F485266
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 904 | 378 | 886 | 299 |
Family's Representative Sequence
| Representative Sequence | 3300005328|Ga0070676_10002095|Ga0070676_100020958 |
| Length | 321 |
| Sequence | MAGRAPGRSQAGPHPLGGPTNVPGGRGAPIRISDFGMDTISLAGTLPQKLAAIEGAGFSQVMLMARDLVGHAEGIDDAVRVVKASGLRVTGFQVLRDFEGLSGHLHDYKIDVAKSMLEMCRAVGATVLLVCSSTSTHASGDPDALARDLRKLAMLALPLGIRIAYEGLSWGRHVNEFTTAWDIVCRADAPNLGIGIDSFHAFATKTALVDLDVLDPDKIFLVQLADFMWNEIPSVEERIATARHFRVFPGEGVHSEALAELVMRLDRLGYRGDYSFEVFNDDYQQMPLPVVAERARRSAVWLGEDVLHRSVPLPGRMRLRR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2511231002 | Polaromonas sp. CF318 | Isolate | Rhizosphere |
| 2 | 2547132374 | Acidovorax radicis N35 | Isolate | Unclassified |
| 3 | 2585428058 | Methylibium sp. CF468 | Isolate | Rhizosphere |
| 4 | 2585428062 | Methylibium sp. CF059 | Isolate | Rhizosphere |
| 5 | 2643221570 | Acidovorax sp. Root568 | Isolate | Unclassified |
| 6 | 2643221596 | Acidovorax sp. Root70 | Isolate | Unclassified |
| 7 | 2643221609 | Acidovorax sp. Root217 | Isolate | Unclassified |
| 8 | 2643221611 | Acidovorax sp. Root219 | Isolate | Unclassified |
| 9 | 2643221621 | Achromobacter sp. Root83 | Isolate | Unclassified |
| 10 | 2643221652 | Acidovorax sp. Root402 | Isolate | Unclassified |
| 11 | 2643221717 | Acidovorax sp. Root267 | Isolate | Unclassified |
| 12 | 2721755523 | Delftia sp. HK171 | Isolate | Unclassified |
| 13 | 2738543012 | Acidovorax sp. CF301 | Isolate | Unclassified |
| 14 | 2816332133 | Acidovorax radicis 2721A | Isolate | Unclassified |
| 15 | 2839138175 | Delftia acidovorans B15 | Isolate | Rhizosphere |
| 16 | 2881101125 | Ramlibacter rhizophilus CCTCC AB2015357 | Isolate | Rhizosphere |
| 17 | 2919704043 | Hydrogenophaga palleronii 4249 | Isolate | Unclassified |
| 18 | 2990710928 | Acidovorax delafieldii SLBN-75 | Isolate | Rhizosphere |
| 19 | 3300002704 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB | Metagenome | Unclassified |
| 20 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 21 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 22 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 23 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 24 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 25 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 26 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 27 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 28 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 29 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 30 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 31 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 32 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 33 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 34 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 35 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 36 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 37 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 38 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 39 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 40 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 41 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 42 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 44 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 45 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 48 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 50 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 51 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 53 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 54 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 62 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 65 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 66 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 69 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 74 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 75 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 76 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 77 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 78 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 79 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 80 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 81 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 82 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 83 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 84 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 85 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 86 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 87 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 88 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 89 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 90 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 91 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 92 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 93 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 94 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 95 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 96 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 97 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 98 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 99 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 100 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 101 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 102 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 103 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 104 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 105 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 106 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 107 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 108 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 109 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 110 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 111 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 112 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 113 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 114 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 115 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 116 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 118 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 119 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 120 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 121 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 122 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 123 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 125 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 126 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 128 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 129 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 131 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 132 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 133 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 134 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 135 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 136 | 3300012513 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 | Metagenome | Rhizosphere |
| 137 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 138 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 139 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 140 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 141 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 142 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 143 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 144 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 145 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 146 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 147 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 148 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 149 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 150 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 151 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 152 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 153 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 154 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 155 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 156 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 157 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 158 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 159 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 160 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 161 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 162 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 163 | 3300025290 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 165 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 166 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 167 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 168 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 169 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 170 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 171 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 172 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 173 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 174 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 232 | 3300027614 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 234 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 235 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 236 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 237 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 238 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 239 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 240 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 241 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 242 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 243 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 244 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 245 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 246 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 247 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 248 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 249 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 250 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 251 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 252 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 253 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 254 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 255 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 256 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 257 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 258 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 259 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 260 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 261 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 262 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 263 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 264 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 265 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 266 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 267 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 268 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 269 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 270 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 271 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 272 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 273 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 274 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 275 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 276 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 277 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 278 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 279 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 280 | 3300041463 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG | Metagenome | Rhizoplane |
| 281 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 282 | 3300041501 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG | Metagenome | Unclassified |
| 283 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 284 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 285 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 286 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 287 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 288 | 3300042115 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 | Metagenome | Rhizosphere |
| 289 | 3300042127 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 | Metagenome | Rhizosphere |
| 290 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 291 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 292 | 3300042185 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 | Metagenome | Rhizosphere |
| 293 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 294 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 295 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 296 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 297 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 298 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 299 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 324 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 325 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 326 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 327 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 328 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 329 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 330 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 331 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 332 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 333 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 334 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 335 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 336 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 337 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 338 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 339 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 341 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 342 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 343 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 344 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 345 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 346 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 347 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 348 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 349 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 350 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 351 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 352 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 353 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 354 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 355 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 356 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 357 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 358 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 359 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 360 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 361 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 362 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 363 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 364 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 365 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 366 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 367 | 3300053129 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere | Metagenome | Endosphere |
| 368 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 369 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 370 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 371 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 372 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 373 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 374 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 375 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 376 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 377 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 378 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.9 |
| Metatranscriptomes | 0.11 |
| Isolates | 1.99 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 13.61 |
| Nodule | 0.44 |
| Rhizoplane | 3.21 |
| Rhizosphere | 75 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 7.74 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25155J39150_1000090 | 3300002704 | Bacteria | 51836 |
| 2 | JGI25156J39149_1000148 | 3300002705 | Bacteria | 51890 |
| 3 | JGI25154J39366_1000155 | 3300002738 | Bacteria | 52889 |
| 4 | JGI25157J39369_1000183 | 3300002741 | Bacteria | 52889 |
| 5 | JGI25150J39212_1004158 | 3300002774 | Bacteria | 3262 |
| 6 | JGI25150J39212_1004356 | 3300002774 | Bacteria | 3160 |
| 7 | JGI25151J46595_10001873 | 3300003187 | Bacteria | 13428 |
| 8 | JGI25151J46595_10009246 | 3300003187 | Bacteria | 4682 |
| 9 | JGI25151J46595_10027293 | 3300003187 | Bacteria | 2291 |
| 10 | JGI25406J46586_10032068 | 3300003203 | Unclassified | 1957 |
| 11 | JGI25153J46596_10004275 | 3300003215 | Bacteria | 7724 |
| 12 | rootH2_10050795 | 3300003320 | Bacteria | 5449 |
| 13 | rootL2_10005678 | 3300003322 | Bacteria | 4807 |
| 14 | JGI25160J50197_1000059 | 3300003354 | Bacteria | 116962 |
| 15 | JGI25161J50226_1000008 | 3300003374 | Bacteria | 239245 |
| 16 | Ga0055537_1000245 | 3300003773 | Bacteria | 39851 |
| 17 | Ga0055537_1000249 | 3300003773 | Bacteria | 39449 |
| 18 | Ga0055524_1000057 | 3300003775 | Bacteria | 139566 |
| 19 | Ga0055536_1003494 | 3300003781 | Bacteria | 8425 |
| 20 | Ga0055528_1000888 | 3300003790 | Bacteria | 20186 |
| 21 | Ga0055530_10002076 | 3300003791 | Bacteria | 13433 |
| 22 | Ga0055540_1001554 | 3300003792 | Bacteria | 13439 |
| 23 | Ga0055531_10000281 | 3300003794 | Bacteria | 51971 |
| 24 | Ga0055531_10002433 | 3300003794 | Bacteria | 12465 |
| 25 | Ga0055531_10014357 | 3300003794 | Bacteria | 3570 |
| 26 | Ga0055543_1000138 | 3300004625 | Bacteria | 60628 |
| 27 | Ga0065165_1007150 | 3300005262 | Bacteria | 5586 |
| 28 | Ga0065712_10099630 | 3300005290 | Bacteria | 2086 |
| 29 | Ga0065715_10119990 | 3300005293 | Bacteria | 2271 |
| 30 | Ga0065715_10126678 | 3300005293 | Bacteria | 2103 |
| 31 | Ga0070676_10002095 | 3300005328 | Bacteria | 10149 |
| 32 | Ga0070676_10012793 | 3300005328 | Bacteria | 4591 |
| 33 | Ga0070676_10027724 | 3300005328 | Bacteria | 3214 |
| 34 | Ga0070676_10030285 | 3300005328 | Bacteria | 3085 |
| 35 | Ga0070683_100028689 | 3300005329 | Bacteria | 5031 |
| 36 | Ga0070683_100087454 | 3300005329 | Bacteria | 2923 |
| 37 | Ga0070690_100001452 | 3300005330 | Bacteria | 12372 |
| 38 | Ga0070690_100047352 | 3300005330 | Bacteria | 2735 |
| 39 | Ga0070670_100008053 | 3300005331 | Bacteria | 8967 |
| 40 | Ga0070670_100029077 | 3300005331 | Bacteria | 4755 |
| 41 | Ga0070670_100095055 | 3300005331 | Bacteria | 2563 |
| 42 | Ga0070677_10003466 | 3300005333 | Bacteria | 5088 |
| 43 | Ga0068869_100000481 | 3300005334 | Bacteria | 22080 |
| 44 | Ga0068869_100002513 | 3300005334 | Bacteria | 11067 |
| 45 | Ga0070666_10000745 | 3300005335 | Bacteria | 19736 |
| 46 | Ga0070666_10090255 | 3300005335 | Bacteria | 2104 |
| 47 | Ga0070666_10107516 | 3300005335 | Bacteria | 1927 |
| 48 | Ga0070666_10195358 | 3300005335 | Bacteria | 1423 |
| 49 | Ga0070680_100049561 | 3300005336 | Bacteria | 3424 |
| 50 | Ga0068868_100000971 | 3300005338 | Bacteria | 19511 |
| 51 | Ga0068868_100050030 | 3300005338 | Bacteria | 3281 |
| 52 | Ga0068868_100061098 | 3300005338 | Bacteria | 2985 |
| 53 | Ga0068868_100065210 | 3300005338 | Bacteria | 2893 |
| 54 | Ga0068868_100130065 | 3300005338 | Bacteria | 2059 |
| 55 | Ga0068868_100198559 | 3300005338 | Bacteria | 1671 |
| 56 | Ga0068868_100284614 | 3300005338 | Bacteria | 1400 |
| 57 | Ga0070660_100000483 | 3300005339 | Bacteria | 26582 |
| 58 | Ga0070660_100003597 | 3300005339 | Bacteria | 10701 |
| 59 | Ga0070660_100174322 | 3300005339 | Bacteria | 1738 |
| 60 | Ga0070689_100002088 | 3300005340 | Bacteria | 12972 |
| 61 | Ga0070689_100015294 | 3300005340 | Bacteria | 5592 |
| 62 | Ga0070689_100054672 | 3300005340 | Bacteria | 3091 |
| 63 | Ga0070689_100532457 | 3300005340 | Bacteria | 1010 |
| 64 | Ga0070687_100017491 | 3300005343 | Bacteria | 3298 |
| 65 | Ga0070687_100117256 | 3300005343 | Bacteria | 1517 |
| 66 | Ga0070661_100042363 | 3300005344 | Bacteria | 3322 |
| 67 | Ga0070661_100062174 | 3300005344 | Bacteria | 2741 |
| 68 | Ga0070661_100243376 | 3300005344 | Bacteria | 1386 |
| 69 | Ga0070668_100001533 | 3300005347 | Bacteria | 16665 |
| 70 | Ga0070668_100049482 | 3300005347 | Bacteria | 3233 |
| 71 | Ga0070668_100211549 | 3300005347 | Bacteria | 1595 |
| 72 | Ga0070669_100004947 | 3300005353 | Bacteria | 9626 |
| 73 | Ga0070675_100001174 | 3300005354 | Bacteria | 18990 |
| 74 | Ga0070675_100023744 | 3300005354 | Bacteria | 4906 |
| 75 | Ga0070675_100030891 | 3300005354 | Bacteria | 4327 |
| 76 | Ga0070675_100033406 | 3300005354 | Bacteria | 4171 |
| 77 | Ga0070675_100092616 | 3300005354 | Bacteria | 2534 |
| 78 | Ga0070675_100364154 | 3300005354 | Unclassified | 1284 |
| 79 | Ga0070671_100001053 | 3300005355 | Bacteria | 20340 |
| 80 | Ga0070671_100002310 | 3300005355 | Bacteria | 14715 |
| 81 | Ga0070671_100007296 | 3300005355 | Bacteria | 8829 |
| 82 | Ga0070671_100010290 | 3300005355 | Bacteria | 7504 |
| 83 | Ga0070671_100047279 | 3300005355 | Bacteria | 3579 |
| 84 | Ga0070671_100060980 | 3300005355 | Bacteria | 3141 |
| 85 | Ga0070671_100088195 | 3300005355 | Bacteria | 2596 |
| 86 | Ga0070671_100098636 | 3300005355 | Unclassified | 2451 |
| 87 | Ga0070671_100169992 | 3300005355 | Bacteria | 1843 |
| 88 | Ga0070671_100241336 | 3300005355 | Bacteria | 1534 |
| 89 | Ga0070674_100055090 | 3300005356 | Bacteria | 2752 |
| 90 | Ga0070674_100060111 | 3300005356 | Bacteria | 2648 |
| 91 | Ga0070674_100099699 | 3300005356 | Bacteria | 2114 |
| 92 | Ga0070674_100145916 | 3300005356 | Bacteria | 1781 |
| 93 | Ga0070674_100408572 | 3300005356 | Bacteria | 1111 |
| 94 | Ga0070673_100007976 | 3300005364 | Bacteria | 7016 |
| 95 | Ga0070673_100026546 | 3300005364 | Bacteria | 4279 |
| 96 | Ga0070673_100048464 | 3300005364 | Bacteria | 3312 |
| 97 | Ga0070673_100257003 | 3300005364 | Bacteria | 1525 |
| 98 | Ga0070688_100002954 | 3300005365 | Bacteria | 8666 |
| 99 | Ga0070688_100057346 | 3300005365 | Bacteria | 2448 |
| 100 | Ga0070688_100089848 | 3300005365 | Bacteria | 2005 |
| 101 | Ga0070659_100003296 | 3300005366 | Bacteria | 11497 |
| 102 | Ga0070659_100051700 | 3300005366 | Bacteria | 3231 |
| 103 | Ga0070667_100001469 | 3300005367 | Bacteria | 21118 |
| 104 | Ga0070667_100004231 | 3300005367 | Bacteria | 12120 |
| 105 | Ga0070667_100007604 | 3300005367 | Bacteria | 8987 |
| 106 | Ga0070667_100020817 | 3300005367 | Bacteria | 5448 |
| 107 | Ga0070667_100042389 | 3300005367 | Bacteria | 3819 |
| 108 | Ga0070667_100054892 | 3300005367 | Bacteria | 3364 |
| 109 | Ga0070667_100074494 | 3300005367 | Bacteria | 2896 |
| 110 | Ga0070709_10043398 | 3300005434 | Bacteria | 2780 |
| 111 | Ga0070701_10017069 | 3300005438 | Bacteria | 3388 |
| 112 | Ga0070711_100004626 | 3300005439 | Bacteria | 8146 |
| 113 | Ga0070711_100209686 | 3300005439 | Bacteria | 1508 |
| 114 | Ga0070705_100004377 | 3300005440 | Bacteria | 6877 |
| 115 | Ga0070694_100025464 | 3300005444 | Bacteria | 3827 |
| 116 | Ga0070708_100000792 | 3300005445 | Bacteria | 23848 |
| 117 | Ga0070663_100003912 | 3300005455 | Bacteria | 8683 |
| 118 | Ga0070663_100004009 | 3300005455 | Bacteria | 8589 |
| 119 | Ga0070663_100021054 | 3300005455 | Bacteria | 4330 |
| 120 | Ga0070663_100107551 | 3300005455 | Bacteria | 2091 |
| 121 | Ga0070663_100135412 | 3300005455 | Bacteria | 1875 |
| 122 | Ga0070663_100155362 | 3300005455 | Bacteria | 1757 |
| 123 | Ga0070663_100182684 | 3300005455 | Bacteria | 1628 |
| 124 | Ga0070663_100252222 | 3300005455 | Bacteria | 1397 |
| 125 | Ga0070678_100000242 | 3300005456 | Bacteria | 25045 |
| 126 | Ga0070678_100002830 | 3300005456 | Bacteria | 9597 |
| 127 | Ga0070678_100013194 | 3300005456 | Bacteria | 5170 |
| 128 | Ga0070662_100001177 | 3300005457 | Bacteria | 16048 |
| 129 | Ga0070662_100027749 | 3300005457 | Bacteria | 3934 |
| 130 | Ga0070662_100048655 | 3300005457 | Bacteria | 3055 |
| 131 | Ga0070662_100060606 | 3300005457 | Bacteria | 2760 |
| 132 | Ga0070662_100260566 | 3300005457 | Bacteria | 1397 |
| 133 | Ga0070662_100264038 | 3300005457 | Bacteria | 1388 |
| 134 | Ga0070681_10076070 | 3300005458 | Bacteria | 3316 |
| 135 | Ga0068867_100002983 | 3300005459 | Bacteria | 11932 |
| 136 | Ga0068867_100004082 | 3300005459 | Bacteria | 10270 |
| 137 | Ga0068867_100007271 | 3300005459 | Bacteria | 7832 |
| 138 | Ga0068867_100044893 | 3300005459 | Bacteria | 3239 |
| 139 | Ga0068867_100188620 | 3300005459 | Bacteria | 1644 |
| 140 | Ga0068867_100292737 | 3300005459 | Bacteria | 1339 |
| 141 | Ga0068867_100295992 | 3300005459 | Bacteria | 1332 |
| 142 | Ga0068867_100329731 | 3300005459 | Unclassified | 1267 |
| 143 | Ga0068867_100523140 | 3300005459 | Bacteria | 1023 |
| 144 | Ga0070685_10003675 | 3300005466 | Bacteria | 7777 |
| 145 | Ga0070685_10011495 | 3300005466 | Bacteria | 4634 |
| 146 | Ga0070685_10259974 | 3300005466 | Bacteria | 1154 |
| 147 | Ga0070706_100003222 | 3300005467 | Bacteria | 16122 |
| 148 | Ga0070706_100015189 | 3300005467 | Bacteria | 7110 |
| 149 | Ga0070706_100209206 | 3300005467 | Bacteria | 1822 |
| 150 | Ga0070707_100033981 | 3300005468 | Bacteria | 4864 |
| 151 | Ga0070707_100070778 | 3300005468 | Bacteria | 3360 |
| 152 | Ga0070707_100241402 | 3300005468 | Bacteria | 1758 |
| 153 | Ga0070699_100156957 | 3300005518 | Bacteria | 2013 |
| 154 | Ga0070679_100037311 | 3300005530 | Bacteria | 4826 |
| 155 | Ga0070697_100133293 | 3300005536 | Bacteria | 2085 |
| 156 | Ga0070697_100149793 | 3300005536 | Bacteria | 1966 |
| 157 | Ga0068853_100002005 | 3300005539 | Bacteria | 15041 |
| 158 | Ga0068853_100098480 | 3300005539 | Bacteria | 2582 |
| 159 | Ga0070672_100011595 | 3300005543 | Bacteria | 6150 |
| 160 | Ga0070672_100083034 | 3300005543 | Bacteria | 2571 |
| 161 | Ga0070672_100086923 | 3300005543 | Bacteria | 2515 |
| 162 | Ga0070672_100091803 | 3300005543 | Bacteria | 2450 |
| 163 | Ga0070686_100021664 | 3300005544 | Bacteria | 3825 |
| 164 | Ga0070696_100067690 | 3300005546 | Bacteria | 2506 |
| 165 | Ga0070696_100309732 | 3300005546 | Bacteria | 1212 |
| 166 | Ga0070693_100002585 | 3300005547 | Bacteria | 8333 |
| 167 | Ga0070693_100280213 | 3300005547 | Bacteria | 1116 |
| 168 | Ga0070665_100001402 | 3300005548 | Bacteria | 28337 |
| 169 | Ga0070665_100005336 | 3300005548 | Bacteria | 13281 |
| 170 | Ga0070665_100007136 | 3300005548 | Bacteria | 11361 |
| 171 | Ga0070665_100054460 | 3300005548 | Bacteria | 4012 |
| 172 | Ga0070665_100057649 | 3300005548 | Bacteria | 3893 |
| 173 | Ga0070665_100264556 | 3300005548 | Bacteria | 1721 |
| 174 | Ga0070704_100084074 | 3300005549 | Bacteria | 2352 |
| 175 | Ga0068855_100003898 | 3300005563 | Bacteria | 18217 |
| 176 | Ga0068855_100028758 | 3300005563 | Bacteria | 6650 |
| 177 | Ga0068855_100129567 | 3300005563 | Bacteria | 2882 |
| 178 | Ga0070664_100045893 | 3300005564 | Bacteria | 3690 |
| 179 | Ga0070664_100083739 | 3300005564 | Bacteria | 2752 |
| 180 | Ga0070664_100084232 | 3300005564 | Bacteria | 2744 |
| 181 | Ga0068857_100006391 | 3300005577 | Bacteria | 10098 |
| 182 | Ga0068857_100007102 | 3300005577 | Bacteria | 9645 |
| 183 | Ga0068857_100026898 | 3300005577 | Bacteria | 5072 |
| 184 | Ga0068854_100047229 | 3300005578 | Bacteria | 3068 |
| 185 | Ga0068854_100095261 | 3300005578 | Bacteria | 2222 |
| 186 | Ga0068854_100290222 | 3300005578 | Bacteria | 1320 |
| 187 | Ga0068856_100001796 | 3300005614 | Bacteria | 22411 |
| 188 | Ga0068856_100068424 | 3300005614 | Bacteria | 3510 |
| 189 | Ga0068856_100171183 | 3300005614 | Bacteria | 2184 |
| 190 | Ga0068856_100235728 | 3300005614 | Bacteria | 1845 |
| 191 | Ga0068856_100246726 | 3300005614 | Bacteria | 1801 |
| 192 | Ga0068856_100543997 | 3300005614 | Bacteria | 1182 |
| 193 | Ga0070702_100010808 | 3300005615 | Bacteria | 4514 |
| 194 | Ga0070702_100141728 | 3300005615 | Bacteria | 1532 |
| 195 | Ga0070702_100166995 | 3300005615 | Bacteria | 1428 |
| 196 | Ga0068852_100008965 | 3300005616 | Bacteria | 7404 |
| 197 | Ga0068852_100009773 | 3300005616 | Bacteria | 7131 |
| 198 | Ga0068852_100069113 | 3300005616 | Bacteria | 3094 |
| 199 | Ga0068852_100109419 | 3300005616 | Bacteria | 2509 |
| 200 | Ga0068852_100110416 | 3300005616 | Bacteria | 2499 |
| 201 | Ga0068859_100000893 | 3300005617 | Bacteria | 30367 |
| 202 | Ga0068859_100001169 | 3300005617 | Bacteria | 26837 |
| 203 | Ga0068859_100115911 | 3300005617 | Bacteria | 2744 |
| 204 | Ga0068859_100228435 | 3300005617 | Bacteria | 1949 |
| 205 | Ga0068859_100387167 | 3300005617 | Bacteria | 1494 |
| 206 | Ga0068859_100519202 | 3300005617 | Bacteria | 1286 |
| 207 | Ga0068859_100647164 | 3300005617 | Bacteria | 1149 |
| 208 | Ga0068864_100001446 | 3300005618 | Bacteria | 19579 |
| 209 | Ga0068864_100002752 | 3300005618 | Bacteria | 14500 |
| 210 | Ga0068864_100008932 | 3300005618 | Bacteria | 8261 |
| 211 | Ga0068864_100009929 | 3300005618 | Bacteria | 7852 |
| 212 | Ga0068864_100053879 | 3300005618 | Bacteria | 3471 |
| 213 | Ga0068864_100064654 | 3300005618 | Bacteria | 3173 |
| 214 | Ga0068864_100170353 | 3300005618 | Bacteria | 1985 |
| 215 | Ga0068866_10001177 | 3300005718 | Bacteria | 11439 |
| 216 | Ga0068866_10068112 | 3300005718 | Bacteria | 1870 |
| 217 | Ga0068861_100001611 | 3300005719 | Bacteria | 14383 |
| 218 | Ga0068861_100017505 | 3300005719 | Bacteria | 5091 |
| 219 | Ga0068861_100097514 | 3300005719 | Bacteria | 2332 |
| 220 | Ga0068861_100127825 | 3300005719 | Bacteria | 2059 |
| 221 | Ga0068851_10001091 | 3300005834 | Bacteria | 11776 |
| 222 | Ga0068851_10005660 | 3300005834 | Bacteria | 5678 |
| 223 | Ga0068851_10014288 | 3300005834 | Bacteria | 3769 |
| 224 | Ga0068851_10029960 | 3300005834 | Bacteria | 2697 |
| 225 | Ga0068851_10072861 | 3300005834 | Bacteria | 1780 |
| 226 | Ga0068870_10022611 | 3300005840 | Bacteria | 3091 |
| 227 | Ga0068870_10031568 | 3300005840 | Bacteria | 2685 |
| 228 | Ga0068870_10037573 | 3300005840 | Bacteria | 2497 |
| 229 | Ga0068870_10074828 | 3300005840 | Bacteria | 1856 |
| 230 | Ga0068863_100000521 | 3300005841 | Bacteria | 39214 |
| 231 | Ga0068863_100003595 | 3300005841 | Bacteria | 15301 |
| 232 | Ga0068863_100053013 | 3300005841 | Bacteria | 3844 |
| 233 | Ga0068863_100066801 | 3300005841 | Bacteria | 3401 |
| 234 | Ga0068863_100094420 | 3300005841 | Bacteria | 2839 |
| 235 | Ga0068863_100200108 | 3300005841 | Bacteria | 1921 |
| 236 | Ga0068858_100003010 | 3300005842 | Bacteria | 16901 |
| 237 | Ga0068858_100011160 | 3300005842 | Bacteria | 8493 |
| 238 | Ga0068858_100012873 | 3300005842 | Bacteria | 7889 |
| 239 | Ga0068858_100092887 | 3300005842 | Bacteria | 2809 |
| 240 | Ga0068858_100275734 | 3300005842 | Bacteria | 1601 |
| 241 | Ga0068860_100001084 | 3300005843 | Bacteria | 30014 |
| 242 | Ga0068860_100003063 | 3300005843 | Bacteria | 17272 |
| 243 | Ga0068860_100056774 | 3300005843 | Bacteria | 3721 |
| 244 | Ga0068860_100063066 | 3300005843 | Bacteria | 3521 |
| 245 | Ga0068860_100201500 | 3300005843 | Bacteria | 1929 |
| 246 | Ga0068860_100222797 | 3300005843 | Bacteria | 1832 |
| 247 | Ga0068862_100013035 | 3300005844 | Bacteria | 6877 |
| 248 | Ga0068862_100022088 | 3300005844 | Bacteria | 5323 |
| 249 | Ga0068862_100025057 | 3300005844 | Bacteria | 5007 |
| 250 | Ga0081539_10004545 | 3300005985 | Bacteria | 15212 |
| 251 | Ga0075365_10070468 | 3300006038 | Bacteria | 2351 |
| 252 | Ga0075365_10094818 | 3300006038 | Bacteria | 2037 |
| 253 | Ga0075363_100024927 | 3300006048 | Bacteria | 3045 |
| 254 | Ga0075363_100046047 | 3300006048 | Bacteria | 2313 |
| 255 | Ga0075363_100142151 | 3300006048 | Bacteria | 1352 |
| 256 | Ga0075364_10061998 | 3300006051 | Bacteria | 2454 |
| 257 | Ga0075432_10041461 | 3300006058 | Bacteria | 1608 |
| 258 | Ga0070715_10072640 | 3300006163 | Bacteria | 1540 |
| 259 | Ga0070716_100005733 | 3300006173 | Bacteria | 6032 |
| 260 | Ga0070716_100018789 | 3300006173 | Bacteria | 3605 |
| 261 | Ga0070712_100014560 | 3300006175 | Bacteria | 5048 |
| 262 | Ga0075362_10064159 | 3300006177 | Bacteria | 1666 |
| 263 | Ga0075362_10139001 | 3300006177 | Bacteria | 1160 |
| 264 | Ga0075367_10033023 | 3300006178 | Bacteria | 2981 |
| 265 | Ga0075367_10039603 | 3300006178 | Bacteria | 2748 |
| 266 | Ga0075367_10044599 | 3300006178 | Bacteria | 2600 |
| 267 | Ga0075367_10086488 | 3300006178 | Bacteria | 1903 |
| 268 | Ga0075366_10016722 | 3300006195 | Bacteria | 4217 |
| 269 | Ga0075366_10041574 | 3300006195 | Bacteria | 2722 |
| 270 | Ga0075366_10084996 | 3300006195 | Bacteria | 1892 |
| 271 | Ga0075366_10101706 | 3300006195 | Bacteria | 1725 |
| 272 | Ga0075366_10122499 | 3300006195 | Bacteria | 1567 |
| 273 | Ga0097621_100003129 | 3300006237 | Bacteria | 11355 |
| 274 | Ga0097621_100003977 | 3300006237 | Bacteria | 10240 |
| 275 | Ga0097621_100014273 | 3300006237 | Bacteria | 5941 |
| 276 | Ga0097621_100178593 | 3300006237 | Bacteria | 1833 |
| 277 | Ga0075370_10001742 | 3300006353 | Bacteria | 9690 |
| 278 | Ga0075370_10002345 | 3300006353 | Bacteria | 8754 |
| 279 | Ga0075370_10039044 | 3300006353 | Bacteria | 2674 |
| 280 | Ga0075370_10092239 | 3300006353 | Bacteria | 1748 |
| 281 | Ga0075370_10112178 | 3300006353 | Bacteria | 1584 |
| 282 | Ga0075370_10233958 | 3300006353 | Bacteria | 1087 |
| 283 | Ga0068871_100010510 | 3300006358 | Bacteria | 6761 |
| 284 | Ga0068871_100017564 | 3300006358 | Bacteria | 5417 |
| 285 | Ga0068871_100035783 | 3300006358 | Bacteria | 3948 |
| 286 | Ga0068871_100451079 | 3300006358 | Bacteria | 1153 |
| 287 | Ga0068871_100521336 | 3300006358 | Unclassified | 1073 |
| 288 | Ga0075430_100219669 | 3300006846 | Bacteria | 1577 |
| 289 | Ga0075433_10026406 | 3300006852 | Bacteria | 4917 |
| 290 | Ga0075433_10109382 | 3300006852 | Bacteria | 2452 |
| 291 | Ga0075434_100028620 | 3300006871 | Bacteria | 5477 |
| 292 | Ga0075434_100248463 | 3300006871 | Bacteria | 1798 |
| 293 | Ga0075434_100279067 | 3300006871 | Bacteria | 1690 |
| 294 | Ga0075434_100379205 | 3300006871 | Bacteria | 1435 |
| 295 | Ga0075436_100030838 | 3300006914 | Bacteria | 3690 |
| 296 | Ga0097620_100000893 | 3300006931 | Bacteria | 30367 |
| 297 | Ga0097620_100001169 | 3300006931 | Bacteria | 26837 |
| 298 | Ga0097620_100115908 | 3300006931 | Bacteria | 2744 |
| 299 | Ga0097620_100228431 | 3300006931 | Bacteria | 1949 |
| 300 | Ga0097620_100387193 | 3300006931 | Bacteria | 1494 |
| 301 | Ga0097620_100519138 | 3300006931 | Bacteria | 1286 |
| 302 | Ga0097620_100647183 | 3300006931 | Bacteria | 1149 |
| 303 | Ga0079104_1000007 | 3300006946 | Bacteria | 390531 |
| 304 | Ga0079104_1000352 | 3300006946 | Bacteria | 55479 |
| 305 | Ga0105240_10030931 | 3300009093 | Bacteria | 6952 |
| 306 | Ga0105240_10038834 | 3300009093 | Bacteria | 6103 |
| 307 | Ga0111539_10054115 | 3300009094 | Bacteria | 4776 |
| 308 | Ga0111539_10073152 | 3300009094 | Bacteria | 4041 |
| 309 | Ga0111539_10154655 | 3300009094 | Bacteria | 2684 |
| 310 | Ga0105245_10001644 | 3300009098 | Bacteria | 20337 |
| 311 | Ga0105245_10007857 | 3300009098 | Bacteria | 9331 |
| 312 | Ga0105245_10057243 | 3300009098 | Bacteria | 3506 |
| 313 | Ga0105245_10073690 | 3300009098 | Bacteria | 3105 |
| 314 | Ga0105245_10197285 | 3300009098 | Bacteria | 1931 |
| 315 | Ga0105245_10274845 | 3300009098 | Bacteria | 1644 |
| 316 | Ga0105245_10388259 | 3300009098 | Bacteria | 1392 |
| 317 | Ga0105245_10590041 | 3300009098 | Bacteria | 1136 |
| 318 | Ga0105247_10064396 | 3300009101 | Bacteria | 2277 |
| 319 | Ga0105247_10265757 | 3300009101 | Bacteria | 1178 |
| 320 | Ga0114129_10045036 | 3300009147 | Bacteria | 6203 |
| 321 | Ga0105243_10001888 | 3300009148 | Bacteria | 17864 |
| 322 | Ga0105243_10014110 | 3300009148 | Bacteria | 6044 |
| 323 | Ga0105241_10036396 | 3300009174 | Bacteria | 3704 |
| 324 | Ga0105242_10005801 | 3300009176 | Bacteria | 9512 |
| 325 | Ga0105242_10155557 | 3300009176 | Bacteria | 1997 |
| 326 | Ga0105248_10008045 | 3300009177 | Bacteria | 11575 |
| 327 | Ga0105248_10013123 | 3300009177 | Bacteria | 9124 |
| 328 | Ga0105248_10035492 | 3300009177 | Bacteria | 5577 |
| 329 | Ga0105248_10120513 | 3300009177 | Bacteria | 2960 |
| 330 | Ga0105248_10254616 | 3300009177 | Bacteria | 1976 |
| 331 | Ga0105237_10016342 | 3300009545 | Bacteria | 7713 |
| 332 | Ga0105237_10197052 | 3300009545 | Bacteria | 2014 |
| 333 | Ga0105239_10126723 | 3300010375 | Bacteria | 2838 |
| 334 | Ga0105239_10408675 | 3300010375 | Bacteria | 1537 |
| 335 | Ga0105239_10427391 | 3300010375 | Bacteria | 1501 |
| 336 | Ga0105239_10449407 | 3300010375 | Bacteria | 1462 |
| 337 | Ga0157326_1003869 | 3300012513 | Bacteria | 1572 |
| 338 | Ga0157373_10006303 | 3300013100 | Bacteria | 8864 |
| 339 | Ga0157371_10000194 | 3300013102 | Bacteria | 90011 |
| 340 | Ga0157370_10135048 | 3300013104 | Bacteria | 2300 |
| 341 | Ga0157370_10410735 | 3300013104 | Bacteria | 1246 |
| 342 | Ga0157369_10198831 | 3300013105 | Bacteria | 2104 |
| 343 | Ga0157374_10002838 | 3300013296 | Bacteria | 14535 |
| 344 | Ga0157374_10007074 | 3300013296 | Bacteria | 9553 |
| 345 | Ga0157378_10005473 | 3300013297 | Bacteria | 11126 |
| 346 | Ga0157378_10007861 | 3300013297 | Bacteria | 9306 |
| 347 | Ga0157378_10008585 | 3300013297 | Bacteria | 8891 |
| 348 | Ga0157378_10039249 | 3300013297 | Bacteria | 4199 |
| 349 | Ga0157378_10098132 | 3300013297 | Bacteria | 2671 |
| 350 | Ga0157378_10199095 | 3300013297 | Bacteria | 1894 |
| 351 | Ga0157378_10226200 | 3300013297 | Bacteria | 1780 |
| 352 | Ga0157378_10696991 | 3300013297 | Bacteria | 1035 |
| 353 | Ga0163162_10001908 | 3300013306 | Bacteria | 19644 |
| 354 | Ga0163162_10118849 | 3300013306 | Bacteria | 2745 |
| 355 | Ga0163162_10266096 | 3300013306 | Bacteria | 1846 |
| 356 | Ga0157372_10005627 | 3300013307 | Bacteria | 13324 |
| 357 | Ga0157372_10189961 | 3300013307 | Bacteria | 2379 |
| 358 | Ga0157375_10009281 | 3300013308 | Bacteria | 8632 |
| 359 | Ga0157375_10019566 | 3300013308 | Bacteria | 6162 |
| 360 | Ga0157375_10025955 | 3300013308 | Bacteria | 5454 |
| 361 | Ga0157375_10031086 | 3300013308 | Bacteria | 5041 |
| 362 | Ga0157375_10228948 | 3300013308 | Bacteria | 2018 |
| 363 | Ga0157375_10230351 | 3300013308 | Bacteria | 2012 |
| 364 | Ga0157375_10873426 | 3300013308 | Bacteria | 1045 |
| 365 | Ga0163163_10009939 | 3300014325 | Bacteria | 8532 |
| 366 | Ga0163163_10083758 | 3300014325 | Bacteria | 3194 |
| 367 | Ga0163163_10191833 | 3300014325 | Bacteria | 2092 |
| 368 | Ga0163163_10826337 | 3300014325 | Bacteria | 990 |
| 369 | Ga0157380_10003347 | 3300014326 | Bacteria | 10992 |
| 370 | Ga0157380_10076760 | 3300014326 | Bacteria | 2720 |
| 371 | Ga0157377_10000016 | 3300014745 | Bacteria | 190613 |
| 372 | Ga0157377_10003307 | 3300014745 | Bacteria | 7281 |
| 373 | Ga0157377_10164348 | 3300014745 | Bacteria | 1383 |
| 374 | Ga0157379_10001362 | 3300014968 | Bacteria | 20016 |
| 375 | Ga0157379_10002571 | 3300014968 | Bacteria | 15232 |
| 376 | Ga0157379_10024832 | 3300014968 | Bacteria | 5320 |
| 377 | Ga0157379_10121989 | 3300014968 | Bacteria | 2345 |
| 378 | Ga0157376_10001750 | 3300014969 | Bacteria | 14458 |
| 379 | Ga0157376_10100763 | 3300014969 | Bacteria | 2523 |
| 380 | Ga0157376_10148985 | 3300014969 | Bacteria | 2108 |
| 381 | Ga0157376_10334746 | 3300014969 | Bacteria | 1443 |
| 382 | Ga0157376_10457661 | 3300014969 | Bacteria | 1246 |
| 383 | Ga0157376_10603769 | 3300014969 | Bacteria | 1092 |
| 384 | Ga0206356_10249116 | 3300020070 | Bacteria | 1874 |
| 385 | Ga0209435_100014 | 3300025206 | Bacteria | 322129 |
| 386 | Ga0209436_103628 | 3300025208 | Bacteria | 4030 |
| 387 | Ga0207427_101622 | 3300025231 | Bacteria | 7628 |
| 388 | Ga0207425_1001097 | 3300025245 | Bacteria | 12286 |
| 389 | Ga0207425_1003608 | 3300025245 | Bacteria | 4891 |
| 390 | Ga0209646_1000001 | 3300025246 | Bacteria | 3092932 |
| 391 | Ga0209026_1000137 | 3300025250 | Bacteria | 116282 |
| 392 | Ga0209759_1000013 | 3300025256 | Bacteria | 399300 |
| 393 | Ga0209129_1006508 | 3300025258 | Bacteria | 3751 |
| 394 | Ga0209129_1009153 | 3300025258 | Bacteria | 2650 |
| 395 | Ga0209565_1000028 | 3300025263 | Bacteria | 348536 |
| 396 | Ga0209565_1001085 | 3300025263 | Bacteria | 13573 |
| 397 | Ga0209673_1000035 | 3300025273 | Bacteria | 328411 |
| 398 | Ga0209130_1000052 | 3300025284 | Bacteria | 216971 |
| 399 | Ga0209130_1002799 | 3300025284 | Bacteria | 8143 |
| 400 | Ga0209130_1032622 | 3300025284 | Bacteria | 1060 |
| 401 | Ga0207673_1010436 | 3300025290 | Bacteria | 1196 |
| 402 | Ga0209675_1000313 | 3300025291 | Bacteria | 43444 |
| 403 | Ga0209675_1001685 | 3300025291 | Bacteria | 12264 |
| 404 | Ga0209675_1004248 | 3300025291 | Bacteria | 6454 |
| 405 | Ga0209676_1000634 | 3300025292 | Bacteria | 50573 |
| 406 | Ga0209676_1001748 | 3300025292 | Bacteria | 18540 |
| 407 | Ga0209025_1004750 | 3300025294 | Bacteria | 11550 |
| 408 | Ga0209025_1005213 | 3300025294 | Bacteria | 10723 |
| 409 | Ga0209025_1006139 | 3300025294 | Bacteria | 9466 |
| 410 | Ga0209564_1003759 | 3300025295 | Bacteria | 9912 |
| 411 | Ga0209564_1010465 | 3300025295 | Bacteria | 4267 |
| 412 | Ga0209564_1026419 | 3300025295 | Bacteria | 1918 |
| 413 | Ga0209758_1000122 | 3300025297 | Bacteria | 190970 |
| 414 | Ga0209758_1020430 | 3300025297 | Bacteria | 3133 |
| 415 | Ga0209050_1000023 | 3300025298 | Bacteria | 537172 |
| 416 | Ga0209050_1000677 | 3300025298 | Bacteria | 51357 |
| 417 | Ga0209256_1000003 | 3300025299 | Bacteria | 1661127 |
| 418 | Ga0209256_1000011 | 3300025299 | Bacteria | 865309 |
| 419 | Ga0207426_1000306 | 3300025302 | Bacteria | 96112 |
| 420 | Ga0209051_1000016 | 3300025303 | Bacteria | 541891 |
| 421 | Ga0209051_1000017 | 3300025303 | Bacteria | 537172 |
| 422 | Ga0209051_1000172 | 3300025303 | Bacteria | 117180 |
| 423 | Ga0209257_1000015 | 3300025304 | Bacteria | 908141 |
| 424 | Ga0209257_1000041 | 3300025304 | Bacteria | 537172 |
| 425 | Ga0209257_1000102 | 3300025304 | Bacteria | 251074 |
| 426 | Ga0209257_1000108 | 3300025304 | Bacteria | 240229 |
| 427 | Ga0209257_1006401 | 3300025304 | Bacteria | 7604 |
| 428 | Ga0207697_10000368 | 3300025315 | Bacteria | 25220 |
| 429 | Ga0207697_10014744 | 3300025315 | Bacteria | 3237 |
| 430 | Ga0207697_10121560 | 3300025315 | Bacteria | 1124 |
| 431 | Ga0207656_10002724 | 3300025321 | Bacteria | 5997 |
| 432 | Ga0207656_10040278 | 3300025321 | Bacteria | 1980 |
| 433 | Ga0207656_10093521 | 3300025321 | Bacteria | 1368 |
| 434 | Ga0207682_10000076 | 3300025893 | Bacteria | 43305 |
| 435 | Ga0207682_10021526 | 3300025893 | Bacteria | 2537 |
| 436 | Ga0207692_10147758 | 3300025898 | Bacteria | 1343 |
| 437 | Ga0207642_10002217 | 3300025899 | Bacteria | 6027 |
| 438 | Ga0207642_10118025 | 3300025899 | Bacteria | 1363 |
| 439 | Ga0207688_10001459 | 3300025901 | Bacteria | 12388 |
| 440 | Ga0207680_10000783 | 3300025903 | Bacteria | 15039 |
| 441 | Ga0207680_10044358 | 3300025903 | Bacteria | 2614 |
| 442 | Ga0207680_10074303 | 3300025903 | Bacteria | 2116 |
| 443 | Ga0207685_10036827 | 3300025905 | Bacteria | 1797 |
| 444 | Ga0207645_10001729 | 3300025907 | Bacteria | 17698 |
| 445 | Ga0207645_10002521 | 3300025907 | Bacteria | 14336 |
| 446 | Ga0207645_10004022 | 3300025907 | Bacteria | 10958 |
| 447 | Ga0207645_10043798 | 3300025907 | Bacteria | 2864 |
| 448 | Ga0207645_10046267 | 3300025907 | Bacteria | 2779 |
| 449 | Ga0207643_10002053 | 3300025908 | Bacteria | 11102 |
| 450 | Ga0207643_10005231 | 3300025908 | Bacteria | 6940 |
| 451 | Ga0207643_10018090 | 3300025908 | Bacteria | 3861 |
| 452 | Ga0207705_10029442 | 3300025909 | Bacteria | 3915 |
| 453 | Ga0207684_10002424 | 3300025910 | Bacteria | 18808 |
| 454 | Ga0207684_10046559 | 3300025910 | Bacteria | 3679 |
| 455 | Ga0207684_10249722 | 3300025910 | Bacteria | 1531 |
| 456 | Ga0207654_10058311 | 3300025911 | Bacteria | 2247 |
| 457 | Ga0207695_10029322 | 3300025913 | Bacteria | 6083 |
| 458 | Ga0207695_10107478 | 3300025913 | Bacteria | 2775 |
| 459 | Ga0207695_10170355 | 3300025913 | Bacteria | 2103 |
| 460 | Ga0207671_10014637 | 3300025914 | Bacteria | 6189 |
| 461 | Ga0207671_10061758 | 3300025914 | Bacteria | 2781 |
| 462 | Ga0207693_10001071 | 3300025915 | Bacteria | 24521 |
| 463 | Ga0207663_10096972 | 3300025916 | Bacteria | 1971 |
| 464 | Ga0207663_10273302 | 3300025916 | Bacteria | 1252 |
| 465 | Ga0207662_10005162 | 3300025918 | Bacteria | 6927 |
| 466 | Ga0207662_10051405 | 3300025918 | Bacteria | 2452 |
| 467 | Ga0207657_10003940 | 3300025919 | Bacteria | 15763 |
| 468 | Ga0207657_10005946 | 3300025919 | Bacteria | 12701 |
| 469 | Ga0207657_10032680 | 3300025919 | Bacteria | 4698 |
| 470 | Ga0207649_10361872 | 3300025920 | Bacteria | 1077 |
| 471 | Ga0207646_10014290 | 3300025922 | Bacteria | 7548 |
| 472 | Ga0207646_10047710 | 3300025922 | Bacteria | 3841 |
| 473 | Ga0207681_10008779 | 3300025923 | Bacteria | 6175 |
| 474 | Ga0207650_10003315 | 3300025925 | Bacteria | 11087 |
| 475 | Ga0207650_10008631 | 3300025925 | Bacteria | 6958 |
| 476 | Ga0207650_10024159 | 3300025925 | Bacteria | 4318 |
| 477 | Ga0207650_10032706 | 3300025925 | Bacteria | 3763 |
| 478 | Ga0207650_10069448 | 3300025925 | Bacteria | 2647 |
| 479 | Ga0207659_10004952 | 3300025926 | Bacteria | 8077 |
| 480 | Ga0207659_10008305 | 3300025926 | Bacteria | 6438 |
| 481 | Ga0207659_10010070 | 3300025926 | Bacteria | 5924 |
| 482 | Ga0207659_10029037 | 3300025926 | Bacteria | 3764 |
| 483 | Ga0207659_10054439 | 3300025926 | Bacteria | 2858 |
| 484 | Ga0207687_10000226 | 3300025927 | Bacteria | 38452 |
| 485 | Ga0207687_10003096 | 3300025927 | Bacteria | 11280 |
| 486 | Ga0207687_10020926 | 3300025927 | Bacteria | 4342 |
| 487 | Ga0207687_10042968 | 3300025927 | Bacteria | 3113 |
| 488 | Ga0207700_10029862 | 3300025928 | Bacteria | 3852 |
| 489 | Ga0207700_10044625 | 3300025928 | Bacteria | 3265 |
| 490 | Ga0207664_10009233 | 3300025929 | Bacteria | 6910 |
| 491 | Ga0207644_10001985 | 3300025931 | Bacteria | 13227 |
| 492 | Ga0207644_10006696 | 3300025931 | Bacteria | 7504 |
| 493 | Ga0207644_10007852 | 3300025931 | Bacteria | 6970 |
| 494 | Ga0207644_10012418 | 3300025931 | Bacteria | 5656 |
| 495 | Ga0207644_10044136 | 3300025931 | Bacteria | 3166 |
| 496 | Ga0207644_10057302 | 3300025931 | Bacteria | 2813 |
| 497 | Ga0207644_10058835 | 3300025931 | Bacteria | 2778 |
| 498 | Ga0207690_10006609 | 3300025932 | Bacteria | 6868 |
| 499 | Ga0207690_10051206 | 3300025932 | Bacteria | 2760 |
| 500 | Ga0207706_10000002 | 3300025933 | Bacteria | 360309 |
| 501 | Ga0207706_10001944 | 3300025933 | Bacteria | 20292 |
| 502 | Ga0207706_10002383 | 3300025933 | Bacteria | 18353 |
| 503 | Ga0207706_10093004 | 3300025933 | Bacteria | 2652 |
| 504 | Ga0207706_10109511 | 3300025933 | Bacteria | 2431 |
| 505 | Ga0207686_10003018 | 3300025934 | Bacteria | 9072 |
| 506 | Ga0207686_10178492 | 3300025934 | Bacteria | 1504 |
| 507 | Ga0207709_10000172 | 3300025935 | Bacteria | 86654 |
| 508 | Ga0207670_10028754 | 3300025936 | Bacteria | 3534 |
| 509 | Ga0207670_10076474 | 3300025936 | Bacteria | 2329 |
| 510 | Ga0207669_10037976 | 3300025937 | Bacteria | 2768 |
| 511 | Ga0207669_10083381 | 3300025937 | Bacteria | 2055 |
| 512 | Ga0207669_10146205 | 3300025937 | Bacteria | 1649 |
| 513 | Ga0207665_10060503 | 3300025939 | Bacteria | 2565 |
| 514 | Ga0207665_10084669 | 3300025939 | Bacteria | 2188 |
| 515 | Ga0207691_10001090 | 3300025940 | Bacteria | 26989 |
| 516 | Ga0207691_10036775 | 3300025940 | Bacteria | 4536 |
| 517 | Ga0207691_10038608 | 3300025940 | Bacteria | 4419 |
| 518 | Ga0207691_10062634 | 3300025940 | Bacteria | 3374 |
| 519 | Ga0207691_10075440 | 3300025940 | Bacteria | 3040 |
| 520 | Ga0207691_10102436 | 3300025940 | Bacteria | 2554 |
| 521 | Ga0207711_10000654 | 3300025941 | Bacteria | 34558 |
| 522 | Ga0207711_10008005 | 3300025941 | Bacteria | 8841 |
| 523 | Ga0207711_10019605 | 3300025941 | Bacteria | 5630 |
| 524 | Ga0207711_10028333 | 3300025941 | Bacteria | 4713 |
| 525 | Ga0207711_10261104 | 3300025941 | Bacteria | 1592 |
| 526 | Ga0207711_10310079 | 3300025941 | Bacteria | 1457 |
| 527 | Ga0207689_10001081 | 3300025942 | Bacteria | 26272 |
| 528 | Ga0207689_10002547 | 3300025942 | Bacteria | 16920 |
| 529 | Ga0207689_10041723 | 3300025942 | Bacteria | 3796 |
| 530 | Ga0207689_10159846 | 3300025942 | Bacteria | 1856 |
| 531 | Ga0207679_10034512 | 3300025945 | Bacteria | 3570 |
| 532 | Ga0207679_10172459 | 3300025945 | Bacteria | 1782 |
| 533 | Ga0207679_10182538 | 3300025945 | Bacteria | 1737 |
| 534 | Ga0207667_10002797 | 3300025949 | Bacteria | 21604 |
| 535 | Ga0207667_10037728 | 3300025949 | Bacteria | 5165 |
| 536 | Ga0207667_10314196 | 3300025949 | Bacteria | 1600 |
| 537 | Ga0207651_10003398 | 3300025960 | Bacteria | 7818 |
| 538 | Ga0207651_10007695 | 3300025960 | Bacteria | 5757 |
| 539 | Ga0207651_10035662 | 3300025960 | Bacteria | 3238 |
| 540 | Ga0207668_10002950 | 3300025972 | Bacteria | 9968 |
| 541 | Ga0207668_10023608 | 3300025972 | Bacteria | 3956 |
| 542 | Ga0207668_10034452 | 3300025972 | Bacteria | 3363 |
| 543 | Ga0207668_10143555 | 3300025972 | Bacteria | 1839 |
| 544 | Ga0207668_10215067 | 3300025972 | Bacteria | 1539 |
| 545 | Ga0207668_10334024 | 3300025972 | Bacteria | 1262 |
| 546 | Ga0207640_10022186 | 3300025981 | Bacteria | 3795 |
| 547 | Ga0207640_10044617 | 3300025981 | Bacteria | 2842 |
| 548 | Ga0207640_10130392 | 3300025981 | Bacteria | 1816 |
| 549 | Ga0207640_10361999 | 3300025981 | Bacteria | 1169 |
| 550 | Ga0207658_10003823 | 3300025986 | Bacteria | 10604 |
| 551 | Ga0207658_10010563 | 3300025986 | Bacteria | 6273 |
| 552 | Ga0207658_10020000 | 3300025986 | Bacteria | 4633 |
| 553 | Ga0207658_10022771 | 3300025986 | Bacteria | 4364 |
| 554 | Ga0207658_10046890 | 3300025986 | Bacteria | 3159 |
| 555 | Ga0207658_10058879 | 3300025986 | Bacteria | 2861 |
| 556 | Ga0207658_10079113 | 3300025986 | Bacteria | 2514 |
| 557 | Ga0207658_10198489 | 3300025986 | Bacteria | 1673 |
| 558 | Ga0207677_10000162 | 3300026023 | Bacteria | 53309 |
| 559 | Ga0207677_10009582 | 3300026023 | Bacteria | 5451 |
| 560 | Ga0207677_10020074 | 3300026023 | Bacteria | 4049 |
| 561 | Ga0207677_10064404 | 3300026023 | Bacteria | 2553 |
| 562 | Ga0207677_10078566 | 3300026023 | Bacteria | 2357 |
| 563 | Ga0207677_10178645 | 3300026023 | Bacteria | 1667 |
| 564 | Ga0207677_10234493 | 3300026023 | Bacteria | 1480 |
| 565 | Ga0207703_10001919 | 3300026035 | Bacteria | 18425 |
| 566 | Ga0207703_10006661 | 3300026035 | Bacteria | 9215 |
| 567 | Ga0207703_10040095 | 3300026035 | Bacteria | 3746 |
| 568 | Ga0207703_10076203 | 3300026035 | Bacteria | 2781 |
| 569 | Ga0207703_10079646 | 3300026035 | Bacteria | 2726 |
| 570 | Ga0207639_10005219 | 3300026041 | Bacteria | 8763 |
| 571 | Ga0207639_10505094 | 3300026041 | Bacteria | 1105 |
| 572 | Ga0207678_10000931 | 3300026067 | Bacteria | 26668 |
| 573 | Ga0207678_10011127 | 3300026067 | Bacteria | 7905 |
| 574 | Ga0207678_10032495 | 3300026067 | Bacteria | 4548 |
| 575 | Ga0207678_10058265 | 3300026067 | Bacteria | 3323 |
| 576 | Ga0207678_10107131 | 3300026067 | Bacteria | 2384 |
| 577 | Ga0207678_10174340 | 3300026067 | Bacteria | 1836 |
| 578 | Ga0207678_10339064 | 3300026067 | Bacteria | 1295 |
| 579 | Ga0207708_10000418 | 3300026075 | Bacteria | 33340 |
| 580 | Ga0207702_10006364 | 3300026078 | Bacteria | 10193 |
| 581 | Ga0207702_10113781 | 3300026078 | Bacteria | 2411 |
| 582 | Ga0207702_10134741 | 3300026078 | Bacteria | 2227 |
| 583 | Ga0207702_10406848 | 3300026078 | Bacteria | 1313 |
| 584 | Ga0207641_10001702 | 3300026088 | Bacteria | 21403 |
| 585 | Ga0207641_10014054 | 3300026088 | Bacteria | 6563 |
| 586 | Ga0207641_10025865 | 3300026088 | Bacteria | 4840 |
| 587 | Ga0207641_10060777 | 3300026088 | Bacteria | 3221 |
| 588 | Ga0207641_10118653 | 3300026088 | Bacteria | 2357 |
| 589 | Ga0207648_10000343 | 3300026089 | Bacteria | 51081 |
| 590 | Ga0207648_10002633 | 3300026089 | Bacteria | 19203 |
| 591 | Ga0207648_10003584 | 3300026089 | Bacteria | 16250 |
| 592 | Ga0207648_10013048 | 3300026089 | Bacteria | 7748 |
| 593 | Ga0207648_10014979 | 3300026089 | Bacteria | 7142 |
| 594 | Ga0207648_10035446 | 3300026089 | Bacteria | 4396 |
| 595 | Ga0207648_10050801 | 3300026089 | Bacteria | 3625 |
| 596 | Ga0207648_10105122 | 3300026089 | Bacteria | 2476 |
| 597 | Ga0207648_10111508 | 3300026089 | Bacteria | 2401 |
| 598 | Ga0207676_10000451 | 3300026095 | Bacteria | 34663 |
| 599 | Ga0207676_10003663 | 3300026095 | Bacteria | 10865 |
| 600 | Ga0207676_10008358 | 3300026095 | Bacteria | 7359 |
| 601 | Ga0207676_10039402 | 3300026095 | Bacteria | 3614 |
| 602 | Ga0207676_10187942 | 3300026095 | Bacteria | 1815 |
| 603 | Ga0207676_10243898 | 3300026095 | Bacteria | 1613 |
| 604 | Ga0207674_10003102 | 3300026116 | Bacteria | 20519 |
| 605 | Ga0207674_10005989 | 3300026116 | Bacteria | 14387 |
| 606 | Ga0207674_10018325 | 3300026116 | Bacteria | 7612 |
| 607 | Ga0207674_10019808 | 3300026116 | Bacteria | 7281 |
| 608 | Ga0207674_10026307 | 3300026116 | Bacteria | 6184 |
| 609 | Ga0207674_10154073 | 3300026116 | Bacteria | 2254 |
| 610 | Ga0207675_100003236 | 3300026118 | Bacteria | 15974 |
| 611 | Ga0207675_100009614 | 3300026118 | Bacteria | 9046 |
| 612 | Ga0207675_100165675 | 3300026118 | Bacteria | 2110 |
| 613 | Ga0207675_100254085 | 3300026118 | Bacteria | 1702 |
| 614 | Ga0207683_10000119 | 3300026121 | Bacteria | 64489 |
| 615 | Ga0207683_10000694 | 3300026121 | Bacteria | 30870 |
| 616 | Ga0207683_10004550 | 3300026121 | Bacteria | 11952 |
| 617 | Ga0207683_10022179 | 3300026121 | Bacteria | 5450 |
| 618 | Ga0207683_10085353 | 3300026121 | Bacteria | 2806 |
| 619 | Ga0207683_10213973 | 3300026121 | Bacteria | 1755 |
| 620 | Ga0207698_10032712 | 3300026142 | Bacteria | 3771 |
| 621 | Ga0207698_10126519 | 3300026142 | Bacteria | 2174 |
| 622 | Ga0207698_10177901 | 3300026142 | Bacteria | 1881 |
| 623 | Ga0207698_10268979 | 3300026142 | Bacteria | 1570 |
| 624 | Ga0209281_1000020 | 3300027111 | Bacteria | 575972 |
| 625 | Ga0209281_1000454 | 3300027111 | Bacteria | 58234 |
| 626 | Ga0209970_1001012 | 3300027614 | Bacteria | 4991 |
| 627 | Ga0209983_1002922 | 3300027665 | Bacteria | 3693 |
| 628 | Ga0209813_10005461 | 3300027866 | Bacteria | 3086 |
| 629 | Ga0209974_10006322 | 3300027876 | Bacteria | 4141 |
| 630 | Ga0207428_10003085 | 3300027907 | Bacteria | 16401 |
| 631 | Ga0207428_10221717 | 3300027907 | Bacteria | 1417 |
| 632 | Ga0268266_10004181 | 3300028379 | Bacteria | 13910 |
| 633 | Ga0268266_10053676 | 3300028379 | Bacteria | 3463 |
| 634 | Ga0268266_10102857 | 3300028379 | Bacteria | 2520 |
| 635 | Ga0268266_10147323 | 3300028379 | Bacteria | 2118 |
| 636 | Ga0268266_10207087 | 3300028379 | Bacteria | 1797 |
| 637 | Ga0268265_10006699 | 3300028380 | Bacteria | 7798 |
| 638 | Ga0268265_10117454 | 3300028380 | Bacteria | 2185 |
| 639 | Ga0268264_10001000 | 3300028381 | Bacteria | 28759 |
| 640 | Ga0268264_10002760 | 3300028381 | Bacteria | 15322 |
| 641 | Ga0268264_10012398 | 3300028381 | Bacteria | 7017 |
| 642 | Ga0268264_10041400 | 3300028381 | Bacteria | 3811 |
| 643 | Ga0268264_10092667 | 3300028381 | Bacteria | 2608 |
| 644 | Ga0268264_10145641 | 3300028381 | Bacteria | 2118 |
| 645 | Ga0307517_10000358 | 3300028786 | Bacteria | 78437 |
| 646 | Ga0307517_10098884 | 3300028786 | Bacteria | 2318 |
| 647 | Ga0307515_10000459 | 3300028794 | Bacteria | 97482 |
| 648 | Ga0307515_10003649 | 3300028794 | Bacteria | 32350 |
| 649 | Ga0307515_10003668 | 3300028794 | Bacteria | 32257 |
| 650 | Ga0307515_10009465 | 3300028794 | Bacteria | 18830 |
| 651 | Ga0307515_10010929 | 3300028794 | Bacteria | 17310 |
| 652 | Ga0307515_10086833 | 3300028794 | Bacteria | 3981 |
| 653 | Ga0307515_10211556 | 3300028794 | Bacteria | 1782 |
| 654 | Ga0307515_10248604 | 3300028794 | Bacteria | 1535 |
| 655 | Ga0307515_10282968 | 3300028794 | Bacteria | 1363 |
| 656 | Ga0307512_10031625 | 3300030522 | Bacteria | 4578 |
| 657 | Ga0307512_10055700 | 3300030522 | Bacteria | 3115 |
| 658 | Ga0307513_10000006 | 3300031456 | Bacteria | 470848 |
| 659 | Ga0307513_10005054 | 3300031456 | Bacteria | 17463 |
| 660 | Ga0307513_10007938 | 3300031456 | Bacteria | 13654 |
| 661 | Ga0307513_10009552 | 3300031456 | Bacteria | 12262 |
| 662 | Ga0307513_10025822 | 3300031456 | Bacteria | 6793 |
| 663 | Ga0307513_10269225 | 3300031456 | Bacteria | 1488 |
| 664 | Ga0307509_10001694 | 3300031507 | Bacteria | 36817 |
| 665 | Ga0307509_10005213 | 3300031507 | Bacteria | 18216 |
| 666 | Ga0307509_10017599 | 3300031507 | Bacteria | 8218 |
| 667 | Ga0307509_10052291 | 3300031507 | Bacteria | 4361 |
| 668 | Ga0307509_10059437 | 3300031507 | Bacteria | 4045 |
| 669 | Ga0307408_100000008 | 3300031548 | Bacteria | 456355 |
| 670 | Ga0307408_100021375 | 3300031548 | Bacteria | 4379 |
| 671 | Ga0307408_100086284 | 3300031548 | Bacteria | 2359 |
| 672 | Ga0307508_10000466 | 3300031616 | Bacteria | 48802 |
| 673 | Ga0307508_10007101 | 3300031616 | Bacteria | 10443 |
| 674 | Ga0307508_10137663 | 3300031616 | Bacteria | 2045 |
| 675 | Ga0307508_10192859 | 3300031616 | Bacteria | 1638 |
| 676 | Ga0307508_10192873 | 3300031616 | Bacteria | 1638 |
| 677 | Ga0307514_10000979 | 3300031649 | Bacteria | 42521 |
| 678 | Ga0307514_10004420 | 3300031649 | Bacteria | 12940 |
| 679 | Ga0307516_10000705 | 3300031730 | Bacteria | 45448 |
| 680 | Ga0307516_10018606 | 3300031730 | Bacteria | 7215 |
| 681 | Ga0307516_10035658 | 3300031730 | Bacteria | 4987 |
| 682 | Ga0307516_10044796 | 3300031730 | Bacteria | 4374 |
| 683 | Ga0307516_10211964 | 3300031730 | Bacteria | 1651 |
| 684 | Ga0307405_10013240 | 3300031731 | Bacteria | 4396 |
| 685 | Ga0307413_10005108 | 3300031824 | Bacteria | 5808 |
| 686 | Ga0307410_10098792 | 3300031852 | Bacteria | 2088 |
| 687 | Ga0307406_10000278 | 3300031901 | Bacteria | 30154 |
| 688 | Ga0307412_10004381 | 3300031911 | Bacteria | 7870 |
| 689 | Ga0307412_10175630 | 3300031911 | Bacteria | 1606 |
| 690 | Ga0307412_10205096 | 3300031911 | Bacteria | 1500 |
| 691 | Ga0307409_100010785 | 3300031995 | Bacteria | 5711 |
| 692 | Ga0307416_100077955 | 3300032002 | Bacteria | 2786 |
| 693 | Ga0307414_10106044 | 3300032004 | Bacteria | 2126 |
| 694 | Ga0307411_10217607 | 3300032005 | Bacteria | 1479 |
| 695 | Ga0307510_10087868 | 3300033180 | Bacteria | 2971 |
| 696 | Ga0307510_10095894 | 3300033180 | Bacteria | 2784 |
| 697 | Ga0307510_10127901 | 3300033180 | Bacteria | 2224 |
| 698 | Ga0307510_10214108 | 3300033180 | Bacteria | 1446 |
| 699 | Ga0373928_0061555 | 3300035084 | Bacteria | 909 |
| 700 | Ga0373923_0051464 | 3300035111 | Bacteria | 1728 |
| 701 | Ga0373932_0026942 | 3300035112 | Bacteria | 1568 |
| 702 | Ga0373936_0000007 | 3300035113 | Bacteria | 290641 |
| 703 | Ga0373945_0040008 | 3300035116 | Bacteria | 1691 |
| 704 | Ga0373953_0003327 | 3300035117 | Bacteria | 4988 |
| 705 | Ga0373956_0007335 | 3300035119 | Bacteria | 4438 |
| 706 | Ga0373943_0048925 | 3300035170 | Bacteria | 2073 |
| 707 | Ga0373955_0039097 | 3300035172 | Bacteria | 2530 |
| 708 | Ga0373955_0298393 | 3300035172 | Bacteria | 971 |
| 709 | Ga0373931_0048807 | 3300035691 | Bacteria | 2245 |
| 710 | Ga0373935_0081080 | 3300035692 | Bacteria | 2109 |
| 711 | Ga0373933_0004441 | 3300035724 | Bacteria | 7697 |
| 712 | Ga0373947_0099653 | 3300035725 | Bacteria | 1824 |
| 713 | Ga0373937_0114854 | 3300036401 | Bacteria | 2506 |
| 714 | Ga0373937_0429242 | 3300036401 | Bacteria | 1254 |
| 715 | Ga0373925_0054821 | 3300037068 | Bacteria | 2982 |
| 716 | Ga0373925_0058365 | 3300037068 | Bacteria | 2894 |
| 717 | Ga0395899_0006012 | 3300037312 | Bacteria | 9421 |
| 718 | Ga0395899_0013757 | 3300037312 | Bacteria | 6185 |
| 719 | Ga0395899_0114460 | 3300037312 | Bacteria | 1937 |
| 720 | Ga0395898_0010903 | 3300037466 | Bacteria | 9484 |
| 721 | Ga0395898_0025013 | 3300037466 | Bacteria | 6019 |
| 722 | Ga0395898_0116213 | 3300037466 | Bacteria | 2563 |
| 723 | Ga0395898_0164667 | 3300037466 | Bacteria | 2121 |
| 724 | Ga0395898_0678282 | 3300037466 | Bacteria | 973 |
| 725 | Ga0395901_0095838 | 3300038443 | Bacteria | 3109 |
| 726 | Ga0451789_0569119 | 3300041443 | Bacteria | 1428 |
| 727 | Ga0451791_0914965 | 3300041451 | Bacteria | 1745 |
| 728 | Ga0451793_0421724 | 3300041452 | Bacteria | 3400 |
| 729 | Ga0451793_1206373 | 3300041452 | Bacteria | 3345 |
| 730 | Ga0451804_0432193 | 3300041463 | Bacteria | 1399 |
| 731 | Ga0451833_0389704 | 3300041491 | Bacteria | 1695 |
| 732 | Ga0451845_0315213 | 3300041501 | Bacteria | 855 |
| 733 | Ga0451853_0867049 | 3300041512 | Bacteria | 2116 |
| 734 | Ga0451853_1826268 | 3300041512 | Bacteria | 1213 |
| 735 | Ga0439445_0009866 | 3300042004 | Bacteria | 2254 |
| 736 | Ga0439449_0000091 | 3300042007 | Bacteria | 29348 |
| 737 | Ga0439449_0000986 | 3300042007 | Bacteria | 11193 |
| 738 | Ga0439449_0093197 | 3300042007 | Bacteria | 1112 |
| 739 | Ga0439455_0050679 | 3300042012 | Bacteria | 1084 |
| 740 | Ga0439462_0001526 | 3300042015 | Bacteria | 5182 |
| 741 | Ga0450911_000074 | 3300042115 | Bacteria | 41259 |
| 742 | Ga0450890_007314 | 3300042127 | Bacteria | 1410 |
| 743 | Ga0439446_0074829 | 3300042156 | Bacteria | 1041 |
| 744 | Ga0439458_0019362 | 3300042157 | Bacteria | 1566 |
| 745 | Ga0450909_012373 | 3300042185 | Bacteria | 1251 |
| 746 | Ga0439434_0069043 | 3300042435 | Bacteria | 1111 |
| 747 | Ga0439435_0055421 | 3300042436 | Bacteria | 1144 |
| 748 | Ga0451577_0000235 | 3300042876 | Bacteria | 109693 |
| 749 | Ga0451577_0003070 | 3300042876 | Bacteria | 18890 |
| 750 | Ga0453683_0006609 | 3300044673 | Bacteria | 7942 |
| 751 | Ga0453684_0000906 | 3300044712 | Bacteria | 98768 |
| 752 | Ga0453684_0009366 | 3300044712 | Bacteria | 17157 |
| 753 | Ga0453684_0030654 | 3300044712 | Bacteria | 7589 |
| 754 | Ga0451576_0005545 | 3300045051 | Bacteria | 15763 |
| 755 | Ga0451576_0008805 | 3300045051 | Bacteria | 11796 |
| 756 | Ga0451576_0025630 | 3300045051 | Bacteria | 6352 |
| 757 | Ga0451576_0038996 | 3300045051 | Bacteria | 5028 |
| 758 | Ga0451576_0320874 | 3300045051 | Bacteria | 1621 |
| 759 | Ga0495592_0000264 | 3300046454 | Bacteria | 44823 |
| 760 | Ga0495638_0060680 | 3300046460 | Bacteria | 2338 |
| 761 | Ga0495650_0009317 | 3300046471 | Bacteria | 5596 |
| 762 | Ga0495650_0014118 | 3300046471 | Bacteria | 4178 |
| 763 | Ga0495580_0135423 | 3300046472 | Bacteria | 1708 |
| 764 | Ga0495580_0264576 | 3300046472 | Bacteria | 1176 |
| 765 | Ga0495664_0033908 | 3300046477 | Bacteria | 3001 |
| 766 | Ga0495610_0036459 | 3300046512 | Bacteria | 2513 |
| 767 | Ga0495620_0108920 | 3300046515 | Bacteria | 1099 |
| 768 | Ga0495628_0251197 | 3300046516 | Bacteria | 1320 |
| 769 | Ga0495630_0379112 | 3300046517 | Bacteria | 1083 |
| 770 | Ga0495631_0119637 | 3300046518 | Bacteria | 1133 |
| 771 | Ga0495632_0002891 | 3300046519 | Bacteria | 12629 |
| 772 | Ga0495632_0026840 | 3300046519 | Bacteria | 3024 |
| 773 | Ga0495643_0083966 | 3300046522 | Bacteria | 1653 |
| 774 | Ga0495643_0171179 | 3300046522 | Bacteria | 1062 |
| 775 | Ga0495654_0002750 | 3300046530 | Bacteria | 11091 |
| 776 | Ga0495586_0119883 | 3300046535 | Bacteria | 1469 |
| 777 | Ga0495645_0019219 | 3300046543 | Bacteria | 4919 |
| 778 | Ga0495625_0001726 | 3300046660 | Bacteria | 25344 |
| 779 | Ga0495625_0009831 | 3300046660 | Bacteria | 7960 |
| 780 | Ga0495658_0254206 | 3300046683 | Bacteria | 1105 |
| 781 | Ga0495658_0265769 | 3300046683 | Bacteria | 1080 |
| 782 | Ga0495671_0044283 | 3300046692 | Bacteria | 2232 |
| 783 | Ga0495671_0154019 | 3300046692 | Bacteria | 1119 |
| 784 | Ga0495649_0015742 | 3300046694 | Bacteria | 4299 |
| 785 | Ga0495660_0122438 | 3300046810 | Bacteria | 1314 |
| 786 | Ga0495636_0107356 | 3300047318 | Bacteria | 1226 |
| 787 | Ga0495687_000212 | 3300047443 | Bacteria | 83406 |
| 788 | Ga0495593_0022467 | 3300047673 | Bacteria | 3514 |
| 789 | Ga0495626_0032592 | 3300048091 | Bacteria | 2501 |
| 790 | Ga0496101_0084219 | 3300048904 | Bacteria | 2354 |
| 791 | Ga0496102_0003078 | 3300048905 | Bacteria | 14125 |
| 792 | Ga0496102_0005035 | 3300048905 | Bacteria | 11191 |
| 793 | Ga0496102_0038160 | 3300048905 | Bacteria | 4334 |
| 794 | Ga0496102_0064277 | 3300048905 | Bacteria | 3361 |
| 795 | Ga0496103_0042225 | 3300048906 | Bacteria | 2805 |
| 796 | Ga0496103_0097636 | 3300048906 | Bacteria | 1857 |
| 797 | Ga0496104_0007078 | 3300048907 | Bacteria | 9893 |
| 798 | Ga0496105_0001968 | 3300048908 | Bacteria | 14776 |
| 799 | Ga0496105_0004944 | 3300048908 | Bacteria | 10079 |
| 800 | Ga0496106_0002588 | 3300048909 | Bacteria | 13468 |
| 801 | Ga0496106_0044949 | 3300048909 | Bacteria | 3316 |
| 802 | Ga0496106_0180640 | 3300048909 | Bacteria | 1675 |
| 803 | Ga0496107_0041577 | 3300048910 | Bacteria | 3301 |
| 804 | Ga0496108_0017714 | 3300048911 | Bacteria | 5826 |
| 805 | Ga0496108_0023581 | 3300048911 | Bacteria | 5064 |
| 806 | Ga0496108_0106038 | 3300048911 | Bacteria | 2400 |
| 807 | Ga0496109_0000170 | 3300048912 | Bacteria | 64299 |
| 808 | Ga0496109_0040742 | 3300048912 | Bacteria | 4207 |
| 809 | Ga0496110_0044760 | 3300048913 | Bacteria | 3866 |
| 810 | Ga0496112_0000241 | 3300048915 | Bacteria | 35206 |
| 811 | Ga0496114_0003680 | 3300048917 | Bacteria | 11790 |
| 812 | Ga0496114_0156636 | 3300048917 | Bacteria | 1978 |
| 813 | Ga0496115_0079611 | 3300048918 | Bacteria | 2667 |
| 814 | Ga0496121_0003833 | 3300048924 | Bacteria | 20921 |
| 815 | Ga0496125_0017574 | 3300048928 | Bacteria | 6813 |
| 816 | Ga0496126_0095970 | 3300048929 | Bacteria | 2600 |
| 817 | Ga0496126_0451417 | 3300048929 | Bacteria | 1035 |
| 818 | Ga0495678_002401 | 3300049459 | Bacteria | 12781 |
| 819 | Ga0501032_0092896 | 3300049569 | Bacteria | 2001 |
| 820 | Ga0501043_0000052 | 3300049579 | Bacteria | 106686 |
| 821 | Ga0501043_0000072 | 3300049579 | Bacteria | 89021 |
| 822 | Ga0501046_0000112 | 3300049580 | Bacteria | 86313 |
| 823 | Ga0501046_0000327 | 3300049580 | Bacteria | 47741 |
| 824 | Ga0501047_0000137 | 3300049581 | Bacteria | 89064 |
| 825 | Ga0501047_0000138 | 3300049581 | Bacteria | 89028 |
| 826 | Ga0501048_0000371 | 3300049582 | Bacteria | 31127 |
| 827 | Ga0501048_0001533 | 3300049582 | Bacteria | 17526 |
| 828 | Ga0501044_0321267 | 3300049823 | Bacteria | 1472 |
| 829 | Ga0501045_0001514 | 3300049824 | Bacteria | 15451 |
| 830 | Ga0501045_0005067 | 3300049824 | Bacteria | 9122 |
| 831 | nmdc:mga03683_47022_c1 | 3300050489 | Bacteria | 1790 |
| 832 | nmdc:mga0yw44_177401_c1 | 3300050492 | Bacteria | 1401 |
| 833 | nmdc:mga0yw44_260643_c1 | 3300050492 | Bacteria | 1155 |
| 834 | nmdc:mga0yw44_36874_c1 | 3300050492 | Bacteria | 2884 |
| 835 | nmdc:mga0k408_13359_c1 | 3300050493 | Bacteria | 4502 |
| 836 | nmdc:mga0k408_186104_c1 | 3300050493 | Bacteria | 1239 |
| 837 | nmdc:mga0k408_20709_c1 | 3300050493 | Bacteria | 3689 |
| 838 | nmdc:mga0k408_237034_c1 | 3300050493 | Bacteria | 1089 |
| 839 | nmdc:mga0k408_585_c1 | 3300050493 | Bacteria | 20193 |
| 840 | nmdc:mga0k408_97470_c1 | 3300050493 | Bacteria | 1732 |
| 841 | nmdc:mga06z11_14050_c1 | 3300050494 | Bacteria | 3534 |
| 842 | nmdc:mga06z11_5847_c1 | 3300050494 | Bacteria | 4965 |
| 843 | nmdc:mga04h51_23644_c1 | 3300050495 | Bacteria | 1873 |
| 844 | nmdc:mga07m45_247_c1 | 3300050496 | Bacteria | 21997 |
| 845 | nmdc:mga07m45_41439_c1 | 3300050496 | Bacteria | 2579 |
| 846 | nmdc:mga07m45_75668_c1 | 3300050496 | Bacteria | 1919 |
| 847 | nmdc:mga07m45_79961_c1 | 3300050496 | Bacteria | 1866 |
| 848 | nmdc:mga05p37_573265_c1 | 3300050507 | Unclassified | 1280 |
| 849 | nmdc:mga05p37_78140_c1 | 3300050507 | Bacteria | 4075 |
| 850 | nmdc:mga06r32_17024_c1 | 3300050510 | Bacteria | 6633 |
| 851 | nmdc:mga06r32_7429_c1 | 3300050510 | Bacteria | 9860 |
| 852 | nmdc:mga08y16_120385_c1 | 3300050511 | Bacteria | 2731 |
| 853 | nmdc:mga08y16_135364_c1 | 3300050511 | Bacteria | 2561 |
| 854 | nmdc:mga08y16_17893_c1 | 3300050511 | Bacteria | 7466 |
| 855 | nmdc:mga0n895_140431_c1 | 3300050512 | Bacteria | 2444 |
| 856 | nmdc:mga0n895_76114_c1 | 3300050512 | Bacteria | 3337 |
| 857 | nmdc:mga0n895_85305_c1 | 3300050512 | Bacteria | 3152 |
| 858 | nmdc:mga0rr50_261508_c1 | 3300050513 | Bacteria | 1440 |
| 859 | nmdc:mga08x19_15991_c1 | 3300050514 | Bacteria | 4571 |
| 860 | nmdc:mga0a205_214160_c1 | 3300050515 | Bacteria | 1814 |
| 861 | nmdc:mga0a205_8967_c1 | 3300050515 | Bacteria | 9117 |
| 862 | nmdc:mga0sz30_51897_c1 | 3300050516 | Bacteria | 1741 |
| 863 | Ga0500644_0008778 | 3300053088 | Bacteria | 2678 |
| 864 | Ga0500644_0015654 | 3300053088 | Bacteria | 2168 |
| 865 | Ga0500644_0091187 | 3300053088 | Bacteria | 1141 |
| 866 | Ga0500646_0001709 | 3300053090 | Bacteria | 5790 |
| 867 | Ga0500583_0120754 | 3300053092 | Bacteria | 1296 |
| 868 | Ga0500651_0027117 | 3300053093 | Bacteria | 3601 |
| 869 | Ga0500593_000435 | 3300053117 | Bacteria | 16452 |
| 870 | Ga0500593_000657 | 3300053117 | Bacteria | 13168 |
| 871 | Ga0500594_0018492 | 3300053118 | Bacteria | 1717 |
| 872 | Ga0500628_003280 | 3300053129 | Bacteria | 2665 |
| 873 | Ga0500652_001537 | 3300053131 | Bacteria | 7060 |
| 874 | Ga0500655_006099 | 3300053133 | Bacteria | 2172 |
| 875 | Ga0500658_0009390 | 3300053134 | Bacteria | 3608 |
| 876 | Ga0500559_0000092 | 3300053136 | Bacteria | 71917 |
| 877 | Ga0500568_0038601 | 3300053139 | Bacteria | 1932 |
| 878 | Ga0500604_0005487 | 3300053151 | Bacteria | 3348 |
| 879 | Ga0500622_0001110 | 3300053156 | Bacteria | 22450 |
| 880 | Ga0500622_0011299 | 3300053156 | Bacteria | 4870 |
| 881 | Ga0500636_0004915 | 3300053177 | Bacteria | 7592 |
| 882 | Ga0500645_000474 | 3300053730 | Bacteria | 27453 |
| 883 | Ga0500645_002165 | 3300053730 | Bacteria | 8997 |
| 884 | Ga0500645_019479 | 3300053730 | Bacteria | 2110 |
| 885 | Ga0500661_004529 | 3300055283 | Bacteria | 2598 |
| 886 | Ga0590075_020359 | 3300059424 | Bacteria | 1651 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300035112 | Ga0373932_0026942 | Ga0373932_0026942_20_817 | 260 |
| 2 | 3300036401 | Ga0373937_0429242 | Ga0373937_0429242_452_1243 | 260 |
| 3 | 3300037466 | Ga0395898_0678282 | Ga0395898_0678282_13_798 | 260 |
| 4 | 3300041501 | Ga0451845_0315213 | Ga0451845_0315213_59_841 | 260 |
| 5 | 3300046472 | Ga0495580_0135423 | Ga0495580_0135423_36_818 | 260 |
| 6 | 3300046522 | Ga0495643_0083966 | Ga0495643_0083966_828_1613 | 260 |
| 7 | 3300046683 | Ga0495658_0265769 | Ga0495658_0265769_263_1060 | 260 |
| 8 | 3300048911 | Ga0496108_0106038 | Ga0496108_0106038_36_830 | 260 |
| 9 | 3300031456 | Ga0307513_10269225 | Ga0307513_102692252 | 268 |
| 10 | 3300042185 | Ga0450909_012373 | Ga0450909_012373_410_1234 | 269 |
| 11 | 3300025290 | Ga0207673_1010436 | Ga0207673_10104362 | 271 |
| 12 | 3300048911 | Ga0496108_0023581 | Ga0496108_0023581_3501_4400 | 271 |
| 13 | 3300005333 | Ga0070677_10003466 | Ga0070677_100034662 | 273 |
| 14 | 3300005338 | Ga0068868_100061098 | Ga0068868_1000610983 | 273 |
| 15 | 3300005347 | Ga0070668_100001533 | Ga0070668_1000015336 | 273 |
| 16 | 3300005354 | Ga0070675_100001174 | Ga0070675_10000117411 | 273 |
| 17 | 3300005355 | Ga0070671_100010290 | Ga0070671_1000102906 | 273 |
| 18 | 3300005355 | Ga0070671_100047279 | Ga0070671_1000472793 | 273 |
| 19 | 3300005356 | Ga0070674_100060111 | Ga0070674_1000601112 | 273 |
| 20 | 3300005364 | Ga0070673_100048464 | Ga0070673_1000484643 | 273 |
| 21 | 3300005367 | Ga0070667_100007604 | Ga0070667_1000076049 | 273 |
| 22 | 3300005367 | Ga0070667_100042389 | Ga0070667_1000423893 | 273 |
| 23 | 3300005455 | Ga0070663_100003912 | Ga0070663_1000039122 | 273 |
| 24 | 3300005456 | Ga0070678_100000242 | Ga0070678_10000024210 | 273 |
| 25 | 3300005459 | Ga0068867_100188620 | Ga0068867_1001886202 | 273 |
| 26 | 3300005543 | Ga0070672_100086923 | Ga0070672_1000869232 | 273 |
| 27 | 3300005548 | Ga0070665_100005336 | Ga0070665_1000053364 | 273 |
| 28 | 3300005578 | Ga0068854_100290222 | Ga0068854_1002902222 | 273 |
| 29 | 3300005614 | Ga0068856_100068424 | Ga0068856_1000684242 | 273 |
| 30 | 3300005615 | Ga0070702_100141728 | Ga0070702_1001417282 | 273 |
| 31 | 3300005617 | Ga0068859_100387167 | Ga0068859_1003871672 | 273 |
| 32 | 3300005618 | Ga0068864_100008932 | Ga0068864_1000089328 | 273 |
| 33 | 3300005719 | Ga0068861_100127825 | Ga0068861_1001278252 | 273 |
| 34 | 3300005834 | Ga0068851_10029960 | Ga0068851_100299602 | 273 |
| 35 | 3300005840 | Ga0068870_10031568 | Ga0068870_100315682 | 273 |
| 36 | 3300005841 | Ga0068863_100053013 | Ga0068863_1000530133 | 273 |
| 37 | 3300005842 | Ga0068858_100011160 | Ga0068858_1000111608 | 273 |
| 38 | 3300005842 | Ga0068858_100092887 | Ga0068858_1000928872 | 273 |
| 39 | 3300005843 | Ga0068860_100063066 | Ga0068860_1000630662 | 273 |
| 40 | 3300006237 | Ga0097621_100003129 | Ga0097621_10000312911 | 273 |
| 41 | 3300006358 | Ga0068871_100010510 | Ga0068871_1000105102 | 273 |
| 42 | 3300006871 | Ga0075434_100379205 | Ga0075434_1003792052 | 273 |
| 43 | 3300006931 | Ga0097620_100387193 | Ga0097620_1003871932 | 273 |
| 44 | 3300009177 | Ga0105248_10254616 | Ga0105248_102546162 | 273 |
| 45 | 3300013297 | Ga0157378_10008585 | Ga0157378_100085854 | 273 |
| 46 | 3300013297 | Ga0157378_10098132 | Ga0157378_100981323 | 273 |
| 47 | 3300013308 | Ga0157375_10009281 | Ga0157375_100092816 | 273 |
| 48 | 3300013308 | Ga0157375_10873426 | Ga0157375_108734261 | 273 |
| 49 | 3300014325 | Ga0163163_10191833 | Ga0163163_101918332 | 273 |
| 50 | 3300014968 | Ga0157379_10024832 | Ga0157379_100248324 | 273 |
| 51 | 3300014969 | Ga0157376_10457661 | Ga0157376_104576612 | 273 |
| 52 | 3300025315 | Ga0207697_10014744 | Ga0207697_100147442 | 273 |
| 53 | 3300025321 | Ga0207656_10002724 | Ga0207656_100027242 | 273 |
| 54 | 3300025893 | Ga0207682_10021526 | Ga0207682_100215263 | 273 |
| 55 | 3300025907 | Ga0207645_10004022 | Ga0207645_1000402210 | 273 |
| 56 | 3300025908 | Ga0207643_10005231 | Ga0207643_100052312 | 273 |
| 57 | 3300025926 | Ga0207659_10010070 | Ga0207659_100100702 | 273 |
| 58 | 3300025931 | Ga0207644_10006696 | Ga0207644_100066962 | 273 |
| 59 | 3300025931 | Ga0207644_10057302 | Ga0207644_100573023 | 273 |
| 60 | 3300025937 | Ga0207669_10037976 | Ga0207669_100379762 | 273 |
| 61 | 3300025940 | Ga0207691_10001090 | Ga0207691_1000109018 | 273 |
| 62 | 3300025941 | Ga0207711_10261104 | Ga0207711_102611042 | 273 |
| 63 | 3300025941 | Ga0207711_10310079 | Ga0207711_103100792 | 273 |
| 64 | 3300025945 | Ga0207679_10172459 | Ga0207679_101724592 | 273 |
| 65 | 3300025960 | Ga0207651_10003398 | Ga0207651_100033987 | 273 |
| 66 | 3300025972 | Ga0207668_10334024 | Ga0207668_103340242 | 273 |
| 67 | 3300025981 | Ga0207640_10361999 | Ga0207640_103619992 | 273 |
| 68 | 3300025986 | Ga0207658_10003823 | Ga0207658_100038239 | 273 |
| 69 | 3300025986 | Ga0207658_10046890 | Ga0207658_100468902 | 273 |
| 70 | 3300026035 | Ga0207703_10076203 | Ga0207703_100762032 | 273 |
| 71 | 3300026035 | Ga0207703_10079646 | Ga0207703_100796461 | 273 |
| 72 | 3300026067 | Ga0207678_10011127 | Ga0207678_100111275 | 273 |
| 73 | 3300026078 | Ga0207702_10113781 | Ga0207702_101137812 | 273 |
| 74 | 3300026088 | Ga0207641_10060777 | Ga0207641_100607773 | 273 |
| 75 | 3300026089 | Ga0207648_10013048 | Ga0207648_100130488 | 273 |
| 76 | 3300026095 | Ga0207676_10008358 | Ga0207676_100083582 | 273 |
| 77 | 3300026118 | Ga0207675_100165675 | Ga0207675_1001656752 | 273 |
| 78 | 3300026121 | Ga0207683_10000119 | Ga0207683_1000011955 | 273 |
| 79 | 3300026142 | Ga0207698_10126519 | Ga0207698_101265193 | 273 |
| 80 | 3300028379 | Ga0268266_10004181 | Ga0268266_100041815 | 273 |
| 81 | 3300028381 | Ga0268264_10145641 | Ga0268264_101456412 | 273 |
| 82 | 3300035084 | Ga0373928_0061555 | Ga0373928_0061555_42_881 | 273 |
| 83 | 3300035691 | Ga0373931_0048807 | Ga0373931_0048807_286_1125 | 273 |
| 84 | 3300050512 | nmdc:mga0n895_85305_c1 | nmdc:mga0n895_85305_c1_1118_1960 | 273 |
| 85 | 3300005445 | Ga0070708_100000792 | Ga0070708_10000079212 | 274 |
| 86 | 3300005467 | Ga0070706_100209206 | Ga0070706_1002092062 | 274 |
| 87 | 3300025910 | Ga0207684_10249722 | Ga0207684_102497222 | 274 |
| 88 | 3300005335 | Ga0070666_10090255 | Ga0070666_100902551 | 275 |
| 89 | 3300005338 | Ga0068868_100284614 | Ga0068868_1002846142 | 275 |
| 90 | 3300005354 | Ga0070675_100364154 | Ga0070675_1003641541 | 275 |
| 91 | 3300005356 | Ga0070674_100145916 | Ga0070674_1001459162 | 275 |
| 92 | 3300005456 | Ga0070678_100013194 | Ga0070678_1000131943 | 275 |
| 93 | 3300005459 | Ga0068867_100329731 | Ga0068867_1003297312 | 275 |
| 94 | 3300005467 | Ga0070706_100015189 | Ga0070706_1000151897 | 275 |
| 95 | 3300005468 | Ga0070707_100241402 | Ga0070707_1002414022 | 275 |
| 96 | 3300005518 | Ga0070699_100156957 | Ga0070699_1001569572 | 275 |
| 97 | 3300005536 | Ga0070697_100133293 | Ga0070697_1001332932 | 275 |
| 98 | 3300005543 | Ga0070672_100011595 | Ga0070672_1000115957 | 275 |
| 99 | 3300005546 | Ga0070696_100309732 | Ga0070696_1003097322 | 275 |
| 100 | 3300005548 | Ga0070665_100057649 | Ga0070665_1000576492 | 275 |
| 101 | 3300005549 | Ga0070704_100084074 | Ga0070704_1000840742 | 275 |
| 102 | 3300006852 | Ga0075433_10026406 | Ga0075433_100264063 | 275 |
| 103 | 3300006871 | Ga0075434_100028620 | Ga0075434_1000286205 | 275 |
| 104 | 3300013308 | Ga0157375_10230351 | Ga0157375_102303511 | 275 |
| 105 | 3300014969 | Ga0157376_10148985 | Ga0157376_101489852 | 275 |
| 106 | 3300025903 | Ga0207680_10044358 | Ga0207680_100443582 | 275 |
| 107 | 3300025910 | Ga0207684_10046559 | Ga0207684_100465592 | 275 |
| 108 | 3300025922 | Ga0207646_10014290 | Ga0207646_100142904 | 275 |
| 109 | 3300025940 | Ga0207691_10038608 | Ga0207691_100386084 | 275 |
| 110 | 3300026023 | Ga0207677_10078566 | Ga0207677_100785662 | 275 |
| 111 | 3300026089 | Ga0207648_10105122 | Ga0207648_101051223 | 275 |
| 112 | 3300026121 | Ga0207683_10022179 | Ga0207683_100221794 | 275 |
| 113 | 3300028379 | Ga0268266_10207087 | Ga0268266_102070872 | 275 |
| 114 | 3300047318 | Ga0495636_0107356 | Ga0495636_0107356_142_987 | 275 |
| 115 | 3300050512 | nmdc:mga0n895_140431_c1 | nmdc:mga0n895_140431_c1_358_1203 | 275 |
| 116 | 3300050512 | nmdc:mga0n895_76114_c1 | nmdc:mga0n895_76114_c1_2205_3050 | 275 |
| 117 | 3300050515 | nmdc:mga0a205_214160_c1 | nmdc:mga0a205_214160_c1_386_1231 | 275 |
| 118 | 3300050515 | nmdc:mga0a205_8967_c1 | nmdc:mga0a205_8967_c1_2455_3300 | 275 |
| 119 | 3300009147 | Ga0114129_10045036 | Ga0114129_100450365 | 276 |
| 120 | 3300005340 | Ga0070689_100532457 | Ga0070689_1005324571 | 277 |
| 121 | 3300005344 | Ga0070661_100243376 | Ga0070661_1002433762 | 277 |
| 122 | 3300005355 | Ga0070671_100098636 | Ga0070671_1000986362 | 277 |
| 123 | 3300005355 | Ga0070671_100241336 | Ga0070671_1002413361 | 277 |
| 124 | 3300005366 | Ga0070659_100051700 | Ga0070659_1000517004 | 277 |
| 125 | 3300005547 | Ga0070693_100280213 | Ga0070693_1002802131 | 277 |
| 126 | 3300005563 | Ga0068855_100028758 | Ga0068855_1000287585 | 277 |
| 127 | 3300005564 | Ga0070664_100083739 | Ga0070664_1000837394 | 277 |
| 128 | 3300005614 | Ga0068856_100543997 | Ga0068856_1005439971 | 277 |
| 129 | 3300005834 | Ga0068851_10014288 | Ga0068851_100142883 | 277 |
| 130 | 3300006358 | Ga0068871_100521336 | Ga0068871_1005213362 | 277 |
| 131 | 3300009094 | Ga0111539_10154655 | Ga0111539_101546553 | 277 |
| 132 | 3300025932 | Ga0207690_10051206 | Ga0207690_100512063 | 277 |
| 133 | 3300025949 | Ga0207667_10037728 | Ga0207667_100377284 | 277 |
| 134 | 3300026078 | Ga0207702_10406848 | Ga0207702_104068481 | 277 |
| 135 | 3300028794 | Ga0307515_10282968 | Ga0307515_102829682 | 277 |
| 136 | 3300035725 | Ga0373947_0099653 | Ga0373947_0099653_864_1721 | 277 |
| 137 | 3300036401 | Ga0373937_0114854 | Ga0373937_0114854_467_1324 | 277 |
| 138 | 3300037068 | Ga0373925_0058365 | Ga0373925_0058365_145_1002 | 277 |
| 139 | 3300041512 | Ga0451853_0867049 | Ga0451853_0867049_492_1349 | 277 |
| 140 | 3300046472 | Ga0495580_0264576 | Ga0495580_0264576_133_990 | 277 |
| 141 | 3300050511 | nmdc:mga08y16_120385_c1 | nmdc:mga08y16_120385_c1_1467_2360 | 277 |
| 142 | 3300005347 | Ga0070668_100049482 | Ga0070668_1000494823 | 278 |
| 143 | 3300005466 | Ga0070685_10259974 | Ga0070685_102599741 | 278 |
| 144 | 3300005844 | Ga0068862_100025057 | Ga0068862_1000250575 | 278 |
| 145 | 3300025925 | Ga0207650_10032706 | Ga0207650_100327061 | 278 |
| 146 | 3300025972 | Ga0207668_10034452 | Ga0207668_100344523 | 278 |
| 147 | 3300026116 | Ga0207674_10154073 | Ga0207674_101540733 | 278 |
| 148 | 3300025920 | Ga0207649_10361872 | Ga0207649_103618722 | 279 |
| 149 | 3300028794 | Ga0307515_10000459 | Ga0307515_1000045986 | 279 |
| 150 | 3300031649 | Ga0307514_10000979 | Ga0307514_1000097938 | 279 |
| 151 | 3300033180 | Ga0307510_10127901 | Ga0307510_101279012 | 279 |
| 152 | 3300006852 | Ga0075433_10109382 | Ga0075433_101093822 | 280 |
| 153 | 3300006871 | Ga0075434_100248463 | Ga0075434_1002484632 | 280 |
| 154 | 3300005614 | Ga0068856_100246726 | Ga0068856_1002467262 | 282 |
| 155 | 3300046530 | Ga0495654_0002750 | Ga0495654_0002750_5988_6920 | 282 |
| 156 | 3300042115 | Ga0450911_000074 | Ga0450911_000074_27622_28527 | 283 |
| 157 | 3300048924 | Ga0496121_0003833 | Ga0496121_0003833_8593_9498 | 283 |
| 158 | 3300048928 | Ga0496125_0017574 | Ga0496125_0017574_870_1775 | 283 |
| 159 | 3300006173 | Ga0070716_100018789 | Ga0070716_1000187894 | 285 |
| 160 | 3300006914 | Ga0075436_100030838 | Ga0075436_1000308384 | 285 |
| 161 | 3300013308 | Ga0157375_10031086 | Ga0157375_100310866 | 285 |
| 162 | 3300025939 | Ga0207665_10084669 | Ga0207665_100846692 | 285 |
| 163 | 3300046517 | Ga0495630_0379112 | Ga0495630_0379112_193_1065 | 285 |
| 164 | 3300048905 | Ga0496102_0038160 | Ga0496102_0038160_1621_2487 | 285 |
| 165 | 3300050513 | nmdc:mga0rr50_261508_c1 | nmdc:mga0rr50_261508_c1_33_908 | 285 |
| 166 | 3300050514 | nmdc:mga08x19_15991_c1 | nmdc:mga08x19_15991_c1_975_1859 | 285 |
| 167 | 3300053730 | Ga0500645_002165 | Ga0500645_002165_166_1059 | 287 |
| 168 | iso_pu_bacteria | 2721755523 | 2722883087 | 287 |
| 169 | iso_pu_bacteria | 2839138175 | 2839141434 | 287 |
| 170 | iso_pu_bacteria | 2643221621 | 2644119489 | 288 |
| 171 | iso_pu_bacteria | 2881101125 | 2881103683 | 289 |
| 172 | 3300005328 | Ga0070676_10027724 | Ga0070676_100277241 | 290 |
| 173 | 3300005339 | Ga0070660_100000483 | Ga0070660_10000048333 | 290 |
| 174 | 3300005354 | Ga0070675_100030891 | Ga0070675_1000308914 | 290 |
| 175 | 3300005355 | Ga0070671_100002310 | Ga0070671_1000023109 | 290 |
| 176 | 3300005356 | Ga0070674_100408572 | Ga0070674_1004085721 | 290 |
| 177 | 3300005364 | Ga0070673_100026546 | Ga0070673_1000265464 | 290 |
| 178 | 3300005366 | Ga0070659_100003296 | Ga0070659_1000032968 | 290 |
| 179 | 3300005455 | Ga0070663_100021054 | Ga0070663_1000210544 | 290 |
| 180 | 3300005457 | Ga0070662_100001177 | Ga0070662_1000011774 | 290 |
| 181 | 3300005530 | Ga0070679_100037311 | Ga0070679_1000373113 | 290 |
| 182 | 3300005539 | Ga0068853_100002005 | Ga0068853_10000200516 | 290 |
| 183 | 3300005563 | Ga0068855_100003898 | Ga0068855_1000038985 | 290 |
| 184 | 3300005614 | Ga0068856_100001796 | Ga0068856_10000179611 | 290 |
| 185 | 3300006946 | Ga0079104_1000007 | Ga0079104_10000074 | 290 |
| 186 | 3300009148 | Ga0105243_10001888 | Ga0105243_1000188817 | 290 |
| 187 | 3300013100 | Ga0157373_10006303 | Ga0157373_100063039 | 290 |
| 188 | 3300013102 | Ga0157371_10000194 | Ga0157371_1000019415 | 290 |
| 189 | 3300013105 | Ga0157369_10198831 | Ga0157369_101988312 | 290 |
| 190 | 3300013307 | Ga0157372_10005627 | Ga0157372_1000562712 | 290 |
| 191 | 3300025907 | Ga0207645_10043798 | Ga0207645_100437984 | 290 |
| 192 | 3300025919 | Ga0207657_10003940 | Ga0207657_1000394020 | 290 |
| 193 | 3300025926 | Ga0207659_10054439 | Ga0207659_100544394 | 290 |
| 194 | 3300025931 | Ga0207644_10001985 | Ga0207644_100019859 | 290 |
| 195 | 3300025932 | Ga0207690_10006609 | Ga0207690_100066095 | 290 |
| 196 | 3300025933 | Ga0207706_10000002 | Ga0207706_10000002286 | 290 |
| 197 | 3300025935 | Ga0207709_10000172 | Ga0207709_1000017215 | 290 |
| 198 | 3300025940 | Ga0207691_10036775 | Ga0207691_100367755 | 290 |
| 199 | 3300025949 | Ga0207667_10002797 | Ga0207667_1000279715 | 290 |
| 200 | 3300025960 | Ga0207651_10007695 | Ga0207651_100076954 | 290 |
| 201 | 3300025972 | Ga0207668_10143555 | Ga0207668_101435552 | 290 |
| 202 | 3300025981 | Ga0207640_10130392 | Ga0207640_101303922 | 290 |
| 203 | 3300025986 | Ga0207658_10058879 | Ga0207658_100588792 | 290 |
| 204 | 3300026041 | Ga0207639_10005219 | Ga0207639_1000521911 | 290 |
| 205 | 3300026067 | Ga0207678_10032495 | Ga0207678_100324953 | 290 |
| 206 | 3300026078 | Ga0207702_10006364 | Ga0207702_100063646 | 290 |
| 207 | 3300026142 | Ga0207698_10177901 | Ga0207698_101779012 | 290 |
| 208 | 3300027111 | Ga0209281_1000020 | Ga0209281_1000020493 | 290 |
| 209 | 3300042876 | Ga0451577_0000235 | Ga0451577_0000235_57138_58022 | 290 |
| 210 | 3300044712 | Ga0453684_0000906 | Ga0453684_0000906_46263_47147 | 290 |
| 211 | 3300045051 | Ga0451576_0008805 | Ga0451576_0008805_7910_8803 | 290 |
| 212 | 3300048905 | Ga0496102_0003078 | Ga0496102_0003078_5533_6483 | 290 |
| 213 | 3300048906 | Ga0496103_0097636 | Ga0496103_0097636_310_1260 | 290 |
| 214 | 3300048909 | Ga0496106_0002588 | Ga0496106_0002588_8053_9003 | 290 |
| 215 | 3300049459 | Ga0495678_002401 | Ga0495678_002401_1692_2588 | 290 |
| 216 | 3300005616 | Ga0068852_100008965 | Ga0068852_10000896511 | 292 |
| 217 | 3300006048 | Ga0075363_100046047 | Ga0075363_1000460472 | 292 |
| 218 | 3300006178 | Ga0075367_10039603 | Ga0075367_100396034 | 292 |
| 219 | 3300006195 | Ga0075366_10101706 | Ga0075366_101017061 | 292 |
| 220 | 3300026142 | Ga0207698_10032712 | Ga0207698_100327122 | 292 |
| 221 | 3300031911 | Ga0307412_10205096 | Ga0307412_102050961 | 292 |
| 222 | 3300032002 | Ga0307416_100077955 | Ga0307416_1000779552 | 292 |
| 223 | 3300037466 | Ga0395898_0164667 | Ga0395898_0164667_17_901 | 292 |
| 224 | 3300041451 | Ga0451791_0914965 | Ga0451791_0914965_672_1577 | 292 |
| 225 | 3300042007 | Ga0439449_0000986 | Ga0439449_0000986_6260_7150 | 292 |
| 226 | 3300042007 | Ga0439449_0093197 | Ga0439449_0093197_22_903 | 292 |
| 227 | 3300042015 | Ga0439462_0001526 | Ga0439462_0001526_3925_4815 | 292 |
| 228 | 3300046471 | Ga0495650_0009317 | Ga0495650_0009317_855_1748 | 292 |
| 229 | 3300049569 | Ga0501032_0092896 | Ga0501032_0092896_609_1529 | 292 |
| 230 | 3300049579 | Ga0501043_0000072 | Ga0501043_0000072_3702_4622 | 292 |
| 231 | 3300049580 | Ga0501046_0000112 | Ga0501046_0000112_1053_1973 | 292 |
| 232 | 3300049581 | Ga0501047_0000138 | Ga0501047_0000138_84400_85320 | 292 |
| 233 | 3300049582 | Ga0501048_0001533 | Ga0501048_0001533_15536_16456 | 292 |
| 234 | 3300049824 | Ga0501045_0005067 | Ga0501045_0005067_2131_3051 | 292 |
| 235 | 3300050492 | nmdc:mga0yw44_177401_c1 | nmdc:mga0yw44_177401_c1_95_988 | 292 |
| 236 | 3300050492 | nmdc:mga0yw44_36874_c1 | nmdc:mga0yw44_36874_c1_960_1853 | 292 |
| 237 | 3300059424 | Ga0590075_020359 | Ga0590075_020359_713_1603 | 292 |
| 238 | 3300005843 | Ga0068860_100056774 | Ga0068860_1000567742 | 293 |
| 239 | 3300028381 | Ga0268264_10041400 | Ga0268264_100414002 | 293 |
| 240 | 3300028794 | Ga0307515_10086833 | Ga0307515_100868333 | 293 |
| 241 | 3300046518 | Ga0495631_0119637 | Ga0495631_0119637_211_1122 | 293 |
| 242 | iso_pu_bacteria | 2511231002 | 2511245644 | 293 |
| 243 | iso_pu_bacteria | 2585428058 | 2587736260 | 293 |
| 244 | iso_pu_bacteria | 2585428062 | 2587757046 | 293 |
| 245 | 3300005331 | Ga0070670_100029077 | Ga0070670_1000290774 | 294 |
| 246 | 3300005367 | Ga0070667_100054892 | Ga0070667_1000548921 | 294 |
| 247 | 3300005617 | Ga0068859_100228435 | Ga0068859_1002284352 | 294 |
| 248 | 3300006931 | Ga0097620_100228431 | Ga0097620_1002284312 | 294 |
| 249 | 3300009093 | Ga0105240_10038834 | Ga0105240_100388342 | 294 |
| 250 | 3300010375 | Ga0105239_10427391 | Ga0105239_104273912 | 294 |
| 251 | 3300014326 | Ga0157380_10076760 | Ga0157380_100767602 | 294 |
| 252 | 3300025913 | Ga0207695_10029322 | Ga0207695_100293223 | 294 |
| 253 | 3300025914 | Ga0207671_10061758 | Ga0207671_100617582 | 294 |
| 254 | 3300025925 | Ga0207650_10024159 | Ga0207650_100241593 | 294 |
| 255 | 3300031548 | Ga0307408_100086284 | Ga0307408_1000862843 | 294 |
| 256 | 3300031901 | Ga0307406_10000278 | Ga0307406_1000027827 | 294 |
| 257 | 3300035172 | Ga0373955_0298393 | Ga0373955_0298393_28_927 | 294 |
| 258 | 3300042156 | Ga0439446_0074829 | Ga0439446_0074829_11_925 | 294 |
| 259 | 3300049579 | Ga0501043_0000052 | Ga0501043_0000052_102333_103250 | 294 |
| 260 | 3300049580 | Ga0501046_0000327 | Ga0501046_0000327_43429_44346 | 294 |
| 261 | 3300049581 | Ga0501047_0000137 | Ga0501047_0000137_49288_50205 | 294 |
| 262 | 3300049582 | Ga0501048_0000371 | Ga0501048_0000371_5959_6876 | 294 |
| 263 | 3300049823 | Ga0501044_0321267 | Ga0501044_0321267_220_1137 | 294 |
| 264 | 3300049824 | Ga0501045_0001514 | Ga0501045_0001514_12402_13319 | 294 |
| 265 | iso_pu_bacteria | 2547132374 | 2548500443 | 294 |
| 266 | iso_pu_bacteria | 2643221570 | 2643864549 | 294 |
| 267 | iso_pu_bacteria | 2643221596 | 2643992839 | 294 |
| 268 | iso_pu_bacteria | 2643221609 | 2644058241 | 294 |
| 269 | iso_pu_bacteria | 2643221611 | 2644073294 | 294 |
| 270 | iso_pu_bacteria | 2643221652 | 2644291762 | 294 |
| 271 | iso_pu_bacteria | 2643221717 | 2644647010 | 294 |
| 272 | iso_pu_bacteria | 2738543012 | 2739244418 | 294 |
| 273 | iso_pu_bacteria | 2816332133 | 2816469849 | 294 |
| 274 | iso_pu_bacteria | 2919704043 | 2919704383 | 294 |
| 275 | iso_pu_bacteria | 2990710928 | 2990715128 | 294 |
| 276 | 3300005290 | Ga0065712_10099630 | Ga0065712_100996302 | 295 |
| 277 | 3300005293 | Ga0065715_10126678 | Ga0065715_101266782 | 295 |
| 278 | 3300005329 | Ga0070683_100028689 | Ga0070683_1000286893 | 295 |
| 279 | 3300005329 | Ga0070683_100087454 | Ga0070683_1000874544 | 295 |
| 280 | 3300005330 | Ga0070690_100047352 | Ga0070690_1000473522 | 295 |
| 281 | 3300005331 | Ga0070670_100095055 | Ga0070670_1000950552 | 295 |
| 282 | 3300005334 | Ga0068869_100002513 | Ga0068869_10000251310 | 295 |
| 283 | 3300005335 | Ga0070666_10107516 | Ga0070666_101075162 | 295 |
| 284 | 3300005338 | Ga0068868_100130065 | Ga0068868_1001300652 | 295 |
| 285 | 3300005339 | Ga0070660_100003597 | Ga0070660_1000035972 | 295 |
| 286 | 3300005340 | Ga0070689_100015294 | Ga0070689_1000152942 | 295 |
| 287 | 3300005343 | Ga0070687_100017491 | Ga0070687_1000174913 | 295 |
| 288 | 3300005344 | Ga0070661_100042363 | Ga0070661_1000423632 | 295 |
| 289 | 3300005344 | Ga0070661_100062174 | Ga0070661_1000621741 | 295 |
| 290 | 3300005355 | Ga0070671_100088195 | Ga0070671_1000881953 | 295 |
| 291 | 3300005356 | Ga0070674_100055090 | Ga0070674_1000550902 | 295 |
| 292 | 3300005365 | Ga0070688_100057346 | Ga0070688_1000573462 | 295 |
| 293 | 3300005438 | Ga0070701_10017069 | Ga0070701_100170693 | 295 |
| 294 | 3300005455 | Ga0070663_100004009 | Ga0070663_1000040097 | 295 |
| 295 | 3300005455 | Ga0070663_100155362 | Ga0070663_1001553622 | 295 |
| 296 | 3300005457 | Ga0070662_100027749 | Ga0070662_1000277493 | 295 |
| 297 | 3300005459 | Ga0068867_100295992 | Ga0068867_1002959922 | 295 |
| 298 | 3300005466 | Ga0070685_10003675 | Ga0070685_100036752 | 295 |
| 299 | 3300005539 | Ga0068853_100098480 | Ga0068853_1000984802 | 295 |
| 300 | 3300005544 | Ga0070686_100021664 | Ga0070686_1000216643 | 295 |
| 301 | 3300005548 | Ga0070665_100054460 | Ga0070665_1000544606 | 295 |
| 302 | 3300005564 | Ga0070664_100045893 | Ga0070664_1000458933 | 295 |
| 303 | 3300005564 | Ga0070664_100084232 | Ga0070664_1000842322 | 295 |
| 304 | 3300005577 | Ga0068857_100006391 | Ga0068857_1000063919 | 295 |
| 305 | 3300005616 | Ga0068852_100009773 | Ga0068852_1000097734 | 295 |
| 306 | 3300005616 | Ga0068852_100069113 | Ga0068852_1000691133 | 295 |
| 307 | 3300005618 | Ga0068864_100064654 | Ga0068864_1000646543 | 295 |
| 308 | 3300005718 | Ga0068866_10068112 | Ga0068866_100681122 | 295 |
| 309 | 3300005719 | Ga0068861_100017505 | Ga0068861_1000175053 | 295 |
| 310 | 3300005834 | Ga0068851_10001091 | Ga0068851_1000109111 | 295 |
| 311 | 3300005834 | Ga0068851_10005660 | Ga0068851_100056602 | 295 |
| 312 | 3300005840 | Ga0068870_10074828 | Ga0068870_100748282 | 295 |
| 313 | 3300005841 | Ga0068863_100200108 | Ga0068863_1002001082 | 295 |
| 314 | 3300005844 | Ga0068862_100022088 | Ga0068862_1000220886 | 295 |
| 315 | 3300006237 | Ga0097621_100178593 | Ga0097621_1001785932 | 295 |
| 316 | 3300009094 | Ga0111539_10054115 | Ga0111539_100541153 | 295 |
| 317 | 3300009098 | Ga0105245_10274845 | Ga0105245_102748452 | 295 |
| 318 | 3300009101 | Ga0105247_10265757 | Ga0105247_102657571 | 295 |
| 319 | 3300009177 | Ga0105248_10120513 | Ga0105248_101205132 | 295 |
| 320 | 3300010375 | Ga0105239_10449407 | Ga0105239_104494072 | 295 |
| 321 | 3300013296 | Ga0157374_10007074 | Ga0157374_100070744 | 295 |
| 322 | 3300013297 | Ga0157378_10226200 | Ga0157378_102262002 | 295 |
| 323 | 3300014325 | Ga0163163_10083758 | Ga0163163_100837583 | 295 |
| 324 | 3300014326 | Ga0157380_10003347 | Ga0157380_1000334710 | 295 |
| 325 | 3300014745 | Ga0157377_10003307 | Ga0157377_100033077 | 295 |
| 326 | 3300014745 | Ga0157377_10164348 | Ga0157377_101643481 | 295 |
| 327 | 3300014968 | Ga0157379_10121989 | Ga0157379_101219892 | 295 |
| 328 | 3300014969 | Ga0157376_10100763 | Ga0157376_101007633 | 295 |
| 329 | 3300014969 | Ga0157376_10334746 | Ga0157376_103347462 | 295 |
| 330 | 3300025315 | Ga0207697_10000368 | Ga0207697_1000036820 | 295 |
| 331 | 3300025321 | Ga0207656_10040278 | Ga0207656_100402782 | 295 |
| 332 | 3300025893 | Ga0207682_10000076 | Ga0207682_1000007611 | 295 |
| 333 | 3300025901 | Ga0207688_10001459 | Ga0207688_1000145912 | 295 |
| 334 | 3300025903 | Ga0207680_10074303 | Ga0207680_100743032 | 295 |
| 335 | 3300025907 | Ga0207645_10002521 | Ga0207645_1000252116 | 295 |
| 336 | 3300025908 | Ga0207643_10002053 | Ga0207643_100020538 | 295 |
| 337 | 3300025909 | Ga0207705_10029442 | Ga0207705_100294424 | 295 |
| 338 | 3300025918 | Ga0207662_10005162 | Ga0207662_100051626 | 295 |
| 339 | 3300025919 | Ga0207657_10005946 | Ga0207657_100059462 | 295 |
| 340 | 3300025925 | Ga0207650_10003315 | Ga0207650_1000331512 | 295 |
| 341 | 3300025926 | Ga0207659_10004952 | Ga0207659_100049527 | 295 |
| 342 | 3300025931 | Ga0207644_10012418 | Ga0207644_100124185 | 295 |
| 343 | 3300025933 | Ga0207706_10002383 | Ga0207706_1000238319 | 295 |
| 344 | 3300025936 | Ga0207670_10028754 | Ga0207670_100287542 | 295 |
| 345 | 3300025937 | Ga0207669_10083381 | Ga0207669_100833812 | 295 |
| 346 | 3300025940 | Ga0207691_10102436 | Ga0207691_101024362 | 295 |
| 347 | 3300025942 | Ga0207689_10002547 | Ga0207689_1000254717 | 295 |
| 348 | 3300025945 | Ga0207679_10034512 | Ga0207679_100345123 | 295 |
| 349 | 3300025986 | Ga0207658_10020000 | Ga0207658_100200002 | 295 |
| 350 | 3300026023 | Ga0207677_10009582 | Ga0207677_100095826 | 295 |
| 351 | 3300026035 | Ga0207703_10040095 | Ga0207703_100400952 | 295 |
| 352 | 3300026067 | Ga0207678_10000931 | Ga0207678_1000093121 | 295 |
| 353 | 3300026067 | Ga0207678_10339064 | Ga0207678_103390642 | 295 |
| 354 | 3300026075 | Ga0207708_10000418 | Ga0207708_100004184 | 295 |
| 355 | 3300026088 | Ga0207641_10025865 | Ga0207641_100258652 | 295 |
| 356 | 3300026089 | Ga0207648_10014979 | Ga0207648_100149797 | 295 |
| 357 | 3300026095 | Ga0207676_10243898 | Ga0207676_102438982 | 295 |
| 358 | 3300026116 | Ga0207674_10005989 | Ga0207674_100059897 | 295 |
| 359 | 3300026118 | Ga0207675_100009614 | Ga0207675_1000096147 | 295 |
| 360 | 3300026121 | Ga0207683_10004550 | Ga0207683_1000455013 | 295 |
| 361 | 3300026142 | Ga0207698_10268979 | Ga0207698_102689791 | 295 |
| 362 | 3300027907 | Ga0207428_10221717 | Ga0207428_102217172 | 295 |
| 363 | 3300028379 | Ga0268266_10053676 | Ga0268266_100536764 | 295 |
| 364 | 3300028381 | Ga0268264_10092667 | Ga0268264_100926673 | 295 |
| 365 | 3300031911 | Ga0307412_10175630 | Ga0307412_101756302 | 295 |
| 366 | 3300041443 | Ga0451789_0569119 | Ga0451789_0569119_237_1166 | 295 |
| 367 | 3300041452 | Ga0451793_0421724 | Ga0451793_0421724_1758_2654 | 295 |
| 368 | 3300041463 | Ga0451804_0432193 | Ga0451804_0432193_177_1073 | 295 |
| 369 | 3300042004 | Ga0439445_0009866 | Ga0439445_0009866_501_1406 | 295 |
| 370 | 3300042436 | Ga0439435_0055421 | Ga0439435_0055421_123_1025 | 295 |
| 371 | 3300045051 | Ga0451576_0038996 | Ga0451576_0038996_1208_2110 | 295 |
| 372 | 3300046460 | Ga0495638_0060680 | Ga0495638_0060680_352_1281 | 295 |
| 373 | 3300046519 | Ga0495632_0002891 | Ga0495632_0002891_1751_2680 | 295 |
| 374 | 3300048904 | Ga0496101_0084219 | Ga0496101_0084219_126_1025 | 295 |
| 375 | 3300048905 | Ga0496102_0064277 | Ga0496102_0064277_2191_3090 | 295 |
| 376 | 3300048908 | Ga0496105_0004944 | Ga0496105_0004944_3856_4755 | 295 |
| 377 | 3300048909 | Ga0496106_0044949 | Ga0496106_0044949_1035_1934 | 295 |
| 378 | 3300048910 | Ga0496107_0041577 | Ga0496107_0041577_1939_2838 | 295 |
| 379 | 3300048913 | Ga0496110_0044760 | Ga0496110_0044760_1606_2505 | 295 |
| 380 | 3300048929 | Ga0496126_0095970 | Ga0496126_0095970_280_1185 | 295 |
| 381 | 3300050511 | nmdc:mga08y16_135364_c1 | nmdc:mga08y16_135364_c1_1197_2096 | 295 |
| 382 | 3300053088 | Ga0500644_0091187 | Ga0500644_0091187_172_1101 | 295 |
| 383 | 3300053090 | Ga0500646_0001709 | Ga0500646_0001709_3597_4526 | 295 |
| 384 | 3300053131 | Ga0500652_001537 | Ga0500652_001537_4222_5151 | 295 |
| 385 | 3300053133 | Ga0500655_006099 | Ga0500655_006099_603_1532 | 295 |
| 386 | 3300053151 | Ga0500604_0005487 | Ga0500604_0005487_1151_2080 | 295 |
| 387 | 3300053156 | Ga0500622_0001110 | Ga0500622_0001110_6537_7466 | 295 |
| 388 | 3300003794 | Ga0055531_10000281 | Ga0055531_1000028138 | 296 |
| 389 | 3300005293 | Ga0065715_10119990 | Ga0065715_101199903 | 296 |
| 390 | 3300005354 | Ga0070675_100023744 | Ga0070675_1000237442 | 296 |
| 391 | 3300005367 | Ga0070667_100020817 | Ga0070667_1000208174 | 296 |
| 392 | 3300005459 | Ga0068867_100523140 | Ga0068867_1005231401 | 296 |
| 393 | 3300005543 | Ga0070672_100083034 | Ga0070672_1000830343 | 296 |
| 394 | 3300005548 | Ga0070665_100264556 | Ga0070665_1002645562 | 296 |
| 395 | 3300005617 | Ga0068859_100519202 | Ga0068859_1005192022 | 296 |
| 396 | 3300005618 | Ga0068864_100053879 | Ga0068864_1000538792 | 296 |
| 397 | 3300005618 | Ga0068864_100170353 | Ga0068864_1001703533 | 296 |
| 398 | 3300005719 | Ga0068861_100097514 | Ga0068861_1000975143 | 296 |
| 399 | 3300005841 | Ga0068863_100094420 | Ga0068863_1000944202 | 296 |
| 400 | 3300006846 | Ga0075430_100219669 | Ga0075430_1002196692 | 296 |
| 401 | 3300006931 | Ga0097620_100519138 | Ga0097620_1005191382 | 296 |
| 402 | 3300010375 | Ga0105239_10126723 | Ga0105239_101267233 | 296 |
| 403 | 3300013308 | Ga0157375_10228948 | Ga0157375_102289482 | 296 |
| 404 | 3300025284 | Ga0209130_1032622 | Ga0209130_10326221 | 296 |
| 405 | 3300025303 | Ga0209051_1000172 | Ga0209051_1000172104 | 296 |
| 406 | 3300025304 | Ga0209257_1000015 | Ga0209257_1000015483 | 296 |
| 407 | 3300025304 | Ga0209257_1000108 | Ga0209257_1000108227 | 296 |
| 408 | 3300025925 | Ga0207650_10069448 | Ga0207650_100694483 | 296 |
| 409 | 3300025926 | Ga0207659_10008305 | Ga0207659_100083054 | 296 |
| 410 | 3300025941 | Ga0207711_10028333 | Ga0207711_100283332 | 296 |
| 411 | 3300025972 | Ga0207668_10002950 | Ga0207668_100029507 | 296 |
| 412 | 3300025986 | Ga0207658_10022771 | Ga0207658_100227713 | 296 |
| 413 | 3300026088 | Ga0207641_10118653 | Ga0207641_101186533 | 296 |
| 414 | 3300026095 | Ga0207676_10039402 | Ga0207676_100394024 | 296 |
| 415 | 3300026095 | Ga0207676_10187942 | Ga0207676_101879422 | 296 |
| 416 | 3300026118 | Ga0207675_100254085 | Ga0207675_1002540853 | 296 |
| 417 | 3300027614 | Ga0209970_1001012 | Ga0209970_10010122 | 296 |
| 418 | 3300028379 | Ga0268266_10147323 | Ga0268266_101473232 | 296 |
| 419 | 3300037312 | Ga0395899_0006012 | Ga0395899_0006012_1232_2134 | 296 |
| 420 | 3300037312 | Ga0395899_0013757 | Ga0395899_0013757_5258_6163 | 296 |
| 421 | 3300037466 | Ga0395898_0025013 | Ga0395898_0025013_25_927 | 296 |
| 422 | 3300037466 | Ga0395898_0116213 | Ga0395898_0116213_1636_2541 | 296 |
| 423 | 3300042007 | Ga0439449_0000091 | Ga0439449_0000091_14287_15204 | 296 |
| 424 | 3300044673 | Ga0453683_0006609 | Ga0453683_0006609_4414_5319 | 296 |
| 425 | 3300045051 | Ga0451576_0025630 | Ga0451576_0025630_1494_2399 | 296 |
| 426 | 3300046535 | Ga0495586_0119883 | Ga0495586_0119883_141_1073 | 296 |
| 427 | 3300048905 | Ga0496102_0005035 | Ga0496102_0005035_5556_6467 | 296 |
| 428 | 3300002704 | JGI25155J39150_1000090 | JGI25155J39150_100009040 | 297 |
| 429 | 3300002705 | JGI25156J39149_1000148 | JGI25156J39149_100014840 | 297 |
| 430 | 3300002738 | JGI25154J39366_1000155 | JGI25154J39366_100015541 | 297 |
| 431 | 3300002741 | JGI25157J39369_1000183 | JGI25157J39369_10001837 | 297 |
| 432 | 3300002774 | JGI25150J39212_1004158 | JGI25150J39212_10041582 | 297 |
| 433 | 3300002774 | JGI25150J39212_1004356 | JGI25150J39212_10043562 | 297 |
| 434 | 3300003187 | JGI25151J46595_10001873 | JGI25151J46595_100018737 | 297 |
| 435 | 3300003187 | JGI25151J46595_10009246 | JGI25151J46595_100092464 | 297 |
| 436 | 3300003187 | JGI25151J46595_10027293 | JGI25151J46595_100272932 | 297 |
| 437 | 3300003203 | JGI25406J46586_10032068 | JGI25406J46586_100320682 | 297 |
| 438 | 3300003215 | JGI25153J46596_10004275 | JGI25153J46596_100042752 | 297 |
| 439 | 3300003320 | rootH2_10050795 | rootH2_100507954 | 297 |
| 440 | 3300003322 | rootL2_10005678 | rootL2_100056786 | 297 |
| 441 | 3300003354 | JGI25160J50197_1000059 | JGI25160J50197_100005956 | 297 |
| 442 | 3300003374 | JGI25161J50226_1000008 | JGI25161J50226_10000082 | 297 |
| 443 | 3300003773 | Ga0055537_1000245 | Ga0055537_10002457 | 297 |
| 444 | 3300003773 | Ga0055537_1000249 | Ga0055537_10002496 | 297 |
| 445 | 3300003775 | Ga0055524_1000057 | Ga0055524_10000577 | 297 |
| 446 | 3300003781 | Ga0055536_1003494 | Ga0055536_10034945 | 297 |
| 447 | 3300003790 | Ga0055528_1000888 | Ga0055528_10008885 | 297 |
| 448 | 3300003791 | Ga0055530_10002076 | Ga0055530_100020767 | 297 |
| 449 | 3300003792 | Ga0055540_1001554 | Ga0055540_10015549 | 297 |
| 450 | 3300003794 | Ga0055531_10002433 | Ga0055531_100024337 | 297 |
| 451 | 3300003794 | Ga0055531_10014357 | Ga0055531_100143572 | 297 |
| 452 | 3300004625 | Ga0055543_1000138 | Ga0055543_100013841 | 297 |
| 453 | 3300005262 | Ga0065165_1007150 | Ga0065165_10071506 | 297 |
| 454 | 3300005328 | Ga0070676_10002095 | Ga0070676_100020958 | 297 |
| 455 | 3300005328 | Ga0070676_10012793 | Ga0070676_100127932 | 297 |
| 456 | 3300005328 | Ga0070676_10030285 | Ga0070676_100302854 | 297 |
| 457 | 3300005330 | Ga0070690_100001452 | Ga0070690_1000014524 | 297 |
| 458 | 3300005331 | Ga0070670_100008053 | Ga0070670_1000080534 | 297 |
| 459 | 3300005334 | Ga0068869_100000481 | Ga0068869_10000048110 | 297 |
| 460 | 3300005335 | Ga0070666_10000745 | Ga0070666_100007456 | 297 |
| 461 | 3300005335 | Ga0070666_10195358 | Ga0070666_101953581 | 297 |
| 462 | 3300005336 | Ga0070680_100049561 | Ga0070680_1000495614 | 297 |
| 463 | 3300005338 | Ga0068868_100000971 | Ga0068868_10000097113 | 297 |
| 464 | 3300005338 | Ga0068868_100050030 | Ga0068868_1000500302 | 297 |
| 465 | 3300005338 | Ga0068868_100065210 | Ga0068868_1000652102 | 297 |
| 466 | 3300005338 | Ga0068868_100198559 | Ga0068868_1001985592 | 297 |
| 467 | 3300005339 | Ga0070660_100174322 | Ga0070660_1001743222 | 297 |
| 468 | 3300005340 | Ga0070689_100002088 | Ga0070689_1000020886 | 297 |
| 469 | 3300005340 | Ga0070689_100054672 | Ga0070689_1000546721 | 297 |
| 470 | 3300005343 | Ga0070687_100117256 | Ga0070687_1001172562 | 297 |
| 471 | 3300005347 | Ga0070668_100211549 | Ga0070668_1002115492 | 297 |
| 472 | 3300005353 | Ga0070669_100004947 | Ga0070669_1000049473 | 297 |
| 473 | 3300005354 | Ga0070675_100033406 | Ga0070675_1000334063 | 297 |
| 474 | 3300005354 | Ga0070675_100092616 | Ga0070675_1000926162 | 297 |
| 475 | 3300005355 | Ga0070671_100001053 | Ga0070671_10000105319 | 297 |
| 476 | 3300005355 | Ga0070671_100007296 | Ga0070671_1000072967 | 297 |
| 477 | 3300005355 | Ga0070671_100060980 | Ga0070671_1000609802 | 297 |
| 478 | 3300005355 | Ga0070671_100169992 | Ga0070671_1001699921 | 297 |
| 479 | 3300005356 | Ga0070674_100099699 | Ga0070674_1000996992 | 297 |
| 480 | 3300005364 | Ga0070673_100007976 | Ga0070673_1000079763 | 297 |
| 481 | 3300005364 | Ga0070673_100257003 | Ga0070673_1002570032 | 297 |
| 482 | 3300005365 | Ga0070688_100002954 | Ga0070688_1000029549 | 297 |
| 483 | 3300005365 | Ga0070688_100089848 | Ga0070688_1000898482 | 297 |
| 484 | 3300005367 | Ga0070667_100001469 | Ga0070667_10000146910 | 297 |
| 485 | 3300005367 | Ga0070667_100004231 | Ga0070667_10000423113 | 297 |
| 486 | 3300005367 | Ga0070667_100074494 | Ga0070667_1000744942 | 297 |
| 487 | 3300005434 | Ga0070709_10043398 | Ga0070709_100433984 | 297 |
| 488 | 3300005439 | Ga0070711_100004626 | Ga0070711_1000046265 | 297 |
| 489 | 3300005439 | Ga0070711_100209686 | Ga0070711_1002096862 | 297 |
| 490 | 3300005440 | Ga0070705_100004377 | Ga0070705_1000043774 | 297 |
| 491 | 3300005444 | Ga0070694_100025464 | Ga0070694_1000254644 | 297 |
| 492 | 3300005455 | Ga0070663_100107551 | Ga0070663_1001075512 | 297 |
| 493 | 3300005455 | Ga0070663_100135412 | Ga0070663_1001354122 | 297 |
| 494 | 3300005455 | Ga0070663_100182684 | Ga0070663_1001826842 | 297 |
| 495 | 3300005455 | Ga0070663_100252222 | Ga0070663_1002522222 | 297 |
| 496 | 3300005456 | Ga0070678_100002830 | Ga0070678_1000028301 | 297 |
| 497 | 3300005457 | Ga0070662_100048655 | Ga0070662_1000486552 | 297 |
| 498 | 3300005457 | Ga0070662_100060606 | Ga0070662_1000606063 | 297 |
| 499 | 3300005457 | Ga0070662_100260566 | Ga0070662_1002605663 | 297 |
| 500 | 3300005457 | Ga0070662_100264038 | Ga0070662_1002640381 | 297 |
| 501 | 3300005458 | Ga0070681_10076070 | Ga0070681_100760704 | 297 |
| 502 | 3300005459 | Ga0068867_100002983 | Ga0068867_1000029839 | 297 |
| 503 | 3300005459 | Ga0068867_100004082 | Ga0068867_10000408210 | 297 |
| 504 | 3300005459 | Ga0068867_100007271 | Ga0068867_1000072712 | 297 |
| 505 | 3300005459 | Ga0068867_100044893 | Ga0068867_1000448933 | 297 |
| 506 | 3300005459 | Ga0068867_100292737 | Ga0068867_1002927372 | 297 |
| 507 | 3300005466 | Ga0070685_10011495 | Ga0070685_100114956 | 297 |
| 508 | 3300005467 | Ga0070706_100003222 | Ga0070706_10000322212 | 297 |
| 509 | 3300005468 | Ga0070707_100033981 | Ga0070707_1000339812 | 297 |
| 510 | 3300005468 | Ga0070707_100070778 | Ga0070707_1000707782 | 297 |
| 511 | 3300005536 | Ga0070697_100149793 | Ga0070697_1001497931 | 297 |
| 512 | 3300005543 | Ga0070672_100091803 | Ga0070672_1000918033 | 297 |
| 513 | 3300005546 | Ga0070696_100067690 | Ga0070696_1000676902 | 297 |
| 514 | 3300005547 | Ga0070693_100002585 | Ga0070693_1000025859 | 297 |
| 515 | 3300005548 | Ga0070665_100001402 | Ga0070665_10000140220 | 297 |
| 516 | 3300005548 | Ga0070665_100007136 | Ga0070665_1000071367 | 297 |
| 517 | 3300005563 | Ga0068855_100129567 | Ga0068855_1001295672 | 297 |
| 518 | 3300005577 | Ga0068857_100007102 | Ga0068857_1000071028 | 297 |
| 519 | 3300005577 | Ga0068857_100026898 | Ga0068857_1000268985 | 297 |
| 520 | 3300005578 | Ga0068854_100047229 | Ga0068854_1000472293 | 297 |
| 521 | 3300005578 | Ga0068854_100095261 | Ga0068854_1000952613 | 297 |
| 522 | 3300005614 | Ga0068856_100171183 | Ga0068856_1001711832 | 297 |
| 523 | 3300005614 | Ga0068856_100235728 | Ga0068856_1002357282 | 297 |
| 524 | 3300005615 | Ga0070702_100010808 | Ga0070702_1000108084 | 297 |
| 525 | 3300005615 | Ga0070702_100166995 | Ga0070702_1001669952 | 297 |
| 526 | 3300005616 | Ga0068852_100109419 | Ga0068852_1001094193 | 297 |
| 527 | 3300005616 | Ga0068852_100110416 | Ga0068852_1001104162 | 297 |
| 528 | 3300005617 | Ga0068859_100000893 | Ga0068859_10000089324 | 297 |
| 529 | 3300005617 | Ga0068859_100001169 | Ga0068859_10000116910 | 297 |
| 530 | 3300005617 | Ga0068859_100115911 | Ga0068859_1001159113 | 297 |
| 531 | 3300005617 | Ga0068859_100647164 | Ga0068859_1006471642 | 297 |
| 532 | 3300005618 | Ga0068864_100001446 | Ga0068864_10000144628 | 297 |
| 533 | 3300005618 | Ga0068864_100002752 | Ga0068864_1000027529 | 297 |
| 534 | 3300005618 | Ga0068864_100009929 | Ga0068864_10000992910 | 297 |
| 535 | 3300005718 | Ga0068866_10001177 | Ga0068866_1000117712 | 297 |
| 536 | 3300005719 | Ga0068861_100001611 | Ga0068861_1000016119 | 297 |
| 537 | 3300005834 | Ga0068851_10072861 | Ga0068851_100728612 | 297 |
| 538 | 3300005840 | Ga0068870_10022611 | Ga0068870_100226113 | 297 |
| 539 | 3300005840 | Ga0068870_10037573 | Ga0068870_100375732 | 297 |
| 540 | 3300005841 | Ga0068863_100000521 | Ga0068863_10000052127 | 297 |
| 541 | 3300005841 | Ga0068863_100003595 | Ga0068863_1000035959 | 297 |
| 542 | 3300005841 | Ga0068863_100066801 | Ga0068863_1000668014 | 297 |
| 543 | 3300005842 | Ga0068858_100003010 | Ga0068858_10000301013 | 297 |
| 544 | 3300005842 | Ga0068858_100012873 | Ga0068858_1000128736 | 297 |
| 545 | 3300005842 | Ga0068858_100275734 | Ga0068858_1002757342 | 297 |
| 546 | 3300005843 | Ga0068860_100001084 | Ga0068860_10000108418 | 297 |
| 547 | 3300005843 | Ga0068860_100003063 | Ga0068860_10000306313 | 297 |
| 548 | 3300005843 | Ga0068860_100201500 | Ga0068860_1002015002 | 297 |
| 549 | 3300005843 | Ga0068860_100222797 | Ga0068860_1002227972 | 297 |
| 550 | 3300005844 | Ga0068862_100013035 | Ga0068862_1000130355 | 297 |
| 551 | 3300005985 | Ga0081539_10004545 | Ga0081539_100045454 | 297 |
| 552 | 3300006038 | Ga0075365_10070468 | Ga0075365_100704682 | 297 |
| 553 | 3300006038 | Ga0075365_10094818 | Ga0075365_100948182 | 297 |
| 554 | 3300006048 | Ga0075363_100024927 | Ga0075363_1000249274 | 297 |
| 555 | 3300006048 | Ga0075363_100142151 | Ga0075363_1001421512 | 297 |
| 556 | 3300006051 | Ga0075364_10061998 | Ga0075364_100619982 | 297 |
| 557 | 3300006058 | Ga0075432_10041461 | Ga0075432_100414612 | 297 |
| 558 | 3300006163 | Ga0070715_10072640 | Ga0070715_100726402 | 297 |
| 559 | 3300006173 | Ga0070716_100005733 | Ga0070716_1000057338 | 297 |
| 560 | 3300006175 | Ga0070712_100014560 | Ga0070712_1000145603 | 297 |
| 561 | 3300006177 | Ga0075362_10064159 | Ga0075362_100641592 | 297 |
| 562 | 3300006177 | Ga0075362_10139001 | Ga0075362_101390012 | 297 |
| 563 | 3300006178 | Ga0075367_10033023 | Ga0075367_100330232 | 297 |
| 564 | 3300006178 | Ga0075367_10044599 | Ga0075367_100445993 | 297 |
| 565 | 3300006178 | Ga0075367_10086488 | Ga0075367_100864882 | 297 |
| 566 | 3300006195 | Ga0075366_10016722 | Ga0075366_100167224 | 297 |
| 567 | 3300006195 | Ga0075366_10041574 | Ga0075366_100415742 | 297 |
| 568 | 3300006195 | Ga0075366_10084996 | Ga0075366_100849962 | 297 |
| 569 | 3300006195 | Ga0075366_10122499 | Ga0075366_101224992 | 297 |
| 570 | 3300006237 | Ga0097621_100003977 | Ga0097621_1000039772 | 297 |
| 571 | 3300006237 | Ga0097621_100014273 | Ga0097621_1000142735 | 297 |
| 572 | 3300006353 | Ga0075370_10001742 | Ga0075370_100017426 | 297 |
| 573 | 3300006353 | Ga0075370_10002345 | Ga0075370_100023459 | 297 |
| 574 | 3300006353 | Ga0075370_10039044 | Ga0075370_100390442 | 297 |
| 575 | 3300006353 | Ga0075370_10092239 | Ga0075370_100922392 | 297 |
| 576 | 3300006353 | Ga0075370_10112178 | Ga0075370_101121782 | 297 |
| 577 | 3300006353 | Ga0075370_10233958 | Ga0075370_102339582 | 297 |
| 578 | 3300006358 | Ga0068871_100017564 | Ga0068871_1000175643 | 297 |
| 579 | 3300006358 | Ga0068871_100035783 | Ga0068871_1000357834 | 297 |
| 580 | 3300006358 | Ga0068871_100451079 | Ga0068871_1004510791 | 297 |
| 581 | 3300006871 | Ga0075434_100279067 | Ga0075434_1002790672 | 297 |
| 582 | 3300006931 | Ga0097620_100000893 | Ga0097620_10000089324 | 297 |
| 583 | 3300006931 | Ga0097620_100001169 | Ga0097620_10000116918 | 297 |
| 584 | 3300006931 | Ga0097620_100115908 | Ga0097620_1001159082 | 297 |
| 585 | 3300006931 | Ga0097620_100647183 | Ga0097620_1006471832 | 297 |
| 586 | 3300006946 | Ga0079104_1000352 | Ga0079104_100035215 | 297 |
| 587 | 3300009093 | Ga0105240_10030931 | Ga0105240_100309317 | 297 |
| 588 | 3300009094 | Ga0111539_10073152 | Ga0111539_100731522 | 297 |
| 589 | 3300009098 | Ga0105245_10001644 | Ga0105245_100016443 | 297 |
| 590 | 3300009098 | Ga0105245_10007857 | Ga0105245_100078574 | 297 |
| 591 | 3300009098 | Ga0105245_10057243 | Ga0105245_100572432 | 297 |
| 592 | 3300009098 | Ga0105245_10073690 | Ga0105245_100736902 | 297 |
| 593 | 3300009098 | Ga0105245_10197285 | Ga0105245_101972852 | 297 |
| 594 | 3300009098 | Ga0105245_10388259 | Ga0105245_103882592 | 297 |
| 595 | 3300009098 | Ga0105245_10590041 | Ga0105245_105900412 | 297 |
| 596 | 3300009101 | Ga0105247_10064396 | Ga0105247_100643963 | 297 |
| 597 | 3300009148 | Ga0105243_10014110 | Ga0105243_100141104 | 297 |
| 598 | 3300009174 | Ga0105241_10036396 | Ga0105241_100363964 | 297 |
| 599 | 3300009176 | Ga0105242_10005801 | Ga0105242_100058012 | 297 |
| 600 | 3300009176 | Ga0105242_10155557 | Ga0105242_101555573 | 297 |
| 601 | 3300009177 | Ga0105248_10008045 | Ga0105248_100080459 | 297 |
| 602 | 3300009177 | Ga0105248_10013123 | Ga0105248_100131237 | 297 |
| 603 | 3300009177 | Ga0105248_10035492 | Ga0105248_100354925 | 297 |
| 604 | 3300009545 | Ga0105237_10016342 | Ga0105237_100163427 | 297 |
| 605 | 3300009545 | Ga0105237_10197052 | Ga0105237_101970522 | 297 |
| 606 | 3300010375 | Ga0105239_10408675 | Ga0105239_104086751 | 297 |
| 607 | 3300012513 | Ga0157326_1003869 | Ga0157326_10038692 | 297 |
| 608 | 3300013104 | Ga0157370_10135048 | Ga0157370_101350482 | 297 |
| 609 | 3300013104 | Ga0157370_10410735 | Ga0157370_104107352 | 297 |
| 610 | 3300013296 | Ga0157374_10002838 | Ga0157374_100028385 | 297 |
| 611 | 3300013297 | Ga0157378_10005473 | Ga0157378_100054735 | 297 |
| 612 | 3300013297 | Ga0157378_10007861 | Ga0157378_1000786110 | 297 |
| 613 | 3300013297 | Ga0157378_10039249 | Ga0157378_100392494 | 297 |
| 614 | 3300013297 | Ga0157378_10199095 | Ga0157378_101990952 | 297 |
| 615 | 3300013297 | Ga0157378_10696991 | Ga0157378_106969911 | 297 |
| 616 | 3300013306 | Ga0163162_10001908 | Ga0163162_1000190814 | 297 |
| 617 | 3300013306 | Ga0163162_10118849 | Ga0163162_101188494 | 297 |
| 618 | 3300013306 | Ga0163162_10266096 | Ga0163162_102660962 | 297 |
| 619 | 3300013307 | Ga0157372_10189961 | Ga0157372_101899613 | 297 |
| 620 | 3300013308 | Ga0157375_10019566 | Ga0157375_100195667 | 297 |
| 621 | 3300013308 | Ga0157375_10025955 | Ga0157375_100259555 | 297 |
| 622 | 3300014325 | Ga0163163_10009939 | Ga0163163_100099395 | 297 |
| 623 | 3300014325 | Ga0163163_10826337 | Ga0163163_108263371 | 297 |
| 624 | 3300014745 | Ga0157377_10000016 | Ga0157377_10000016134 | 297 |
| 625 | 3300014968 | Ga0157379_10001362 | Ga0157379_1000136216 | 297 |
| 626 | 3300014968 | Ga0157379_10002571 | Ga0157379_100025719 | 297 |
| 627 | 3300014969 | Ga0157376_10001750 | Ga0157376_1000175011 | 297 |
| 628 | 3300014969 | Ga0157376_10603769 | Ga0157376_106037691 | 297 |
| 629 | 3300020070 | Ga0206356_10249116 | Ga0206356_102491162 | 297 |
| 630 | 3300025206 | Ga0209435_100014 | Ga0209435_100014198 | 297 |
| 631 | 3300025208 | Ga0209436_103628 | Ga0209436_1036285 | 297 |
| 632 | 3300025231 | Ga0207427_101622 | Ga0207427_1016222 | 297 |
| 633 | 3300025245 | Ga0207425_1001097 | Ga0207425_10010975 | 297 |
| 634 | 3300025245 | Ga0207425_1003608 | Ga0207425_10036083 | 297 |
| 635 | 3300025246 | Ga0209646_1000001 | Ga0209646_1000001198 | 297 |
| 636 | 3300025250 | Ga0209026_1000137 | Ga0209026_100013792 | 297 |
| 637 | 3300025256 | Ga0209759_1000013 | Ga0209759_1000013198 | 297 |
| 638 | 3300025258 | Ga0209129_1006508 | Ga0209129_10065082 | 297 |
| 639 | 3300025258 | Ga0209129_1009153 | Ga0209129_10091532 | 297 |
| 640 | 3300025263 | Ga0209565_1000028 | Ga0209565_1000028104 | 297 |
| 641 | 3300025263 | Ga0209565_1001085 | Ga0209565_10010854 | 297 |
| 642 | 3300025273 | Ga0209673_1000035 | Ga0209673_1000035231 | 297 |
| 643 | 3300025284 | Ga0209130_1000052 | Ga0209130_1000052148 | 297 |
| 644 | 3300025284 | Ga0209130_1002799 | Ga0209130_10027996 | 297 |
| 645 | 3300025291 | Ga0209675_1000313 | Ga0209675_10003135 | 297 |
| 646 | 3300025291 | Ga0209675_1001685 | Ga0209675_100168513 | 297 |
| 647 | 3300025291 | Ga0209675_1004248 | Ga0209675_10042481 | 297 |
| 648 | 3300025292 | Ga0209676_1000634 | Ga0209676_100063417 | 297 |
| 649 | 3300025292 | Ga0209676_1001748 | Ga0209676_100174818 | 297 |
| 650 | 3300025294 | Ga0209025_1004750 | Ga0209025_10047509 | 297 |
| 651 | 3300025294 | Ga0209025_1005213 | Ga0209025_10052136 | 297 |
| 652 | 3300025294 | Ga0209025_1006139 | Ga0209025_10061392 | 297 |
| 653 | 3300025295 | Ga0209564_1003759 | Ga0209564_100375911 | 297 |
| 654 | 3300025295 | Ga0209564_1010465 | Ga0209564_10104651 | 297 |
| 655 | 3300025295 | Ga0209564_1026419 | Ga0209564_10264192 | 297 |
| 656 | 3300025297 | Ga0209758_1000122 | Ga0209758_100012261 | 297 |
| 657 | 3300025297 | Ga0209758_1020430 | Ga0209758_10204302 | 297 |
| 658 | 3300025298 | Ga0209050_1000023 | Ga0209050_1000023498 | 297 |
| 659 | 3300025298 | Ga0209050_1000677 | Ga0209050_100067720 | 297 |
| 660 | 3300025299 | Ga0209256_1000003 | Ga0209256_10000031248 | 297 |
| 661 | 3300025299 | Ga0209256_1000011 | Ga0209256_100001184 | 297 |
| 662 | 3300025302 | Ga0207426_1000306 | Ga0207426_100030641 | 297 |
| 663 | 3300025303 | Ga0209051_1000016 | Ga0209051_1000016248 | 297 |
| 664 | 3300025303 | Ga0209051_1000017 | Ga0209051_1000017498 | 297 |
| 665 | 3300025304 | Ga0209257_1000041 | Ga0209257_1000041498 | 297 |
| 666 | 3300025304 | Ga0209257_1000102 | Ga0209257_100010245 | 297 |
| 667 | 3300025304 | Ga0209257_1006401 | Ga0209257_10064017 | 297 |
| 668 | 3300025315 | Ga0207697_10121560 | Ga0207697_101215602 | 297 |
| 669 | 3300025321 | Ga0207656_10093521 | Ga0207656_100935212 | 297 |
| 670 | 3300025898 | Ga0207692_10147758 | Ga0207692_101477582 | 297 |
| 671 | 3300025899 | Ga0207642_10002217 | Ga0207642_100022172 | 297 |
| 672 | 3300025899 | Ga0207642_10118025 | Ga0207642_101180251 | 297 |
| 673 | 3300025903 | Ga0207680_10000783 | Ga0207680_100007837 | 297 |
| 674 | 3300025905 | Ga0207685_10036827 | Ga0207685_100368272 | 297 |
| 675 | 3300025907 | Ga0207645_10001729 | Ga0207645_100017296 | 297 |
| 676 | 3300025907 | Ga0207645_10046267 | Ga0207645_100462672 | 297 |
| 677 | 3300025908 | Ga0207643_10018090 | Ga0207643_100180903 | 297 |
| 678 | 3300025910 | Ga0207684_10002424 | Ga0207684_100024242 | 297 |
| 679 | 3300025911 | Ga0207654_10058311 | Ga0207654_100583112 | 297 |
| 680 | 3300025913 | Ga0207695_10107478 | Ga0207695_101074782 | 297 |
| 681 | 3300025913 | Ga0207695_10170355 | Ga0207695_101703552 | 297 |
| 682 | 3300025914 | Ga0207671_10014637 | Ga0207671_100146373 | 297 |
| 683 | 3300025915 | Ga0207693_10001071 | Ga0207693_100010718 | 297 |
| 684 | 3300025916 | Ga0207663_10096972 | Ga0207663_100969723 | 297 |
| 685 | 3300025916 | Ga0207663_10273302 | Ga0207663_102733021 | 297 |
| 686 | 3300025918 | Ga0207662_10051405 | Ga0207662_100514052 | 297 |
| 687 | 3300025919 | Ga0207657_10032680 | Ga0207657_100326802 | 297 |
| 688 | 3300025922 | Ga0207646_10047710 | Ga0207646_100477103 | 297 |
| 689 | 3300025923 | Ga0207681_10008779 | Ga0207681_100087793 | 297 |
| 690 | 3300025925 | Ga0207650_10008631 | Ga0207650_100086313 | 297 |
| 691 | 3300025926 | Ga0207659_10029037 | Ga0207659_100290374 | 297 |
| 692 | 3300025927 | Ga0207687_10000226 | Ga0207687_1000022613 | 297 |
| 693 | 3300025927 | Ga0207687_10003096 | Ga0207687_100030969 | 297 |
| 694 | 3300025927 | Ga0207687_10020926 | Ga0207687_100209264 | 297 |
| 695 | 3300025927 | Ga0207687_10042968 | Ga0207687_100429682 | 297 |
| 696 | 3300025928 | Ga0207700_10029862 | Ga0207700_100298623 | 297 |
| 697 | 3300025928 | Ga0207700_10044625 | Ga0207700_100446254 | 297 |
| 698 | 3300025929 | Ga0207664_10009233 | Ga0207664_100092336 | 297 |
| 699 | 3300025931 | Ga0207644_10007852 | Ga0207644_100078528 | 297 |
| 700 | 3300025931 | Ga0207644_10044136 | Ga0207644_100441364 | 297 |
| 701 | 3300025931 | Ga0207644_10058835 | Ga0207644_100588353 | 297 |
| 702 | 3300025933 | Ga0207706_10001944 | Ga0207706_1000194414 | 297 |
| 703 | 3300025933 | Ga0207706_10093004 | Ga0207706_100930042 | 297 |
| 704 | 3300025933 | Ga0207706_10109511 | Ga0207706_101095113 | 297 |
| 705 | 3300025934 | Ga0207686_10003018 | Ga0207686_100030184 | 297 |
| 706 | 3300025934 | Ga0207686_10178492 | Ga0207686_101784922 | 297 |
| 707 | 3300025936 | Ga0207670_10076474 | Ga0207670_100764742 | 297 |
| 708 | 3300025937 | Ga0207669_10146205 | Ga0207669_101462052 | 297 |
| 709 | 3300025939 | Ga0207665_10060503 | Ga0207665_100605033 | 297 |
| 710 | 3300025940 | Ga0207691_10062634 | Ga0207691_100626343 | 297 |
| 711 | 3300025940 | Ga0207691_10075440 | Ga0207691_100754403 | 297 |
| 712 | 3300025941 | Ga0207711_10000654 | Ga0207711_1000065414 | 297 |
| 713 | 3300025941 | Ga0207711_10008005 | Ga0207711_100080057 | 297 |
| 714 | 3300025941 | Ga0207711_10019605 | Ga0207711_100196054 | 297 |
| 715 | 3300025942 | Ga0207689_10001081 | Ga0207689_1000108111 | 297 |
| 716 | 3300025942 | Ga0207689_10041723 | Ga0207689_100417235 | 297 |
| 717 | 3300025942 | Ga0207689_10159846 | Ga0207689_101598462 | 297 |
| 718 | 3300025945 | Ga0207679_10182538 | Ga0207679_101825382 | 297 |
| 719 | 3300025949 | Ga0207667_10314196 | Ga0207667_103141962 | 297 |
| 720 | 3300025960 | Ga0207651_10035662 | Ga0207651_100356624 | 297 |
| 721 | 3300025972 | Ga0207668_10023608 | Ga0207668_100236082 | 297 |
| 722 | 3300025972 | Ga0207668_10215067 | Ga0207668_102150672 | 297 |
| 723 | 3300025981 | Ga0207640_10022186 | Ga0207640_100221862 | 297 |
| 724 | 3300025981 | Ga0207640_10044617 | Ga0207640_100446172 | 297 |
| 725 | 3300025986 | Ga0207658_10010563 | Ga0207658_100105636 | 297 |
| 726 | 3300025986 | Ga0207658_10079113 | Ga0207658_100791132 | 297 |
| 727 | 3300025986 | Ga0207658_10198489 | Ga0207658_101984892 | 297 |
| 728 | 3300026023 | Ga0207677_10000162 | Ga0207677_1000016233 | 297 |
| 729 | 3300026023 | Ga0207677_10020074 | Ga0207677_100200744 | 297 |
| 730 | 3300026023 | Ga0207677_10064404 | Ga0207677_100644042 | 297 |
| 731 | 3300026023 | Ga0207677_10178645 | Ga0207677_101786452 | 297 |
| 732 | 3300026023 | Ga0207677_10234493 | Ga0207677_102344932 | 297 |
| 733 | 3300026035 | Ga0207703_10001919 | Ga0207703_100019193 | 297 |
| 734 | 3300026035 | Ga0207703_10006661 | Ga0207703_100066618 | 297 |
| 735 | 3300026041 | Ga0207639_10505094 | Ga0207639_105050942 | 297 |
| 736 | 3300026067 | Ga0207678_10058265 | Ga0207678_100582652 | 297 |
| 737 | 3300026067 | Ga0207678_10107131 | Ga0207678_101071312 | 297 |
| 738 | 3300026067 | Ga0207678_10174340 | Ga0207678_101743402 | 297 |
| 739 | 3300026078 | Ga0207702_10134741 | Ga0207702_101347412 | 297 |
| 740 | 3300026088 | Ga0207641_10001702 | Ga0207641_1000170218 | 297 |
| 741 | 3300026088 | Ga0207641_10014054 | Ga0207641_100140543 | 297 |
| 742 | 3300026089 | Ga0207648_10000343 | Ga0207648_1000034352 | 297 |
| 743 | 3300026089 | Ga0207648_10002633 | Ga0207648_100026339 | 297 |
| 744 | 3300026089 | Ga0207648_10003584 | Ga0207648_1000358410 | 297 |
| 745 | 3300026089 | Ga0207648_10035446 | Ga0207648_100354463 | 297 |
| 746 | 3300026089 | Ga0207648_10050801 | Ga0207648_100508013 | 297 |
| 747 | 3300026089 | Ga0207648_10111508 | Ga0207648_101115082 | 297 |
| 748 | 3300026095 | Ga0207676_10000451 | Ga0207676_1000045123 | 297 |
| 749 | 3300026095 | Ga0207676_10003663 | Ga0207676_100036634 | 297 |
| 750 | 3300026116 | Ga0207674_10003102 | Ga0207674_1000310212 | 297 |
| 751 | 3300026116 | Ga0207674_10018325 | Ga0207674_1001832510 | 297 |
| 752 | 3300026116 | Ga0207674_10019808 | Ga0207674_100198088 | 297 |
| 753 | 3300026116 | Ga0207674_10026307 | Ga0207674_100263073 | 297 |
| 754 | 3300026118 | Ga0207675_100003236 | Ga0207675_1000032369 | 297 |
| 755 | 3300026121 | Ga0207683_10000694 | Ga0207683_100006941 | 297 |
| 756 | 3300026121 | Ga0207683_10085353 | Ga0207683_100853532 | 297 |
| 757 | 3300026121 | Ga0207683_10213973 | Ga0207683_102139733 | 297 |
| 758 | 3300027111 | Ga0209281_1000454 | Ga0209281_100045442 | 297 |
| 759 | 3300027665 | Ga0209983_1002922 | Ga0209983_10029223 | 297 |
| 760 | 3300027866 | Ga0209813_10005461 | Ga0209813_100054611 | 297 |
| 761 | 3300027876 | Ga0209974_10006322 | Ga0209974_100063222 | 297 |
| 762 | 3300027907 | Ga0207428_10003085 | Ga0207428_100030857 | 297 |
| 763 | 3300028379 | Ga0268266_10102857 | Ga0268266_101028572 | 297 |
| 764 | 3300028380 | Ga0268265_10006699 | Ga0268265_100066998 | 297 |
| 765 | 3300028380 | Ga0268265_10117454 | Ga0268265_101174542 | 297 |
| 766 | 3300028381 | Ga0268264_10001000 | Ga0268264_1000100013 | 297 |
| 767 | 3300028381 | Ga0268264_10002760 | Ga0268264_100027605 | 297 |
| 768 | 3300028381 | Ga0268264_10012398 | Ga0268264_100123988 | 297 |
| 769 | 3300028786 | Ga0307517_10000358 | Ga0307517_100003587 | 297 |
| 770 | 3300028786 | Ga0307517_10098884 | Ga0307517_100988842 | 297 |
| 771 | 3300028794 | Ga0307515_10003649 | Ga0307515_1000364930 | 297 |
| 772 | 3300028794 | Ga0307515_10003668 | Ga0307515_1000366818 | 297 |
| 773 | 3300028794 | Ga0307515_10009465 | Ga0307515_100094658 | 297 |
| 774 | 3300028794 | Ga0307515_10010929 | Ga0307515_1001092910 | 297 |
| 775 | 3300028794 | Ga0307515_10211556 | Ga0307515_102115562 | 297 |
| 776 | 3300028794 | Ga0307515_10248604 | Ga0307515_102486042 | 297 |
| 777 | 3300030522 | Ga0307512_10031625 | Ga0307512_100316252 | 297 |
| 778 | 3300030522 | Ga0307512_10055700 | Ga0307512_100557003 | 297 |
| 779 | 3300031456 | Ga0307513_10000006 | Ga0307513_10000006411 | 297 |
| 780 | 3300031456 | Ga0307513_10005054 | Ga0307513_100050543 | 297 |
| 781 | 3300031456 | Ga0307513_10007938 | Ga0307513_100079389 | 297 |
| 782 | 3300031456 | Ga0307513_10009552 | Ga0307513_100095523 | 297 |
| 783 | 3300031456 | Ga0307513_10025822 | Ga0307513_100258224 | 297 |
| 784 | 3300031507 | Ga0307509_10001694 | Ga0307509_1000169411 | 297 |
| 785 | 3300031507 | Ga0307509_10005213 | Ga0307509_100052139 | 297 |
| 786 | 3300031507 | Ga0307509_10017599 | Ga0307509_100175993 | 297 |
| 787 | 3300031507 | Ga0307509_10052291 | Ga0307509_100522914 | 297 |
| 788 | 3300031507 | Ga0307509_10059437 | Ga0307509_100594375 | 297 |
| 789 | 3300031548 | Ga0307408_100000008 | Ga0307408_100000008270 | 297 |
| 790 | 3300031548 | Ga0307408_100021375 | Ga0307408_1000213755 | 297 |
| 791 | 3300031616 | Ga0307508_10000466 | Ga0307508_1000046632 | 297 |
| 792 | 3300031616 | Ga0307508_10007101 | Ga0307508_100071017 | 297 |
| 793 | 3300031616 | Ga0307508_10137663 | Ga0307508_101376632 | 297 |
| 794 | 3300031616 | Ga0307508_10192859 | Ga0307508_101928592 | 297 |
| 795 | 3300031616 | Ga0307508_10192873 | Ga0307508_101928732 | 297 |
| 796 | 3300031649 | Ga0307514_10004420 | Ga0307514_100044208 | 297 |
| 797 | 3300031730 | Ga0307516_10000705 | Ga0307516_1000070519 | 297 |
| 798 | 3300031730 | Ga0307516_10018606 | Ga0307516_100186066 | 297 |
| 799 | 3300031730 | Ga0307516_10035658 | Ga0307516_100356585 | 297 |
| 800 | 3300031730 | Ga0307516_10044796 | Ga0307516_100447965 | 297 |
| 801 | 3300031730 | Ga0307516_10211964 | Ga0307516_102119642 | 297 |
| 802 | 3300031731 | Ga0307405_10013240 | Ga0307405_100132403 | 297 |
| 803 | 3300031824 | Ga0307413_10005108 | Ga0307413_100051087 | 297 |
| 804 | 3300031852 | Ga0307410_10098792 | Ga0307410_100987922 | 297 |
| 805 | 3300031911 | Ga0307412_10004381 | Ga0307412_100043817 | 297 |
| 806 | 3300031995 | Ga0307409_100010785 | Ga0307409_1000107855 | 297 |
| 807 | 3300032004 | Ga0307414_10106044 | Ga0307414_101060443 | 297 |
| 808 | 3300032005 | Ga0307411_10217607 | Ga0307411_102176072 | 297 |
| 809 | 3300033180 | Ga0307510_10087868 | Ga0307510_100878684 | 297 |
| 810 | 3300033180 | Ga0307510_10095894 | Ga0307510_100958942 | 297 |
| 811 | 3300033180 | Ga0307510_10214108 | Ga0307510_102141082 | 297 |
| 812 | 3300035111 | Ga0373923_0051464 | Ga0373923_0051464_625_1560 | 297 |
| 813 | 3300035113 | Ga0373936_0000007 | Ga0373936_0000007_283963_284883 | 297 |
| 814 | 3300035116 | Ga0373945_0040008 | Ga0373945_0040008_739_1674 | 297 |
| 815 | 3300035117 | Ga0373953_0003327 | Ga0373953_0003327_402_1337 | 297 |
| 816 | 3300035119 | Ga0373956_0007335 | Ga0373956_0007335_3251_4186 | 297 |
| 817 | 3300035170 | Ga0373943_0048925 | Ga0373943_0048925_614_1549 | 297 |
| 818 | 3300035172 | Ga0373955_0039097 | Ga0373955_0039097_1233_2168 | 297 |
| 819 | 3300035692 | Ga0373935_0081080 | Ga0373935_0081080_1061_1999 | 297 |
| 820 | 3300035724 | Ga0373933_0004441 | Ga0373933_0004441_4362_5297 | 297 |
| 821 | 3300037068 | Ga0373925_0054821 | Ga0373925_0054821_399_1334 | 297 |
| 822 | 3300037312 | Ga0395899_0114460 | Ga0395899_0114460_565_1464 | 297 |
| 823 | 3300037466 | Ga0395898_0010903 | Ga0395898_0010903_1087_1986 | 297 |
| 824 | 3300038443 | Ga0395901_0095838 | Ga0395901_0095838_1123_2022 | 297 |
| 825 | 3300041452 | Ga0451793_1206373 | Ga0451793_1206373_2150_3049 | 297 |
| 826 | 3300041491 | Ga0451833_0389704 | Ga0451833_0389704_141_1037 | 297 |
| 827 | 3300041512 | Ga0451853_1826268 | Ga0451853_1826268_196_1095 | 297 |
| 828 | 3300042012 | Ga0439455_0050679 | Ga0439455_0050679_70_1011 | 297 |
| 829 | 3300042127 | Ga0450890_007314 | Ga0450890_007314_63_971 | 297 |
| 830 | 3300042157 | Ga0439458_0019362 | Ga0439458_0019362_251_1147 | 297 |
| 831 | 3300042435 | Ga0439434_0069043 | Ga0439434_0069043_63_986 | 297 |
| 832 | 3300042876 | Ga0451577_0003070 | Ga0451577_0003070_3470_4375 | 297 |
| 833 | 3300044712 | Ga0453684_0009366 | Ga0453684_0009366_4468_5373 | 297 |
| 834 | 3300044712 | Ga0453684_0030654 | Ga0453684_0030654_3159_4064 | 297 |
| 835 | 3300045051 | Ga0451576_0005545 | Ga0451576_0005545_2767_3672 | 297 |
| 836 | 3300045051 | Ga0451576_0320874 | Ga0451576_0320874_259_1182 | 297 |
| 837 | 3300046454 | Ga0495592_0000264 | Ga0495592_0000264_8191_9102 | 297 |
| 838 | 3300046471 | Ga0495650_0014118 | Ga0495650_0014118_187_1083 | 297 |
| 839 | 3300046477 | Ga0495664_0033908 | Ga0495664_0033908_1013_1948 | 297 |
| 840 | 3300046512 | Ga0495610_0036459 | Ga0495610_0036459_1113_2027 | 297 |
| 841 | 3300046515 | Ga0495620_0108920 | Ga0495620_0108920_175_1086 | 297 |
| 842 | 3300046516 | Ga0495628_0251197 | Ga0495628_0251197_168_1079 | 297 |
| 843 | 3300046519 | Ga0495632_0026840 | Ga0495632_0026840_948_1844 | 297 |
| 844 | 3300046522 | Ga0495643_0171179 | Ga0495643_0171179_41_937 | 297 |
| 845 | 3300046543 | Ga0495645_0019219 | Ga0495645_0019219_1808_2743 | 297 |
| 846 | 3300046660 | Ga0495625_0001726 | Ga0495625_0001726_19050_19949 | 297 |
| 847 | 3300046660 | Ga0495625_0009831 | Ga0495625_0009831_2237_3133 | 297 |
| 848 | 3300046683 | Ga0495658_0254206 | Ga0495658_0254206_154_1062 | 297 |
| 849 | 3300046692 | Ga0495671_0044283 | Ga0495671_0044283_462_1367 | 297 |
| 850 | 3300046692 | Ga0495671_0154019 | Ga0495671_0154019_51_965 | 297 |
| 851 | 3300046694 | Ga0495649_0015742 | Ga0495649_0015742_2307_3203 | 297 |
| 852 | 3300046810 | Ga0495660_0122438 | Ga0495660_0122438_389_1285 | 297 |
| 853 | 3300047443 | Ga0495687_000212 | Ga0495687_000212_36776_37672 | 297 |
| 854 | 3300047673 | Ga0495593_0022467 | Ga0495593_0022467_1019_1930 | 297 |
| 855 | 3300048091 | Ga0495626_0032592 | Ga0495626_0032592_718_1614 | 297 |
| 856 | 3300048906 | Ga0496103_0042225 | Ga0496103_0042225_491_1393 | 297 |
| 857 | 3300048907 | Ga0496104_0007078 | Ga0496104_0007078_4498_5433 | 297 |
| 858 | 3300048908 | Ga0496105_0001968 | Ga0496105_0001968_12268_13203 | 297 |
| 859 | 3300048909 | Ga0496106_0180640 | Ga0496106_0180640_77_1012 | 297 |
| 860 | 3300048911 | Ga0496108_0017714 | Ga0496108_0017714_2548_3450 | 297 |
| 861 | 3300048912 | Ga0496109_0000170 | Ga0496109_0000170_49698_50609 | 297 |
| 862 | 3300048912 | Ga0496109_0040742 | Ga0496109_0040742_3074_4009 | 297 |
| 863 | 3300048915 | Ga0496112_0000241 | Ga0496112_0000241_14133_15068 | 297 |
| 864 | 3300048917 | Ga0496114_0003680 | Ga0496114_0003680_7107_8006 | 297 |
| 865 | 3300048917 | Ga0496114_0156636 | Ga0496114_0156636_313_1248 | 297 |
| 866 | 3300048918 | Ga0496115_0079611 | Ga0496115_0079611_1696_2631 | 297 |
| 867 | 3300048929 | Ga0496126_0451417 | Ga0496126_0451417_123_1022 | 297 |
| 868 | 3300050489 | nmdc:mga03683_47022_c1 | nmdc:mga03683_47022_c1_92_988 | 297 |
| 869 | 3300050492 | nmdc:mga0yw44_260643_c1 | nmdc:mga0yw44_260643_c1_233_1129 | 297 |
| 870 | 3300050493 | nmdc:mga0k408_13359_c1 | nmdc:mga0k408_13359_c1_1013_1909 | 297 |
| 871 | 3300050493 | nmdc:mga0k408_186104_c1 | nmdc:mga0k408_186104_c1_77_976 | 297 |
| 872 | 3300050493 | nmdc:mga0k408_20709_c1 | nmdc:mga0k408_20709_c1_1389_2285 | 297 |
| 873 | 3300050493 | nmdc:mga0k408_237034_c1 | nmdc:mga0k408_237034_c1_69_980 | 297 |
| 874 | 3300050493 | nmdc:mga0k408_585_c1 | nmdc:mga0k408_585_c1_8324_9235 | 297 |
| 875 | 3300050493 | nmdc:mga0k408_97470_c1 | nmdc:mga0k408_97470_c1_333_1229 | 297 |
| 876 | 3300050494 | nmdc:mga06z11_14050_c1 | nmdc:mga06z11_14050_c1_2250_3161 | 297 |
| 877 | 3300050494 | nmdc:mga06z11_5847_c1 | nmdc:mga06z11_5847_c1_1516_2412 | 297 |
| 878 | 3300050495 | nmdc:mga04h51_23644_c1 | nmdc:mga04h51_23644_c1_81_977 | 297 |
| 879 | 3300050496 | nmdc:mga07m45_247_c1 | nmdc:mga07m45_247_c1_16879_17775 | 297 |
| 880 | 3300050496 | nmdc:mga07m45_41439_c1 | nmdc:mga07m45_41439_c1_1429_2325 | 297 |
| 881 | 3300050496 | nmdc:mga07m45_75668_c1 | nmdc:mga07m45_75668_c1_379_1275 | 297 |
| 882 | 3300050496 | nmdc:mga07m45_79961_c1 | nmdc:mga07m45_79961_c1_381_1337 | 297 |
| 883 | 3300050507 | nmdc:mga05p37_573265_c1 | nmdc:mga05p37_573265_c1_115_1056 | 297 |
| 884 | 3300050507 | nmdc:mga05p37_78140_c1 | nmdc:mga05p37_78140_c1_1792_2733 | 297 |
| 885 | 3300050510 | nmdc:mga06r32_17024_c1 | nmdc:mga06r32_17024_c1_932_1843 | 297 |
| 886 | 3300050510 | nmdc:mga06r32_7429_c1 | nmdc:mga06r32_7429_c1_2099_2992 | 297 |
| 887 | 3300050511 | nmdc:mga08y16_17893_c1 | nmdc:mga08y16_17893_c1_772_1713 | 297 |
| 888 | 3300050516 | nmdc:mga0sz30_51897_c1 | nmdc:mga0sz30_51897_c1_216_1112 | 297 |
| 889 | 3300053088 | Ga0500644_0008778 | Ga0500644_0008778_593_1486 | 297 |
| 890 | 3300053088 | Ga0500644_0015654 | Ga0500644_0015654_1082_1996 | 297 |
| 891 | 3300053092 | Ga0500583_0120754 | Ga0500583_0120754_110_1021 | 297 |
| 892 | 3300053093 | Ga0500651_0027117 | Ga0500651_0027117_1144_2058 | 297 |
| 893 | 3300053117 | Ga0500593_000435 | Ga0500593_000435_2901_3812 | 297 |
| 894 | 3300053117 | Ga0500593_000657 | Ga0500593_000657_7573_8466 | 297 |
| 895 | 3300053118 | Ga0500594_0018492 | Ga0500594_0018492_571_1485 | 297 |
| 896 | 3300053129 | Ga0500628_003280 | Ga0500628_003280_1357_2250 | 297 |
| 897 | 3300053134 | Ga0500658_0009390 | Ga0500658_0009390_2687_3583 | 297 |
| 898 | 3300053136 | Ga0500559_0000092 | Ga0500559_0000092_41019_41933 | 297 |
| 899 | 3300053139 | Ga0500568_0038601 | Ga0500568_0038601_881_1777 | 297 |
| 900 | 3300053156 | Ga0500622_0011299 | Ga0500622_0011299_792_1706 | 297 |
| 901 | 3300053177 | Ga0500636_0004915 | Ga0500636_0004915_5316_6212 | 297 |
| 902 | 3300053730 | Ga0500645_000474 | Ga0500645_000474_12070_12963 | 297 |
| 903 | 3300053730 | Ga0500645_019479 | Ga0500645_019479_779_1672 | 297 |
| 904 | 3300055283 | Ga0500661_004529 | Ga0500661_004529_695_1591 | 297 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5hmq-assembly1.cif.gz_A | xylose isomerase-like tim barrel/4-hydroxyphenylpyruvate dioxygenase fusion protein | 0.9529 | 9 | 282 |
| 5hmq-assembly3.cif.gz_E | xylose isomerase-like tim barrel/4-hydroxyphenylpyruvate dioxygenase fusion protein | 0.9528 | 9 | 282 |
| 5hmq-assembly3.cif.gz_D | xylose isomerase-like tim barrel/4-hydroxyphenylpyruvate dioxygenase fusion protein | 0.9526 | 9 | 282 |
| 5hmq-assembly1.cif.gz_C | xylose isomerase-like tim barrel/4-hydroxyphenylpyruvate dioxygenase fusion protein | 0.9526 | 9 | 282 |
| 5hmq-assembly2.cif.gz_B | xylose isomerase-like tim barrel/4-hydroxyphenylpyruvate dioxygenase fusion protein | 0.9525 | 9 | 282 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1i60A00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes | 0.8644 | 11 | 284 | 3.20.20.150 |
| 2g0wB00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes | 0.8623 | 9 | 288 | 3.20.20.150 |
| 2q02C00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes | 0.8577 | 10 | 278 | 3.20.20.150 |
| 1i60A00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes | 0.8465 | 11 | 284 | 3.20.20.150 |
| 2q02C00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes | 0.8338 | 10 | 278 | 3.20.20.150 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-H0Q617-F1-model_v4 | Putative 4-hydroxyphenylpyruvate dioxygenase | 0.9828 | 8 | 286 |
GO:0051213
|
| AF-A0A7V2XMM7-F1-model_v4 | Sugar phosphate isomerase/epimerase | 0.9825 | 5 | 205 |
GO:0016853
|
| AF-A0A536Z2G5-F1-model_v4 | Sugar phosphate isomerase/epimerase | 0.98 | 8 | 243 |
GO:0016853
|
| AF-A0A6J4PQ75-F1-model_v4 | 4-hydroxyphenylpyruvate dioxygenase (EC 1.13.11.27) | 0.9779 | 7 | 115 |
GO:0003868
|
| AF-B9Z2U2-F1-model_v4 | Xylose isomerase domain protein TIM barrel | 0.9771 | 9 | 285 |
GO:0016853
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar