria 28759
640 Ga0268264_10002760 3300028381 Bacteria 15322
641 Ga0268264_10012398 3300028381 Bacteria 7017
642 Ga0268264_10041400 3300028381 Bacteria 3811
643 Ga0268264_10092667 3300028381 Bacteria 2608
644 Ga0268264_10145641 3300028381 Bacteria 2118
645 Ga0307517_10000358 3300028786 Bacteria 78437
646 Ga0307517_10098884 3300028786 Bacteria 2318
647 Ga0307515_10000459 3300028794 Bacteria 97482
648 Ga0307515_10003649 3300028794 Bacteria 32350
649 Ga0307515_10003668 3300028794 Bacteria 32257
650 Ga0307515_10009465 3300028794 Bacteria 18830
651 Ga0307515_10010929 3300028794 Bacteria 17310
652 Ga0307515_10086833 3300028794 Bacteria 3981
653 Ga0307515_10211556 3300028794 Bacteria 1782
654 Ga0307515_10248604 3300028794 Bacteria 1535
655 Ga0307515_10282968 3300028794 Bacteria 1363
656 Ga0307512_10031625 3300030522 Bacteria 4578
657 Ga0307512_10055700 3300030522 Bacteria 3115
658 Ga0307513_10000006 3300031456 Bacteria 470848
659 Ga0307513_10005054 3300031456 Bacteria 17463
660 Ga0307513_10007938 3300031456 Bacteria 13654
661 Ga0307513_10009552 3300031456 Bacteria 12262
662 Ga0307513_10025822 3300031456 Bacteria 6793
663 Ga0307513_10269225 3300031456 Bacteria 1488
664 Ga0307509_10001694 3300031507 Bacteria 36817
665 Ga0307509_10005213 3300031507 Bacteria 18216
666 Ga0307509_10017599 3300031507 Bacteria 8218
667 Ga0307509_10052291 3300031507 Bacteria 4361
668 Ga0307509_10059437 3300031507 Bacteria 4045
669 Ga0307408_100000008 3300031548 Bacteria 456355
670 Ga0307408_100021375 3300031548 Bacteria 4379
671 Ga0307408_100086284 3300031548 Bacteria 2359
672 Ga0307508_10000466 3300031616 Bacteria 48802
673 Ga0307508_10007101 3300031616 Bacteria 10443
674 Ga0307508_10137663 3300031616 Bacteria 2045
675 Ga0307508_10192859 3300031616 Bacteria 1638
676 Ga0307508_10192873 3300031616 Bacteria 1638
677 Ga0307514_10000979 3300031649 Bacteria 42521
678 Ga0307514_10004420 3300031649 Bacteria 12940
679 Ga0307516_10000705 3300031730 Bacteria 45448
680 Ga0307516_10018606 3300031730 Bacteria 7215
681 Ga0307516_10035658 3300031730 Bacteria 4987
682 Ga0307516_10044796 3300031730 Bacteria 4374
683 Ga0307516_10211964 3300031730 Bacteria 1651
684 Ga0307405_10013240 3300031731 Bacteria 4396
685 Ga0307413_10005108 3300031824 Bacteria 5808
686 Ga0307410_10098792 3300031852 Bacteria 2088
687 Ga0307406_10000278 3300031901 Bacteria 30154
688 Ga0307412_10004381 3300031911 Bacteria 7870
689 Ga0307412_10175630 3300031911 Bacteria 1606
690 Ga0307412_10205096 3300031911 Bacteria 1500
691 Ga0307409_100010785 3300031995 Bacteria 5711
692 Ga0307416_100077955 3300032002 Bacteria 2786
693 Ga0307414_10106044 3300032004 Bacteria 2126
694 Ga0307411_10217607 3300032005 Bacteria 1479
695 Ga0307510_10087868 3300033180 Bacteria 2971
696 Ga0307510_10095894 3300033180 Bacteria 2784
697 Ga0307510_10127901 3300033180 Bacteria 2224
698 Ga0307510_10214108 3300033180 Bacteria 1446
699 Ga0373928_0061555 3300035084 Bacteria 909
700 Ga0373923_0051464 3300035111 Bacteria 1728
701 Ga0373932_0026942 3300035112 Bacteria 1568
702 Ga0373936_0000007 3300035113 Bacteria 290641
703 Ga0373945_0040008 3300035116 Bacteria 1691
704 Ga0373953_0003327 3300035117 Bacteria 4988
705 Ga0373956_0007335 3300035119 Bacteria 4438
706 Ga0373943_0048925 3300035170 Bacteria 2073
707 Ga0373955_0039097 3300035172 Bacteria 2530
708 Ga0373955_0298393 3300035172 Bacteria 971
709 Ga0373931_0048807 3300035691 Bacteria 2245
710 Ga0373935_0081080 3300035692 Bacteria 2109
711 Ga0373933_0004441 3300035724 Bacteria 7697
712 Ga0373947_0099653 3300035725 Bacteria 1824
713 Ga0373937_0114854 3300036401 Bacteria 2506
714 Ga0373937_0429242 3300036401 Bacteria 1254
715 Ga0373925_0054821 3300037068 Bacteria 2982
716 Ga0373925_0058365 3300037068 Bacteria 2894
717 Ga0395899_0006012 3300037312 Bacteria 9421
718 Ga0395899_0013757 3300037312 Bacteria 6185
719 Ga0395899_0114460 3300037312 Bacteria 1937
720 Ga0395898_0010903 3300037466 Bacteria 9484
721 Ga0395898_0025013 3300037466 Bacteria 6019
722 Ga0395898_0116213 3300037466 Bacteria 2563
723 Ga0395898_0164667 3300037466 Bacteria 2121
724 Ga0395898_0678282 3300037466 Bacteria 973
725 Ga0395901_0095838 3300038443 Bacteria 3109
726 Ga0451789_0569119 3300041443 Bacteria 1428
727 Ga0451791_0914965 3300041451 Bacteria 1745
728 Ga0451793_0421724 3300041452 Bacteria 3400
729 Ga0451793_1206373 3300041452 Bacteria 3345
730 Ga0451804_0432193 3300041463 Bacteria 1399
731 Ga0451833_0389704 3300041491 Bacteria 1695
732 Ga0451845_0315213 3300041501 Bacteria 855
733 Ga0451853_0867049 3300041512 Bacteria 2116
734 Ga0451853_1826268 3300041512 Bacteria 1213
735 Ga0439445_0009866 3300042004 Bacteria 2254
736 Ga0439449_0000091 3300042007 Bacteria 29348
737 Ga0439449_0000986 3300042007 Bacteria 11193
738 Ga0439449_0093197 3300042007 Bacteria 1112
739 Ga0439455_0050679 3300042012 Bacteria 1084
740 Ga0439462_0001526 3300042015 Bacteria 5182
741 Ga0450911_000074 3300042115 Bacteria 41259
742 Ga0450890_007314 3300042127 Bacteria 1410
743 Ga0439446_0074829 3300042156 Bacteria 1041
744 Ga0439458_0019362 3300042157 Bacteria 1566
745 Ga0450909_012373 3300042185 Bacteria 1251
746 Ga0439434_0069043 3300042435 Bacteria 1111
747 Ga0439435_0055421 3300042436 Bacteria 1144
748 Ga0451577_0000235 3300042876 Bacteria 109693
749 Ga0451577_0003070 3300042876 Bacteria 18890
750 Ga0453683_0006609 3300044673 Bacteria 7942
751 Ga0453684_0000906 3300044712 Bacteria 98768
752 Ga0453684_0009366 3300044712 Bacteria 17157
753 Ga0453684_0030654 3300044712 Bacteria 7589
754 Ga0451576_0005545 3300045051 Bacteria 15763
755 Ga0451576_0008805 3300045051 Bacteria 11796
756 Ga0451576_0025630 3300045051 Bacteria 6352
757 Ga0451576_0038996 3300045051 Bacteria 5028
758 Ga0451576_0320874 3300045051 Bacteria 1621
759 Ga0495592_0000264 3300046454 Bacteria 44823
760 Ga0495638_0060680 3300046460 Bacteria 2338
761 Ga0495650_0009317 3300046471 Bacteria 5596
762 Ga0495650_0014118 3300046471 Bacteria 4178
763 Ga0495580_0135423 3300046472 Bacteria 1708
764 Ga0495580_0264576 3300046472 Bacteria 1176
765 Ga0495664_0033908 3300046477 Bacteria 3001
766 Ga0495610_0036459 3300046512 Bacteria 2513
767 Ga0495620_0108920 3300046515 Bacteria 1099
768 Ga0495628_0251197 3300046516 Bacteria 1320
769 Ga0495630_0379112 3300046517 Bacteria 1083
770 Ga0495631_0119637 3300046518 Bacteria 1133
771 Ga0495632_0002891 3300046519 Bacteria 12629
772 Ga0495632_0026840 3300046519 Bacteria 3024
773 Ga0495643_0083966 3300046522 Bacteria 1653
774 Ga0495643_0171179 3300046522 Bacteria 1062
775 Ga0495654_0002750 3300046530 Bacteria 11091
776 Ga0495586_0119883 3300046535 Bacteria 1469
777 Ga0495645_0019219 3300046543 Bacteria 4919
778 Ga0495625_0001726 3300046660 Bacteria 25344
779 Ga0495625_0009831 3300046660 Bacteria 7960
780 Ga0495658_0254206 3300046683 Bacteria 1105
781 Ga0495658_0265769 3300046683 Bacteria 1080
782 Ga0495671_0044283 3300046692 Bacteria 2232
783 Ga0495671_0154019 3300046692 Bacteria 1119
784 Ga0495649_0015742 3300046694 Bacteria 4299
785 Ga0495660_0122438 3300046810 Bacteria 1314
786 Ga0495636_0107356 3300047318 Bacteria 1226
787 Ga0495687_000212 3300047443 Bacteria 83406
788 Ga0495593_0022467 3300047673 Bacteria 3514
789 Ga0495626_0032592 3300048091 Bacteria 2501
790 Ga0496101_0084219 3300048904 Bacteria 2354
791 Ga0496102_0003078 3300048905 Bacteria 14125
792 Ga0496102_0005035 3300048905 Bacteria 11191
793 Ga0496102_0038160 3300048905 Bacteria 4334
794 Ga0496102_0064277 3300048905 Bacteria 3361
795 Ga0496103_0042225 3300048906 Bacteria 2805
796 Ga0496103_0097636 3300048906 Bacteria 1857
797 Ga0496104_0007078 3300048907 Bacteria 9893
798 Ga0496105_0001968 3300048908 Bacteria 14776
799 Ga0496105_0004944 3300048908 Bacteria 10079
800 Ga0496106_0002588 3300048909 Bacteria 13468
801 Ga0496106_0044949 3300048909 Bacteria 3316
802 Ga0496106_0180640 3300048909 Bacteria 1675
803 Ga0496107_0041577 3300048910 Bacteria 3301
804 Ga0496108_0017714 3300048911 Bacteria 5826
805 Ga0496108_0023581 3300048911 Bacteria 5064
806 Ga0496108_0106038 3300048911 Bacteria 2400
807 Ga0496109_0000170 3300048912 Bacteria 64299
808 Ga0496109_0040742 3300048912 Bacteria 4207
809 Ga0496110_0044760 3300048913 Bacteria 3866
810 Ga0496112_0000241 3300048915 Bacteria 35206
811 Ga0496114_0003680 3300048917 Bacteria 11790
812 Ga0496114_0156636 3300048917 Bacteria 1978
813 Ga0496115_0079611 3300048918 Bacteria 2667
814 Ga0496121_0003833 3300048924 Bacteria 20921
815 Ga0496125_0017574 3300048928 Bacteria 6813
816 Ga0496126_0095970 3300048929 Bacteria 2600
817 Ga0496126_0451417 3300048929 Bacteria 1035
818 Ga0495678_002401 3300049459 Bacteria 12781
819 Ga0501032_0092896 3300049569 Bacteria 2001
820 Ga0501043_0000052 3300049579 Bacteria 106686
821 Ga0501043_0000072 3300049579 Bacteria 89021
822 Ga0501046_0000112 3300049580 Bacteria 86313
823 Ga0501046_0000327 3300049580 Bacteria 47741
824 Ga0501047_0000137 3300049581 Bacteria 89064
825 Ga0501047_0000138 3300049581 Bacteria 89028
826 Ga0501048_0000371 3300049582 Bacteria 31127
827 Ga0501048_0001533 3300049582 Bacteria 17526
828 Ga0501044_0321267 3300049823 Bacteria 1472
829 Ga0501045_0001514 3300049824 Bacteria 15451
830 Ga0501045_0005067 3300049824 Bacteria 9122
831 nmdc:mga03683_47022_c1 3300050489 Bacteria 1790
832 nmdc:mga0yw44_177401_c1 3300050492 Bacteria 1401
833 nmdc:mga0yw44_260643_c1 3300050492 Bacteria 1155
834 nmdc:mga0yw44_36874_c1 3300050492 Bacteria 2884
835 nmdc:mga0k408_13359_c1 3300050493 Bacteria 4502
836 nmdc:mga0k408_186104_c1 3300050493 Bacteria 1239
837 nmdc:mga0k408_20709_c1 3300050493 Bacteria 3689
838 nmdc:mga0k408_237034_c1 3300050493 Bacteria 1089
839 nmdc:mga0k408_585_c1 3300050493 Bacteria 20193
840 nmdc:mga0k408_97470_c1 3300050493 Bacteria 1732
841 nmdc:mga06z11_14050_c1 3300050494 Bacteria 3534
842 nmdc:mga06z11_5847_c1 3300050494 Bacteria 4965
843 nmdc:mga04h51_23644_c1 3300050495 Bacteria 1873
844 nmdc:mga07m45_247_c1 3300050496 Bacteria 21997
845 nmdc:mga07m45_41439_c1 3300050496 Bacteria 2579
846 nmdc:mga07m45_75668_c1 3300050496 Bacteria 1919
847 nmdc:mga07m45_79961_c1 3300050496 Bacteria 1866
848 nmdc:mga05p37_573265_c1 3300050507 Unclassified 1280
849 nmdc:mga05p37_78140_c1 3300050507 Bacteria 4075
850 nmdc:mga06r32_17024_c1 3300050510 Bacteria 6633
851 nmdc:mga06r32_7429_c1 3300050510 Bacteria 9860
852 nmdc:mga08y16_120385_c1 3300050511 Bacteria 2731
853 nmdc:mga08y16_135364_c1 3300050511 Bacteria 2561
854 nmdc:mga08y16_17893_c1 3300050511 Bacteria 7466
855 nmdc:mga0n895_140431_c1 3300050512 Bacteria 2444
856 nmdc:mga0n895_76114_c1 3300050512 Bacteria 3337
857 nmdc:mga0n895_85305_c1 3300050512 Bacteria 3152
858 nmdc:mga0rr50_261508_c1 3300050513 Bacteria 1440
859 nmdc:mga08x19_15991_c1 3300050514 Bacteria 4571
860 nmdc:mga0a205_214160_c1 3300050515 Bacteria 1814
861 nmdc:mga0a205_8967_c1 3300050515 Bacteria 9117
862 nmdc:mga0sz30_51897_c1 3300050516 Bacteria 1741
863 Ga0500644_0008778 3300053088 Bacteria 2678
864 Ga0500644_0015654 3300053088 Bacteria 2168
865 Ga0500644_0091187 3300053088 Bacteria 1141
866 Ga0500646_0001709 3300053090 Bacteria 5790
867 Ga0500583_0120754 3300053092 Bacteria 1296
868 Ga0500651_0027117 3300053093 Bacteria 3601
869 Ga0500593_000435 3300053117 Bacteria 16452
870 Ga0500593_000657 3300053117 Bacteria 13168
871 Ga0500594_0018492 3300053118 Bacteria 1717
872 Ga0500628_003280 3300053129 Bacteria 2665
873 Ga0500652_001537 3300053131 Bacteria 7060
874 Ga0500655_006099 3300053133 Bacteria 2172
875 Ga0500658_0009390 3300053134 Bacteria 3608
876 Ga0500559_0000092 3300053136 Bacteria 71917
877 Ga0500568_0038601 3300053139 Bacteria 1932
878 Ga0500604_0005487 3300053151 Bacteria 3348
879 Ga0500622_0001110 3300053156 Bacteria 22450
880 Ga0500622_0011299 3300053156 Bacteria 4870
881 Ga0500636_0004915 3300053177 Bacteria 7592
882 Ga0500645_000474 3300053730 Bacteria 27453
883 Ga0500645_002165 3300053730 Bacteria 8997
884 Ga0500645_019479 3300053730 Bacteria 2110
885 Ga0500661_004529 3300055283 Bacteria 2598
886 Ga0590075_020359 3300059424 Bacteria 1651

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300035112 Ga0373932_0026942 Ga0373932_0026942_20_817 260
2 3300036401 Ga0373937_0429242 Ga0373937_0429242_452_1243 260
3 3300037466 Ga0395898_0678282 Ga0395898_0678282_13_798 260
4 3300041501 Ga0451845_0315213 Ga0451845_0315213_59_841 260
5 3300046472 Ga0495580_0135423 Ga0495580_0135423_36_818 260
6 3300046522 Ga0495643_0083966 Ga0495643_0083966_828_1613 260
7 3300046683 Ga0495658_0265769 Ga0495658_0265769_263_1060 260
8 3300048911 Ga0496108_0106038 Ga0496108_0106038_36_830 260
9 3300031456 Ga0307513_10269225 Ga0307513_102692252 268
10 3300042185 Ga0450909_012373 Ga0450909_012373_410_1234 269
11 3300025290 Ga0207673_1010436 Ga0207673_10104362 271
12 3300048911 Ga0496108_0023581 Ga0496108_0023581_3501_4400 271
13 3300005333 Ga0070677_10003466 Ga0070677_100034662 273
14 3300005338 Ga0068868_100061098 Ga0068868_1000610983 273
15 3300005347 Ga0070668_100001533 Ga0070668_1000015336 273
16 3300005354 Ga0070675_100001174 Ga0070675_10000117411 273
17 3300005355 Ga0070671_100010290 Ga0070671_1000102906 273
18 3300005355 Ga0070671_100047279 Ga0070671_1000472793 273
19 3300005356 Ga0070674_100060111 Ga0070674_1000601112 273
20 3300005364 Ga0070673_100048464 Ga0070673_1000484643 273
21 3300005367 Ga0070667_100007604 Ga0070667_1000076049 273
22 3300005367 Ga0070667_100042389 Ga0070667_1000423893 273
23 3300005455 Ga0070663_100003912 Ga0070663_1000039122 273
24 3300005456 Ga0070678_100000242 Ga0070678_10000024210 273
25 3300005459 Ga0068867_100188620 Ga0068867_1001886202 273
26 3300005543 Ga0070672_100086923 Ga0070672_1000869232 273
27 3300005548 Ga0070665_100005336 Ga0070665_1000053364 273
28 3300005578 Ga0068854_100290222 Ga0068854_1002902222 273
29 3300005614 Ga0068856_100068424 Ga0068856_1000684242 273
30 3300005615 Ga0070702_100141728 Ga0070702_1001417282 273
31 3300005617 Ga0068859_100387167 Ga0068859_1003871672 273
32 3300005618 Ga0068864_100008932 Ga0068864_1000089328 273
33 3300005719 Ga0068861_100127825 Ga0068861_1001278252 273
34 3300005834 Ga0068851_10029960 Ga0068851_100299602 273
35 3300005840 Ga0068870_10031568 Ga0068870_100315682 273
36 3300005841 Ga0068863_100053013 Ga0068863_1000530133 273
37 3300005842 Ga0068858_100011160 Ga0068858_1000111608 273
38 3300005842 Ga0068858_100092887 Ga0068858_1000928872 273
39 3300005843 Ga0068860_100063066 Ga0068860_1000630662 273
40 3300006237 Ga0097621_100003129 Ga0097621_10000312911 273
41 3300006358 Ga0068871_100010510 Ga0068871_1000105102 273
42 3300006871 Ga0075434_100379205 Ga0075434_1003792052 273
43 3300006931 Ga0097620_100387193 Ga0097620_1003871932 273
44 3300009177 Ga0105248_10254616 Ga0105248_102546162 273
45 3300013297 Ga0157378_10008585 Ga0157378_100085854 273
46 3300013297 Ga0157378_10098132 Ga0157378_100981323 273
47 3300013308 Ga0157375_10009281 Ga0157375_100092816 273
48 3300013308 Ga0157375_10873426 Ga0157375_108734261 273
49 3300014325 Ga0163163_10191833 Ga0163163_101918332 273
50 3300014968 Ga0157379_10024832 Ga0157379_100248324 273
51 3300014969 Ga0157376_10457661 Ga0157376_104576612 273
52 3300025315 Ga0207697_10014744 Ga0207697_100147442 273
53 3300025321 Ga0207656_10002724 Ga0207656_100027242 273
54 3300025893 Ga0207682_10021526 Ga0207682_100215263 273
55 3300025907 Ga0207645_10004022 Ga0207645_1000402210 273
56 3300025908 Ga0207643_10005231 Ga0207643_100052312 273
57 3300025926 Ga0207659_10010070 Ga0207659_100100702 273
58 3300025931 Ga0207644_10006696 Ga0207644_100066962 273
59 3300025931 Ga0207644_10057302 Ga0207644_100573023 273
60 3300025937 Ga0207669_10037976 Ga0207669_100379762 273
61 3300025940 Ga0207691_10001090 Ga0207691_1000109018 273
62 3300025941 Ga0207711_10261104 Ga0207711_102611042 273
63 3300025941 Ga0207711_10310079 Ga0207711_103100792 273
64 3300025945 Ga0207679_10172459 Ga0207679_101724592 273
65 3300025960 Ga0207651_10003398 Ga0207651_100033987 273
66 3300025972 Ga0207668_10334024 Ga0207668_103340242 273
67 3300025981 Ga0207640_10361999 Ga0207640_103619992 273
68 3300025986 Ga0207658_10003823 Ga0207658_100038239 273
69 3300025986 Ga0207658_10046890 Ga0207658_100468902 273
70 3300026035 Ga0207703_10076203 Ga0207703_100762032 273
71 3300026035 Ga0207703_10079646 Ga0207703_100796461 273
72 3300026067 Ga0207678_10011127 Ga0207678_100111275 273
73 3300026078 Ga0207702_10113781 Ga0207702_101137812 273
74 3300026088 Ga0207641_10060777 Ga0207641_100607773 273
75 3300026089 Ga0207648_10013048 Ga0207648_100130488 273
76 3300026095 Ga0207676_10008358 Ga0207676_100083582 273
77 3300026118 Ga0207675_100165675 Ga0207675_1001656752 273
78 3300026121 Ga0207683_10000119 Ga0207683_1000011955 273
79 3300026142 Ga0207698_10126519 Ga0207698_101265193 273
80 3300028379 Ga0268266_10004181 Ga0268266_100041815 273
81 3300028381 Ga0268264_10145641 Ga0268264_101456412 273
82 3300035084 Ga0373928_0061555 Ga0373928_0061555_42_881 273
83 3300035691 Ga0373931_0048807 Ga0373931_0048807_286_1125 273
84 3300050512 nmdc:mga0n895_85305_c1 nmdc:mga0n895_85305_c1_1118_1960 273
85 3300005445 Ga0070708_100000792 Ga0070708_10000079212 274
86 3300005467 Ga0070706_100209206 Ga0070706_1002092062 274
87 3300025910 Ga0207684_10249722 Ga0207684_102497222 274
88 3300005335 Ga0070666_10090255 Ga0070666_100902551 275
89 3300005338 Ga0068868_100284614 Ga0068868_1002846142 275
90 3300005354 Ga0070675_100364154 Ga0070675_1003641541 275
91 3300005356 Ga0070674_100145916 Ga0070674_1001459162 275
92 3300005456 Ga0070678_100013194 Ga0070678_1000131943 275
93 3300005459 Ga0068867_100329731 Ga0068867_1003297312 275
94 3300005467 Ga0070706_100015189 Ga0070706_1000151897 275
95 3300005468 Ga0070707_100241402 Ga0070707_1002414022 275
96 3300005518 Ga0070699_100156957 Ga0070699_1001569572 275
97 3300005536 Ga0070697_100133293 Ga0070697_1001332932 275
98 3300005543 Ga0070672_100011595 Ga0070672_1000115957 275
99 3300005546 Ga0070696_100309732 Ga0070696_1003097322 275
100 3300005548 Ga0070665_100057649 Ga0070665_1000576492 275
101 3300005549 Ga0070704_100084074 Ga0070704_1000840742 275
102 3300006852 Ga0075433_10026406 Ga0075433_100264063 275
103 3300006871 Ga0075434_100028620 Ga0075434_1000286205 275
104 3300013308 Ga0157375_10230351 Ga0157375_102303511 275
105 3300014969 Ga0157376_10148985 Ga0157376_101489852 275
106 3300025903 Ga0207680_10044358 Ga0207680_100443582 275
107 3300025910 Ga0207684_10046559 Ga0207684_100465592 275
108 3300025922 Ga0207646_10014290 Ga0207646_100142904 275
109 3300025940 Ga0207691_10038608 Ga0207691_100386084 275
110 3300026023 Ga0207677_10078566 Ga0207677_100785662 275
111 3300026089 Ga0207648_10105122 Ga0207648_101051223 275
112 3300026121 Ga0207683_10022179 Ga0207683_100221794 275
113 3300028379 Ga0268266_10207087 Ga0268266_102070872 275
114 3300047318 Ga0495636_0107356 Ga0495636_0107356_142_987 275
115 3300050512 nmdc:mga0n895_140431_c1 nmdc:mga0n895_140431_c1_358_1203 275
116 3300050512 nmdc:mga0n895_76114_c1 nmdc:mga0n895_76114_c1_2205_3050 275
117 3300050515 nmdc:mga0a205_214160_c1 nmdc:mga0a205_214160_c1_386_1231 275
118 3300050515 nmdc:mga0a205_8967_c1 nmdc:mga0a205_8967_c1_2455_3300 275
119 3300009147 Ga0114129_10045036 Ga0114129_100450365 276
120 3300005340 Ga0070689_100532457 Ga0070689_1005324571 277
121 3300005344 Ga0070661_100243376 Ga0070661_1002433762 277
122 3300005355 Ga0070671_100098636 Ga0070671_1000986362 277
123 3300005355 Ga0070671_100241336 Ga0070671_1002413361 277
124 3300005366 Ga0070659_100051700 Ga0070659_1000517004 277
125 3300005547 Ga0070693_100280213 Ga0070693_1002802131 277
126 3300005563 Ga0068855_100028758 Ga0068855_1000287585 277
127 3300005564 Ga0070664_100083739 Ga0070664_1000837394 277
128 3300005614 Ga0068856_100543997 Ga0068856_1005439971 277
129 3300005834 Ga0068851_10014288 Ga0068851_100142883 277
130 3300006358 Ga0068871_100521336 Ga0068871_1005213362 277
131 3300009094 Ga0111539_10154655 Ga0111539_101546553 277
132 3300025932 Ga0207690_10051206 Ga0207690_100512063 277
133 3300025949 Ga0207667_10037728 Ga0207667_100377284 277
134 3300026078 Ga0207702_10406848 Ga0207702_104068481 277
135 3300028794 Ga0307515_10282968 Ga0307515_102829682 277
136 3300035725 Ga0373947_0099653 Ga0373947_0099653_864_1721 277
137 3300036401 Ga0373937_0114854 Ga0373937_0114854_467_1324 277
138 3300037068 Ga0373925_0058365 Ga0373925_0058365_145_1002 277
139 3300041512 Ga0451853_0867049 Ga0451853_0867049_492_1349 277
140 3300046472 Ga0495580_0264576 Ga0495580_0264576_133_990 277
141 3300050511 nmdc:mga08y16_120385_c1 nmdc:mga08y16_120385_c1_1467_2360 277
142 3300005347 Ga0070668_100049482 Ga0070668_1000494823 278
143 3300005466 Ga0070685_10259974 Ga0070685_102599741 278
144 3300005844 Ga0068862_100025057 Ga0068862_1000250575 278
145 3300025925 Ga0207650_10032706 Ga0207650_100327061 278
146 3300025972 Ga0207668_10034452 Ga0207668_100344523 278
147 3300026116 Ga0207674_10154073 Ga0207674_101540733 278
148 3300025920 Ga0207649_10361872 Ga0207649_103618722 279
149 3300028794 Ga0307515_10000459 Ga0307515_1000045986 279
150 3300031649 Ga0307514_10000979 Ga0307514_1000097938 279
151 3300033180 Ga0307510_10127901 Ga0307510_101279012 279
152 3300006852 Ga0075433_10109382 Ga0075433_101093822 280
153 3300006871 Ga0075434_100248463 Ga0075434_1002484632 280
154 3300005614 Ga0068856_100246726 Ga0068856_1002467262 282
155 3300046530 Ga0495654_0002750 Ga0495654_0002750_5988_6920 282
156 3300042115 Ga0450911_000074 Ga0450911_000074_27622_28527 283
157 3300048924 Ga0496121_0003833 Ga0496121_0003833_8593_9498 283
158 3300048928 Ga0496125_0017574 Ga0496125_0017574_870_1775 283
159 3300006173 Ga0070716_100018789 Ga0070716_1000187894 285
160 3300006914 Ga0075436_100030838 Ga0075436_1000308384 285
161 3300013308 Ga0157375_10031086 Ga0157375_100310866 285
162 3300025939 Ga0207665_10084669 Ga0207665_100846692 285
163 3300046517 Ga0495630_0379112 Ga0495630_0379112_193_1065 285
164 3300048905 Ga0496102_0038160 Ga0496102_0038160_1621_2487 285
165 3300050513 nmdc:mga0rr50_261508_c1 nmdc:mga0rr50_261508_c1_33_908 285
166 3300050514 nmdc:mga08x19_15991_c1 nmdc:mga08x19_15991_c1_975_1859 285
167 3300053730 Ga0500645_002165 Ga0500645_002165_166_1059 287
168 iso_pu_bacteria 2721755523 2722883087 287
169 iso_pu_bacteria 2839138175 2839141434 287
170 iso_pu_bacteria 2643221621 2644119489 288
171 iso_pu_bacteria 2881101125 2881103683 289
172 3300005328 Ga0070676_10027724 Ga0070676_100277241 290
173 3300005339 Ga0070660_100000483 Ga0070660_10000048333 290
174 3300005354 Ga0070675_100030891 Ga0070675_1000308914 290
175 3300005355 Ga0070671_100002310 Ga0070671_1000023109 290
176 3300005356 Ga0070674_100408572 Ga0070674_1004085721 290
177 3300005364 Ga0070673_100026546 Ga0070673_1000265464 290
178 3300005366 Ga0070659_100003296 Ga0070659_1000032968 290
179 3300005455 Ga0070663_100021054 Ga0070663_1000210544 290
180 3300005457 Ga0070662_100001177 Ga0070662_1000011774 290
181 3300005530 Ga0070679_100037311 Ga0070679_1000373113 290
182 3300005539 Ga0068853_100002005 Ga0068853_10000200516 290
183 3300005563 Ga0068855_100003898 Ga0068855_1000038985 290
184 3300005614 Ga0068856_100001796 Ga0068856_10000179611 290
185 3300006946 Ga0079104_1000007 Ga0079104_10000074 290
186 3300009148 Ga0105243_10001888 Ga0105243_1000188817 290
187 3300013100 Ga0157373_10006303 Ga0157373_100063039 290
188 3300013102 Ga0157371_10000194 Ga0157371_1000019415 290
189 3300013105 Ga0157369_10198831 Ga0157369_101988312 290
190 3300013307 Ga0157372_10005627 Ga0157372_1000562712 290
191 3300025907 Ga0207645_10043798 Ga0207645_100437984 290
192 3300025919 Ga0207657_10003940 Ga0207657_1000394020 290
193 3300025926 Ga0207659_10054439 Ga0207659_100544394 290
194 3300025931 Ga0207644_10001985 Ga0207644_100019859 290
195 3300025932 Ga0207690_10006609 Ga0207690_100066095 290
196 3300025933 Ga0207706_10000002 Ga0207706_10000002286 290
197 3300025935 Ga0207709_10000172 Ga0207709_1000017215 290
198 3300025940 Ga0207691_10036775 Ga0207691_100367755 290
199 3300025949 Ga0207667_10002797 Ga0207667_1000279715 290
200 3300025960 Ga0207651_10007695 Ga0207651_100076954 290
201 3300025972 Ga0207668_10143555 Ga0207668_101435552 290
202 3300025981 Ga0207640_10130392 Ga0207640_101303922 290
203 3300025986 Ga0207658_10058879 Ga0207658_100588792 290
204 3300026041 Ga0207639_10005219 Ga0207639_1000521911 290
205 3300026067 Ga0207678_10032495 Ga0207678_100324953 290
206 3300026078 Ga0207702_10006364 Ga0207702_100063646 290
207 3300026142 Ga0207698_10177901 Ga0207698_101779012 290
208 3300027111 Ga0209281_1000020 Ga0209281_1000020493 290
209 3300042876 Ga0451577_0000235 Ga0451577_0000235_57138_58022 290
210 3300044712 Ga0453684_0000906 Ga0453684_0000906_46263_47147 290
211 3300045051 Ga0451576_0008805 Ga0451576_0008805_7910_8803 290
212 3300048905 Ga0496102_0003078 Ga0496102_0003078_5533_6483 290
213 3300048906 Ga0496103_0097636 Ga0496103_0097636_310_1260 290
214 3300048909 Ga0496106_0002588 Ga0496106_0002588_8053_9003 290
215 3300049459 Ga0495678_002401 Ga0495678_002401_1692_2588 290
216 3300005616 Ga0068852_100008965 Ga0068852_10000896511 292
217 3300006048 Ga0075363_100046047 Ga0075363_1000460472 292
218 3300006178 Ga0075367_10039603 Ga0075367_100396034 292
219 3300006195 Ga0075366_10101706 Ga0075366_101017061 292
220 3300026142 Ga0207698_10032712 Ga0207698_100327122 292
221 3300031911 Ga0307412_10205096 Ga0307412_102050961 292
222 3300032002 Ga0307416_100077955 Ga0307416_1000779552 292
223 3300037466 Ga0395898_0164667 Ga0395898_0164667_17_901 292
224 3300041451 Ga0451791_0914965 Ga0451791_0914965_672_1577 292
225 3300042007 Ga0439449_0000986 Ga0439449_0000986_6260_7150 292
226 3300042007 Ga0439449_0093197 Ga0439449_0093197_22_903 292
227 3300042015 Ga0439462_0001526 Ga0439462_0001526_3925_4815 292
228 3300046471 Ga0495650_0009317 Ga0495650_0009317_855_1748 292
229 3300049569 Ga0501032_0092896 Ga0501032_0092896_609_1529 292
230 3300049579 Ga0501043_0000072 Ga0501043_0000072_3702_4622 292
231 3300049580 Ga0501046_0000112 Ga0501046_0000112_1053_1973 292
232 3300049581 Ga0501047_0000138 Ga0501047_0000138_84400_85320 292
233 3300049582 Ga0501048_0001533 Ga0501048_0001533_15536_16456 292
234 3300049824 Ga0501045_0005067 Ga0501045_0005067_2131_3051 292
235 3300050492 nmdc:mga0yw44_177401_c1 nmdc:mga0yw44_177401_c1_95_988 292
236 3300050492 nmdc:mga0yw44_36874_c1 nmdc:mga0yw44_36874_c1_960_1853 292
237 3300059424 Ga0590075_020359 Ga0590075_020359_713_1603 292
238 3300005843 Ga0068860_100056774 Ga0068860_1000567742 293
239 3300028381 Ga0268264_10041400 Ga0268264_100414002 293
240 3300028794 Ga0307515_10086833 Ga0307515_100868333 293
241 3300046518 Ga0495631_0119637 Ga0495631_0119637_211_1122 293
242 iso_pu_bacteria 2511231002 2511245644 293
243 iso_pu_bacteria 2585428058 2587736260 293
244 iso_pu_bacteria 2585428062 2587757046 293
245 3300005331 Ga0070670_100029077 Ga0070670_1000290774 294
246 3300005367 Ga0070667_100054892 Ga0070667_1000548921 294
247 3300005617 Ga0068859_100228435 Ga0068859_1002284352 294
248 3300006931 Ga0097620_100228431 Ga0097620_1002284312 294
249 3300009093 Ga0105240_10038834 Ga0105240_100388342 294
250 3300010375 Ga0105239_10427391 Ga0105239_104273912 294
251 3300014326 Ga0157380_10076760 Ga0157380_100767602 294
252 3300025913 Ga0207695_10029322 Ga0207695_100293223 294
253 3300025914 Ga0207671_10061758 Ga0207671_100617582 294
254 3300025925 Ga0207650_10024159 Ga0207650_100241593 294
255 3300031548 Ga0307408_100086284 Ga0307408_1000862843 294
256 3300031901 Ga0307406_10000278 Ga0307406_1000027827 294
257 3300035172 Ga0373955_0298393 Ga0373955_0298393_28_927 294
258 3300042156 Ga0439446_0074829 Ga0439446_0074829_11_925 294
259 3300049579 Ga0501043_0000052 Ga0501043_0000052_102333_103250 294
260 3300049580 Ga0501046_0000327 Ga0501046_0000327_43429_44346 294
261 3300049581 Ga0501047_0000137 Ga0501047_0000137_49288_50205 294
262 3300049582 Ga0501048_0000371 Ga0501048_0000371_5959_6876 294
263 3300049823 Ga0501044_0321267 Ga0501044_0321267_220_1137 294
264 3300049824 Ga0501045_0001514 Ga0501045_0001514_12402_13319 294
265 iso_pu_bacteria 2547132374 2548500443 294
266 iso_pu_bacteria 2643221570 2643864549 294
267 iso_pu_bacteria 2643221596 2643992839 294
268 iso_pu_bacteria 2643221609 2644058241 294
269 iso_pu_bacteria 2643221611 2644073294 294
270 iso_pu_bacteria 2643221652 2644291762 294
271 iso_pu_bacteria 2643221717 2644647010 294
272 iso_pu_bacteria 2738543012 2739244418 294
273 iso_pu_bacteria 2816332133 2816469849 294
274 iso_pu_bacteria 2919704043 2919704383 294
275 iso_pu_bacteria 2990710928 2990715128 294
276 3300005290 Ga0065712_10099630 Ga0065712_100996302 295
277 3300005293 Ga0065715_10126678 Ga0065715_101266782 295
278 3300005329 Ga0070683_100028689 Ga0070683_1000286893 295
279 3300005329 Ga0070683_100087454 Ga0070683_1000874544 295
280 3300005330 Ga0070690_100047352 Ga0070690_1000473522 295
281 3300005331 Ga0070670_100095055 Ga0070670_1000950552 295
282 3300005334 Ga0068869_100002513 Ga0068869_10000251310 295
283 3300005335 Ga0070666_10107516 Ga0070666_101075162 295
284 3300005338 Ga0068868_100130065 Ga0068868_1001300652 295
285 3300005339 Ga0070660_100003597 Ga0070660_1000035972 295
286 3300005340 Ga0070689_100015294 Ga0070689_1000152942 295
287 3300005343 Ga0070687_100017491 Ga0070687_1000174913 295
288 3300005344 Ga0070661_100042363 Ga0070661_1000423632 295
289 3300005344 Ga0070661_100062174 Ga0070661_1000621741 295
290 3300005355 Ga0070671_100088195 Ga0070671_1000881953 295
291 3300005356 Ga0070674_100055090 Ga0070674_1000550902 295
292 3300005365 Ga0070688_100057346 Ga0070688_1000573462 295
293 3300005438 Ga0070701_10017069 Ga0070701_100170693 295
294 3300005455 Ga0070663_100004009 Ga0070663_1000040097 295
295 3300005455 Ga0070663_100155362 Ga0070663_1001553622 295
296 3300005457 Ga0070662_100027749 Ga0070662_1000277493 295
297 3300005459 Ga0068867_100295992 Ga0068867_1002959922 295
298 3300005466 Ga0070685_10003675 Ga0070685_100036752 295
299 3300005539 Ga0068853_100098480 Ga0068853_1000984802 295
300 3300005544 Ga0070686_100021664 Ga0070686_1000216643 295
301 3300005548 Ga0070665_100054460 Ga0070665_1000544606 295
302 3300005564 Ga0070664_100045893 Ga0070664_1000458933 295
303 3300005564 Ga0070664_100084232 Ga0070664_1000842322 295
304 3300005577 Ga0068857_100006391 Ga0068857_1000063919 295
305 3300005616 Ga0068852_100009773 Ga0068852_1000097734 295
306 3300005616 Ga0068852_100069113 Ga0068852_1000691133 295
307 3300005618 Ga0068864_100064654 Ga0068864_1000646543 295
308 3300005718 Ga0068866_10068112 Ga0068866_100681122 295
309 3300005719 Ga0068861_100017505 Ga0068861_1000175053 295
310 3300005834 Ga0068851_10001091 Ga0068851_1000109111 295
311 3300005834 Ga0068851_10005660 Ga0068851_100056602 295
312 3300005840 Ga0068870_10074828 Ga0068870_100748282 295
313 3300005841 Ga0068863_100200108 Ga0068863_1002001082 295
314 3300005844 Ga0068862_100022088 Ga0068862_1000220886 295
315 3300006237 Ga0097621_100178593 Ga0097621_1001785932 295
316 3300009094 Ga0111539_10054115 Ga0111539_100541153 295
317 3300009098 Ga0105245_10274845 Ga0105245_102748452 295
318 3300009101 Ga0105247_10265757 Ga0105247_102657571 295
319 3300009177 Ga0105248_10120513 Ga0105248_101205132 295
320 3300010375 Ga0105239_10449407 Ga0105239_104494072 295
321 3300013296 Ga0157374_10007074 Ga0157374_100070744 295
322 3300013297 Ga0157378_10226200 Ga0157378_102262002 295
323 3300014325 Ga0163163_10083758 Ga0163163_100837583 295
324 3300014326 Ga0157380_10003347 Ga0157380_1000334710 295
325 3300014745 Ga0157377_10003307 Ga0157377_100033077 295
326 3300014745 Ga0157377_10164348 Ga0157377_101643481 295
327 3300014968 Ga0157379_10121989 Ga0157379_101219892 295
328 3300014969 Ga0157376_10100763 Ga0157376_101007633 295
329 3300014969 Ga0157376_10334746 Ga0157376_103347462 295
330 3300025315 Ga0207697_10000368 Ga0207697_1000036820 295
331 3300025321 Ga0207656_10040278 Ga0207656_100402782 295
332 3300025893 Ga0207682_10000076 Ga0207682_1000007611 295
333 3300025901 Ga0207688_10001459 Ga0207688_1000145912 295
334 3300025903 Ga0207680_10074303 Ga0207680_100743032 295
335 3300025907 Ga0207645_10002521 Ga0207645_1000252116 295
336 3300025908 Ga0207643_10002053 Ga0207643_100020538 295
337 3300025909 Ga0207705_10029442 Ga0207705_100294424 295
338 3300025918 Ga0207662_10005162 Ga0207662_100051626 295
339 3300025919 Ga0207657_10005946 Ga0207657_100059462 295
340 3300025925 Ga0207650_10003315 Ga0207650_1000331512 295
341 3300025926 Ga0207659_10004952 Ga0207659_100049527 295
342 3300025931 Ga0207644_10012418 Ga0207644_100124185 295
343 3300025933 Ga0207706_10002383 Ga0207706_1000238319 295
344 3300025936 Ga0207670_10028754 Ga0207670_100287542 295
345 3300025937 Ga0207669_10083381 Ga0207669_100833812 295
346 3300025940 Ga0207691_10102436 Ga0207691_101024362 295
347 3300025942 Ga0207689_10002547 Ga0207689_1000254717 295
348 3300025945 Ga0207679_10034512 Ga0207679_100345123 295
349 3300025986 Ga0207658_10020000 Ga0207658_100200002 295
350 3300026023 Ga0207677_10009582 Ga0207677_100095826 295
351 3300026035 Ga0207703_10040095 Ga0207703_100400952 295
352 3300026067 Ga0207678_10000931 Ga0207678_1000093121 295
353 3300026067 Ga0207678_10339064 Ga0207678_103390642 295
354 3300026075 Ga0207708_10000418 Ga0207708_100004184 295
355 3300026088 Ga0207641_10025865 Ga0207641_100258652 295
356 3300026089 Ga0207648_10014979 Ga0207648_100149797 295
357 3300026095 Ga0207676_10243898 Ga0207676_102438982 295
358 3300026116 Ga0207674_10005989 Ga0207674_100059897 295
359 3300026118 Ga0207675_100009614 Ga0207675_1000096147 295
360 3300026121 Ga0207683_10004550 Ga0207683_1000455013 295
361 3300026142 Ga0207698_10268979 Ga0207698_102689791 295
362 3300027907 Ga0207428_10221717 Ga0207428_102217172 295
363 3300028379 Ga0268266_10053676 Ga0268266_100536764 295
364 3300028381 Ga0268264_10092667 Ga0268264_100926673 295
365 3300031911 Ga0307412_10175630 Ga0307412_101756302 295
366 3300041443 Ga0451789_0569119 Ga0451789_0569119_237_1166 295
367 3300041452 Ga0451793_0421724 Ga0451793_0421724_1758_2654 295
368 3300041463 Ga0451804_0432193 Ga0451804_0432193_177_1073 295
369 3300042004 Ga0439445_0009866 Ga0439445_0009866_501_1406 295
370 3300042436 Ga0439435_0055421 Ga0439435_0055421_123_1025 295
371 3300045051 Ga0451576_0038996 Ga0451576_0038996_1208_2110 295
372 3300046460 Ga0495638_0060680 Ga0495638_0060680_352_1281 295
373 3300046519 Ga0495632_0002891 Ga0495632_0002891_1751_2680 295
374 3300048904 Ga0496101_0084219 Ga0496101_0084219_126_1025 295
375 3300048905 Ga0496102_0064277 Ga0496102_0064277_2191_3090 295
376 3300048908 Ga0496105_0004944 Ga0496105_0004944_3856_4755 295
377 3300048909 Ga0496106_0044949 Ga0496106_0044949_1035_1934 295
378 3300048910 Ga0496107_0041577 Ga0496107_0041577_1939_2838 295
379 3300048913 Ga0496110_0044760 Ga0496110_0044760_1606_2505 295
380 3300048929 Ga0496126_0095970 Ga0496126_0095970_280_1185 295
381 3300050511 nmdc:mga08y16_135364_c1 nmdc:mga08y16_135364_c1_1197_2096 295
382 3300053088 Ga0500644_0091187 Ga0500644_0091187_172_1101 295
383 3300053090 Ga0500646_0001709 Ga0500646_0001709_3597_4526 295
384 3300053131 Ga0500652_001537 Ga0500652_001537_4222_5151 295
385 3300053133 Ga0500655_006099 Ga0500655_006099_603_1532 295
386 3300053151 Ga0500604_0005487 Ga0500604_0005487_1151_2080 295
387 3300053156 Ga0500622_0001110 Ga0500622_0001110_6537_7466 295
388 3300003794 Ga0055531_10000281 Ga0055531_1000028138 296
389 3300005293 Ga0065715_10119990 Ga0065715_101199903 296
390 3300005354 Ga0070675_100023744 Ga0070675_1000237442 296
391 3300005367 Ga0070667_100020817 Ga0070667_1000208174 296
392 3300005459 Ga0068867_100523140 Ga0068867_1005231401 296
393 3300005543 Ga0070672_100083034 Ga0070672_1000830343 296
394 3300005548 Ga0070665_100264556 Ga0070665_1002645562 296
395 3300005617 Ga0068859_100519202 Ga0068859_1005192022 296
396 3300005618 Ga0068864_100053879 Ga0068864_1000538792 296
397 3300005618 Ga0068864_100170353 Ga0068864_1001703533 296
398 3300005719 Ga0068861_100097514 Ga0068861_1000975143 296
399 3300005841 Ga0068863_100094420 Ga0068863_1000944202 296
400 3300006846 Ga0075430_100219669 Ga0075430_1002196692 296
401 3300006931 Ga0097620_100519138 Ga0097620_1005191382 296
402 3300010375 Ga0105239_10126723 Ga0105239_101267233 296
403 3300013308 Ga0157375_10228948 Ga0157375_102289482 296
404 3300025284 Ga0209130_1032622 Ga0209130_10326221 296
405 3300025303 Ga0209051_1000172 Ga0209051_1000172104 296
406 3300025304 Ga0209257_1000015 Ga0209257_1000015483 296
407 3300025304 Ga0209257_1000108 Ga0209257_1000108227 296
408 3300025925 Ga0207650_10069448 Ga0207650_100694483 296
409 3300025926 Ga0207659_10008305 Ga0207659_100083054 296
410 3300025941 Ga0207711_10028333 Ga0207711_100283332 296
411 3300025972 Ga0207668_10002950 Ga0207668_100029507 296
412 3300025986 Ga0207658_10022771 Ga0207658_100227713 296
413 3300026088 Ga0207641_10118653 Ga0207641_101186533 296
414 3300026095 Ga0207676_10039402 Ga0207676_100394024 296
415 3300026095 Ga0207676_10187942 Ga0207676_101879422 296
416 3300026118 Ga0207675_100254085 Ga0207675_1002540853 296
417 3300027614 Ga0209970_1001012 Ga0209970_10010122 296
418 3300028379 Ga0268266_10147323 Ga0268266_101473232 296
419 3300037312 Ga0395899_0006012 Ga0395899_0006012_1232_2134 296
420 3300037312 Ga0395899_0013757 Ga0395899_0013757_5258_6163 296
421 3300037466 Ga0395898_0025013 Ga0395898_0025013_25_927 296
422 3300037466 Ga0395898_0116213 Ga0395898_0116213_1636_2541 296
423 3300042007 Ga0439449_0000091 Ga0439449_0000091_14287_15204 296
424 3300044673 Ga0453683_0006609 Ga0453683_0006609_4414_5319 296
425 3300045051 Ga0451576_0025630 Ga0451576_0025630_1494_2399 296
426 3300046535 Ga0495586_0119883 Ga0495586_0119883_141_1073 296
427 3300048905 Ga0496102_0005035 Ga0496102_0005035_5556_6467 296
428 3300002704 JGI25155J39150_1000090 JGI25155J39150_100009040 297
429 3300002705 JGI25156J39149_1000148 JGI25156J39149_100014840 297
430 3300002738 JGI25154J39366_1000155 JGI25154J39366_100015541 297
431 3300002741 JGI25157J39369_1000183 JGI25157J39369_10001837 297
432 3300002774 JGI25150J39212_1004158 JGI25150J39212_10041582 297
433 3300002774 JGI25150J39212_1004356 JGI25150J39212_10043562 297
434 3300003187 JGI25151J46595_10001873 JGI25151J46595_100018737 297
435 3300003187 JGI25151J46595_10009246 JGI25151J46595_100092464 297
436 3300003187 JGI25151J46595_10027293 JGI25151J46595_100272932 297
437 3300003203 JGI25406J46586_10032068 JGI25406J46586_100320682 297
438 3300003215 JGI25153J46596_10004275 JGI25153J46596_100042752 297
439 3300003320 rootH2_10050795 rootH2_100507954 297
440 3300003322 rootL2_10005678 rootL2_100056786 297
441 3300003354 JGI25160J50197_1000059 JGI25160J50197_100005956 297
442 3300003374 JGI25161J50226_1000008 JGI25161J50226_10000082 297
443 3300003773 Ga0055537_1000245 Ga0055537_10002457 297
444 3300003773 Ga0055537_1000249 Ga0055537_10002496 297
445 3300003775 Ga0055524_1000057 Ga0055524_10000577 297
446 3300003781 Ga0055536_1003494 Ga0055536_10034945 297
447 3300003790 Ga0055528_1000888 Ga0055528_10008885 297
448 3300003791 Ga0055530_10002076 Ga0055530_100020767 297
449 3300003792 Ga0055540_1001554 Ga0055540_10015549 297
450 3300003794 Ga0055531_10002433 Ga0055531_100024337 297
451 3300003794 Ga0055531_10014357 Ga0055531_100143572 297
452 3300004625 Ga0055543_1000138 Ga0055543_100013841 297
453 3300005262 Ga0065165_1007150 Ga0065165_10071506 297
454 3300005328 Ga0070676_10002095 Ga0070676_100020958 297
455 3300005328 Ga0070676_10012793 Ga0070676_100127932 297
456 3300005328 Ga0070676_10030285 Ga0070676_100302854 297
457 3300005330 Ga0070690_100001452 Ga0070690_1000014524 297
458 3300005331 Ga0070670_100008053 Ga0070670_1000080534 297
459 3300005334 Ga0068869_100000481 Ga0068869_10000048110 297
460 3300005335 Ga0070666_10000745 Ga0070666_100007456 297
461 3300005335 Ga0070666_10195358 Ga0070666_101953581 297
462 3300005336 Ga0070680_100049561 Ga0070680_1000495614 297
463 3300005338 Ga0068868_100000971 Ga0068868_10000097113 297
464 3300005338 Ga0068868_100050030 Ga0068868_1000500302 297
465 3300005338 Ga0068868_100065210 Ga0068868_1000652102 297
466 3300005338 Ga0068868_100198559 Ga0068868_1001985592 297
467 3300005339 Ga0070660_100174322 Ga0070660_1001743222 297
468 3300005340 Ga0070689_100002088 Ga0070689_1000020886 297
469 3300005340 Ga0070689_100054672 Ga0070689_1000546721 297
470 3300005343 Ga0070687_100117256 Ga0070687_1001172562 297
471 3300005347 Ga0070668_100211549 Ga0070668_1002115492 297
472 3300005353 Ga0070669_100004947 Ga0070669_1000049473 297
473 3300005354 Ga0070675_100033406 Ga0070675_1000334063 297
474 3300005354 Ga0070675_100092616 Ga0070675_1000926162 297
475 3300005355 Ga0070671_100001053 Ga0070671_10000105319 297
476 3300005355 Ga0070671_100007296 Ga0070671_1000072967 297
477 3300005355 Ga0070671_100060980 Ga0070671_1000609802 297
478 3300005355 Ga0070671_100169992 Ga0070671_1001699921 297
479 3300005356 Ga0070674_100099699 Ga0070674_1000996992 297
480 3300005364 Ga0070673_100007976 Ga0070673_1000079763 297
481 3300005364 Ga0070673_100257003 Ga0070673_1002570032 297
482 3300005365 Ga0070688_100002954 Ga0070688_1000029549 297
483 3300005365 Ga0070688_100089848 Ga0070688_1000898482 297
484 3300005367 Ga0070667_100001469 Ga0070667_10000146910 297
485 3300005367 Ga0070667_100004231 Ga0070667_10000423113 297
486 3300005367 Ga0070667_100074494 Ga0070667_1000744942 297
487 3300005434 Ga0070709_10043398 Ga0070709_100433984 297
488 3300005439 Ga0070711_100004626 Ga0070711_1000046265 297
489 3300005439 Ga0070711_100209686 Ga0070711_1002096862 297
490 3300005440 Ga0070705_100004377 Ga0070705_1000043774 297
491 3300005444 Ga0070694_100025464 Ga0070694_1000254644 297
492 3300005455 Ga0070663_100107551 Ga0070663_1001075512 297
493 3300005455 Ga0070663_100135412 Ga0070663_1001354122 297
494 3300005455 Ga0070663_100182684 Ga0070663_1001826842 297
495 3300005455 Ga0070663_100252222 Ga0070663_1002522222 297
496 3300005456 Ga0070678_100002830 Ga0070678_1000028301 297
497 3300005457 Ga0070662_100048655 Ga0070662_1000486552 297
498 3300005457 Ga0070662_100060606 Ga0070662_1000606063 297
499 3300005457 Ga0070662_100260566 Ga0070662_1002605663 297
500 3300005457 Ga0070662_100264038 Ga0070662_1002640381 297
501 3300005458 Ga0070681_10076070 Ga0070681_100760704 297
502 3300005459 Ga0068867_100002983 Ga0068867_1000029839 297
503 3300005459 Ga0068867_100004082 Ga0068867_10000408210 297
504 3300005459 Ga0068867_100007271 Ga0068867_1000072712 297
505 3300005459 Ga0068867_100044893 Ga0068867_1000448933 297
506 3300005459 Ga0068867_100292737 Ga0068867_1002927372 297
507 3300005466 Ga0070685_10011495 Ga0070685_100114956 297
508 3300005467 Ga0070706_100003222 Ga0070706_10000322212 297
509 3300005468 Ga0070707_100033981 Ga0070707_1000339812 297
510 3300005468 Ga0070707_100070778 Ga0070707_1000707782 297
511 3300005536 Ga0070697_100149793 Ga0070697_1001497931 297
512 3300005543 Ga0070672_100091803 Ga0070672_1000918033 297
513 3300005546 Ga0070696_100067690 Ga0070696_1000676902 297
514 3300005547 Ga0070693_100002585 Ga0070693_1000025859 297
515 3300005548 Ga0070665_100001402 Ga0070665_10000140220 297
516 3300005548 Ga0070665_100007136 Ga0070665_1000071367 297
517 3300005563 Ga0068855_100129567 Ga0068855_1001295672 297
518 3300005577 Ga0068857_100007102 Ga0068857_1000071028 297
519 3300005577 Ga0068857_100026898 Ga0068857_1000268985 297
520 3300005578 Ga0068854_100047229 Ga0068854_1000472293 297
521 3300005578 Ga0068854_100095261 Ga0068854_1000952613 297
522 3300005614 Ga0068856_100171183 Ga0068856_1001711832 297
523 3300005614 Ga0068856_100235728 Ga0068856_1002357282 297
524 3300005615 Ga0070702_100010808 Ga0070702_1000108084 297
525 3300005615 Ga0070702_100166995 Ga0070702_1001669952 297
526 3300005616 Ga0068852_100109419 Ga0068852_1001094193 297
527 3300005616 Ga0068852_100110416 Ga0068852_1001104162 297
528 3300005617 Ga0068859_100000893 Ga0068859_10000089324 297
529 3300005617 Ga0068859_100001169 Ga0068859_10000116910 297
530 3300005617 Ga0068859_100115911 Ga0068859_1001159113 297
531 3300005617 Ga0068859_100647164 Ga0068859_1006471642 297
532 3300005618 Ga0068864_100001446 Ga0068864_10000144628 297
533 3300005618 Ga0068864_100002752 Ga0068864_1000027529 297
534 3300005618 Ga0068864_100009929 Ga0068864_10000992910 297
535 3300005718 Ga0068866_10001177 Ga0068866_1000117712 297
536 3300005719 Ga0068861_100001611 Ga0068861_1000016119 297
537 3300005834 Ga0068851_10072861 Ga0068851_100728612 297
538 3300005840 Ga0068870_10022611 Ga0068870_100226113 297
539 3300005840 Ga0068870_10037573 Ga0068870_100375732 297
540 3300005841 Ga0068863_100000521 Ga0068863_10000052127 297
541 3300005841 Ga0068863_100003595 Ga0068863_1000035959 297
542 3300005841 Ga0068863_100066801 Ga0068863_1000668014 297
543 3300005842 Ga0068858_100003010 Ga0068858_10000301013 297
544 3300005842 Ga0068858_100012873 Ga0068858_1000128736 297
545 3300005842 Ga0068858_100275734 Ga0068858_1002757342 297
546 3300005843 Ga0068860_100001084 Ga0068860_10000108418 297
547 3300005843 Ga0068860_100003063 Ga0068860_10000306313 297
548 3300005843 Ga0068860_100201500 Ga0068860_1002015002 297
549 3300005843 Ga0068860_100222797 Ga0068860_1002227972 297
550 3300005844 Ga0068862_100013035 Ga0068862_1000130355 297
551 3300005985 Ga0081539_10004545 Ga0081539_100045454 297
552 3300006038 Ga0075365_10070468 Ga0075365_100704682 297
553 3300006038 Ga0075365_10094818 Ga0075365_100948182 297
554 3300006048 Ga0075363_100024927 Ga0075363_1000249274 297
555 3300006048 Ga0075363_100142151 Ga0075363_1001421512 297
556 3300006051 Ga0075364_10061998 Ga0075364_100619982 297
557 3300006058 Ga0075432_10041461 Ga0075432_100414612 297
558 3300006163 Ga0070715_10072640 Ga0070715_100726402 297
559 3300006173 Ga0070716_100005733 Ga0070716_1000057338 297
560 3300006175 Ga0070712_100014560 Ga0070712_1000145603 297
561 3300006177 Ga0075362_10064159 Ga0075362_100641592 297
562 3300006177 Ga0075362_10139001 Ga0075362_101390012 297
563 3300006178 Ga0075367_10033023 Ga0075367_100330232 297
564 3300006178 Ga0075367_10044599 Ga0075367_100445993 297
565 3300006178 Ga0075367_10086488 Ga0075367_100864882 297
566 3300006195 Ga0075366_10016722 Ga0075366_100167224 297
567 3300006195 Ga0075366_10041574 Ga0075366_100415742 297
568 3300006195 Ga0075366_10084996 Ga0075366_100849962 297
569 3300006195 Ga0075366_10122499 Ga0075366_101224992 297
570 3300006237 Ga0097621_100003977 Ga0097621_1000039772 297
571 3300006237 Ga0097621_100014273 Ga0097621_1000142735 297
572 3300006353 Ga0075370_10001742 Ga0075370_100017426 297
573 3300006353 Ga0075370_10002345 Ga0075370_100023459 297
574 3300006353 Ga0075370_10039044 Ga0075370_100390442 297
575 3300006353 Ga0075370_10092239 Ga0075370_100922392 297
576 3300006353 Ga0075370_10112178 Ga0075370_101121782 297
577 3300006353 Ga0075370_10233958 Ga0075370_102339582 297
578 3300006358 Ga0068871_100017564 Ga0068871_1000175643 297
579 3300006358 Ga0068871_100035783 Ga0068871_1000357834 297
580 3300006358 Ga0068871_100451079 Ga0068871_1004510791 297
581 3300006871 Ga0075434_100279067 Ga0075434_1002790672 297
582 3300006931 Ga0097620_100000893 Ga0097620_10000089324 297
583 3300006931 Ga0097620_100001169 Ga0097620_10000116918 297
584 3300006931 Ga0097620_100115908 Ga0097620_1001159082 297
585 3300006931 Ga0097620_100647183 Ga0097620_1006471832 297
586 3300006946 Ga0079104_1000352 Ga0079104_100035215 297
587 3300009093 Ga0105240_10030931 Ga0105240_100309317 297
588 3300009094 Ga0111539_10073152 Ga0111539_100731522 297
589 3300009098 Ga0105245_10001644 Ga0105245_100016443 297
590 3300009098 Ga0105245_10007857 Ga0105245_100078574 297
591 3300009098 Ga0105245_10057243 Ga0105245_100572432 297
592 3300009098 Ga0105245_10073690 Ga0105245_100736902 297
593 3300009098 Ga0105245_10197285 Ga0105245_101972852 297
594 3300009098 Ga0105245_10388259 Ga0105245_103882592 297
595 3300009098 Ga0105245_10590041 Ga0105245_105900412 297
596 3300009101 Ga0105247_10064396 Ga0105247_100643963 297
597 3300009148 Ga0105243_10014110 Ga0105243_100141104 297
598 3300009174 Ga0105241_10036396 Ga0105241_100363964 297
599 3300009176 Ga0105242_10005801 Ga0105242_100058012 297
600 3300009176 Ga0105242_10155557 Ga0105242_101555573 297
601 3300009177 Ga0105248_10008045 Ga0105248_100080459 297
602 3300009177 Ga0105248_10013123 Ga0105248_100131237 297
603 3300009177 Ga0105248_10035492 Ga0105248_100354925 297
604 3300009545 Ga0105237_10016342 Ga0105237_100163427 297
605 3300009545 Ga0105237_10197052 Ga0105237_101970522 297
606 3300010375 Ga0105239_10408675 Ga0105239_104086751 297
607 3300012513 Ga0157326_1003869 Ga0157326_10038692 297
608 3300013104 Ga0157370_10135048 Ga0157370_101350482 297
609 3300013104 Ga0157370_10410735 Ga0157370_104107352 297
610 3300013296 Ga0157374_10002838 Ga0157374_100028385 297
611 3300013297 Ga0157378_10005473 Ga0157378_100054735 297
612 3300013297 Ga0157378_10007861 Ga0157378_1000786110 297
613 3300013297 Ga0157378_10039249 Ga0157378_100392494 297
614 3300013297 Ga0157378_10199095 Ga0157378_101990952 297
615 3300013297 Ga0157378_10696991 Ga0157378_106969911 297
616 3300013306 Ga0163162_10001908 Ga0163162_1000190814 297
617 3300013306 Ga0163162_10118849 Ga0163162_101188494 297
618 3300013306 Ga0163162_10266096 Ga0163162_102660962 297
619 3300013307 Ga0157372_10189961 Ga0157372_101899613 297
620 3300013308 Ga0157375_10019566 Ga0157375_100195667 297
621 3300013308 Ga0157375_10025955 Ga0157375_100259555 297
622 3300014325 Ga0163163_10009939 Ga0163163_100099395 297
623 3300014325 Ga0163163_10826337 Ga0163163_108263371 297
624 3300014745 Ga0157377_10000016 Ga0157377_10000016134 297
625 3300014968 Ga0157379_10001362 Ga0157379_1000136216 297
626 3300014968 Ga0157379_10002571 Ga0157379_100025719 297
627 3300014969 Ga0157376_10001750 Ga0157376_1000175011 297
628 3300014969 Ga0157376_10603769 Ga0157376_106037691 297
629 3300020070 Ga0206356_10249116 Ga0206356_102491162 297
630 3300025206 Ga0209435_100014 Ga0209435_100014198 297
631 3300025208 Ga0209436_103628 Ga0209436_1036285 297
632 3300025231 Ga0207427_101622 Ga0207427_1016222 297
633 3300025245 Ga0207425_1001097 Ga0207425_10010975 297
634 3300025245 Ga0207425_1003608 Ga0207425_10036083 297
635 3300025246 Ga0209646_1000001 Ga0209646_1000001198 297
636 3300025250 Ga0209026_1000137 Ga0209026_100013792 297
637 3300025256 Ga0209759_1000013 Ga0209759_1000013198 297
638 3300025258 Ga0209129_1006508 Ga0209129_10065082 297
639 3300025258 Ga0209129_1009153 Ga0209129_10091532 297
640 3300025263 Ga0209565_1000028 Ga0209565_1000028104 297
641 3300025263 Ga0209565_1001085 Ga0209565_10010854 297
642 3300025273 Ga0209673_1000035 Ga0209673_1000035231 297
643 3300025284 Ga0209130_1000052 Ga0209130_1000052148 297
644 3300025284 Ga0209130_1002799 Ga0209130_10027996 297
645 3300025291 Ga0209675_1000313 Ga0209675_10003135 297
646 3300025291 Ga0209675_1001685 Ga0209675_100168513 297
647 3300025291 Ga0209675_1004248 Ga0209675_10042481 297
648 3300025292 Ga0209676_1000634 Ga0209676_100063417 297
649 3300025292 Ga0209676_1001748 Ga0209676_100174818 297
650 3300025294 Ga0209025_1004750 Ga0209025_10047509 297
651 3300025294 Ga0209025_1005213 Ga0209025_10052136 297
652 3300025294 Ga0209025_1006139 Ga0209025_10061392 297
653 3300025295 Ga0209564_1003759 Ga0209564_100375911 297
654 3300025295 Ga0209564_1010465 Ga0209564_10104651 297
655 3300025295 Ga0209564_1026419 Ga0209564_10264192 297
656 3300025297 Ga0209758_1000122 Ga0209758_100012261 297
657 3300025297 Ga0209758_1020430 Ga0209758_10204302 297
658 3300025298 Ga0209050_1000023 Ga0209050_1000023498 297
659 3300025298 Ga0209050_1000677 Ga0209050_100067720 297
660 3300025299 Ga0209256_1000003 Ga0209256_10000031248 297
661 3300025299 Ga0209256_1000011 Ga0209256_100001184 297
662 3300025302 Ga0207426_1000306 Ga0207426_100030641 297
663 3300025303 Ga0209051_1000016 Ga0209051_1000016248 297
664 3300025303 Ga0209051_1000017 Ga0209051_1000017498 297
665 3300025304 Ga0209257_1000041 Ga0209257_1000041498 297
666 3300025304 Ga0209257_1000102 Ga0209257_100010245 297
667 3300025304 Ga0209257_1006401 Ga0209257_10064017 297
668 3300025315 Ga0207697_10121560 Ga0207697_101215602 297
669 3300025321 Ga0207656_10093521 Ga0207656_100935212 297
670 3300025898 Ga0207692_10147758 Ga0207692_101477582 297
671 3300025899 Ga0207642_10002217 Ga0207642_100022172 297
672 3300025899 Ga0207642_10118025 Ga0207642_101180251 297
673 3300025903 Ga0207680_10000783 Ga0207680_100007837 297
674 3300025905 Ga0207685_10036827 Ga0207685_100368272 297
675 3300025907 Ga0207645_10001729 Ga0207645_100017296 297
676 3300025907 Ga0207645_10046267 Ga0207645_100462672 297
677 3300025908 Ga0207643_10018090 Ga0207643_100180903 297
678 3300025910 Ga0207684_10002424 Ga0207684_100024242 297
679 3300025911 Ga0207654_10058311 Ga0207654_100583112 297
680 3300025913 Ga0207695_10107478 Ga0207695_101074782 297
681 3300025913 Ga0207695_10170355 Ga0207695_101703552 297
682 3300025914 Ga0207671_10014637 Ga0207671_100146373 297
683 3300025915 Ga0207693_10001071 Ga0207693_100010718 297
684 3300025916 Ga0207663_10096972 Ga0207663_100969723 297
685 3300025916 Ga0207663_10273302 Ga0207663_102733021 297
686 3300025918 Ga0207662_10051405 Ga0207662_100514052 297
687 3300025919 Ga0207657_10032680 Ga0207657_100326802 297
688 3300025922 Ga0207646_10047710 Ga0207646_100477103 297
689 3300025923 Ga0207681_10008779 Ga0207681_100087793 297
690 3300025925 Ga0207650_10008631 Ga0207650_100086313 297
691 3300025926 Ga0207659_10029037 Ga0207659_100290374 297
692 3300025927 Ga0207687_10000226 Ga0207687_1000022613 297
693 3300025927 Ga0207687_10003096 Ga0207687_100030969 297
694 3300025927 Ga0207687_10020926 Ga0207687_100209264 297
695 3300025927 Ga0207687_10042968 Ga0207687_100429682 297
696 3300025928 Ga0207700_10029862 Ga0207700_100298623 297
697 3300025928 Ga0207700_10044625 Ga0207700_100446254 297
698 3300025929 Ga0207664_10009233 Ga0207664_100092336 297
699 3300025931 Ga0207644_10007852 Ga0207644_100078528 297
700 3300025931 Ga0207644_10044136 Ga0207644_100441364 297
701 3300025931 Ga0207644_10058835 Ga0207644_100588353 297
702 3300025933 Ga0207706_10001944 Ga0207706_1000194414 297
703 3300025933 Ga0207706_10093004 Ga0207706_100930042 297
704 3300025933 Ga0207706_10109511 Ga0207706_101095113 297
705 3300025934 Ga0207686_10003018 Ga0207686_100030184 297
706 3300025934 Ga0207686_10178492 Ga0207686_101784922 297
707 3300025936 Ga0207670_10076474 Ga0207670_100764742 297
708 3300025937 Ga0207669_10146205 Ga0207669_101462052 297
709 3300025939 Ga0207665_10060503 Ga0207665_100605033 297
710 3300025940 Ga0207691_10062634 Ga0207691_100626343 297
711 3300025940 Ga0207691_10075440 Ga0207691_100754403 297
712 3300025941 Ga0207711_10000654 Ga0207711_1000065414 297
713 3300025941 Ga0207711_10008005 Ga0207711_100080057 297
714 3300025941 Ga0207711_10019605 Ga0207711_100196054 297
715 3300025942 Ga0207689_10001081 Ga0207689_1000108111 297
716 3300025942 Ga0207689_10041723 Ga0207689_100417235 297
717 3300025942 Ga0207689_10159846 Ga0207689_101598462 297
718 3300025945 Ga0207679_10182538 Ga0207679_101825382 297
719 3300025949 Ga0207667_10314196 Ga0207667_103141962 297
720 3300025960 Ga0207651_10035662 Ga0207651_100356624 297
721 3300025972 Ga0207668_10023608 Ga0207668_100236082 297
722 3300025972 Ga0207668_10215067 Ga0207668_102150672 297
723 3300025981 Ga0207640_10022186 Ga0207640_100221862 297
724 3300025981 Ga0207640_10044617 Ga0207640_100446172 297
725 3300025986 Ga0207658_10010563 Ga0207658_100105636 297
726 3300025986 Ga0207658_10079113 Ga0207658_100791132 297
727 3300025986 Ga0207658_10198489 Ga0207658_101984892 297
728 3300026023 Ga0207677_10000162 Ga0207677_1000016233 297
729 3300026023 Ga0207677_10020074 Ga0207677_100200744 297
730 3300026023 Ga0207677_10064404 Ga0207677_100644042 297
731 3300026023 Ga0207677_10178645 Ga0207677_101786452 297
732 3300026023 Ga0207677_10234493 Ga0207677_102344932 297
733 3300026035 Ga0207703_10001919 Ga0207703_100019193 297
734 3300026035 Ga0207703_10006661 Ga0207703_100066618 297
735 3300026041 Ga0207639_10505094 Ga0207639_105050942 297
736 3300026067 Ga0207678_10058265 Ga0207678_100582652 297
737 3300026067 Ga0207678_10107131 Ga0207678_101071312 297
738 3300026067 Ga0207678_10174340 Ga0207678_101743402 297
739 3300026078 Ga0207702_10134741 Ga0207702_101347412 297
740 3300026088 Ga0207641_10001702 Ga0207641_1000170218 297
741 3300026088 Ga0207641_10014054 Ga0207641_100140543 297
742 3300026089 Ga0207648_10000343 Ga0207648_1000034352 297
743 3300026089 Ga0207648_10002633 Ga0207648_100026339 297
744 3300026089 Ga0207648_10003584 Ga0207648_1000358410 297
745 3300026089 Ga0207648_10035446 Ga0207648_100354463 297
746 3300026089 Ga0207648_10050801 Ga0207648_100508013 297
747 3300026089 Ga0207648_10111508 Ga0207648_101115082 297
748 3300026095 Ga0207676_10000451 Ga0207676_1000045123 297
749 3300026095 Ga0207676_10003663 Ga0207676_100036634 297
750 3300026116 Ga0207674_10003102 Ga0207674_1000310212 297
751 3300026116 Ga0207674_10018325 Ga0207674_1001832510 297
752 3300026116 Ga0207674_10019808 Ga0207674_100198088 297
753 3300026116 Ga0207674_10026307 Ga0207674_100263073 297
754 3300026118 Ga0207675_100003236 Ga0207675_1000032369 297
755 3300026121 Ga0207683_10000694 Ga0207683_100006941 297
756 3300026121 Ga0207683_10085353 Ga0207683_100853532 297
757 3300026121 Ga0207683_10213973 Ga0207683_102139733 297
758 3300027111 Ga0209281_1000454 Ga0209281_100045442 297
759 3300027665 Ga0209983_1002922 Ga0209983_10029223 297
760 3300027866 Ga0209813_10005461 Ga0209813_100054611 297
761 3300027876 Ga0209974_10006322 Ga0209974_100063222 297
762 3300027907 Ga0207428_10003085 Ga0207428_100030857 297
763 3300028379 Ga0268266_10102857 Ga0268266_101028572 297
764 3300028380 Ga0268265_10006699 Ga0268265_100066998 297
765 3300028380 Ga0268265_10117454 Ga0268265_101174542 297
766 3300028381 Ga0268264_10001000 Ga0268264_1000100013 297
767 3300028381 Ga0268264_10002760 Ga0268264_100027605 297
768 3300028381 Ga0268264_10012398 Ga0268264_100123988 297
769 3300028786 Ga0307517_10000358 Ga0307517_100003587 297
770 3300028786 Ga0307517_10098884 Ga0307517_100988842 297
771 3300028794 Ga0307515_10003649 Ga0307515_1000364930 297
772 3300028794 Ga0307515_10003668 Ga0307515_1000366818 297
773 3300028794 Ga0307515_10009465 Ga0307515_100094658 297
774 3300028794 Ga0307515_10010929 Ga0307515_1001092910 297
775 3300028794 Ga0307515_10211556 Ga0307515_102115562 297
776 3300028794 Ga0307515_10248604 Ga0307515_102486042 297
777 3300030522 Ga0307512_10031625 Ga0307512_100316252 297
778 3300030522 Ga0307512_10055700 Ga0307512_100557003 297
779 3300031456 Ga0307513_10000006 Ga0307513_10000006411 297
780 3300031456 Ga0307513_10005054 Ga0307513_100050543 297
781 3300031456 Ga0307513_10007938 Ga0307513_100079389 297
782 3300031456 Ga0307513_10009552 Ga0307513_100095523 297
783 3300031456 Ga0307513_10025822 Ga0307513_100258224 297
784 3300031507 Ga0307509_10001694 Ga0307509_1000169411 297
785 3300031507 Ga0307509_10005213 Ga0307509_100052139 297
786 3300031507 Ga0307509_10017599 Ga0307509_100175993 297
787 3300031507 Ga0307509_10052291 Ga0307509_100522914 297
788 3300031507 Ga0307509_10059437 Ga0307509_100594375 297
789 3300031548 Ga0307408_100000008 Ga0307408_100000008270 297
790 3300031548 Ga0307408_100021375 Ga0307408_1000213755 297
791 3300031616 Ga0307508_10000466 Ga0307508_1000046632 297
792 3300031616 Ga0307508_10007101 Ga0307508_100071017 297
793 3300031616 Ga0307508_10137663 Ga0307508_101376632 297
794 3300031616 Ga0307508_10192859 Ga0307508_101928592 297
795 3300031616 Ga0307508_10192873 Ga0307508_101928732 297
796 3300031649 Ga0307514_10004420 Ga0307514_100044208 297
797 3300031730 Ga0307516_10000705 Ga0307516_1000070519 297
798 3300031730 Ga0307516_10018606 Ga0307516_100186066 297
799 3300031730 Ga0307516_10035658 Ga0307516_100356585 297
800 3300031730 Ga0307516_10044796 Ga0307516_100447965 297
801 3300031730 Ga0307516_10211964 Ga0307516_102119642 297
802 3300031731 Ga0307405_10013240 Ga0307405_100132403 297
803 3300031824 Ga0307413_10005108 Ga0307413_100051087 297
804 3300031852 Ga0307410_10098792 Ga0307410_100987922 297
805 3300031911 Ga0307412_10004381 Ga0307412_100043817 297
806 3300031995 Ga0307409_100010785 Ga0307409_1000107855 297
807 3300032004 Ga0307414_10106044 Ga0307414_101060443 297
808 3300032005 Ga0307411_10217607 Ga0307411_102176072 297
809 3300033180 Ga0307510_10087868 Ga0307510_100878684 297
810 3300033180 Ga0307510_10095894 Ga0307510_100958942 297
811 3300033180 Ga0307510_10214108 Ga0307510_102141082 297
812 3300035111 Ga0373923_0051464 Ga0373923_0051464_625_1560 297
813 3300035113 Ga0373936_0000007 Ga0373936_0000007_283963_284883 297
814 3300035116 Ga0373945_0040008 Ga0373945_0040008_739_1674 297
815 3300035117 Ga0373953_0003327 Ga0373953_0003327_402_1337 297
816 3300035119 Ga0373956_0007335 Ga0373956_0007335_3251_4186 297
817 3300035170 Ga0373943_0048925 Ga0373943_0048925_614_1549 297
818 3300035172 Ga0373955_0039097 Ga0373955_0039097_1233_2168 297
819 3300035692 Ga0373935_0081080 Ga0373935_0081080_1061_1999 297
820 3300035724 Ga0373933_0004441 Ga0373933_0004441_4362_5297 297
821 3300037068 Ga0373925_0054821 Ga0373925_0054821_399_1334 297
822 3300037312 Ga0395899_0114460 Ga0395899_0114460_565_1464 297
823 3300037466 Ga0395898_0010903 Ga0395898_0010903_1087_1986 297
824 3300038443 Ga0395901_0095838 Ga0395901_0095838_1123_2022 297
825 3300041452 Ga0451793_1206373 Ga0451793_1206373_2150_3049 297
826 3300041491 Ga0451833_0389704 Ga0451833_0389704_141_1037 297
827 3300041512 Ga0451853_1826268 Ga0451853_1826268_196_1095 297
828 3300042012 Ga0439455_0050679 Ga0439455_0050679_70_1011 297
829 3300042127 Ga0450890_007314 Ga0450890_007314_63_971 297
830 3300042157 Ga0439458_0019362 Ga0439458_0019362_251_1147 297
831 3300042435 Ga0439434_0069043 Ga0439434_0069043_63_986 297
832 3300042876 Ga0451577_0003070 Ga0451577_0003070_3470_4375 297
833 3300044712 Ga0453684_0009366 Ga0453684_0009366_4468_5373 297
834 3300044712 Ga0453684_0030654 Ga0453684_0030654_3159_4064 297
835 3300045051 Ga0451576_0005545 Ga0451576_0005545_2767_3672 297
836 3300045051 Ga0451576_0320874 Ga0451576_0320874_259_1182 297
837 3300046454 Ga0495592_0000264 Ga0495592_0000264_8191_9102 297
838 3300046471 Ga0495650_0014118 Ga0495650_0014118_187_1083 297
839 3300046477 Ga0495664_0033908 Ga0495664_0033908_1013_1948 297
840 3300046512 Ga0495610_0036459 Ga0495610_0036459_1113_2027 297
841 3300046515 Ga0495620_0108920 Ga0495620_0108920_175_1086 297
842 3300046516 Ga0495628_0251197 Ga0495628_0251197_168_1079 297
843 3300046519 Ga0495632_0026840 Ga0495632_0026840_948_1844 297
844 3300046522 Ga0495643_0171179 Ga0495643_0171179_41_937 297
845 3300046543 Ga0495645_0019219 Ga0495645_0019219_1808_2743 297
846 3300046660 Ga0495625_0001726 Ga0495625_0001726_19050_19949 297
847 3300046660 Ga0495625_0009831 Ga0495625_0009831_2237_3133 297
848 3300046683 Ga0495658_0254206 Ga0495658_0254206_154_1062 297
849 3300046692 Ga0495671_0044283 Ga0495671_0044283_462_1367 297
850 3300046692 Ga0495671_0154019 Ga0495671_0154019_51_965 297
851 3300046694 Ga0495649_0015742 Ga0495649_0015742_2307_3203 297
852 3300046810 Ga0495660_0122438 Ga0495660_0122438_389_1285 297
853 3300047443 Ga0495687_000212 Ga0495687_000212_36776_37672 297
854 3300047673 Ga0495593_0022467 Ga0495593_0022467_1019_1930 297
855 3300048091 Ga0495626_0032592 Ga0495626_0032592_718_1614 297
856 3300048906 Ga0496103_0042225 Ga0496103_0042225_491_1393 297
857 3300048907 Ga0496104_0007078 Ga0496104_0007078_4498_5433 297
858 3300048908 Ga0496105_0001968 Ga0496105_0001968_12268_13203 297
859 3300048909 Ga0496106_0180640 Ga0496106_0180640_77_1012 297
860 3300048911 Ga0496108_0017714 Ga0496108_0017714_2548_3450 297
861 3300048912 Ga0496109_0000170 Ga0496109_0000170_49698_50609 297
862 3300048912 Ga0496109_0040742 Ga0496109_0040742_3074_4009 297
863 3300048915 Ga0496112_0000241 Ga0496112_0000241_14133_15068 297
864 3300048917 Ga0496114_0003680 Ga0496114_0003680_7107_8006 297
865 3300048917 Ga0496114_0156636 Ga0496114_0156636_313_1248 297
866 3300048918 Ga0496115_0079611 Ga0496115_0079611_1696_2631 297
867 3300048929 Ga0496126_0451417 Ga0496126_0451417_123_1022 297
868 3300050489 nmdc:mga03683_47022_c1 nmdc:mga03683_47022_c1_92_988 297
869 3300050492 nmdc:mga0yw44_260643_c1 nmdc:mga0yw44_260643_c1_233_1129 297
870 3300050493 nmdc:mga0k408_13359_c1 nmdc:mga0k408_13359_c1_1013_1909 297
871 3300050493 nmdc:mga0k408_186104_c1 nmdc:mga0k408_186104_c1_77_976 297
872 3300050493 nmdc:mga0k408_20709_c1 nmdc:mga0k408_20709_c1_1389_2285 297
873 3300050493 nmdc:mga0k408_237034_c1 nmdc:mga0k408_237034_c1_69_980 297
874 3300050493 nmdc:mga0k408_585_c1 nmdc:mga0k408_585_c1_8324_9235 297
875 3300050493 nmdc:mga0k408_97470_c1 nmdc:mga0k408_97470_c1_333_1229 297
876 3300050494 nmdc:mga06z11_14050_c1 nmdc:mga06z11_14050_c1_2250_3161 297
877 3300050494 nmdc:mga06z11_5847_c1 nmdc:mga06z11_5847_c1_1516_2412 297
878 3300050495 nmdc:mga04h51_23644_c1 nmdc:mga04h51_23644_c1_81_977 297
879 3300050496 nmdc:mga07m45_247_c1 nmdc:mga07m45_247_c1_16879_17775 297
880 3300050496 nmdc:mga07m45_41439_c1 nmdc:mga07m45_41439_c1_1429_2325 297
881 3300050496 nmdc:mga07m45_75668_c1 nmdc:mga07m45_75668_c1_379_1275 297
882 3300050496 nmdc:mga07m45_79961_c1 nmdc:mga07m45_79961_c1_381_1337 297
883 3300050507 nmdc:mga05p37_573265_c1 nmdc:mga05p37_573265_c1_115_1056 297
884 3300050507 nmdc:mga05p37_78140_c1 nmdc:mga05p37_78140_c1_1792_2733 297
885 3300050510 nmdc:mga06r32_17024_c1 nmdc:mga06r32_17024_c1_932_1843 297
886 3300050510 nmdc:mga06r32_7429_c1 nmdc:mga06r32_7429_c1_2099_2992 297
887 3300050511 nmdc:mga08y16_17893_c1 nmdc:mga08y16_17893_c1_772_1713 297
888 3300050516 nmdc:mga0sz30_51897_c1 nmdc:mga0sz30_51897_c1_216_1112 297
889 3300053088 Ga0500644_0008778 Ga0500644_0008778_593_1486 297
890 3300053088 Ga0500644_0015654 Ga0500644_0015654_1082_1996 297
891 3300053092 Ga0500583_0120754 Ga0500583_0120754_110_1021 297
892 3300053093 Ga0500651_0027117 Ga0500651_0027117_1144_2058 297
893 3300053117 Ga0500593_000435 Ga0500593_000435_2901_3812 297
894 3300053117 Ga0500593_000657 Ga0500593_000657_7573_8466 297
895 3300053118 Ga0500594_0018492 Ga0500594_0018492_571_1485 297
896 3300053129 Ga0500628_003280 Ga0500628_003280_1357_2250 297
897 3300053134 Ga0500658_0009390 Ga0500658_0009390_2687_3583 297
898 3300053136 Ga0500559_0000092 Ga0500559_0000092_41019_41933 297
899 3300053139 Ga0500568_0038601 Ga0500568_0038601_881_1777 297
900 3300053156 Ga0500622_0011299 Ga0500622_0011299_792_1706 297
901 3300053177 Ga0500636_0004915 Ga0500636_0004915_5316_6212 297
902 3300053730 Ga0500645_000474 Ga0500645_000474_12070_12963 297
903 3300053730 Ga0500645_019479 Ga0500645_019479_779_1672 297
904 3300055283 Ga0500661_004529 Ga0500661_004529_695_1591 297

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01261

AP_endonuc_2

Xylose isomerase-like TIM barrel

50

304

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
5hmq-assembly1.cif.gz_A xylose isomerase-like tim barrel/4-hydroxyphenylpyruvate dioxygenase fusion protein 0.9529 9 282
5hmq-assembly3.cif.gz_E xylose isomerase-like tim barrel/4-hydroxyphenylpyruvate dioxygenase fusion protein 0.9528 9 282
5hmq-assembly3.cif.gz_D xylose isomerase-like tim barrel/4-hydroxyphenylpyruvate dioxygenase fusion protein 0.9526 9 282
5hmq-assembly1.cif.gz_C xylose isomerase-like tim barrel/4-hydroxyphenylpyruvate dioxygenase fusion protein 0.9526 9 282
5hmq-assembly2.cif.gz_B xylose isomerase-like tim barrel/4-hydroxyphenylpyruvate dioxygenase fusion protein 0.9525 9 282
ID Description Score Start End Superfamily
1i60A00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.8644 11 284 3.20.20.150
2g0wB00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.8623 9 288 3.20.20.150
2q02C00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.8577 10 278 3.20.20.150
1i60A00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.8465 11 284 3.20.20.150
2q02C00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.8338 10 278 3.20.20.150
ID Description Score Start End GO Terms
AF-H0Q617-F1-model_v4 Putative 4-hydroxyphenylpyruvate dioxygenase 0.9828 8 286 GO:0051213
AF-A0A7V2XMM7-F1-model_v4 Sugar phosphate isomerase/epimerase 0.9825 5 205 GO:0016853
AF-A0A536Z2G5-F1-model_v4 Sugar phosphate isomerase/epimerase 0.98 8 243 GO:0016853
AF-A0A6J4PQ75-F1-model_v4 4-hydroxyphenylpyruvate dioxygenase (EC 1.13.11.27) 0.9779 7 115 GO:0003868
AF-B9Z2U2-F1-model_v4 Xylose isomerase domain protein TIM barrel 0.9771 9 285 GO:0016853

Feature Viewer

pLDDT pTM Quality
91.87 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map