F485282

General Info

Members Datasets Scaffolds Average Seq Length
904 393 1808 320

Family's Representative Sequence

Representative Sequence 3300034957|Ga0373938_0000189|Ga0373938_0000189_7042_8070
Length 342
Sequence VDACTPLSEFSRPFRLFLHVELLMAGPVIAVTDSVFPSLDPAKAALSRLNPTYRMAKSANADDILAVAKDADAILVTYAKLTREILSQLTRCRAIGRFGLGVDNIDLAAAKEKGIAVNYVPDYCIREVSDHAMALLLALIRKIPLSNKLVQGGRWEMPAVVPIRRIEGTVLGLVGFGHIPRLVAPKAQAFGMKVIAFDPFAKADVFKAARVESVDFDTLLNRSDYVSVHAPHTPQTRGMMNAAVFAKMKKGAYIINTARGPLIDEPALVAALDSGQVGGAGLDVVTAEPLAKDSPLLGRDNVIISPHTAFYSIEALEELQTKCASDVARVLSGEKAVYPISA

Samples

Sample ID Description Type Environment
1 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
2 2209111006 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 Metagenome Rhizosphere
3 3300000041 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere Metagenome Rhizosphere
4 3300000042 Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young Metagenome Rhizosphere
5 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
6 3300000044 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old Metagenome Rhizosphere
7 3300000045 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis Col-0 old rhizosphere Metagenome Rhizosphere
8 3300000652 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA Metagenome Rhizosphere
9 3300001430 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 Metagenome Rhizosphere
10 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
11 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
12 3300001978 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 Metagenome Rhizosphere
13 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
14 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
15 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
16 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
17 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
18 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
19 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
20 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
21 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
22 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
23 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
24 3300005276 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Mutant cpr5 v1 Metagenome Rhizosphere
25 3300005277 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v2 (version 2) Metagenome Rhizosphere
26 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
27 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
28 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
29 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
30 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
31 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
32 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
33 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
34 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
35 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
36 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
37 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
38 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
39 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
40 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
41 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
42 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
43 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
44 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
45 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
46 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
47 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
48 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
49 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
50 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
51 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
52 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
53 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
54 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
55 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
56 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
57 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
58 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
59 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
60 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
61 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
62 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
63 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
64 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
65 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
66 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
67 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
68 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
69 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
70 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
71 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
72 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
73 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
74 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
75 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
76 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
77 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
78 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
79 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
80 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
81 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
82 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
83 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
84 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
85 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
86 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
87 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
88 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
89 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
90 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
91 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
92 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
93 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
94 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
95 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
96 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
97 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
98 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
99 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
100 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
101 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
102 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
103 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
104 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
105 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
106 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
107 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
108 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
109 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
110 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
111 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
112 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
113 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
114 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
115 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
116 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
117 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
118 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
119 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
120 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
121 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
122 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
123 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
124 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
125 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
126 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
127 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
128 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
129 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
130 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
131 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
132 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
133 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
134 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
135 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
136 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
137 3300012507 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 Metagenome Rhizosphere
138 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
139 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
140 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
141 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
142 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
143 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
144 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
145 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
146 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
147 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
148 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
149 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
150 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
151 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
152 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
154 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
212 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
213 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
215 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
216 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
217 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
218 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
219 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
220 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
221 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
223 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
224 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
225 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
226 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
227 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
228 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
229 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
230 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
231 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
232 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
233 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
234 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
235 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
236 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
237 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
238 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
239 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
240 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
241 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
242 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
243 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
244 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
245 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
246 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
247 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
248 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
249 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
250 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
251 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
252 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
253 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
254 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
255 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
256 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
257 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
258 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
259 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
260 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
261 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
262 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
263 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
264 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
265 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
266 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
267 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
268 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
269 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
270 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
271 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
272 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
273 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
274 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
275 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
276 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
277 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
278 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
279 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
280 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
281 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
282 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
283 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
284 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
285 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
286 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
287 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
288 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
289 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
290 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
291 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
292 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
293 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
294 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
295 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
296 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
297 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
298 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
299 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
300 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
301 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
302 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
303 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
304 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
305 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
306 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
307 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
308 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
309 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
310 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
311 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
312 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
313 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
314 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
315 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
316 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
317 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
318 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
319 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
320 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
321 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
322 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
323 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
324 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
325 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
326 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
327 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
328 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
329 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
330 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
331 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
332 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
333 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
334 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
335 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
336 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
337 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
338 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
339 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
340 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
341 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
342 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
343 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
344 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
345 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
346 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
347 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
348 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
349 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
350 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
351 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
352 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
353 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
354 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
355 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
356 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
357 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
358 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
359 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
360 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
361 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
362 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
363 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
364 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
365 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
366 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
367 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
368 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
369 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
370 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
371 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
372 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
373 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
374 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
375 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
376 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
377 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
378 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
379 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
380 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
381 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
382 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
383 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
384 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
385 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
386 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
387 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
388 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
389 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
390 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
391 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
392 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
393 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.55
Nodule 0
Rhizoplane 9.62
Rhizosphere 89.71
Stem 0
Stem Tuber 0
Unclassified 6.42

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0373938_0000189 3300034957 Bacteria 9118
2 2214736890 2209111006 Bacteria 4039
3 ARcpr5oldR_c000047 3300000041 Bacteria 22345
4 ARSoilYngRDRAFT_c00157 3300000042 Bacteria 11648
5 ARcpr5yngRDRAFT_c000017 3300000043 Bacteria 27988
6 ARSoilOldRDRAFT_c000006 3300000044 Bacteria 57169
7 ARCol0oldRDRAFT_c00392 3300000045 Bacteria 4208
8 ARCol0yngRDRAFT_1000043 3300000652 Bacteria 21432
9 JGI24032J14994_100260 3300001430 Bacteria 2785
10 JGI24741J21665_1002498 3300001915 Bacteria 4757
11 JGI24746J21847_1000993 3300001977 Bacteria 4458
12 JGI24747J21853_1003133 3300001978 Bacteria 1413
13 JGI24737J22298_10001790 3300001990 Bacteria 7694
14 JGI24737J22298_10002208 3300001990 Bacteria 6938
15 JGI24750J21931_1000171 3300002070 Bacteria 10831
16 JGI24745J21846_1000194 3300002073 Bacteria 4922
17 JGI24748J21848_1000395 3300002074 Bacteria 4944
18 JGI24738J21930_10000071 3300002075 Bacteria 21500
19 JGI24744J21845_10001362 3300002077 Bacteria 4835
20 JGI24033J26618_1000207 3300002155 Bacteria 7000
21 JGI24034J26672_10001193 3300002239 Bacteria 3399
22 JGI24742J22300_10000213 3300002244 Bacteria 8631
23 JGI24751J29686_10003110 3300002459 Bacteria 3343
24 JGI25405J52794_10005976 3300003911 Bacteria 2216
25 Ga0065717_1002446 3300005276 Bacteria 1971
26 Ga0065716_1001557 3300005277 Bacteria 6670
27 Ga0065712_10000757 3300005290 Bacteria 8523
28 Ga0065712_10001275 3300005290 Bacteria 6623
29 Ga0065712_10004439 3300005290 Bacteria 5624
30 Ga0065715_10005549 3300005293 Bacteria 7449
31 Ga0065715_10089468 3300005293 Bacteria 10045
32 Ga0065715_10096866 3300005293 Bacteria 3803
33 Ga0070676_10000243 3300005328 Bacteria 23510
34 Ga0070683_100011399 3300005329 Bacteria 7685
35 Ga0070683_100053101 3300005329 Bacteria 3755
36 Ga0070690_100036222 3300005330 Bacteria 3099
37 Ga0070690_100239110 3300005330 Bacteria 1280
38 Ga0070670_100017245 3300005331 Bacteria 6193
39 Ga0070670_100029525 3300005331 Bacteria 4720
40 Ga0070670_100045450 3300005331 Bacteria 3775
41 Ga0070677_10000354 3300005333 Bacteria 16037
42 Ga0068869_100000203 3300005334 Bacteria 31014
43 Ga0070666_10019333 3300005335 Plasmid 4396
44 Ga0070666_10022117 3300005335 Bacteria 4127
45 Ga0070666_10057341 3300005335 Bacteria 2631
46 Ga0070666_10079713 3300005335 Bacteria 2236
47 Ga0070680_100002314 3300005336 Bacteria 14060
48 Ga0070680_100046059 3300005336 Bacteria 3547
49 Ga0070682_100000935 3300005337 Bacteria 17035
50 Ga0070682_100034840 3300005337 Bacteria 3068
51 Ga0068868_100002681 3300005338 Bacteria 12350
52 Ga0070660_100002042 3300005339 Bacteria 13931
53 Ga0070660_100017351 3300005339 Bacteria 5246
54 Ga0070660_100161124 3300005339 Bacteria 1808
55 Ga0070689_100004641 3300005340 Bacteria 9306
56 Ga0070689_100007095 3300005340 Bacteria 7804
57 Ga0070689_100033260 3300005340 Bacteria 3927
58 Ga0070691_10000067 3300005341 Bacteria 28711
59 Ga0070687_100000177 3300005343 Bacteria 22163
60 Ga0070661_100001273 3300005344 Bacteria 17718
61 Ga0070661_100049725 3300005344 Unclassified 3069
62 Ga0070692_10000279 3300005345 Bacteria 14346
63 Ga0070668_100001472 3300005347 Bacteria 17006
64 Ga0070668_100014983 3300005347 Bacteria 5791
65 Ga0070668_100397058 3300005347 Bacteria 1177
66 Ga0070669_100001453 3300005353 Bacteria 17173
67 Ga0070669_100026971 3300005353 Bacteria 4134
68 Ga0070675_100009187 3300005354 Bacteria 7677
69 Ga0070675_100130105 3300005354 Bacteria 2144
70 Ga0070671_100001883 3300005355 Bacteria 16034
71 Ga0070671_100358671 3300005355 Bacteria 1244
72 Ga0070674_100000681 3300005356 Bacteria 17167
73 Ga0070674_100208891 3300005356 Bacteria 1512
74 Ga0070673_100000855 3300005364 Bacteria 17061
75 Ga0070673_100020847 3300005364 Bacteria 4736
76 Ga0070673_100063544 3300005364 Bacteria 2938
77 Ga0070688_100003962 3300005365 Bacteria 7677
78 Ga0070688_100007807 3300005365 Bacteria 5781
79 Ga0070688_100067173 3300005365 Bacteria 2283
80 Ga0070659_100000865 3300005366 Bacteria 22133
81 Ga0070659_100024645 3300005366 Bacteria 4614
82 Ga0070659_100090462 3300005366 Bacteria 2452
83 Ga0070667_100002230 3300005367 Bacteria 17055
84 Ga0070667_100064439 3300005367 Plasmid 3109
85 Ga0070667_100113677 3300005367 Bacteria 2350
86 Ga0070667_100304025 3300005367 Bacteria 1436
87 Ga0070703_10001642 3300005406 Bacteria 6647
88 Ga0070703_10028220 3300005406 Bacteria 1677
89 Ga0070709_10000219 3300005434 Bacteria 37061
90 Ga0070714_100309849 3300005435 Bacteria 1474
91 Ga0070713_100000224 3300005436 Bacteria 37679
92 Ga0070713_100315963 3300005436 Bacteria 1441
93 Ga0070713_100418523 3300005436 Bacteria 1254
94 Ga0070710_10000956 3300005437 Bacteria 13707
95 Ga0070710_10024912 3300005437 Bacteria 3162
96 Ga0070710_10064585 3300005437 Bacteria 2094
97 Ga0070701_10005114 3300005438 Bacteria 5388
98 Ga0070701_10007452 3300005438 Bacteria 4677
99 Ga0070711_100046600 3300005439 Bacteria 2954
100 Ga0070711_100074337 3300005439 Bacteria 2403
101 Ga0070711_100093115 3300005439 Bacteria 2175
102 Ga0070711_100108359 3300005439 Bacteria 2035
103 Ga0070705_100005835 3300005440 Bacteria 6023
104 Ga0070700_100005851 3300005441 Bacteria 6529
105 Ga0070700_100187315 3300005441 Bacteria 1444
106 Ga0070694_100003826 3300005444 Bacteria 8991
107 Ga0070694_100006136 3300005444 Bacteria 7291
108 Ga0070708_100109315 3300005445 Bacteria 2540
109 Ga0070663_100006960 3300005455 Bacteria 6847
110 Ga0070663_100173142 3300005455 Bacteria 1669
111 Ga0070663_100365481 3300005455 Bacteria 1171
112 Ga0070678_100001091 3300005456 Bacteria 14198
113 Ga0070678_100005289 3300005456 Bacteria 7438
114 Ga0070678_100467563 3300005456 Unclassified 1107
115 Ga0070662_100002349 3300005457 Bacteria 11640
116 Ga0070662_100070604 3300005457 Bacteria 2574
117 Ga0070681_10024485 3300005458 Bacteria 6076
118 Ga0070681_10053992 3300005458 Bacteria 4004
119 Ga0070681_10143449 3300005458 Bacteria 2317
120 Ga0068867_100000679 3300005459 Bacteria 22540
121 Ga0070685_10004534 3300005466 Bacteria 7029
122 Ga0070685_10009881 3300005466 Bacteria 4948
123 Ga0070707_100398354 3300005468 Bacteria 1337
124 Ga0070698_100334228 3300005471 Bacteria 1446
125 Ga0070699_100042469 3300005518 Bacteria 3934
126 Ga0070679_100023517 3300005530 Bacteria 6032
127 Ga0070679_100072165 3300005530 Bacteria 3444
128 Ga0070679_100237237 3300005530 Bacteria 1782
129 Ga0070684_100009436 3300005535 Bacteria 7685
130 Ga0068853_100005760 3300005539 Bacteria 9755
131 Ga0068853_100066309 3300005539 Unclassified 3134
132 Ga0068853_100372742 3300005539 Bacteria 1332
133 Ga0070672_100006901 3300005543 Bacteria 7677
134 Ga0070672_100179904 3300005543 Bacteria 1762
135 Ga0070672_100369301 3300005543 Bacteria 1225
136 Ga0070686_100001302 3300005544 Bacteria 14092
137 Ga0070686_100007436 3300005544 Bacteria 6113
138 Ga0070686_100008195 3300005544 Bacteria 5848
139 Ga0070695_100002461 3300005545 Bacteria 10663
140 Ga0070695_100035427 3300005545 Bacteria 3135
141 Ga0070696_100001783 3300005546 Bacteria 14106
142 Ga0070696_100063265 3300005546 Bacteria 2592
143 Ga0070696_100207079 3300005546 Bacteria 1467
144 Ga0070693_100002420 3300005547 Bacteria 8583
145 Ga0070693_100020181 3300005547 Bacteria 3510
146 Ga0070693_100032492 3300005547 Bacteria 2871
147 Ga0070665_100007393 3300005548 Bacteria 11177
148 Ga0070665_100044933 3300005548 Plasmid 4434
149 Ga0070665_100270254 3300005548 Bacteria 1702
150 Ga0070665_100285507 3300005548 Unclassified 1652
151 Ga0070704_100004905 3300005549 Bacteria 7766
152 Ga0070704_100008656 3300005549 Bacteria 6117
153 Ga0070704_100300021 3300005549 Bacteria 1338
154 Ga0070704_100385894 3300005549 Bacteria 1191
155 Ga0068855_100010931 3300005563 Bacteria 10955
156 Ga0070664_100008419 3300005564 Bacteria 8340
157 Ga0070664_100080870 3300005564 Bacteria 2799
158 Ga0070664_100187041 3300005564 Bacteria 1844
159 Ga0068857_100000534 3300005577 Bacteria 27500
160 Ga0068857_100221056 3300005577 Bacteria 1730
161 Ga0068854_100007195 3300005578 Bacteria 7107
162 Ga0068856_100000272 3300005614 Bacteria 56279
163 Ga0068856_100395948 3300005614 Bacteria 1401
164 Ga0070702_100006314 3300005615 Bacteria 5601
165 Ga0068852_100003393 3300005616 Bacteria 11127
166 Ga0068859_100003965 3300005617 Bacteria 15100
167 Ga0068859_100041550 3300005617 Bacteria 4618
168 Ga0068859_100082748 3300005617 Bacteria 3252
169 Ga0068859_100232466 3300005617 Unclassified 1932
170 Ga0068864_100006326 3300005618 Bacteria 9712
171 Ga0068864_100009979 3300005618 Bacteria 7836
172 Ga0068864_100582154 3300005618 Unclassified 1084
173 Ga0068866_10000252 3300005718 Bacteria 25051
174 Ga0068866_10040918 3300005718 Bacteria 2297
175 Ga0068861_100001032 3300005719 Bacteria 17052
176 Ga0068861_100046020 3300005719 Bacteria 3288
177 Ga0068861_100213103 3300005719 Unclassified 1628
178 Ga0068870_10000092 3300005840 Bacteria 29393
179 Ga0068863_100017599 3300005841 Bacteria 6847
180 Ga0068863_100103188 3300005841 Bacteria 2712
181 Ga0068863_100260484 3300005841 Bacteria 1676
182 Ga0068863_100472007 3300005841 Bacteria 1233
183 Ga0068858_100003904 3300005842 Bacteria 14725
184 Ga0068858_100007004 3300005842 Bacteria 10952
185 Ga0068858_100060938 3300005842 Bacteria 3488
186 Ga0068858_100105241 3300005842 Bacteria 2633
187 Ga0068858_100107069 3300005842 Unclassified 2609
188 Ga0068860_100003148 3300005843 Bacteria 17055
189 Ga0068860_100062392 3300005843 Bacteria 3541
190 Ga0068860_100314652 3300005843 Bacteria 1536
191 Ga0068862_100019495 3300005844 Bacteria 5662
192 Ga0068862_100053228 3300005844 Bacteria 3464
193 Ga0081455_10000185 3300005937 Bacteria 78750
194 Ga0081455_10010009 3300005937 Bacteria 9692
195 Ga0081455_10048349 3300005937 Bacteria 3676
196 Ga0070717_10000285 3300006028 Bacteria 34330
197 Ga0070717_10201997 3300006028 Bacteria 1741
198 Ga0075365_10006667 3300006038 Bacteria 6379
199 Ga0075368_10053959 3300006042 Bacteria 1601
200 Ga0075432_10000240 3300006058 Bacteria 14777
201 Ga0070715_10007982 3300006163 Plasmid 3669
202 Ga0070715_10054620 3300006163 Bacteria 1730
203 Ga0070716_100004717 3300006173 Bacteria 6537
204 Ga0070716_100268151 3300006173 Bacteria 1172
205 Ga0070712_100034230 3300006175 Plasmid 3441
206 Ga0070712_100039928 3300006175 Bacteria 3214
207 Ga0075367_10123183 3300006178 Unclassified 1599
208 Ga0075427_10001422 3300006194 Bacteria 3071
209 Ga0097621_100003827 3300006237 Bacteria 10424
210 Ga0068871_100000215 3300006358 Bacteria 40308
211 Ga0068871_100001366 3300006358 Bacteria 16355
212 Ga0075428_100012848 3300006844 Bacteria 9317
213 Ga0075428_100037318 3300006844 Bacteria 5350
214 Ga0075428_100122112 3300006844 Unclassified 2836
215 Ga0075430_100000012 3300006846 Bacteria 94359
216 Ga0075431_100000602 3300006847 Bacteria 30370
217 Ga0075431_100030504 3300006847 Bacteria 5554
218 Ga0075433_10000338 3300006852 Bacteria 29055
219 Ga0075433_10175157 3300006852 Bacteria 1909
220 Ga0075434_100000373 3300006871 Bacteria 32610
221 Ga0075434_100000842 3300006871 Bacteria 24401
222 Ga0075434_100193239 3300006871 Bacteria 2056
223 Ga0075429_100007327 3300006880 Bacteria 9575
224 Ga0075429_100025962 3300006880 Bacteria 5085
225 Ga0068865_100000190 3300006881 Bacteria 34392
226 Ga0068865_100009354 3300006881 Bacteria 6072
227 Ga0097620_100003965 3300006931 Bacteria 15100
228 Ga0097620_100041549 3300006931 Bacteria 4618
229 Ga0097620_100082750 3300006931 Bacteria 3252
230 Ga0075435_100011049 3300007076 Bacteria 6624
231 Ga0075435_100024690 3300007076 Bacteria 4668
232 Ga0075435_100109235 3300007076 Bacteria 2299
233 Ga0075435_100235885 3300007076 Bacteria 1555
234 Ga0075435_100243335 3300007076 Unclassified 1530
235 Ga0075435_100346151 3300007076 Bacteria 1274
236 Ga0099794_10137235 3300007265 Bacteria 1237
237 Ga0105251_10020186 3300009011 Plasmid 3505
238 Ga0105251_10035309 3300009011 Bacteria 2468
239 Ga0105250_10035199 3300009092 Bacteria 2009
240 Ga0105240_10027358 3300009093 Bacteria 7465
241 Ga0105240_10070736 3300009093 Bacteria 4316
242 Ga0105240_10251390 3300009093 Bacteria 2044
243 Ga0111539_10000299 3300009094 Bacteria 60010
244 Ga0111539_10000725 3300009094 Bacteria 42875
245 Ga0111539_10005091 3300009094 Bacteria 17061
246 Ga0111539_10005821 3300009094 Bacteria 15939
247 Ga0111539_10429664 3300009094 Bacteria 1538
248 Ga0111539_10779953 3300009094 Bacteria 1112
249 Ga0105245_10000543 3300009098 Bacteria 34420
250 Ga0105245_10035281 3300009098 Bacteria 4438
251 Ga0105245_10057546 3300009098 Unclassified 3497
252 Ga0105245_10347300 3300009098 Bacteria 1469
253 Ga0105247_10003987 3300009101 Bacteria 9506
254 Ga0105247_10005905 3300009101 Bacteria 7647
255 Ga0105247_10014231 3300009101 Bacteria 4774
256 Ga0105247_10198805 3300009101 Unclassified 1346
257 Ga0114129_10000227 3300009147 Bacteria 62698
258 Ga0114129_10015409 3300009147 Bacteria 10876
259 Ga0114129_10019814 3300009147 Bacteria 9572
260 Ga0114129_10192052 3300009147 Bacteria 2772
261 Ga0114129_10218604 3300009147 Bacteria 2572
262 Ga0114129_10609620 3300009147 Bacteria 1413
263 Ga0105243_10023782 3300009148 Bacteria 4669
264 Ga0105243_10034321 3300009148 Bacteria 3926
265 Ga0105243_10039708 3300009148 Bacteria 3671
266 Ga0105241_10002875 3300009174 Bacteria 12867
267 Ga0105241_10020666 3300009174 Bacteria 4864
268 Ga0105241_10166885 3300009174 Bacteria 1815
269 Ga0105242_10001766 3300009176 Bacteria 17062
270 Ga0105242_10148496 3300009176 Bacteria 2042
271 Ga0105242_10495367 3300009176 Bacteria 1161
272 Ga0105248_10000501 3300009177 Bacteria 44646
273 Ga0105248_10041038 3300009177 Bacteria 5188
274 Ga0105248_10083720 3300009177 Bacteria 3588
275 Ga0105248_10252808 3300009177 Bacteria 1984
276 Ga0105248_10382944 3300009177 Unclassified 1584
277 Ga0105248_10542848 3300009177 Bacteria 1311
278 Ga0105237_10011199 3300009545 Bacteria 9507
279 Ga0105237_10014165 3300009545 Bacteria 8348
280 Ga0105237_10039491 3300009545 Bacteria 4765
281 Ga0105237_10112215 3300009545 Bacteria 2718
282 Ga0105238_10102269 3300009551 Bacteria 2847
283 Ga0105249_10006521 3300009553 Bacteria 10153
284 Ga0105249_10039615 3300009553 Bacteria 4278
285 Ga0105239_10005329 3300010375 Bacteria 15087
286 Ga0105246_10003469 3300011119 Bacteria 9558
287 Ga0105246_10165556 3300011119 Bacteria 1688
288 Ga0105246_10197576 3300011119 Bacteria 1561
289 Ga0105246_10422840 3300011119 Unclassified 1112
290 Ga0157342_1000244 3300012507 Bacteria 2998
291 Ga0157373_10068573 3300013100 Bacteria 2507
292 Ga0157371_10034339 3300013102 Bacteria 3638
293 Ga0157369_10293426 3300013105 Bacteria 1692
294 Ga0157374_10062294 3300013296 Plasmid 3496
295 Ga0157374_10164329 3300013296 Bacteria 2163
296 Ga0157374_10561304 3300013296 Unclassified 1150
297 Ga0157378_10013696 3300013297 Bacteria 7093
298 Ga0157378_10127726 3300013297 Bacteria 2350
299 Ga0163162_10004207 3300013306 Bacteria 13834
300 Ga0163162_10036841 3300013306 Bacteria 4878
301 Ga0163162_10085046 3300013306 Unclassified 3239
302 Ga0163162_10441223 3300013306 Unclassified 1434
303 Ga0157372_10014709 3300013307 Bacteria 8373
304 Ga0157372_10168338 3300013307 Bacteria 2535
305 Ga0157375_10002141 3300013308 Bacteria 17061
306 Ga0157375_10031231 3300013308 Bacteria 5031
307 Ga0157375_10130497 3300013308 Bacteria 2632
308 Ga0157375_10490179 3300013308 Bacteria 1394
309 Ga0163163_10003931 3300014325 Bacteria 12675
310 Ga0163163_10005032 3300014325 Bacteria 11390
311 Ga0163163_10055004 3300014325 Bacteria 3933
312 Ga0163163_10079659 3300014325 Bacteria 3274
313 Ga0157380_10000049 3300014326 Bacteria 71296
314 Ga0157377_10078009 3300014745 Unclassified 1930
315 Ga0157379_10015257 3300014968 Bacteria 6739
316 Ga0157379_10015309 3300014968 Bacteria 6727
317 Ga0157379_10021769 3300014968 Bacteria 5679
318 Ga0157379_10377192 3300014968 Unclassified 1301
319 Ga0157376_10000099 3300014969 Bacteria 62912
320 Ga0157376_10016011 3300014969 Bacteria 5682
321 Ga0157376_10025417 3300014969 Bacteria 4663
322 Ga0163161_10000081 3300017792 Bacteria 97213
323 Ga0207666_1000167 3300025271 Bacteria 10172
324 Ga0207673_1000150 3300025290 Bacteria 6838
325 Ga0207697_10002292 3300025315 Bacteria 10003
326 Ga0207653_10000843 3300025885 Bacteria 10205
327 Ga0207653_10024102 3300025885 Bacteria 1941
328 Ga0207682_10000046 3300025893 Bacteria 51587
329 Ga0207692_10036538 3300025898 Unclassified 2396
330 Ga0207642_10000135 3300025899 Bacteria 20564
331 Ga0207642_10009208 3300025899 Bacteria 3426
332 Ga0207710_10000850 3300025900 Bacteria 16454
333 Ga0207710_10000873 3300025900 Bacteria 16148
334 Ga0207710_10017322 3300025900 Bacteria 3056
335 Ga0207688_10001056 3300025901 Bacteria 14080
336 Ga0207680_10005263 3300025903 Bacteria 6171
337 Ga0207647_10007296 3300025904 Bacteria 8002
338 Ga0207647_10077967 3300025904 Bacteria 1991
339 Ga0207685_10031726 3300025905 Unclassified 1895
340 Ga0207699_10000312 3300025906 Bacteria 25999
341 Ga0207699_10087690 3300025906 Bacteria 1946
342 Ga0207699_10212969 3300025906 Bacteria 1315
343 Ga0207645_10000162 3300025907 Bacteria 52720
344 Ga0207645_10157376 3300025907 Bacteria 1485
345 Ga0207643_10000025 3300025908 Bacteria 101583
346 Ga0207684_10084848 3300025910 Bacteria 2697
347 Ga0207654_10001641 3300025911 Bacteria 11696
348 Ga0207654_10070689 3300025911 Bacteria 2073
349 Ga0207707_10002255 3300025912 Bacteria 17449
350 Ga0207693_10003951 3300025915 Bacteria 12597
351 Ga0207693_10006436 3300025915 Bacteria 9731
352 Ga0207663_10040020 3300025916 Unclassified 2846
353 Ga0207663_10172076 3300025916 Bacteria 1539
354 Ga0207660_10001243 3300025917 Bacteria 17069
355 Ga0207660_10073977 3300025917 Bacteria 2486
356 Ga0207660_10099479 3300025917 Bacteria 2170
357 Ga0207662_10024757 3300025918 Bacteria 3454
358 Ga0207662_10285371 3300025918 Bacteria 1094
359 Ga0207657_10009100 3300025919 Bacteria 10019
360 Ga0207657_10101539 3300025919 Bacteria 2387
361 Ga0207657_10128242 3300025919 Bacteria 2081
362 Ga0207649_10000048 3300025920 Bacteria 110714
363 Ga0207649_10067804 3300025920 Unclassified 2266
364 Ga0207652_10026062 3300025921 Bacteria 4866
365 Ga0207652_10071521 3300025921 Bacteria 3014
366 Ga0207652_10245815 3300025921 Bacteria 1613
367 Ga0207652_10284478 3300025921 Bacteria 1492
368 Ga0207681_10000131 3300025923 Bacteria 61025
369 Ga0207681_10018372 3300025923 Bacteria 4405
370 Ga0207650_10012254 3300025925 Bacteria 5917
371 Ga0207659_10000040 3300025926 Bacteria 91375
372 Ga0207687_10000090 3300025927 Bacteria 66310
373 Ga0207700_10000231 3300025928 Bacteria 33501
374 Ga0207700_10359713 3300025928 Bacteria 1269
375 Ga0207664_10197377 3300025929 Bacteria 1735
376 Ga0207644_10000473 3300025931 Bacteria 25907
377 Ga0207644_10063240 3300025931 Bacteria 2687
378 Ga0207690_10000173 3300025932 Bacteria 50054
379 Ga0207690_10305467 3300025932 Bacteria 1246
380 Ga0207706_10015889 3300025933 Bacteria 6804
381 Ga0207686_10014701 3300025934 Bacteria 4364
382 Ga0207686_10069456 3300025934 Unclassified 2260
383 Ga0207709_10000585 3300025935 Bacteria 30473
384 Ga0207709_10077416 3300025935 Bacteria 2132
385 Ga0207709_10119012 3300025935 Unclassified 1780
386 Ga0207670_10002222 3300025936 Bacteria 10152
387 Ga0207670_10006934 3300025936 Bacteria 6305
388 Ga0207670_10273308 3300025936 Bacteria 1314
389 Ga0207669_10000102 3300025937 Bacteria 42874
390 Ga0207669_10147487 3300025937 Bacteria 1643
391 Ga0207704_10000097 3300025938 Bacteria 49151
392 Ga0207704_10020284 3300025938 Bacteria 3512
393 Ga0207665_10000487 3300025939 Bacteria 26772
394 Ga0207665_10009084 3300025939 Bacteria 6526
395 Ga0207665_10116372 3300025939 Bacteria 1884
396 Ga0207665_10216484 3300025939 Bacteria 1402
397 Ga0207691_10007973 3300025940 Bacteria 10188
398 Ga0207711_10000847 3300025941 Bacteria 29585
399 Ga0207711_10001975 3300025941 Bacteria 18574
400 Ga0207711_10286792 3300025941 Bacteria 1517
401 Ga0207689_10000677 3300025942 Bacteria 32501
402 Ga0207689_10003052 3300025942 Bacteria 15417
403 Ga0207661_10000204 3300025944 Bacteria 38344
404 Ga0207661_10074423 3300025944 Bacteria 2784
405 Ga0207661_10105698 3300025944 Bacteria 2372
406 Ga0207661_10188910 3300025944 Bacteria 1805
407 Ga0207679_10000090 3300025945 Bacteria 79412
408 Ga0207679_10145059 3300025945 Unclassified 1924
409 Ga0207679_10180706 3300025945 Bacteria 1745
410 Ga0207679_10188131 3300025945 Bacteria 1714
411 Ga0207651_10000017 3300025960 Bacteria 100256
412 Ga0207651_10026112 3300025960 Plasmid 3642
413 Ga0207712_10000114 3300025961 Bacteria 87261
414 Ga0207712_10070190 3300025961 Plasmid 2516
415 Ga0207668_10000139 3300025972 Bacteria 49764
416 Ga0207668_10058200 3300025972 Bacteria 2700
417 Ga0207668_10360260 3300025972 Bacteria 1218
418 Ga0207668_10429545 3300025972 Bacteria 1123
419 Ga0207640_10000221 3300025981 Bacteria 40097
420 Ga0207640_10063623 3300025981 Bacteria 2452
421 Ga0207658_10005690 3300025986 Bacteria 8523
422 Ga0207658_10011332 3300025986 Bacteria 6069
423 Ga0207677_10002794 3300026023 Bacteria 9219
424 Ga0207677_10040887 3300026023 Bacteria 3061
425 Ga0207703_10001230 3300026035 Bacteria 23955
426 Ga0207703_10009415 3300026035 Bacteria 7674
427 Ga0207639_10001275 3300026041 Bacteria 17013
428 Ga0207639_10075624 3300026041 Bacteria 2649
429 Ga0207678_10000197 3300026067 Bacteria 52596
430 Ga0207678_10010540 3300026067 Bacteria 8118
431 Ga0207708_10004699 3300026075 Bacteria 10048
432 Ga0207708_10013323 3300026075 Bacteria 6142
433 Ga0207702_10000198 3300026078 Bacteria 71277
434 Ga0207702_10081852 3300026078 Plasmid 2805
435 Ga0207702_10309581 3300026078 Bacteria 1501
436 Ga0207641_10000417 3300026088 Bacteria 49719
437 Ga0207641_10265887 3300026088 Unclassified 1607
438 Ga0207648_10000483 3300026089 Bacteria 44295
439 Ga0207676_10000372 3300026095 Bacteria 38295
440 Ga0207676_10001984 3300026095 Bacteria 14895
441 Ga0207674_10003549 3300026116 Bacteria 19037
442 Ga0207674_10142672 3300026116 Bacteria 2354
443 Ga0207675_100007915 3300026118 Bacteria 10019
444 Ga0207675_100020311 3300026118 Bacteria 6193
445 Ga0207675_100057413 3300026118 Bacteria 3632
446 Ga0207683_10000141 3300026121 Bacteria 59587
447 Ga0207683_10000908 3300026121 Bacteria 27236
448 Ga0209984_1002913 3300027424 Bacteria 1936
449 Ga0210002_1001176 3300027617 Bacteria 3647
450 Ga0209971_1005351 3300027682 Bacteria 3052
451 Ga0209966_1001487 3300027695 Bacteria 4072
452 Ga0209998_10000232 3300027717 Bacteria 18781
453 Ga0209998_10001040 3300027717 Bacteria 6971
454 Ga0209974_10005229 3300027876 Bacteria 4580
455 Ga0207428_10000058 3300027907 Bacteria 158579
456 Ga0207428_10001115 3300027907 Bacteria 29201
457 Ga0207428_10002874 3300027907 Bacteria 17069
458 Ga0207428_10008433 3300027907 Bacteria 9303
459 Ga0268266_10002234 3300028379 Bacteria 21139
460 Ga0268265_10013047 3300028380 Bacteria 5642
461 Ga0268264_10000412 3300028381 Bacteria 60566
462 Ga0265337_1006179 3300028556 Bacteria 4654
463 Ga0265334_10050600 3300028573 Bacteria 1595
464 Ga0265338_10041790 3300028800 Bacteria 4282
465 Ga0265330_10011472 3300031235 Bacteria 4155
466 Ga0265330_10024284 3300031235 Bacteria 2749
467 Ga0265325_10000036 3300031241 Bacteria 96858
468 Ga0265325_10007651 3300031241 Bacteria 6456
469 Ga0265325_10059108 3300031241 Bacteria 1950
470 Ga0265340_10022764 3300031247 Bacteria 3200
471 Ga0265339_10014749 3300031249 Bacteria 4703
472 Ga0265316_10034358 3300031344 Bacteria 4120
473 Ga0265313_10001570 3300031595 Bacteria 21191
474 Ga0265313_10019218 3300031595 Bacteria 3811
475 Ga0265313_10103866 3300031595 Bacteria 1258
476 Ga0265314_10006219 3300031711 Bacteria 10601
477 Ga0265314_10007314 3300031711 Bacteria 9589
478 Ga0307416_100080536 3300032002 Bacteria 2749
479 Ga0373948_0003112 3300034817 Bacteria 2521
480 Ga0373958_0000560 3300034819 Bacteria 4630
481 Ga0373958_0005433 3300034819 Bacteria 1937
482 Ga0373959_0001450 3300034820 Bacteria 3791
483 Ga0373938_0000036 3300034957 Bacteria 17529
484 Ga0373938_0015276 3300034957 Unclassified 1485
485 Ga0373926_0033495 3300035083 Bacteria 1816
486 Ga0373926_0062752 3300035083 Unclassified 1357
487 Ga0373928_0000812 3300035084 Bacteria 6085
488 Ga0373929_0002736 3300035085 Bacteria 3219
489 Ga0373929_0017848 3300035085 Unclassified 1405
490 Ga0373934_0004844 3300035086 Bacteria 4983
491 Ga0373934_0109403 3300035086 Bacteria 1120
492 Ga0373940_0000390 3300035088 Bacteria 6650
493 Ga0373944_0006514 3300035089 Bacteria 3101
494 Ga0373944_0011632 3300035089 Bacteria 2414
495 Ga0373949_0001580 3300035090 Bacteria 6417
496 Ga0373949_0003013 3300035090 Bacteria 4136
497 Ga0373951_0000312 3300035091 Bacteria 15385
498 Ga0373952_0000533 3300035092 Bacteria 6675
499 Ga0373923_0000978 3300035111 Bacteria 7693
500 Ga0373923_0007388 3300035111 Bacteria 3860
501 Ga0373932_0001347 3300035112 Bacteria 6875
502 Ga0373932_0002893 3300035112 Bacteria 4238
503 Ga0373932_0018502 3300035112 Unclassified 1802
504 Ga0373932_0044240 3300035112 Bacteria 1298
505 Ga0373936_0002402 3300035113 Bacteria 7011
506 Ga0373936_0006435 3300035113 Bacteria 4429
507 Ga0373939_0000502 3300035114 Bacteria 9837
508 Ga0373939_0004753 3300035114 Unclassified 3221
509 Ga0373941_0000268 3300035115 Bacteria 10009
510 Ga0373941_0003730 3300035115 Bacteria 3472
511 Ga0373941_0018992 3300035115 Bacteria 1906
512 Ga0373945_0011045 3300035116 Bacteria 2980
513 Ga0373945_0012738 3300035116 Bacteria 2797
514 Ga0373954_0006112 3300035118 Bacteria 5243
515 Ga0373954_0007494 3300035118 Bacteria 4775
516 Ga0373954_0008449 3300035118 Bacteria 4518
517 Ga0373954_0022950 3300035118 Bacteria 2834
518 Ga0373956_0019685 3300035119 Bacteria 2865
519 Ga0373956_0020444 3300035119 Bacteria 2817
520 Ga0373957_0001478 3300035120 Bacteria 6365
521 Ga0373957_0001491 3300035120 Bacteria 6345
522 Ga0373957_0006863 3300035120 Bacteria 3611
523 Ga0373957_0059420 3300035120 Bacteria 1479
524 Ga0373943_0003974 3300035170 Bacteria 6730
525 Ga0373943_0005161 3300035170 Bacteria 5880
526 Ga0373943_0044179 3300035170 Bacteria 2168
527 Ga0373943_0106307 3300035170 Bacteria 1474
528 Ga0373946_0003537 3300035171 Bacteria 5545
529 Ga0373946_0007697 3300035171 Bacteria 3947
530 Ga0373946_0025273 3300035171 Bacteria 2335
531 Ga0373946_0036872 3300035171 Bacteria 1985
532 Ga0373955_0001092 3300035172 Bacteria 11522
533 Ga0373955_0001995 3300035172 Bacteria 8810
534 Ga0373955_0002098 3300035172 Bacteria 8610
535 Ga0373955_0013592 3300035172 Bacteria 3940
536 Ga0373955_0033141 3300035172 Bacteria 2718
537 Ga0373955_0148604 3300035172 Bacteria 1378
538 Ga0373942_0000260 3300035207 Bacteria 14087
539 Ga0373942_0026250 3300035207 Unclassified 1507
540 Ga0373961_0000492 3300035241 Bacteria 15342
541 Ga0373962_0000091 3300035242 Bacteria 19653
542 Ga0373962_0005292 3300035242 Unclassified 3122
543 Ga0373924_0010530 3300035410 Bacteria 3414
544 Ga0373924_0018520 3300035410 Bacteria 2684
545 Ga0373924_0061891 3300035410 Bacteria 1567
546 Ga0373931_0000131 3300035691 Bacteria 34406
547 Ga0373931_0007255 3300035691 Bacteria 5216
548 Ga0373935_0000377 3300035692 Bacteria 22883
549 Ga0373935_0014579 3300035692 Bacteria 4743
550 Ga0373927_0018997 3300035695 Bacteria 4509
551 Ga0373927_0021440 3300035695 Bacteria 4234
552 Ga0373927_0031784 3300035695 Bacteria 3439
553 Ga0373927_0040483 3300035695 Bacteria 3022
554 Ga0373933_0001665 3300035724 Bacteria 12922
555 Ga0373933_0002410 3300035724 Bacteria 10543
556 Ga0373933_0007167 3300035724 Bacteria 6075
557 Ga0373933_0032143 3300035724 Bacteria 3049
558 Ga0373947_0004674 3300035725 Bacteria 8026
559 Ga0373947_0009750 3300035725 Bacteria 5511
560 Ga0373947_0013218 3300035725 Plasmid 4731
561 Ga0373947_0179780 3300035725 Bacteria 1377
562 Ga0373937_0001849 3300036401 Bacteria 17776
563 Ga0373937_0003289 3300036401 Bacteria 13564
564 Ga0373937_0005585 3300036401 Bacteria 10787
565 Ga0373937_0007611 3300036401 Bacteria 9382
566 Ga0373937_0011521 3300036401 Bacteria 7761
567 Ga0373937_0014729 3300036401 Bacteria 6903
568 Ga0373937_0073183 3300036401 Bacteria 3161
569 Ga0373925_0000075 3300037068 Bacteria 105395
570 Ga0373925_0001381 3300037068 Bacteria 21133
571 Ga0373925_0006934 3300037068 Bacteria 8288
572 Ga0373925_0068052 3300037068 Bacteria 2686
573 Ga0395900_0021219 3300037418 Bacteria 6641
574 Ga0395900_0111939 3300037418 Bacteria 2803
575 Ga0395898_0028469 3300037466 Bacteria 5597
576 Ga0395898_0074389 3300037466 Bacteria 3281
577 Ga0436364_0429623 3300037853 Bacteria 2037
578 Ga0395901_0042693 3300038443 Bacteria 4702
579 Ga0242420_007157 3300038996 Bacteria 1784
580 Ga0436361_0670413 3300039447 Bacteria 8708
581 Ga0451577_0096577 3300042876 Bacteria 2638
582 Ga0466966_0235473 3300044684 Bacteria 1104
583 Ga0466961_0044652 3300044693 Bacteria 2836
584 Ga0466963_0021946 3300044694 Bacteria 4036
585 Ga0466963_0097864 3300044694 Bacteria 2005
586 Ga0466963_0348571 3300044694 Bacteria 1043
587 Ga0466959_0093858 3300045049 Bacteria 2153
588 Ga0451576_0370562 3300045051 Bacteria 1500
589 Ga0466967_0005150 3300045976 Bacteria 8993
590 Ga0495592_0000060 3300046454 Bacteria 100113
591 Ga0495592_0001425 3300046454 Bacteria 16601
592 Ga0495592_0009799 3300046454 Bacteria 7210
593 Ga0495592_0013763 3300046454 Bacteria 6151
594 Ga0495592_0150509 3300046454 Bacteria 1610
595 Ga0495603_0011449 3300046455 Bacteria 5369
596 Ga0495603_0014137 3300046455 Bacteria 4829
597 Ga0495603_0031146 3300046455 Bacteria 3211
598 Ga0495629_0001317 3300046459 Bacteria 19520
599 Ga0495629_0008135 3300046459 Bacteria 7717
600 Ga0495629_0045196 3300046459 Bacteria 3090
601 Ga0495629_0149354 3300046459 Bacteria 1624
602 Ga0495641_0016070 3300046461 Bacteria 3957
603 Ga0495641_0045562 3300046461 Bacteria 2019
604 Ga0495651_0000181 3300046462 Bacteria 46803
605 Ga0495651_0001028 3300046462 Bacteria 21603
606 Ga0495651_0015441 3300046462 Bacteria 5907
607 Ga0495651_0034700 3300046462 Bacteria 3932
608 Ga0495653_0000740 3300046463 Bacteria 24927
609 Ga0495653_0006880 3300046463 Bacteria 9345
610 Ga0495653_0054077 3300046463 Unclassified 3069
611 Ga0495653_0080174 3300046463 Bacteria 2416
612 Ga0495580_0019190 3300046472 Bacteria 5081
613 Ga0495580_0190472 3300046472 Bacteria 1414
614 Ga0495582_0017639 3300046473 Bacteria 3905
615 Ga0495582_0095894 3300046473 Bacteria 1657
616 Ga0495582_0181874 3300046473 Bacteria 1198
617 Ga0495639_0109009 3300046475 Bacteria 1312
618 Ga0495662_0001139 3300046476 Bacteria 13118
619 Ga0495662_0010017 3300046476 Bacteria 4651
620 Ga0495662_0054291 3300046476 Bacteria 1935
621 Ga0495664_0000003 3300046477 Bacteria 551602
622 Ga0495664_0018434 3300046477 Bacteria 3999
623 Ga0495664_0073130 3300046477 Bacteria 2049
624 Ga0495664_0110244 3300046477 Bacteria 1661
625 Ga0495584_0034777 3300046491 Bacteria 2547
626 Ga0495585_0002983 3300046492 Bacteria 11691
627 Ga0495594_0012852 3300046499 Plasmid 4366
628 Ga0495594_0019492 3300046499 Bacteria 3604
629 Ga0495607_0043814 3300046501 Bacteria 2643
630 Ga0495608_0000011 3300046511 Bacteria 248514
631 Ga0495608_0014132 3300046511 Bacteria 5538
632 Ga0495608_0020336 3300046511 Bacteria 4562
633 Ga0495618_0000044 3300046514 Bacteria 95526
634 Ga0495618_0007217 3300046514 Bacteria 6729
635 Ga0495628_0000001 3300046516 Bacteria 917742
636 Ga0495628_0022511 3300046516 Bacteria 5177
637 Ga0495628_0032380 3300046516 Bacteria 4220
638 Ga0495630_0002317 3300046517 Bacteria 13234
639 Ga0495630_0021258 3300046517 Bacteria 4791
640 Ga0495630_0155716 3300046517 Bacteria 1739
641 Ga0495663_0009174 3300046525 Bacteria 2743
642 Ga0495666_0004239 3300046526 Bacteria 7232
643 Ga0495642_0134687 3300046528 Bacteria 1065
644 Ga0495652_0000002 3300046529 Bacteria 946606
645 Ga0495652_0006243 3300046529 Bacteria 11114
646 Ga0495652_0011130 3300046529 Bacteria 8150
647 Ga0495652_0124986 3300046529 Bacteria 2045
648 Ga0495665_0010657 3300046531 Bacteria 4978
649 Ga0495640_0000002 3300046533 Bacteria 646434
650 Ga0495640_0020787 3300046533 Bacteria 4824
651 Ga0495586_0017488 3300046535 Bacteria 3811
652 Ga0495586_0034792 3300046535 Bacteria 2706
653 Ga0495587_0000001 3300046536 Bacteria 724132
654 Ga0495587_0002763 3300046536 Bacteria 11717
655 Ga0495587_0024297 3300046536 Bacteria 3716
656 Ga0495587_0052312 3300046536 Bacteria 2410
657 Ga0495587_0087367 3300046536 Bacteria 1804
658 Ga0495609_0097524 3300046538 Bacteria 1275
659 Ga0495645_0000002 3300046543 Bacteria 651644
660 Ga0495645_0008509 3300046543 Bacteria 7166
661 Ga0495645_0021269 3300046543 Bacteria 4688
662 Ga0495622_0057450 3300046557 Bacteria 1803
663 Ga0495633_0004123 3300046558 Bacteria 9362
664 Ga0495667_0000039 3300046559 Bacteria 131308
665 Ga0495667_0008435 3300046559 Bacteria 6995
666 Ga0495667_0012303 3300046559 Bacteria 5800
667 Ga0495667_0032436 3300046559 Bacteria 3501
668 Ga0495656_0008098 3300046615 Bacteria 3741
669 Ga0495634_0000010 3300046642 Bacteria 143792
670 Ga0495634_0261133 3300046642 Unclassified 1056
671 Ga0495611_0024831 3300046648 Bacteria 2608
672 Ga0495611_0127150 3300046648 Bacteria 1189
673 Ga0495635_0000001 3300046663 Bacteria 704901
674 Ga0495635_0007978 3300046663 Bacteria 7401
675 Ga0495635_0030375 3300046663 Bacteria 3755
676 Ga0495635_0047505 3300046663 Bacteria 2960
677 Ga0495635_0060232 3300046663 Bacteria 2609
678 Ga0495635_0245434 3300046663 Unclassified 1208
679 Ga0495659_0002157 3300046664 Bacteria 6410
680 Ga0495588_0001979 3300046674 Bacteria 8763
681 Ga0495657_0000042 3300046675 Bacteria 114669
682 Ga0495657_0008832 3300046675 Bacteria 7673
683 Ga0495657_0039023 3300046675 Bacteria 3265
684 Ga0495599_0000013 3300046678 Bacteria 179828
685 Ga0495599_0003683 3300046678 Bacteria 8982
686 Ga0495599_0034547 3300046678 Bacteria 3176
687 Ga0495599_0103341 3300046678 Bacteria 1775
688 Ga0495623_0000050 3300046679 Bacteria 72959
689 Ga0495623_0000554 3300046679 Bacteria 24925
690 Ga0495623_0013487 3300046679 Bacteria 5299
691 Ga0495646_0000009 3300046680 Bacteria 200698
692 Ga0495646_0001248 3300046680 Bacteria 14920
693 Ga0495646_0114340 3300046680 Bacteria 1533
694 Ga0495647_0005005 3300046681 Plasmid 4339
695 Ga0495647_0012267 3300046681 Bacteria 2948
696 Ga0495658_0009945 3300046683 Plasmid 4745
697 Ga0495658_0026882 3300046683 Bacteria 3089
698 Ga0495658_0034922 3300046683 Bacteria 2762
699 Ga0495658_0044686 3300046683 Bacteria 2483
700 Ga0495613_0009440 3300046689 Bacteria 7236
701 Ga0495613_0104514 3300046689 Bacteria 2044
702 Ga0495613_0176622 3300046689 Bacteria 1513
703 Ga0495624_0037597 3300046690 Bacteria 3112
704 Ga0495670_0005312 3300046691 Bacteria 6339
705 Ga0495600_0000209 3300046809 Bacteria 33688
706 Ga0495600_0000989 3300046809 Bacteria 15327
707 Ga0495581_0046167 3300047315 Bacteria 2516
708 Ga0495581_0148665 3300047315 Bacteria 1368
709 Ga0495604_0000069 3300047317 Bacteria 89935
710 Ga0495604_0002886 3300047317 Bacteria 13771
711 Ga0495604_0007911 3300047317 Bacteria 8420
712 Ga0495604_0010413 3300047317 Bacteria 7366
713 Ga0495674_0000002 3300047319 Bacteria 642785
714 Ga0495674_0160145 3300047319 Unclassified 1883
715 Ga0495676_0181764 3300047321 Bacteria 1473
716 Ga0495680_0000328 3300047322 Bacteria 53287
717 Ga0495680_0001832 3300047322 Bacteria 22412
718 Ga0495680_0012338 3300047322 Bacteria 7524
719 Ga0495680_0012693 3300047322 Bacteria 7397
720 Ga0495675_0000245 3300047444 Bacteria 39142
721 Ga0495675_0000625 3300047444 Bacteria 22516
722 Ga0495675_0010798 3300047444 Bacteria 5723
723 Ga0495684_0000016 3300047471 Bacteria 169338
724 Ga0495684_0000517 3300047471 Bacteria 31334
725 Ga0495684_0019009 3300047471 Bacteria 5290
726 Ga0495593_0000555 3300047673 Bacteria 21201
727 Ga0495593_0008554 3300047673 Bacteria 5951
728 Ga0495593_0015415 3300047673 Unclassified 4328
729 Ga0495602_0000024 3300048088 Bacteria 151162
730 Ga0495602_0052529 3300048088 Bacteria 3619
731 Ga0495614_0002673 3300048089 Bacteria 7926
732 Ga0496100_0000183 3300048903 Bacteria 34629
733 Ga0496100_0001822 3300048903 Bacteria 10654
734 Ga0496100_0258012 3300048903 Bacteria 1292
735 Ga0496101_0001253 3300048904 Bacteria 15192
736 Ga0496101_0040079 3300048904 Unclassified 3335
737 Ga0496101_0164103 3300048904 Bacteria 1705
738 Ga0496101_0334210 3300048904 Unclassified 1189
739 Ga0496101_0382203 3300048904 Bacteria 1108
740 Ga0496102_0002101 3300048905 Bacteria 17126
741 Ga0496102_0021368 3300048905 Bacteria 5724
742 Ga0496102_0088318 3300048905 Bacteria 2865
743 Ga0496102_0096806 3300048905 Unclassified 2736
744 Ga0496102_0524865 3300048905 Unclassified 1106
745 Ga0496103_0011705 3300048906 Bacteria 5203
746 Ga0496103_0017302 3300048906 Bacteria 4314
747 Ga0496103_0130887 3300048906 Unclassified 1602
748 Ga0496103_0278367 3300048906 Unclassified 1076
749 Ga0496104_0000055 3300048907 Bacteria 124267
750 Ga0496104_0003403 3300048907 Bacteria 13734
751 Ga0496104_0015277 3300048907 Bacteria 6952
752 Ga0496104_0018261 3300048907 Bacteria 6398
753 Ga0496104_0019231 3300048907 Bacteria 6244
754 Ga0496104_0220516 3300048907 Bacteria 1809
755 Ga0496104_0489944 3300048907 Unclassified 1140
756 Ga0496105_0000918 3300048908 Bacteria 20094
757 Ga0496105_0009881 3300048908 Bacteria 7482
758 Ga0496105_0027876 3300048908 Bacteria 4618
759 Ga0496105_0082136 3300048908 Unclassified 2661
760 Ga0496105_0098212 3300048908 Bacteria 2418
761 Ga0496105_0105948 3300048908 Bacteria 2321
762 Ga0496105_0123171 3300048908 Unclassified 2137
763 Ga0496105_0168598 3300048908 Bacteria 1795
764 Ga0496106_0000317 3300048909 Bacteria 33879
765 Ga0496106_0018123 3300048909 Bacteria 5206
766 Ga0496106_0070350 3300048909 Bacteria 2672
767 Ga0496106_0083591 3300048909 Unclassified 2455
768 Ga0496106_0105027 3300048909 Bacteria 2194
769 Ga0496107_0013389 3300048910 Bacteria 5731
770 Ga0496107_0036332 3300048910 Unclassified 3533
771 Ga0496107_0059899 3300048910 Bacteria 2755
772 Ga0496108_0039369 3300048911 Bacteria 3940
773 Ga0496108_0045630 3300048911 Bacteria 3660
774 Ga0496108_0448220 3300048911 Bacteria 1127
775 Ga0496108_0474916 3300048911 Unclassified 1092
776 Ga0496109_0000812 3300048912 Bacteria 26052
777 Ga0496109_0012200 3300048912 Bacteria 7413
778 Ga0496109_0023439 3300048912 Bacteria 5480
779 Ga0496109_0025460 3300048912 Bacteria 5273
780 Ga0496109_0060469 3300048912 Bacteria 3462
781 Ga0496109_0091515 3300048912 Bacteria 2813
782 Ga0496109_0353745 3300048912 Bacteria 1387
783 Ga0496109_0540583 3300048912 Unclassified 1099
784 Ga0496110_0004023 3300048913 Bacteria 11334
785 Ga0496110_0011433 3300048913 Bacteria 7265
786 Ga0496110_0114645 3300048913 Bacteria 2425
787 Ga0496110_0149856 3300048913 Bacteria 2112
788 Ga0496110_0169558 3300048913 Bacteria 1980
789 Ga0496110_0210917 3300048913 Bacteria 1766
790 Ga0496110_0366230 3300048913 Bacteria 1313
791 Ga0496111_0002977 3300048914 Bacteria 10382
792 Ga0496111_0010259 3300048914 Bacteria 6277
793 Ga0496111_0034534 3300048914 Bacteria 3611
794 Ga0496111_0128046 3300048914 Bacteria 1878
795 Ga0496111_0164330 3300048914 Bacteria 1648
796 Ga0496111_0271515 3300048914 Bacteria 1258
797 Ga0496112_0002948 3300048915 Bacteria 13879
798 Ga0496112_0085171 3300048915 Unclassified 3127
799 Ga0496112_0189571 3300048915 Bacteria 2018
800 Ga0496112_0448991 3300048915 Bacteria 1227
801 Ga0496112_0449956 3300048915 Bacteria 1226
802 Ga0496112_0527334 3300048915 Unclassified 1115
803 Ga0496113_0008320 3300048916 Bacteria 6752
804 Ga0496113_0017093 3300048916 Bacteria 5028
805 Ga0496113_0039433 3300048916 Bacteria 3476
806 Ga0496113_0127122 3300048916 Bacteria 1997
807 Ga0496113_0146657 3300048916 Bacteria 1860
808 Ga0496113_0176087 3300048916 Bacteria 1695
809 Ga0496114_0000430 3300048917 Bacteria 30988
810 Ga0496114_0017159 3300048917 Bacteria 5838
811 Ga0496114_0286747 3300048917 Bacteria 1452
812 Ga0496115_0008581 3300048918 Bacteria 7564
813 Ga0496115_0014487 3300048918 Bacteria 5970
814 Ga0496115_0016124 3300048918 Bacteria 5683
815 Ga0496115_0028379 3300048918 Bacteria 4386
816 Ga0496115_0061613 3300048918 Plasmid 3024
817 Ga0496115_0208973 3300048918 Bacteria 1612
818 Ga0496115_0248324 3300048918 Unclassified 1465
819 Ga0501034_0116753 3300049571 Bacteria 2657
820 Ga0501034_0491120 3300049571 Bacteria 1142
821 Ga0501036_0383857 3300049572 Bacteria 1172
822 Ga0501038_0068280 3300049574 Bacteria 3022
823 Ga0501041_0022050 3300049577 Bacteria 3813
824 Ga0501041_0118359 3300049577 Bacteria 1645
825 Ga0501042_0108724 3300049578 Bacteria 1996
826 Ga0501042_0226953 3300049578 Bacteria 1347
827 Ga0501048_0117761 3300049582 Bacteria 1876
828 Ga0501067_0015744 3300049583 Bacteria 4184
829 Ga0501068_0339936 3300049584 Bacteria 964
830 Ga0501069_0020274 3300049585 Bacteria 3601
831 Ga0501071_0021167 3300049587 Bacteria 4529
832 Ga0501071_0138285 3300049587 Bacteria 1813
833 Ga0501072_0057934 3300049588 Bacteria 3054
834 Ga0501074_0170065 3300049590 Bacteria 1556
835 Ga0501076_0068865 3300049592 Unclassified 2827
836 Ga0501077_0010511 3300049593 Bacteria 5762
837 Ga0501077_0108335 3300049593 Bacteria 1760
838 Ga0501079_0042947 3300049741 Bacteria 3490
839 Ga0501079_0206065 3300049741 Bacteria 1536
840 Ga0501080_0373660 3300049742 Bacteria 1285
841 Ga0501081_0034379 3300049743 Bacteria 3449
842 Ga0501081_0199923 3300049743 Bacteria 1449
843 Ga0501035_0174953 3300049822 Bacteria 1852
844 Ga0501044_0198495 3300049823 Bacteria 1965
845 nmdc:mga00v17_67260_c1 3300050491 Bacteria 2213
846 nmdc:mga06z11_165224_c1 3300050494 Bacteria 1267
847 nmdc:mga05p37_13845_c1 3300050507 Bacteria 9664
848 nmdc:mga05p37_240876_c1 3300050507 Bacteria 2175
849 nmdc:mga05p37_364276_c1 3300050507 Bacteria 1698
850 nmdc:mga05p37_675_c1 3300050507 Bacteria 37726
851 nmdc:mga05p37_76_c1 3300050507 Bacteria 86726
852 nmdc:mga09592_19945_c1 3300050508 Bacteria 5507
853 nmdc:mga09592_31289_c1 3300050508 Bacteria 4434
854 nmdc:mga0qj67_18840_c1 3300050509 Bacteria 5265
855 nmdc:mga0qj67_229_c1 3300050509 Bacteria 38215
856 nmdc:mga06r32_1246_c1 3300050510 Bacteria 22889
857 nmdc:mga06r32_134_c1 3300050510 Bacteria 54737
858 nmdc:mga08y16_1152_c1 3300050511 Bacteria 26044
859 nmdc:mga08y16_34053_c1 3300050511 Bacteria 5351
860 nmdc:mga08y16_4279_c1 3300050511 Bacteria 14901
861 nmdc:mga0n895_24756_c1 3300050512 Bacteria 5661
862 nmdc:mga0n895_511603_c1 3300050512 Bacteria 1209
863 nmdc:mga0n895_73_c1 3300050512 Bacteria 57709
864 nmdc:mga0n895_96637_c1 3300050512 Bacteria 2959
865 nmdc:mga0rr50_222899_c1 3300050513 Unclassified 1558
866 nmdc:mga0rr50_3303_c1 3300050513 Bacteria 9259
867 nmdc:mga0rr50_84908_c1 3300050513 Bacteria 2452
868 nmdc:mga0rr50_98079_c1 3300050513 Bacteria 2296
869 nmdc:mga08x19_134671_c1 3300050514 Bacteria 1665
870 nmdc:mga0a205_4115_c1 3300050515 Bacteria 13018
871 nmdc:mga0a205_59_c1 3300050515 Bacteria 60447
872 Ga0495601_0000001 3300053077 Bacteria 549454
873 Ga0495601_0000357 3300053077 Bacteria 23996
874 Ga0495601_0000555 3300053077 Bacteria 19790
875 Ga0495601_0002958 3300053077 Bacteria 9661
876 Ga0495601_0004584 3300053077 Bacteria 7993
877 Ga0495601_0006469 3300053077 Bacteria 6852
878 Ga0495601_0027022 3300053077 Bacteria 3546
879 Ga0495612_0000017 3300053078 Bacteria 152112
880 Ga0495612_0000539 3300053078 Bacteria 15250
881 Ga0495612_0008398 3300053078 Bacteria 4188
882 Ga0495612_0009333 3300053078 Bacteria 3981
883 Ga0495595_0000010 3300053084 Bacteria 178819
884 Ga0495595_0000939 3300053084 Bacteria 11212
885 Ga0495595_0001313 3300053084 Bacteria 9655
886 Ga0495595_0002410 3300053084 Bacteria 7299
887 Ga0495595_0005308 3300053084 Bacteria 5212
888 Ga0495595_0020334 3300053084 Bacteria 2889
889 Ga0495595_0176394 3300053084 Bacteria 1059
890 Ga0495619_0000004 3300053085 Bacteria 500068
891 Ga0495619_0000085 3300053085 Bacteria 70073
892 Ga0495619_0000380 3300053085 Bacteria 30640
893 Ga0495619_0000636 3300053085 Bacteria 23148
894 Ga0495619_0002427 3300053085 Bacteria 12237
895 Ga0495619_0008402 3300053085 Bacteria 6529
896 Ga0495619_0025705 3300053085 Bacteria 3783
897 Ga0495619_0075100 3300053085 Bacteria 2268
898 Ga0501084_0015606 3300054114 Bacteria 6300
899 Ga0501084_0020609 3300054114 Bacteria 5498
900 Ga0501084_0281571 3300054114 Bacteria 1404
901 Ga0501082_0073106 3300060353 Bacteria 2953
902 Ga0501082_0097469 3300060353 Bacteria 2542
903 Ga0501082_0431542 3300060353 Bacteria 1151
904 Ga0530510_0054647 3300061734 Bacteria 2886
905 Ga0373938_0000189
906 2214736890
907 ARcpr5oldR_c000047
908 ARSoilYngRDRAFT_c00157
909 ARcpr5yngRDRAFT_c000017
910 ARSoilOldRDRAFT_c000006
911 ARCol0oldRDRAFT_c00392
912 ARCol0yngRDRAFT_1000043
913 JGI24032J14994_100260
914 JGI24741J21665_1002498
915 JGI24746J21847_1000993
916 JGI24747J21853_1003133
917 JGI24737J22298_10001790
918 JGI24737J22298_10002208
919 JGI24750J21931_1000171
920 JGI24745J21846_1000194
921 JGI24748J21848_1000395
922 JGI24738J21930_10000071
923 JGI24744J21845_10001362
924 JGI24033J26618_1000207
925 JGI24034J26672_10001193
926 JGI24742J22300_10000213
927 JGI24751J29686_10003110
928 JGI25405J52794_10005976
929 Ga0065717_1002446
930 Ga0065716_1001557
931 Ga0065712_10000757
932 Ga0065712_10001275
933 Ga0065712_10004439
934 Ga0065715_10005549
935 Ga0065715_10089468
936 Ga0065715_10096866
937 Ga0070676_10000243
938 Ga0070683_100011399
939 Ga0070683_100053101
940 Ga0070690_100036222
941 Ga0070690_100239110
942 Ga0070670_100017245
943 Ga0070670_100029525
944 Ga0070670_100045450
945 Ga0070677_10000354
946 Ga0068869_100000203
947 Ga0070666_10019333
948 Ga0070666_10022117
949 Ga0070666_10057341
950 Ga0070666_10079713
951 Ga0070680_100002314
952 Ga0070680_100046059
953 Ga0070682_100000935
954 Ga0070682_100034840
955 Ga0068868_100002681
956 Ga0070660_100002042
957 Ga0070660_100017351
958 Ga0070660_100161124
959 Ga0070689_100004641
960 Ga0070689_100007095
961 Ga0070689_100033260
962 Ga0070691_10000067
963 Ga0070687_100000177
964 Ga0070661_100001273
965 Ga0070661_100049725
966 Ga0070692_10000279
967 Ga0070668_100001472
968 Ga0070668_100014983
969 Ga0070668_100397058
970 Ga0070669_100001453
971 Ga0070669_100026971
972 Ga0070675_100009187
973 Ga0070675_100130105
974 Ga0070671_100001883
975 Ga0070671_100358671
976 Ga0070674_100000681
977 Ga0070674_100208891
978 Ga0070673_100000855
979 Ga0070673_100020847
980 Ga0070673_100063544
981 Ga0070688_100003962
982 Ga0070688_100007807
983 Ga0070688_100067173
984 Ga0070659_100000865
985 Ga0070659_100024645
986 Ga0070659_100090462
987 Ga0070667_100002230
988 Ga0070667_100064439
989 Ga0070667_100113677
990 Ga0070667_100304025
991 Ga0070703_10001642
992 Ga0070703_10028220
993 Ga0070709_10000219
994 Ga0070714_100309849
995 Ga0070713_100000224
996 Ga0070713_100315963
997 Ga0070713_100418523
998 Ga0070710_10000956
999 Ga0070710_10024912
1000 Ga0070710_10064585
1001 Ga0070701_10005114
1002 Ga0070701_10007452
1003 Ga0070711_100046600
1004 Ga0070711_100074337
1005 Ga0070711_100093115
1006 Ga0070711_100108359
1007 Ga0070705_100005835
1008 Ga0070700_100005851
1009 Ga0070700_100187315
1010 Ga0070694_100003826
1011 Ga0070694_100006136
1012 Ga0070708_100109315
1013 Ga0070663_100006960
1014 Ga0070663_100173142
1015 Ga0070663_100365481
1016 Ga0070678_100001091
1017 Ga0070678_100005289
1018 Ga0070678_100467563
1019 Ga0070662_100002349
1020 Ga0070662_100070604
1021 Ga0070681_10024485
1022 Ga0070681_10053992
1023 Ga0070681_10143449
1024 Ga0068867_100000679
1025 Ga0070685_10004534
1026 Ga0070685_10009881
1027 Ga0070707_100398354
1028 Ga0070698_100334228
1029 Ga0070699_100042469
1030 Ga0070679_100023517
1031 Ga0070679_100072165
1032 Ga0070679_100237237
1033 Ga0070684_100009436
1034 Ga0068853_100005760
1035 Ga0068853_100066309
1036 Ga0068853_100372742
1037 Ga0070672_100006901
1038 Ga0070672_100179904
1039 Ga0070672_100369301
1040 Ga0070686_100001302
1041 Ga0070686_100007436
1042 Ga0070686_100008195
1043 Ga0070695_100002461
1044 Ga0070695_100035427
1045 Ga0070696_100001783
1046 Ga0070696_100063265
1047 Ga0070696_100207079
1048 Ga0070693_100002420
1049 Ga0070693_100020181
1050 Ga0070693_100032492
1051 Ga0070665_100007393
1052 Ga0070665_100044933
1053 Ga0070665_100270254
1054 Ga0070665_100285507
1055 Ga0070704_100004905
1056 Ga0070704_100008656
1057 Ga0070704_100300021
1058 Ga0070704_100385894
1059 Ga0068855_100010931
1060 Ga0070664_100008419
1061 Ga0070664_100080870
1062 Ga0070664_100187041
1063 Ga0068857_100000534
1064 Ga0068857_100221056
1065 Ga0068854_100007195
1066 Ga0068856_100000272
1067 Ga0068856_100395948
1068 Ga0070702_100006314
1069 Ga0068852_100003393
1070 Ga0068859_100003965
1071 Ga0068859_100041550
1072 Ga0068859_100082748
1073 Ga0068859_100232466
1074 Ga0068864_100006326
1075 Ga0068864_100009979
1076 Ga0068864_100582154
1077 Ga0068866_10000252
1078 Ga0068866_10040918
1079 Ga0068861_100001032
1080 Ga0068861_100046020
1081 Ga0068861_100213103
1082 Ga0068870_10000092
1083 Ga0068863_100017599
1084 Ga0068863_100103188
1085 Ga0068863_100260484
1086 Ga0068863_100472007
1087 Ga0068858_100003904
1088 Ga0068858_100007004
1089 Ga0068858_100060938
1090 Ga0068858_100105241
1091 Ga0068858_100107069
1092 Ga0068860_100003148
1093 Ga0068860_100062392
1094 Ga0068860_100314652
1095 Ga0068862_100019495
1096 Ga0068862_100053228
1097 Ga0081455_10000185
1098 Ga0081455_10010009
1099 Ga0081455_10048349
1100 Ga0070717_10000285
1101 Ga0070717_10201997
1102 Ga0075365_10006667
1103 Ga0075368_10053959
1104 Ga0075432_10000240
1105 Ga0070715_10007982
1106 Ga0070715_10054620
1107 Ga0070716_100004717
1108 Ga0070716_100268151
1109 Ga0070712_100034230
1110 Ga0070712_100039928
1111 Ga0075367_10123183
1112 Ga0075427_10001422
1113 Ga0097621_100003827
1114 Ga0068871_100000215
1115 Ga0068871_100001366
1116 Ga0075428_100012848
1117 Ga0075428_100037318
1118 Ga0075428_100122112
1119 Ga0075430_100000012
1120 Ga0075431_100000602
1121 Ga0075431_100030504
1122 Ga0075433_10000338
1123 Ga0075433_10175157
1124 Ga0075434_100000373
1125 Ga0075434_100000842
1126 Ga0075434_100193239
1127 Ga0075429_100007327
1128 Ga0075429_100025962
1129 Ga0068865_100000190
1130 Ga0068865_100009354
1131 Ga0097620_100003965
1132 Ga0097620_100041549
1133 Ga0097620_100082750
1134 Ga0075435_100011049
1135 Ga0075435_100024690
1136 Ga0075435_100109235
1137 Ga0075435_100235885
1138 Ga0075435_100243335
1139 Ga0075435_100346151
1140 Ga0099794_10137235
1141 Ga0105251_10020186
1142 Ga0105251_10035309
1143 Ga0105250_10035199
1144 Ga0105240_10027358
1145 Ga0105240_10070736
1146 Ga0105240_10251390
1147 Ga0111539_10000299
1148 Ga0111539_10000725
1149 Ga0111539_10005091
1150 Ga0111539_10005821
1151 Ga0111539_10429664
1152 Ga0111539_10779953
1153 Ga0105245_10000543
1154 Ga0105245_10035281
1155 Ga0105245_10057546
1156 Ga0105245_10347300
1157 Ga0105247_10003987
1158 Ga0105247_10005905
1159 Ga0105247_10014231
1160 Ga0105247_10198805
1161 Ga0114129_10000227
1162 Ga0114129_10015409
1163 Ga0114129_10019814
1164 Ga0114129_10192052
1165 Ga0114129_10218604
1166 Ga0114129_10609620
1167 Ga0105243_10023782
1168 Ga0105243_10034321
1169 Ga0105243_10039708
1170 Ga0105241_10002875
1171 Ga0105241_10020666
1172 Ga0105241_10166885
1173 Ga0105242_10001766
1174 Ga0105242_10148496
1175 Ga0105242_10495367
1176 Ga0105248_10000501
1177 Ga0105248_10041038
1178 Ga0105248_10083720
1179 Ga0105248_10252808
1180 Ga0105248_10382944
1181 Ga0105248_10542848
1182 Ga0105237_10011199
1183 Ga0105237_10014165
1184 Ga0105237_10039491
1185 Ga0105237_10112215
1186 Ga0105238_10102269
1187 Ga0105249_10006521
1188 Ga0105249_10039615
1189 Ga0105239_10005329
1190 Ga0105246_10003469
1191 Ga0105246_10165556
1192 Ga0105246_10197576
1193 Ga0105246_10422840
1194 Ga0157342_1000244
1195 Ga0157373_10068573
1196 Ga0157371_10034339
1197 Ga0157369_10293426
1198 Ga0157374_10062294
1199 Ga0157374_10164329
1200 Ga0157374_10561304
1201 Ga0157378_10013696
1202 Ga0157378_10127726
1203 Ga0163162_10004207
1204 Ga0163162_10036841
1205 Ga0163162_10085046
1206 Ga0163162_10441223
1207 Ga0157372_10014709
1208 Ga0157372_10168338
1209 Ga0157375_10002141
1210 Ga0157375_10031231
1211 Ga0157375_10130497
1212 Ga0157375_10490179
1213 Ga0163163_10003931
1214 Ga0163163_10005032
1215 Ga0163163_10055004
1216 Ga0163163_10079659
1217 Ga0157380_10000049
1218 Ga0157377_10078009
1219 Ga0157379_10015257
1220 Ga0157379_10015309
1221 Ga0157379_10021769
1222 Ga0157379_10377192
1223 Ga0157376_10000099
1224 Ga0157376_10016011
1225 Ga0157376_10025417
1226 Ga0163161_10000081
1227 Ga0207666_1000167
1228 Ga0207673_1000150
1229 Ga0207697_10002292
1230 Ga0207653_10000843
1231 Ga0207653_10024102
1232 Ga0207682_10000046
1233 Ga0207692_10036538
1234 Ga0207642_10000135
1235 Ga0207642_10009208
1236 Ga0207710_10000850
1237 Ga0207710_10000873
1238 Ga0207710_10017322
1239 Ga0207688_10001056
1240 Ga0207680_10005263
1241 Ga0207647_10007296
1242 Ga0207647_10077967
1243 Ga0207685_10031726
1244 Ga0207699_10000312
1245 Ga0207699_10087690
1246 Ga0207699_10212969
1247 Ga0207645_10000162
1248 Ga0207645_10157376
1249 Ga0207643_10000025
1250 Ga0207684_10084848
1251 Ga0207654_10001641
1252 Ga0207654_10070689
1253 Ga0207707_10002255
1254 Ga0207693_10003951
1255 Ga0207693_10006436
1256 Ga0207663_10040020
1257 Ga0207663_10172076
1258 Ga0207660_10001243
1259 Ga0207660_10073977
1260 Ga0207660_10099479
1261 Ga0207662_10024757
1262 Ga0207662_10285371
1263 Ga0207657_10009100
1264 Ga0207657_10101539
1265 Ga0207657_10128242
1266 Ga0207649_10000048
1267 Ga0207649_10067804
1268 Ga0207652_10026062
1269 Ga0207652_10071521
1270 Ga0207652_10245815
1271 Ga0207652_10284478
1272 Ga0207681_10000131
1273 Ga0207681_10018372
1274 Ga0207650_10012254
1275 Ga0207659_10000040
1276 Ga0207687_10000090
1277 Ga0207700_10000231
1278 Ga0207700_10359713
1279 Ga0207664_10197377
1280 Ga0207644_10000473
1281 Ga0207644_10063240
1282 Ga0207690_10000173
1283 Ga0207690_10305467
1284 Ga0207706_10015889
1285 Ga0207686_10014701
1286 Ga0207686_10069456
1287 Ga0207709_10000585
1288 Ga0207709_10077416
1289 Ga0207709_10119012
1290 Ga0207670_10002222
1291 Ga0207670_10006934
1292 Ga0207670_10273308
1293 Ga0207669_10000102
1294 Ga0207669_10147487
1295 Ga0207704_10000097
1296 Ga0207704_10020284
1297 Ga0207665_10000487
1298 Ga0207665_10009084
1299 Ga0207665_10116372
1300 Ga0207665_10216484
1301 Ga0207691_10007973
1302 Ga0207711_10000847
1303 Ga0207711_10001975
1304 Ga0207711_10286792
1305 Ga0207689_10000677
1306 Ga0207689_10003052
1307 Ga0207661_10000204
1308 Ga0207661_10074423
1309 Ga0207661_10105698
1310 Ga0207661_10188910
1311 Ga0207679_10000090
1312 Ga0207679_10145059
1313 Ga0207679_10180706
1314 Ga0207679_10188131
1315 Ga0207651_10000017
1316 Ga0207651_10026112
1317 Ga0207712_10000114
1318 Ga0207712_10070190
1319 Ga0207668_10000139
1320 Ga0207668_10058200
1321 Ga0207668_10360260
1322 Ga0207668_10429545
1323 Ga0207640_10000221
1324 Ga0207640_10063623
1325 Ga0207658_10005690
1326 Ga0207658_10011332
1327 Ga0207677_10002794
1328 Ga0207677_10040887
1329 Ga0207703_10001230
1330 Ga0207703_10009415
1331 Ga0207639_10001275
1332 Ga0207639_10075624
1333 Ga0207678_10000197
1334 Ga0207678_10010540
1335 Ga0207708_10004699
1336 Ga0207708_10013323
1337 Ga0207702_10000198
1338 Ga0207702_10081852
1339 Ga0207702_10309581
1340 Ga0207641_10000417
1341 Ga0207641_10265887
1342 Ga0207648_10000483
1343 Ga0207676_10000372
1344 Ga0207676_10001984
1345 Ga0207674_10003549
1346 Ga0207674_10142672
1347 Ga0207675_100007915
1348 Ga0207675_100020311
1349 Ga0207675_100057413
1350 Ga0207683_10000141
1351 Ga0207683_10000908
1352 Ga0209984_1002913
1353 Ga0210002_1001176
1354 Ga0209971_1005351
1355 Ga0209966_1001487
1356 Ga0209998_10000232
1357 Ga0209998_10001040
1358 Ga0209974_10005229
1359 Ga0207428_10000058
1360 Ga0207428_10001115
1361 Ga0207428_10002874
1362 Ga0207428_10008433
1363 Ga0268266_10002234
1364 Ga0268265_10013047
1365 Ga0268264_10000412
1366 Ga0265337_1006179
1367 Ga0265334_10050600
1368 Ga0265338_10041790
1369 Ga0265330_10011472
1370 Ga0265330_10024284
1371 Ga0265325_10000036
1372 Ga0265325_10007651
1373 Ga0265325_10059108
1374 Ga0265340_10022764
1375 Ga0265339_10014749
1376 Ga0265316_10034358
1377 Ga0265313_10001570
1378 Ga0265313_10019218
1379 Ga0265313_10103866
1380 Ga0265314_10006219
1381 Ga0265314_10007314
1382 Ga0307416_100080536
1383 Ga0373948_0003112
1384 Ga0373958_0000560
1385 Ga0373958_0005433
1386 Ga0373959_0001450
1387 Ga0373938_0000036
1388 Ga0373938_0015276
1389 Ga0373926_0033495
1390 Ga0373926_0062752
1391 Ga0373928_0000812
1392 Ga0373929_0002736
1393 Ga0373929_0017848
1394 Ga0373934_0004844
1395 Ga0373934_0109403
1396 Ga0373940_0000390
1397 Ga0373944_0006514
1398 Ga0373944_0011632
1399 Ga0373949_0001580
1400 Ga0373949_0003013
1401 Ga0373951_0000312
1402 Ga0373952_0000533
1403 Ga0373923_0000978
1404 Ga0373923_0007388
1405 Ga0373932_0001347
1406 Ga0373932_0002893
1407 Ga0373932_0018502
1408 Ga0373932_0044240
1409 Ga0373936_0002402
1410 Ga0373936_0006435
1411 Ga0373939_0000502
1412 Ga0373939_0004753
1413 Ga0373941_0000268
1414 Ga0373941_0003730
1415 Ga0373941_0018992
1416 Ga0373945_0011045
1417 Ga0373945_0012738
1418 Ga0373954_0006112
1419 Ga0373954_0007494
1420 Ga0373954_0008449
1421 Ga0373954_0022950
1422 Ga0373956_0019685
1423 Ga0373956_0020444
1424 Ga0373957_0001478
1425 Ga0373957_0001491
1426 Ga0373957_0006863
1427 Ga0373957_0059420
1428 Ga0373943_0003974
1429 Ga0373943_0005161
1430 Ga0373943_0044179
1431 Ga0373943_0106307
1432 Ga0373946_0003537
1433 Ga0373946_0007697
1434 Ga0373946_0025273
1435 Ga0373946_0036872
1436 Ga0373955_0001092
1437 Ga0373955_0001995
1438 Ga0373955_0002098
1439 Ga0373955_0013592
1440 Ga0373955_0033141
1441 Ga0373955_0148604
1442 Ga0373942_0000260
1443 Ga0373942_0026250
1444 Ga0373961_0000492
1445 Ga0373962_0000091
1446 Ga0373962_0005292
1447 Ga0373924_0010530
1448 Ga0373924_0018520
1449 Ga0373924_0061891
1450 Ga0373931_0000131
1451 Ga0373931_0007255
1452 Ga0373935_0000377
1453 Ga0373935_0014579
1454 Ga0373927_0018997
1455 Ga0373927_0021440
1456 Ga0373927_0031784
1457 Ga0373927_0040483
1458 Ga0373933_0001665
1459 Ga0373933_0002410
1460 Ga0373933_0007167
1461 Ga0373933_0032143
1462 Ga0373947_0004674
1463 Ga0373947_0009750
1464 Ga0373947_0013218
1465 Ga0373947_0179780
1466 Ga0373937_0001849
1467 Ga0373937_0003289
1468 Ga0373937_0005585
1469 Ga0373937_0007611
1470 Ga0373937_0011521
1471 Ga0373937_0014729
1472 Ga0373937_0073183
1473 Ga0373925_0000075
1474 Ga0373925_0001381
1475 Ga0373925_0006934
1476 Ga0373925_0068052
1477 Ga0395900_0021219
1478 Ga0395900_0111939
1479 Ga0395898_0028469
1480 Ga0395898_0074389
1481 Ga0436364_0429623
1482 Ga0395901_0042693
1483 Ga0242420_007157
1484 Ga0436361_0670413
1485 Ga0451577_0096577
1486 Ga0466966_0235473
1487 Ga0466961_0044652
1488 Ga0466963_0021946
1489 Ga0466963_0097864
1490 Ga0466963_0348571
1491 Ga0466959_0093858
1492 Ga0451576_0370562
1493 Ga0466967_0005150
1494 Ga0495592_0000060
1495 Ga0495592_0001425
1496 Ga0495592_0009799
1497 Ga0495592_0013763
1498 Ga0495592_0150509
1499 Ga0495603_0011449
1500 Ga0495603_0014137
1501 Ga0495603_0031146
1502 Ga0495629_0001317
1503 Ga0495629_0008135
1504 Ga0495629_0045196
1505 Ga0495629_0149354
1506 Ga0495641_0016070
1507 Ga0495641_0045562
1508 Ga0495651_0000181
1509 Ga0495651_0001028
1510 Ga0495651_0015441
1511 Ga0495651_0034700
1512 Ga0495653_0000740
1513 Ga0495653_0006880
1514 Ga0495653_0054077
1515 Ga0495653_0080174
1516 Ga0495580_0019190
1517 Ga0495580_0190472
1518 Ga0495582_0017639
1519 Ga0495582_0095894
1520 Ga0495582_0181874
1521 Ga0495639_0109009
1522 Ga0495662_0001139
1523 Ga0495662_0010017
1524 Ga0495662_0054291
1525 Ga0495664_0000003
1526 Ga0495664_0018434
1527 Ga0495664_0073130
1528 Ga0495664_0110244
1529 Ga0495584_0034777
1530 Ga0495585_0002983
1531 Ga0495594_0012852
1532 Ga0495594_0019492
1533 Ga0495607_0043814
1534 Ga0495608_0000011
1535 Ga0495608_0014132
1536 Ga0495608_0020336
1537 Ga0495618_0000044
1538 Ga0495618_0007217
1539 Ga0495628_0000001
1540 Ga0495628_0022511
1541 Ga0495628_0032380
1542 Ga0495630_0002317
1543 Ga0495630_0021258
1544 Ga0495630_0155716
1545 Ga0495663_0009174
1546 Ga0495666_0004239
1547 Ga0495642_0134687
1548 Ga0495652_0000002
1549 Ga0495652_0006243
1550 Ga0495652_0011130
1551 Ga0495652_0124986
1552 Ga0495665_0010657
1553 Ga0495640_0000002
1554 Ga0495640_0020787
1555 Ga0495586_0017488
1556 Ga0495586_0034792
1557 Ga0495587_0000001
1558 Ga0495587_0002763
1559 Ga0495587_0024297
1560 Ga0495587_0052312
1561 Ga0495587_0087367
1562 Ga0495609_0097524
1563 Ga0495645_0000002
1564 Ga0495645_0008509
1565 Ga0495645_0021269
1566 Ga0495622_0057450
1567 Ga0495633_0004123
1568 Ga0495667_0000039
1569 Ga0495667_0008435
1570 Ga0495667_0012303
1571 Ga0495667_0032436
1572 Ga0495656_0008098
1573 Ga0495634_0000010
1574 Ga0495634_0261133
1575 Ga0495611_0024831
1576 Ga0495611_0127150
1577 Ga0495635_0000001
1578 Ga0495635_0007978
1579 Ga0495635_0030375
1580 Ga0495635_0047505
1581 Ga0495635_0060232
1582 Ga0495635_0245434
1583 Ga0495659_0002157
1584 Ga0495588_0001979
1585 Ga0495657_0000042
1586 Ga0495657_0008832
1587 Ga0495657_0039023
1588 Ga0495599_0000013
1589 Ga0495599_0003683
1590 Ga0495599_0034547
1591 Ga0495599_0103341
1592 Ga0495623_0000050
1593 Ga0495623_0000554
1594 Ga0495623_0013487
1595 Ga0495646_0000009
1596 Ga0495646_0001248
1597 Ga0495646_0114340
1598 Ga0495647_0005005
1599 Ga0495647_0012267
1600 Ga0495658_0009945
1601 Ga0495658_0026882
1602 Ga0495658_0034922
1603 Ga0495658_0044686
1604 Ga0495613_0009440
1605 Ga0495613_0104514
1606 Ga0495613_0176622
1607 Ga0495624_0037597
1608 Ga0495670_0005312
1609 Ga0495600_0000209
1610 Ga0495600_0000989
1611 Ga0495581_0046167
1612 Ga0495581_0148665
1613 Ga0495604_0000069
1614 Ga0495604_0002886
1615 Ga0495604_0007911
1616 Ga0495604_0010413
1617 Ga0495674_0000002
1618 Ga0495674_0160145
1619 Ga0495676_0181764
1620 Ga0495680_0000328
1621 Ga0495680_0001832
1622 Ga0495680_0012338
1623 Ga0495680_0012693
1624 Ga0495675_0000245
1625 Ga0495675_0000625
1626 Ga0495675_0010798
1627 Ga0495684_0000016
1628 Ga0495684_0000517
1629 Ga0495684_0019009
1630 Ga0495593_0000555
1631 Ga0495593_0008554
1632 Ga0495593_0015415
1633 Ga0495602_0000024
1634 Ga0495602_0052529
1635 Ga0495614_0002673
1636 Ga0496100_0000183
1637 Ga0496100_0001822
1638 Ga0496100_0258012
1639 Ga0496101_0001253
1640 Ga0496101_0040079
1641 Ga0496101_0164103
1642 Ga0496101_0334210
1643 Ga0496101_0382203
1644 Ga0496102_0002101
1645 Ga0496102_0021368
1646 Ga0496102_0088318
1647 Ga0496102_0096806
1648 Ga0496102_0524865
1649 Ga0496103_0011705
1650 Ga0496103_0017302
1651 Ga0496103_0130887
1652 Ga0496103_0278367
1653 Ga0496104_0000055
1654 Ga0496104_0003403
1655 Ga0496104_0015277
1656 Ga0496104_0018261
1657 Ga0496104_0019231
1658 Ga0496104_0220516
1659 Ga0496104_0489944
1660 Ga0496105_0000918
1661 Ga0496105_0009881
1662 Ga0496105_0027876
1663 Ga0496105_0082136
1664 Ga0496105_0098212
1665 Ga0496105_0105948
1666 Ga0496105_0123171
1667 Ga0496105_0168598
1668 Ga0496106_0000317
1669 Ga0496106_0018123
1670 Ga0496106_0070350
1671 Ga0496106_0083591
1672 Ga0496106_0105027
1673 Ga0496107_0013389
1674 Ga0496107_0036332
1675 Ga0496107_0059899
1676 Ga0496108_0039369
1677 Ga0496108_0045630
1678 Ga0496108_0448220
1679 Ga0496108_0474916
1680 Ga0496109_0000812
1681 Ga0496109_0012200
1682 Ga0496109_0023439
1683 Ga0496109_0025460
1684 Ga0496109_0060469
1685 Ga0496109_0091515
1686 Ga0496109_0353745
1687 Ga0496109_0540583
1688 Ga0496110_0004023
1689 Ga0496110_0011433
1690 Ga0496110_0114645
1691 Ga0496110_0149856
1692 Ga0496110_0169558
1693 Ga0496110_0210917
1694 Ga0496110_0366230
1695 Ga0496111_0002977
1696 Ga0496111_0010259
1697 Ga0496111_0034534
1698 Ga0496111_0128046
1699 Ga0496111_0164330
1700 Ga0496111_0271515
1701 Ga0496112_0002948
1702 Ga0496112_0085171
1703 Ga0496112_0189571
1704 Ga0496112_0448991
1705 Ga0496112_0449956
1706 Ga0496112_0527334
1707 Ga0496113_0008320
1708 Ga0496113_0017093
1709 Ga0496113_0039433
1710 Ga0496113_0127122
1711 Ga0496113_0146657
1712 Ga0496113_0176087
1713 Ga0496114_0000430
1714 Ga0496114_0017159
1715 Ga0496114_0286747
1716 Ga0496115_0008581
1717 Ga0496115_0014487
1718 Ga0496115_0016124
1719 Ga0496115_0028379
1720 Ga0496115_0061613
1721 Ga0496115_0208973
1722 Ga0496115_0248324
1723 Ga0501034_0116753
1724 Ga0501034_0491120
1725 Ga0501036_0383857
1726 Ga0501038_0068280
1727 Ga0501041_0022050
1728 Ga0501041_0118359
1729 Ga0501042_0108724
1730 Ga0501042_0226953
1731 Ga0501048_0117761
1732 Ga0501067_0015744
1733 Ga0501068_0339936
1734 Ga0501069_0020274
1735 Ga0501071_0021167
1736 Ga0501071_0138285
1737 Ga0501072_0057934
1738 Ga0501074_0170065
1739 Ga0501076_0068865
1740 Ga0501077_0010511
1741 Ga0501077_0108335
1742 Ga0501079_0042947
1743 Ga0501079_0206065
1744 Ga0501080_0373660
1745 Ga0501081_0034379
1746 Ga0501081_0199923
1747 Ga0501035_0174953
1748 Ga0501044_0198495
1749 nmdc:mga00v17_67260_c1
1750 nmdc:mga06z11_165224_c1
1751 nmdc:mga05p37_13845_c1
1752 nmdc:mga05p37_240876_c1
1753 nmdc:mga05p37_364276_c1
1754 nmdc:mga05p37_675_c1
1755 nmdc:mga05p37_76_c1
1756 nmdc:mga09592_19945_c1
1757 nmdc:mga09592_31289_c1
1758 nmdc:mga0qj67_18840_c1
1759 nmdc:mga0qj67_229_c1
1760 nmdc:mga06r32_1246_c1
1761 nmdc:mga06r32_134_c1
1762 nmdc:mga08y16_1152_c1
1763 nmdc:mga08y16_34053_c1
1764 nmdc:mga08y16_4279_c1
1765 nmdc:mga0n895_24756_c1
1766 nmdc:mga0n895_511603_c1
1767 nmdc:mga0n895_73_c1
1768 nmdc:mga0n895_96637_c1
1769 nmdc:mga0rr50_222899_c1
1770 nmdc:mga0rr50_3303_c1
1771 nmdc:mga0rr50_84908_c1
1772 nmdc:mga0rr50_98079_c1
1773 nmdc:mga08x19_134671_c1
1774 nmdc:mga0a205_4115_c1
1775 nmdc:mga0a205_59_c1
1776 Ga0495601_0000001
1777 Ga0495601_0000357
1778 Ga0495601_0000555
1779 Ga0495601_0002958
1780 Ga0495601_0004584
1781 Ga0495601_0006469
1782 Ga0495601_0027022
1783 Ga0495612_0000017
1784 Ga0495612_0000539
1785 Ga0495612_0008398
1786 Ga0495612_0009333
1787 Ga0495595_0000010
1788 Ga0495595_0000939
1789 Ga0495595_0001313
1790 Ga0495595_0002410
1791 Ga0495595_0005308
1792 Ga0495595_0020334
1793 Ga0495595_0176394
1794 Ga0495619_0000004
1795 Ga0495619_0000085
1796 Ga0495619_0000380
1797 Ga0495619_0000636
1798 Ga0495619_0002427
1799 Ga0495619_0008402
1800 Ga0495619_0025705
1801 Ga0495619_0075100
1802 Ga0501084_0015606
1803 Ga0501084_0020609
1804 Ga0501084_0281571
1805 Ga0501082_0073106
1806 Ga0501082_0097469
1807 Ga0501082_0431542
1808 Ga0530510_0054647

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02826

2-Hacid_dh_C

D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding domain

133

309

0.99

PF00389

2-Hacid_dh

D-isomer specific 2-hydroxyacid dehydrogenase, catalytic domain

29

341

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
7va1-assembly1.cif.gz_B crystal structure of human 3-phosphoglycerate dehydrogenase in complex with gdd-04-35 0.9529 102 284
6rj6-assembly1.cif.gz_A crystal structure of phgdh in complex with bi-4924 0.947 105 292
3ddn-assembly1.cif.gz_A crystal structure of hydroxypyruvic acid phosphate bound d-3-phosphoglycerate dehydrogenase in mycobacterium tuberculosis 0.9376 2 318
3ddn-assembly1.cif.gz_B-2 crystal structure of hydroxypyruvic acid phosphate bound d-3-phosphoglycerate dehydrogenase in mycobacterium tuberculosis 0.9365 2 319
3dc2-assembly1.cif.gz_B crystal structure of serine bound d-3-phosphoglycerate dehydrogenase from mycobacterium tuberculosis 0.9361 4 319
ID Description Score Start End Superfamily
af_Q2FZW9_11_72_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9663 39 98 3.40.50.720
af_Q2FZW9_121_261_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9621 145 284 3.40.50.720
af_Q9VII9_150_293_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9535 143 284 3.40.50.720
af_Q7SZY8_153_293_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9525 145 284 3.40.50.720
af_Q2FVW4_141_284_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9522 141 284 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A3T1E0P6-F1-model_v4 deleted 0.9733 141 268
AF-A0A287XTN6-F1-model_v4 deleted 0.9629 160 319
AF-B7FGD0-F1-model_v4 D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding domain-containing protein 0.9622 144 313 GO:0016491
GO:0051287
AF-A0A803NNM4-F1-model_v4 D-3-phosphoglycerate dehydrogenase 0.9621 152 313 GO:0004617
GO:0051287
AF-A0A6I1ZX03-F1-model_v4 C-terminal binding protein 0.962 94 315 GO:0003714
GO:0016616
GO:0051287

Map