F485282
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 904 | 393 | 1808 | 320 |
Family's Representative Sequence
| Representative Sequence | 3300034957|Ga0373938_0000189|Ga0373938_0000189_7042_8070 |
| Length | 342 |
| Sequence | VDACTPLSEFSRPFRLFLHVELLMAGPVIAVTDSVFPSLDPAKAALSRLNPTYRMAKSANADDILAVAKDADAILVTYAKLTREILSQLTRCRAIGRFGLGVDNIDLAAAKEKGIAVNYVPDYCIREVSDHAMALLLALIRKIPLSNKLVQGGRWEMPAVVPIRRIEGTVLGLVGFGHIPRLVAPKAQAFGMKVIAFDPFAKADVFKAARVESVDFDTLLNRSDYVSVHAPHTPQTRGMMNAAVFAKMKKGAYIINTARGPLIDEPALVAALDSGQVGGAGLDVVTAEPLAKDSPLLGRDNVIISPHTAFYSIEALEELQTKCASDVARVLSGEKAVYPISA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 2 | 2209111006 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 | Metagenome | Rhizosphere |
| 3 | 3300000041 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere | Metagenome | Rhizosphere |
| 4 | 3300000042 | Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young | Metagenome | Rhizosphere |
| 5 | 3300000043 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere | Metagenome | Rhizosphere |
| 6 | 3300000044 | Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old | Metagenome | Rhizosphere |
| 7 | 3300000045 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis Col-0 old rhizosphere | Metagenome | Rhizosphere |
| 8 | 3300000652 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA | Metagenome | Rhizosphere |
| 9 | 3300001430 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 | Metagenome | Rhizosphere |
| 10 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 11 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 12 | 3300001978 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 | Metagenome | Rhizosphere |
| 13 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 14 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 15 | 3300002073 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 | Metagenome | Rhizosphere |
| 16 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 17 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 18 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 19 | 3300002155 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 | Metagenome | Rhizosphere |
| 20 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 21 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 22 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 23 | 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 24 | 3300005276 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Mutant cpr5 v1 | Metagenome | Rhizosphere |
| 25 | 3300005277 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v2 (version 2) | Metagenome | Rhizosphere |
| 26 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 27 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 28 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 30 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 31 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 34 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 36 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 37 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 38 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 40 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 41 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 42 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 44 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 51 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 54 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 55 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 57 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 58 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 59 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 62 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 63 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 68 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 69 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 70 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 71 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 72 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 74 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 75 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 76 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 78 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 79 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 80 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 81 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 82 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 83 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 84 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 85 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 86 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 87 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 88 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 89 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 90 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 91 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 92 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 93 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 94 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 95 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 96 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 97 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 98 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 99 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 100 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 101 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 102 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 103 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 104 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 105 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 106 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 107 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 108 | 3300006194 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 | Metagenome | Rhizosphere |
| 109 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 111 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 112 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 113 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 114 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 115 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 116 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 117 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 118 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 120 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 121 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 122 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 123 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 124 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 126 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 127 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 129 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 130 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 131 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 132 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 133 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 134 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 135 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 136 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 137 | 3300012507 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 | Metagenome | Rhizosphere |
| 138 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 139 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 140 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 141 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 142 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 143 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 144 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 145 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 146 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 147 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 148 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 149 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 150 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 151 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 152 | 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025290 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300027424 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300027617 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 221 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 225 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 226 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 227 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 228 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 229 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 230 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 231 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 232 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 233 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 234 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 235 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 236 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 237 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 238 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 239 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 240 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 241 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 242 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 243 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 244 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 245 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 246 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 247 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 248 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 249 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 250 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 251 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 252 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 253 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 254 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 255 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 256 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 257 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 258 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 259 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 260 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 261 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 262 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 263 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 264 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 265 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 266 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 267 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 268 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 269 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 270 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 271 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 272 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 273 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 274 | 3300038996 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 | Metagenome | Rhizosphere |
| 275 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 276 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 277 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 278 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 279 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 280 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 281 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 282 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 283 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 342 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 343 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 344 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 345 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 346 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 347 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 348 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 349 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 350 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 351 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 352 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 353 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 354 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 355 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 356 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 357 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 358 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 359 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 360 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 361 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 362 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 363 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 364 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 365 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 366 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 367 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 368 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 369 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 370 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 371 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 372 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 373 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 374 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 375 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 376 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 377 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 378 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 379 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 380 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 381 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 382 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 383 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 384 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 385 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 386 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 387 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 388 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 389 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 390 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 391 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 392 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 393 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.55 |
| Nodule | 0 |
| Rhizoplane | 9.62 |
| Rhizosphere | 89.71 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 6.42 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0373938_0000189 | 3300034957 | Bacteria | 9118 |
| 2 | 2214736890 | 2209111006 | Bacteria | 4039 |
| 3 | ARcpr5oldR_c000047 | 3300000041 | Bacteria | 22345 |
| 4 | ARSoilYngRDRAFT_c00157 | 3300000042 | Bacteria | 11648 |
| 5 | ARcpr5yngRDRAFT_c000017 | 3300000043 | Bacteria | 27988 |
| 6 | ARSoilOldRDRAFT_c000006 | 3300000044 | Bacteria | 57169 |
| 7 | ARCol0oldRDRAFT_c00392 | 3300000045 | Bacteria | 4208 |
| 8 | ARCol0yngRDRAFT_1000043 | 3300000652 | Bacteria | 21432 |
| 9 | JGI24032J14994_100260 | 3300001430 | Bacteria | 2785 |
| 10 | JGI24741J21665_1002498 | 3300001915 | Bacteria | 4757 |
| 11 | JGI24746J21847_1000993 | 3300001977 | Bacteria | 4458 |
| 12 | JGI24747J21853_1003133 | 3300001978 | Bacteria | 1413 |
| 13 | JGI24737J22298_10001790 | 3300001990 | Bacteria | 7694 |
| 14 | JGI24737J22298_10002208 | 3300001990 | Bacteria | 6938 |
| 15 | JGI24750J21931_1000171 | 3300002070 | Bacteria | 10831 |
| 16 | JGI24745J21846_1000194 | 3300002073 | Bacteria | 4922 |
| 17 | JGI24748J21848_1000395 | 3300002074 | Bacteria | 4944 |
| 18 | JGI24738J21930_10000071 | 3300002075 | Bacteria | 21500 |
| 19 | JGI24744J21845_10001362 | 3300002077 | Bacteria | 4835 |
| 20 | JGI24033J26618_1000207 | 3300002155 | Bacteria | 7000 |
| 21 | JGI24034J26672_10001193 | 3300002239 | Bacteria | 3399 |
| 22 | JGI24742J22300_10000213 | 3300002244 | Bacteria | 8631 |
| 23 | JGI24751J29686_10003110 | 3300002459 | Bacteria | 3343 |
| 24 | JGI25405J52794_10005976 | 3300003911 | Bacteria | 2216 |
| 25 | Ga0065717_1002446 | 3300005276 | Bacteria | 1971 |
| 26 | Ga0065716_1001557 | 3300005277 | Bacteria | 6670 |
| 27 | Ga0065712_10000757 | 3300005290 | Bacteria | 8523 |
| 28 | Ga0065712_10001275 | 3300005290 | Bacteria | 6623 |
| 29 | Ga0065712_10004439 | 3300005290 | Bacteria | 5624 |
| 30 | Ga0065715_10005549 | 3300005293 | Bacteria | 7449 |
| 31 | Ga0065715_10089468 | 3300005293 | Bacteria | 10045 |
| 32 | Ga0065715_10096866 | 3300005293 | Bacteria | 3803 |
| 33 | Ga0070676_10000243 | 3300005328 | Bacteria | 23510 |
| 34 | Ga0070683_100011399 | 3300005329 | Bacteria | 7685 |
| 35 | Ga0070683_100053101 | 3300005329 | Bacteria | 3755 |
| 36 | Ga0070690_100036222 | 3300005330 | Bacteria | 3099 |
| 37 | Ga0070690_100239110 | 3300005330 | Bacteria | 1280 |
| 38 | Ga0070670_100017245 | 3300005331 | Bacteria | 6193 |
| 39 | Ga0070670_100029525 | 3300005331 | Bacteria | 4720 |
| 40 | Ga0070670_100045450 | 3300005331 | Bacteria | 3775 |
| 41 | Ga0070677_10000354 | 3300005333 | Bacteria | 16037 |
| 42 | Ga0068869_100000203 | 3300005334 | Bacteria | 31014 |
| 43 | Ga0070666_10019333 | 3300005335 | Plasmid | 4396 |
| 44 | Ga0070666_10022117 | 3300005335 | Bacteria | 4127 |
| 45 | Ga0070666_10057341 | 3300005335 | Bacteria | 2631 |
| 46 | Ga0070666_10079713 | 3300005335 | Bacteria | 2236 |
| 47 | Ga0070680_100002314 | 3300005336 | Bacteria | 14060 |
| 48 | Ga0070680_100046059 | 3300005336 | Bacteria | 3547 |
| 49 | Ga0070682_100000935 | 3300005337 | Bacteria | 17035 |
| 50 | Ga0070682_100034840 | 3300005337 | Bacteria | 3068 |
| 51 | Ga0068868_100002681 | 3300005338 | Bacteria | 12350 |
| 52 | Ga0070660_100002042 | 3300005339 | Bacteria | 13931 |
| 53 | Ga0070660_100017351 | 3300005339 | Bacteria | 5246 |
| 54 | Ga0070660_100161124 | 3300005339 | Bacteria | 1808 |
| 55 | Ga0070689_100004641 | 3300005340 | Bacteria | 9306 |
| 56 | Ga0070689_100007095 | 3300005340 | Bacteria | 7804 |
| 57 | Ga0070689_100033260 | 3300005340 | Bacteria | 3927 |
| 58 | Ga0070691_10000067 | 3300005341 | Bacteria | 28711 |
| 59 | Ga0070687_100000177 | 3300005343 | Bacteria | 22163 |
| 60 | Ga0070661_100001273 | 3300005344 | Bacteria | 17718 |
| 61 | Ga0070661_100049725 | 3300005344 | Unclassified | 3069 |
| 62 | Ga0070692_10000279 | 3300005345 | Bacteria | 14346 |
| 63 | Ga0070668_100001472 | 3300005347 | Bacteria | 17006 |
| 64 | Ga0070668_100014983 | 3300005347 | Bacteria | 5791 |
| 65 | Ga0070668_100397058 | 3300005347 | Bacteria | 1177 |
| 66 | Ga0070669_100001453 | 3300005353 | Bacteria | 17173 |
| 67 | Ga0070669_100026971 | 3300005353 | Bacteria | 4134 |
| 68 | Ga0070675_100009187 | 3300005354 | Bacteria | 7677 |
| 69 | Ga0070675_100130105 | 3300005354 | Bacteria | 2144 |
| 70 | Ga0070671_100001883 | 3300005355 | Bacteria | 16034 |
| 71 | Ga0070671_100358671 | 3300005355 | Bacteria | 1244 |
| 72 | Ga0070674_100000681 | 3300005356 | Bacteria | 17167 |
| 73 | Ga0070674_100208891 | 3300005356 | Bacteria | 1512 |
| 74 | Ga0070673_100000855 | 3300005364 | Bacteria | 17061 |
| 75 | Ga0070673_100020847 | 3300005364 | Bacteria | 4736 |
| 76 | Ga0070673_100063544 | 3300005364 | Bacteria | 2938 |
| 77 | Ga0070688_100003962 | 3300005365 | Bacteria | 7677 |
| 78 | Ga0070688_100007807 | 3300005365 | Bacteria | 5781 |
| 79 | Ga0070688_100067173 | 3300005365 | Bacteria | 2283 |
| 80 | Ga0070659_100000865 | 3300005366 | Bacteria | 22133 |
| 81 | Ga0070659_100024645 | 3300005366 | Bacteria | 4614 |
| 82 | Ga0070659_100090462 | 3300005366 | Bacteria | 2452 |
| 83 | Ga0070667_100002230 | 3300005367 | Bacteria | 17055 |
| 84 | Ga0070667_100064439 | 3300005367 | Plasmid | 3109 |
| 85 | Ga0070667_100113677 | 3300005367 | Bacteria | 2350 |
| 86 | Ga0070667_100304025 | 3300005367 | Bacteria | 1436 |
| 87 | Ga0070703_10001642 | 3300005406 | Bacteria | 6647 |
| 88 | Ga0070703_10028220 | 3300005406 | Bacteria | 1677 |
| 89 | Ga0070709_10000219 | 3300005434 | Bacteria | 37061 |
| 90 | Ga0070714_100309849 | 3300005435 | Bacteria | 1474 |
| 91 | Ga0070713_100000224 | 3300005436 | Bacteria | 37679 |
| 92 | Ga0070713_100315963 | 3300005436 | Bacteria | 1441 |
| 93 | Ga0070713_100418523 | 3300005436 | Bacteria | 1254 |
| 94 | Ga0070710_10000956 | 3300005437 | Bacteria | 13707 |
| 95 | Ga0070710_10024912 | 3300005437 | Bacteria | 3162 |
| 96 | Ga0070710_10064585 | 3300005437 | Bacteria | 2094 |
| 97 | Ga0070701_10005114 | 3300005438 | Bacteria | 5388 |
| 98 | Ga0070701_10007452 | 3300005438 | Bacteria | 4677 |
| 99 | Ga0070711_100046600 | 3300005439 | Bacteria | 2954 |
| 100 | Ga0070711_100074337 | 3300005439 | Bacteria | 2403 |
| 101 | Ga0070711_100093115 | 3300005439 | Bacteria | 2175 |
| 102 | Ga0070711_100108359 | 3300005439 | Bacteria | 2035 |
| 103 | Ga0070705_100005835 | 3300005440 | Bacteria | 6023 |
| 104 | Ga0070700_100005851 | 3300005441 | Bacteria | 6529 |
| 105 | Ga0070700_100187315 | 3300005441 | Bacteria | 1444 |
| 106 | Ga0070694_100003826 | 3300005444 | Bacteria | 8991 |
| 107 | Ga0070694_100006136 | 3300005444 | Bacteria | 7291 |
| 108 | Ga0070708_100109315 | 3300005445 | Bacteria | 2540 |
| 109 | Ga0070663_100006960 | 3300005455 | Bacteria | 6847 |
| 110 | Ga0070663_100173142 | 3300005455 | Bacteria | 1669 |
| 111 | Ga0070663_100365481 | 3300005455 | Bacteria | 1171 |
| 112 | Ga0070678_100001091 | 3300005456 | Bacteria | 14198 |
| 113 | Ga0070678_100005289 | 3300005456 | Bacteria | 7438 |
| 114 | Ga0070678_100467563 | 3300005456 | Unclassified | 1107 |
| 115 | Ga0070662_100002349 | 3300005457 | Bacteria | 11640 |
| 116 | Ga0070662_100070604 | 3300005457 | Bacteria | 2574 |
| 117 | Ga0070681_10024485 | 3300005458 | Bacteria | 6076 |
| 118 | Ga0070681_10053992 | 3300005458 | Bacteria | 4004 |
| 119 | Ga0070681_10143449 | 3300005458 | Bacteria | 2317 |
| 120 | Ga0068867_100000679 | 3300005459 | Bacteria | 22540 |
| 121 | Ga0070685_10004534 | 3300005466 | Bacteria | 7029 |
| 122 | Ga0070685_10009881 | 3300005466 | Bacteria | 4948 |
| 123 | Ga0070707_100398354 | 3300005468 | Bacteria | 1337 |
| 124 | Ga0070698_100334228 | 3300005471 | Bacteria | 1446 |
| 125 | Ga0070699_100042469 | 3300005518 | Bacteria | 3934 |
| 126 | Ga0070679_100023517 | 3300005530 | Bacteria | 6032 |
| 127 | Ga0070679_100072165 | 3300005530 | Bacteria | 3444 |
| 128 | Ga0070679_100237237 | 3300005530 | Bacteria | 1782 |
| 129 | Ga0070684_100009436 | 3300005535 | Bacteria | 7685 |
| 130 | Ga0068853_100005760 | 3300005539 | Bacteria | 9755 |
| 131 | Ga0068853_100066309 | 3300005539 | Unclassified | 3134 |
| 132 | Ga0068853_100372742 | 3300005539 | Bacteria | 1332 |
| 133 | Ga0070672_100006901 | 3300005543 | Bacteria | 7677 |
| 134 | Ga0070672_100179904 | 3300005543 | Bacteria | 1762 |
| 135 | Ga0070672_100369301 | 3300005543 | Bacteria | 1225 |
| 136 | Ga0070686_100001302 | 3300005544 | Bacteria | 14092 |
| 137 | Ga0070686_100007436 | 3300005544 | Bacteria | 6113 |
| 138 | Ga0070686_100008195 | 3300005544 | Bacteria | 5848 |
| 139 | Ga0070695_100002461 | 3300005545 | Bacteria | 10663 |
| 140 | Ga0070695_100035427 | 3300005545 | Bacteria | 3135 |
| 141 | Ga0070696_100001783 | 3300005546 | Bacteria | 14106 |
| 142 | Ga0070696_100063265 | 3300005546 | Bacteria | 2592 |
| 143 | Ga0070696_100207079 | 3300005546 | Bacteria | 1467 |
| 144 | Ga0070693_100002420 | 3300005547 | Bacteria | 8583 |
| 145 | Ga0070693_100020181 | 3300005547 | Bacteria | 3510 |
| 146 | Ga0070693_100032492 | 3300005547 | Bacteria | 2871 |
| 147 | Ga0070665_100007393 | 3300005548 | Bacteria | 11177 |
| 148 | Ga0070665_100044933 | 3300005548 | Plasmid | 4434 |
| 149 | Ga0070665_100270254 | 3300005548 | Bacteria | 1702 |
| 150 | Ga0070665_100285507 | 3300005548 | Unclassified | 1652 |
| 151 | Ga0070704_100004905 | 3300005549 | Bacteria | 7766 |
| 152 | Ga0070704_100008656 | 3300005549 | Bacteria | 6117 |
| 153 | Ga0070704_100300021 | 3300005549 | Bacteria | 1338 |
| 154 | Ga0070704_100385894 | 3300005549 | Bacteria | 1191 |
| 155 | Ga0068855_100010931 | 3300005563 | Bacteria | 10955 |
| 156 | Ga0070664_100008419 | 3300005564 | Bacteria | 8340 |
| 157 | Ga0070664_100080870 | 3300005564 | Bacteria | 2799 |
| 158 | Ga0070664_100187041 | 3300005564 | Bacteria | 1844 |
| 159 | Ga0068857_100000534 | 3300005577 | Bacteria | 27500 |
| 160 | Ga0068857_100221056 | 3300005577 | Bacteria | 1730 |
| 161 | Ga0068854_100007195 | 3300005578 | Bacteria | 7107 |
| 162 | Ga0068856_100000272 | 3300005614 | Bacteria | 56279 |
| 163 | Ga0068856_100395948 | 3300005614 | Bacteria | 1401 |
| 164 | Ga0070702_100006314 | 3300005615 | Bacteria | 5601 |
| 165 | Ga0068852_100003393 | 3300005616 | Bacteria | 11127 |
| 166 | Ga0068859_100003965 | 3300005617 | Bacteria | 15100 |
| 167 | Ga0068859_100041550 | 3300005617 | Bacteria | 4618 |
| 168 | Ga0068859_100082748 | 3300005617 | Bacteria | 3252 |
| 169 | Ga0068859_100232466 | 3300005617 | Unclassified | 1932 |
| 170 | Ga0068864_100006326 | 3300005618 | Bacteria | 9712 |
| 171 | Ga0068864_100009979 | 3300005618 | Bacteria | 7836 |
| 172 | Ga0068864_100582154 | 3300005618 | Unclassified | 1084 |
| 173 | Ga0068866_10000252 | 3300005718 | Bacteria | 25051 |
| 174 | Ga0068866_10040918 | 3300005718 | Bacteria | 2297 |
| 175 | Ga0068861_100001032 | 3300005719 | Bacteria | 17052 |
| 176 | Ga0068861_100046020 | 3300005719 | Bacteria | 3288 |
| 177 | Ga0068861_100213103 | 3300005719 | Unclassified | 1628 |
| 178 | Ga0068870_10000092 | 3300005840 | Bacteria | 29393 |
| 179 | Ga0068863_100017599 | 3300005841 | Bacteria | 6847 |
| 180 | Ga0068863_100103188 | 3300005841 | Bacteria | 2712 |
| 181 | Ga0068863_100260484 | 3300005841 | Bacteria | 1676 |
| 182 | Ga0068863_100472007 | 3300005841 | Bacteria | 1233 |
| 183 | Ga0068858_100003904 | 3300005842 | Bacteria | 14725 |
| 184 | Ga0068858_100007004 | 3300005842 | Bacteria | 10952 |
| 185 | Ga0068858_100060938 | 3300005842 | Bacteria | 3488 |
| 186 | Ga0068858_100105241 | 3300005842 | Bacteria | 2633 |
| 187 | Ga0068858_100107069 | 3300005842 | Unclassified | 2609 |
| 188 | Ga0068860_100003148 | 3300005843 | Bacteria | 17055 |
| 189 | Ga0068860_100062392 | 3300005843 | Bacteria | 3541 |
| 190 | Ga0068860_100314652 | 3300005843 | Bacteria | 1536 |
| 191 | Ga0068862_100019495 | 3300005844 | Bacteria | 5662 |
| 192 | Ga0068862_100053228 | 3300005844 | Bacteria | 3464 |
| 193 | Ga0081455_10000185 | 3300005937 | Bacteria | 78750 |
| 194 | Ga0081455_10010009 | 3300005937 | Bacteria | 9692 |
| 195 | Ga0081455_10048349 | 3300005937 | Bacteria | 3676 |
| 196 | Ga0070717_10000285 | 3300006028 | Bacteria | 34330 |
| 197 | Ga0070717_10201997 | 3300006028 | Bacteria | 1741 |
| 198 | Ga0075365_10006667 | 3300006038 | Bacteria | 6379 |
| 199 | Ga0075368_10053959 | 3300006042 | Bacteria | 1601 |
| 200 | Ga0075432_10000240 | 3300006058 | Bacteria | 14777 |
| 201 | Ga0070715_10007982 | 3300006163 | Plasmid | 3669 |
| 202 | Ga0070715_10054620 | 3300006163 | Bacteria | 1730 |
| 203 | Ga0070716_100004717 | 3300006173 | Bacteria | 6537 |
| 204 | Ga0070716_100268151 | 3300006173 | Bacteria | 1172 |
| 205 | Ga0070712_100034230 | 3300006175 | Plasmid | 3441 |
| 206 | Ga0070712_100039928 | 3300006175 | Bacteria | 3214 |
| 207 | Ga0075367_10123183 | 3300006178 | Unclassified | 1599 |
| 208 | Ga0075427_10001422 | 3300006194 | Bacteria | 3071 |
| 209 | Ga0097621_100003827 | 3300006237 | Bacteria | 10424 |
| 210 | Ga0068871_100000215 | 3300006358 | Bacteria | 40308 |
| 211 | Ga0068871_100001366 | 3300006358 | Bacteria | 16355 |
| 212 | Ga0075428_100012848 | 3300006844 | Bacteria | 9317 |
| 213 | Ga0075428_100037318 | 3300006844 | Bacteria | 5350 |
| 214 | Ga0075428_100122112 | 3300006844 | Unclassified | 2836 |
| 215 | Ga0075430_100000012 | 3300006846 | Bacteria | 94359 |
| 216 | Ga0075431_100000602 | 3300006847 | Bacteria | 30370 |
| 217 | Ga0075431_100030504 | 3300006847 | Bacteria | 5554 |
| 218 | Ga0075433_10000338 | 3300006852 | Bacteria | 29055 |
| 219 | Ga0075433_10175157 | 3300006852 | Bacteria | 1909 |
| 220 | Ga0075434_100000373 | 3300006871 | Bacteria | 32610 |
| 221 | Ga0075434_100000842 | 3300006871 | Bacteria | 24401 |
| 222 | Ga0075434_100193239 | 3300006871 | Bacteria | 2056 |
| 223 | Ga0075429_100007327 | 3300006880 | Bacteria | 9575 |
| 224 | Ga0075429_100025962 | 3300006880 | Bacteria | 5085 |
| 225 | Ga0068865_100000190 | 3300006881 | Bacteria | 34392 |
| 226 | Ga0068865_100009354 | 3300006881 | Bacteria | 6072 |
| 227 | Ga0097620_100003965 | 3300006931 | Bacteria | 15100 |
| 228 | Ga0097620_100041549 | 3300006931 | Bacteria | 4618 |
| 229 | Ga0097620_100082750 | 3300006931 | Bacteria | 3252 |
| 230 | Ga0075435_100011049 | 3300007076 | Bacteria | 6624 |
| 231 | Ga0075435_100024690 | 3300007076 | Bacteria | 4668 |
| 232 | Ga0075435_100109235 | 3300007076 | Bacteria | 2299 |
| 233 | Ga0075435_100235885 | 3300007076 | Bacteria | 1555 |
| 234 | Ga0075435_100243335 | 3300007076 | Unclassified | 1530 |
| 235 | Ga0075435_100346151 | 3300007076 | Bacteria | 1274 |
| 236 | Ga0099794_10137235 | 3300007265 | Bacteria | 1237 |
| 237 | Ga0105251_10020186 | 3300009011 | Plasmid | 3505 |
| 238 | Ga0105251_10035309 | 3300009011 | Bacteria | 2468 |
| 239 | Ga0105250_10035199 | 3300009092 | Bacteria | 2009 |
| 240 | Ga0105240_10027358 | 3300009093 | Bacteria | 7465 |
| 241 | Ga0105240_10070736 | 3300009093 | Bacteria | 4316 |
| 242 | Ga0105240_10251390 | 3300009093 | Bacteria | 2044 |
| 243 | Ga0111539_10000299 | 3300009094 | Bacteria | 60010 |
| 244 | Ga0111539_10000725 | 3300009094 | Bacteria | 42875 |
| 245 | Ga0111539_10005091 | 3300009094 | Bacteria | 17061 |
| 246 | Ga0111539_10005821 | 3300009094 | Bacteria | 15939 |
| 247 | Ga0111539_10429664 | 3300009094 | Bacteria | 1538 |
| 248 | Ga0111539_10779953 | 3300009094 | Bacteria | 1112 |
| 249 | Ga0105245_10000543 | 3300009098 | Bacteria | 34420 |
| 250 | Ga0105245_10035281 | 3300009098 | Bacteria | 4438 |
| 251 | Ga0105245_10057546 | 3300009098 | Unclassified | 3497 |
| 252 | Ga0105245_10347300 | 3300009098 | Bacteria | 1469 |
| 253 | Ga0105247_10003987 | 3300009101 | Bacteria | 9506 |
| 254 | Ga0105247_10005905 | 3300009101 | Bacteria | 7647 |
| 255 | Ga0105247_10014231 | 3300009101 | Bacteria | 4774 |
| 256 | Ga0105247_10198805 | 3300009101 | Unclassified | 1346 |
| 257 | Ga0114129_10000227 | 3300009147 | Bacteria | 62698 |
| 258 | Ga0114129_10015409 | 3300009147 | Bacteria | 10876 |
| 259 | Ga0114129_10019814 | 3300009147 | Bacteria | 9572 |
| 260 | Ga0114129_10192052 | 3300009147 | Bacteria | 2772 |
| 261 | Ga0114129_10218604 | 3300009147 | Bacteria | 2572 |
| 262 | Ga0114129_10609620 | 3300009147 | Bacteria | 1413 |
| 263 | Ga0105243_10023782 | 3300009148 | Bacteria | 4669 |
| 264 | Ga0105243_10034321 | 3300009148 | Bacteria | 3926 |
| 265 | Ga0105243_10039708 | 3300009148 | Bacteria | 3671 |
| 266 | Ga0105241_10002875 | 3300009174 | Bacteria | 12867 |
| 267 | Ga0105241_10020666 | 3300009174 | Bacteria | 4864 |
| 268 | Ga0105241_10166885 | 3300009174 | Bacteria | 1815 |
| 269 | Ga0105242_10001766 | 3300009176 | Bacteria | 17062 |
| 270 | Ga0105242_10148496 | 3300009176 | Bacteria | 2042 |
| 271 | Ga0105242_10495367 | 3300009176 | Bacteria | 1161 |
| 272 | Ga0105248_10000501 | 3300009177 | Bacteria | 44646 |
| 273 | Ga0105248_10041038 | 3300009177 | Bacteria | 5188 |
| 274 | Ga0105248_10083720 | 3300009177 | Bacteria | 3588 |
| 275 | Ga0105248_10252808 | 3300009177 | Bacteria | 1984 |
| 276 | Ga0105248_10382944 | 3300009177 | Unclassified | 1584 |
| 277 | Ga0105248_10542848 | 3300009177 | Bacteria | 1311 |
| 278 | Ga0105237_10011199 | 3300009545 | Bacteria | 9507 |
| 279 | Ga0105237_10014165 | 3300009545 | Bacteria | 8348 |
| 280 | Ga0105237_10039491 | 3300009545 | Bacteria | 4765 |
| 281 | Ga0105237_10112215 | 3300009545 | Bacteria | 2718 |
| 282 | Ga0105238_10102269 | 3300009551 | Bacteria | 2847 |
| 283 | Ga0105249_10006521 | 3300009553 | Bacteria | 10153 |
| 284 | Ga0105249_10039615 | 3300009553 | Bacteria | 4278 |
| 285 | Ga0105239_10005329 | 3300010375 | Bacteria | 15087 |
| 286 | Ga0105246_10003469 | 3300011119 | Bacteria | 9558 |
| 287 | Ga0105246_10165556 | 3300011119 | Bacteria | 1688 |
| 288 | Ga0105246_10197576 | 3300011119 | Bacteria | 1561 |
| 289 | Ga0105246_10422840 | 3300011119 | Unclassified | 1112 |
| 290 | Ga0157342_1000244 | 3300012507 | Bacteria | 2998 |
| 291 | Ga0157373_10068573 | 3300013100 | Bacteria | 2507 |
| 292 | Ga0157371_10034339 | 3300013102 | Bacteria | 3638 |
| 293 | Ga0157369_10293426 | 3300013105 | Bacteria | 1692 |
| 294 | Ga0157374_10062294 | 3300013296 | Plasmid | 3496 |
| 295 | Ga0157374_10164329 | 3300013296 | Bacteria | 2163 |
| 296 | Ga0157374_10561304 | 3300013296 | Unclassified | 1150 |
| 297 | Ga0157378_10013696 | 3300013297 | Bacteria | 7093 |
| 298 | Ga0157378_10127726 | 3300013297 | Bacteria | 2350 |
| 299 | Ga0163162_10004207 | 3300013306 | Bacteria | 13834 |
| 300 | Ga0163162_10036841 | 3300013306 | Bacteria | 4878 |
| 301 | Ga0163162_10085046 | 3300013306 | Unclassified | 3239 |
| 302 | Ga0163162_10441223 | 3300013306 | Unclassified | 1434 |
| 303 | Ga0157372_10014709 | 3300013307 | Bacteria | 8373 |
| 304 | Ga0157372_10168338 | 3300013307 | Bacteria | 2535 |
| 305 | Ga0157375_10002141 | 3300013308 | Bacteria | 17061 |
| 306 | Ga0157375_10031231 | 3300013308 | Bacteria | 5031 |
| 307 | Ga0157375_10130497 | 3300013308 | Bacteria | 2632 |
| 308 | Ga0157375_10490179 | 3300013308 | Bacteria | 1394 |
| 309 | Ga0163163_10003931 | 3300014325 | Bacteria | 12675 |
| 310 | Ga0163163_10005032 | 3300014325 | Bacteria | 11390 |
| 311 | Ga0163163_10055004 | 3300014325 | Bacteria | 3933 |
| 312 | Ga0163163_10079659 | 3300014325 | Bacteria | 3274 |
| 313 | Ga0157380_10000049 | 3300014326 | Bacteria | 71296 |
| 314 | Ga0157377_10078009 | 3300014745 | Unclassified | 1930 |
| 315 | Ga0157379_10015257 | 3300014968 | Bacteria | 6739 |
| 316 | Ga0157379_10015309 | 3300014968 | Bacteria | 6727 |
| 317 | Ga0157379_10021769 | 3300014968 | Bacteria | 5679 |
| 318 | Ga0157379_10377192 | 3300014968 | Unclassified | 1301 |
| 319 | Ga0157376_10000099 | 3300014969 | Bacteria | 62912 |
| 320 | Ga0157376_10016011 | 3300014969 | Bacteria | 5682 |
| 321 | Ga0157376_10025417 | 3300014969 | Bacteria | 4663 |
| 322 | Ga0163161_10000081 | 3300017792 | Bacteria | 97213 |
| 323 | Ga0207666_1000167 | 3300025271 | Bacteria | 10172 |
| 324 | Ga0207673_1000150 | 3300025290 | Bacteria | 6838 |
| 325 | Ga0207697_10002292 | 3300025315 | Bacteria | 10003 |
| 326 | Ga0207653_10000843 | 3300025885 | Bacteria | 10205 |
| 327 | Ga0207653_10024102 | 3300025885 | Bacteria | 1941 |
| 328 | Ga0207682_10000046 | 3300025893 | Bacteria | 51587 |
| 329 | Ga0207692_10036538 | 3300025898 | Unclassified | 2396 |
| 330 | Ga0207642_10000135 | 3300025899 | Bacteria | 20564 |
| 331 | Ga0207642_10009208 | 3300025899 | Bacteria | 3426 |
| 332 | Ga0207710_10000850 | 3300025900 | Bacteria | 16454 |
| 333 | Ga0207710_10000873 | 3300025900 | Bacteria | 16148 |
| 334 | Ga0207710_10017322 | 3300025900 | Bacteria | 3056 |
| 335 | Ga0207688_10001056 | 3300025901 | Bacteria | 14080 |
| 336 | Ga0207680_10005263 | 3300025903 | Bacteria | 6171 |
| 337 | Ga0207647_10007296 | 3300025904 | Bacteria | 8002 |
| 338 | Ga0207647_10077967 | 3300025904 | Bacteria | 1991 |
| 339 | Ga0207685_10031726 | 3300025905 | Unclassified | 1895 |
| 340 | Ga0207699_10000312 | 3300025906 | Bacteria | 25999 |
| 341 | Ga0207699_10087690 | 3300025906 | Bacteria | 1946 |
| 342 | Ga0207699_10212969 | 3300025906 | Bacteria | 1315 |
| 343 | Ga0207645_10000162 | 3300025907 | Bacteria | 52720 |
| 344 | Ga0207645_10157376 | 3300025907 | Bacteria | 1485 |
| 345 | Ga0207643_10000025 | 3300025908 | Bacteria | 101583 |
| 346 | Ga0207684_10084848 | 3300025910 | Bacteria | 2697 |
| 347 | Ga0207654_10001641 | 3300025911 | Bacteria | 11696 |
| 348 | Ga0207654_10070689 | 3300025911 | Bacteria | 2073 |
| 349 | Ga0207707_10002255 | 3300025912 | Bacteria | 17449 |
| 350 | Ga0207693_10003951 | 3300025915 | Bacteria | 12597 |
| 351 | Ga0207693_10006436 | 3300025915 | Bacteria | 9731 |
| 352 | Ga0207663_10040020 | 3300025916 | Unclassified | 2846 |
| 353 | Ga0207663_10172076 | 3300025916 | Bacteria | 1539 |
| 354 | Ga0207660_10001243 | 3300025917 | Bacteria | 17069 |
| 355 | Ga0207660_10073977 | 3300025917 | Bacteria | 2486 |
| 356 | Ga0207660_10099479 | 3300025917 | Bacteria | 2170 |
| 357 | Ga0207662_10024757 | 3300025918 | Bacteria | 3454 |
| 358 | Ga0207662_10285371 | 3300025918 | Bacteria | 1094 |
| 359 | Ga0207657_10009100 | 3300025919 | Bacteria | 10019 |
| 360 | Ga0207657_10101539 | 3300025919 | Bacteria | 2387 |
| 361 | Ga0207657_10128242 | 3300025919 | Bacteria | 2081 |
| 362 | Ga0207649_10000048 | 3300025920 | Bacteria | 110714 |
| 363 | Ga0207649_10067804 | 3300025920 | Unclassified | 2266 |
| 364 | Ga0207652_10026062 | 3300025921 | Bacteria | 4866 |
| 365 | Ga0207652_10071521 | 3300025921 | Bacteria | 3014 |
| 366 | Ga0207652_10245815 | 3300025921 | Bacteria | 1613 |
| 367 | Ga0207652_10284478 | 3300025921 | Bacteria | 1492 |
| 368 | Ga0207681_10000131 | 3300025923 | Bacteria | 61025 |
| 369 | Ga0207681_10018372 | 3300025923 | Bacteria | 4405 |
| 370 | Ga0207650_10012254 | 3300025925 | Bacteria | 5917 |
| 371 | Ga0207659_10000040 | 3300025926 | Bacteria | 91375 |
| 372 | Ga0207687_10000090 | 3300025927 | Bacteria | 66310 |
| 373 | Ga0207700_10000231 | 3300025928 | Bacteria | 33501 |
| 374 | Ga0207700_10359713 | 3300025928 | Bacteria | 1269 |
| 375 | Ga0207664_10197377 | 3300025929 | Bacteria | 1735 |
| 376 | Ga0207644_10000473 | 3300025931 | Bacteria | 25907 |
| 377 | Ga0207644_10063240 | 3300025931 | Bacteria | 2687 |
| 378 | Ga0207690_10000173 | 3300025932 | Bacteria | 50054 |
| 379 | Ga0207690_10305467 | 3300025932 | Bacteria | 1246 |
| 380 | Ga0207706_10015889 | 3300025933 | Bacteria | 6804 |
| 381 | Ga0207686_10014701 | 3300025934 | Bacteria | 4364 |
| 382 | Ga0207686_10069456 | 3300025934 | Unclassified | 2260 |
| 383 | Ga0207709_10000585 | 3300025935 | Bacteria | 30473 |
| 384 | Ga0207709_10077416 | 3300025935 | Bacteria | 2132 |
| 385 | Ga0207709_10119012 | 3300025935 | Unclassified | 1780 |
| 386 | Ga0207670_10002222 | 3300025936 | Bacteria | 10152 |
| 387 | Ga0207670_10006934 | 3300025936 | Bacteria | 6305 |
| 388 | Ga0207670_10273308 | 3300025936 | Bacteria | 1314 |
| 389 | Ga0207669_10000102 | 3300025937 | Bacteria | 42874 |
| 390 | Ga0207669_10147487 | 3300025937 | Bacteria | 1643 |
| 391 | Ga0207704_10000097 | 3300025938 | Bacteria | 49151 |
| 392 | Ga0207704_10020284 | 3300025938 | Bacteria | 3512 |
| 393 | Ga0207665_10000487 | 3300025939 | Bacteria | 26772 |
| 394 | Ga0207665_10009084 | 3300025939 | Bacteria | 6526 |
| 395 | Ga0207665_10116372 | 3300025939 | Bacteria | 1884 |
| 396 | Ga0207665_10216484 | 3300025939 | Bacteria | 1402 |
| 397 | Ga0207691_10007973 | 3300025940 | Bacteria | 10188 |
| 398 | Ga0207711_10000847 | 3300025941 | Bacteria | 29585 |
| 399 | Ga0207711_10001975 | 3300025941 | Bacteria | 18574 |
| 400 | Ga0207711_10286792 | 3300025941 | Bacteria | 1517 |
| 401 | Ga0207689_10000677 | 3300025942 | Bacteria | 32501 |
| 402 | Ga0207689_10003052 | 3300025942 | Bacteria | 15417 |
| 403 | Ga0207661_10000204 | 3300025944 | Bacteria | 38344 |
| 404 | Ga0207661_10074423 | 3300025944 | Bacteria | 2784 |
| 405 | Ga0207661_10105698 | 3300025944 | Bacteria | 2372 |
| 406 | Ga0207661_10188910 | 3300025944 | Bacteria | 1805 |
| 407 | Ga0207679_10000090 | 3300025945 | Bacteria | 79412 |
| 408 | Ga0207679_10145059 | 3300025945 | Unclassified | 1924 |
| 409 | Ga0207679_10180706 | 3300025945 | Bacteria | 1745 |
| 410 | Ga0207679_10188131 | 3300025945 | Bacteria | 1714 |
| 411 | Ga0207651_10000017 | 3300025960 | Bacteria | 100256 |
| 412 | Ga0207651_10026112 | 3300025960 | Plasmid | 3642 |
| 413 | Ga0207712_10000114 | 3300025961 | Bacteria | 87261 |
| 414 | Ga0207712_10070190 | 3300025961 | Plasmid | 2516 |
| 415 | Ga0207668_10000139 | 3300025972 | Bacteria | 49764 |
| 416 | Ga0207668_10058200 | 3300025972 | Bacteria | 2700 |
| 417 | Ga0207668_10360260 | 3300025972 | Bacteria | 1218 |
| 418 | Ga0207668_10429545 | 3300025972 | Bacteria | 1123 |
| 419 | Ga0207640_10000221 | 3300025981 | Bacteria | 40097 |
| 420 | Ga0207640_10063623 | 3300025981 | Bacteria | 2452 |
| 421 | Ga0207658_10005690 | 3300025986 | Bacteria | 8523 |
| 422 | Ga0207658_10011332 | 3300025986 | Bacteria | 6069 |
| 423 | Ga0207677_10002794 | 3300026023 | Bacteria | 9219 |
| 424 | Ga0207677_10040887 | 3300026023 | Bacteria | 3061 |
| 425 | Ga0207703_10001230 | 3300026035 | Bacteria | 23955 |
| 426 | Ga0207703_10009415 | 3300026035 | Bacteria | 7674 |
| 427 | Ga0207639_10001275 | 3300026041 | Bacteria | 17013 |
| 428 | Ga0207639_10075624 | 3300026041 | Bacteria | 2649 |
| 429 | Ga0207678_10000197 | 3300026067 | Bacteria | 52596 |
| 430 | Ga0207678_10010540 | 3300026067 | Bacteria | 8118 |
| 431 | Ga0207708_10004699 | 3300026075 | Bacteria | 10048 |
| 432 | Ga0207708_10013323 | 3300026075 | Bacteria | 6142 |
| 433 | Ga0207702_10000198 | 3300026078 | Bacteria | 71277 |
| 434 | Ga0207702_10081852 | 3300026078 | Plasmid | 2805 |
| 435 | Ga0207702_10309581 | 3300026078 | Bacteria | 1501 |
| 436 | Ga0207641_10000417 | 3300026088 | Bacteria | 49719 |
| 437 | Ga0207641_10265887 | 3300026088 | Unclassified | 1607 |
| 438 | Ga0207648_10000483 | 3300026089 | Bacteria | 44295 |
| 439 | Ga0207676_10000372 | 3300026095 | Bacteria | 38295 |
| 440 | Ga0207676_10001984 | 3300026095 | Bacteria | 14895 |
| 441 | Ga0207674_10003549 | 3300026116 | Bacteria | 19037 |
| 442 | Ga0207674_10142672 | 3300026116 | Bacteria | 2354 |
| 443 | Ga0207675_100007915 | 3300026118 | Bacteria | 10019 |
| 444 | Ga0207675_100020311 | 3300026118 | Bacteria | 6193 |
| 445 | Ga0207675_100057413 | 3300026118 | Bacteria | 3632 |
| 446 | Ga0207683_10000141 | 3300026121 | Bacteria | 59587 |
| 447 | Ga0207683_10000908 | 3300026121 | Bacteria | 27236 |
| 448 | Ga0209984_1002913 | 3300027424 | Bacteria | 1936 |
| 449 | Ga0210002_1001176 | 3300027617 | Bacteria | 3647 |
| 450 | Ga0209971_1005351 | 3300027682 | Bacteria | 3052 |
| 451 | Ga0209966_1001487 | 3300027695 | Bacteria | 4072 |
| 452 | Ga0209998_10000232 | 3300027717 | Bacteria | 18781 |
| 453 | Ga0209998_10001040 | 3300027717 | Bacteria | 6971 |
| 454 | Ga0209974_10005229 | 3300027876 | Bacteria | 4580 |
| 455 | Ga0207428_10000058 | 3300027907 | Bacteria | 158579 |
| 456 | Ga0207428_10001115 | 3300027907 | Bacteria | 29201 |
| 457 | Ga0207428_10002874 | 3300027907 | Bacteria | 17069 |
| 458 | Ga0207428_10008433 | 3300027907 | Bacteria | 9303 |
| 459 | Ga0268266_10002234 | 3300028379 | Bacteria | 21139 |
| 460 | Ga0268265_10013047 | 3300028380 | Bacteria | 5642 |
| 461 | Ga0268264_10000412 | 3300028381 | Bacteria | 60566 |
| 462 | Ga0265337_1006179 | 3300028556 | Bacteria | 4654 |
| 463 | Ga0265334_10050600 | 3300028573 | Bacteria | 1595 |
| 464 | Ga0265338_10041790 | 3300028800 | Bacteria | 4282 |
| 465 | Ga0265330_10011472 | 3300031235 | Bacteria | 4155 |
| 466 | Ga0265330_10024284 | 3300031235 | Bacteria | 2749 |
| 467 | Ga0265325_10000036 | 3300031241 | Bacteria | 96858 |
| 468 | Ga0265325_10007651 | 3300031241 | Bacteria | 6456 |
| 469 | Ga0265325_10059108 | 3300031241 | Bacteria | 1950 |
| 470 | Ga0265340_10022764 | 3300031247 | Bacteria | 3200 |
| 471 | Ga0265339_10014749 | 3300031249 | Bacteria | 4703 |
| 472 | Ga0265316_10034358 | 3300031344 | Bacteria | 4120 |
| 473 | Ga0265313_10001570 | 3300031595 | Bacteria | 21191 |
| 474 | Ga0265313_10019218 | 3300031595 | Bacteria | 3811 |
| 475 | Ga0265313_10103866 | 3300031595 | Bacteria | 1258 |
| 476 | Ga0265314_10006219 | 3300031711 | Bacteria | 10601 |
| 477 | Ga0265314_10007314 | 3300031711 | Bacteria | 9589 |
| 478 | Ga0307416_100080536 | 3300032002 | Bacteria | 2749 |
| 479 | Ga0373948_0003112 | 3300034817 | Bacteria | 2521 |
| 480 | Ga0373958_0000560 | 3300034819 | Bacteria | 4630 |
| 481 | Ga0373958_0005433 | 3300034819 | Bacteria | 1937 |
| 482 | Ga0373959_0001450 | 3300034820 | Bacteria | 3791 |
| 483 | Ga0373938_0000036 | 3300034957 | Bacteria | 17529 |
| 484 | Ga0373938_0015276 | 3300034957 | Unclassified | 1485 |
| 485 | Ga0373926_0033495 | 3300035083 | Bacteria | 1816 |
| 486 | Ga0373926_0062752 | 3300035083 | Unclassified | 1357 |
| 487 | Ga0373928_0000812 | 3300035084 | Bacteria | 6085 |
| 488 | Ga0373929_0002736 | 3300035085 | Bacteria | 3219 |
| 489 | Ga0373929_0017848 | 3300035085 | Unclassified | 1405 |
| 490 | Ga0373934_0004844 | 3300035086 | Bacteria | 4983 |
| 491 | Ga0373934_0109403 | 3300035086 | Bacteria | 1120 |
| 492 | Ga0373940_0000390 | 3300035088 | Bacteria | 6650 |
| 493 | Ga0373944_0006514 | 3300035089 | Bacteria | 3101 |
| 494 | Ga0373944_0011632 | 3300035089 | Bacteria | 2414 |
| 495 | Ga0373949_0001580 | 3300035090 | Bacteria | 6417 |
| 496 | Ga0373949_0003013 | 3300035090 | Bacteria | 4136 |
| 497 | Ga0373951_0000312 | 3300035091 | Bacteria | 15385 |
| 498 | Ga0373952_0000533 | 3300035092 | Bacteria | 6675 |
| 499 | Ga0373923_0000978 | 3300035111 | Bacteria | 7693 |
| 500 | Ga0373923_0007388 | 3300035111 | Bacteria | 3860 |
| 501 | Ga0373932_0001347 | 3300035112 | Bacteria | 6875 |
| 502 | Ga0373932_0002893 | 3300035112 | Bacteria | 4238 |
| 503 | Ga0373932_0018502 | 3300035112 | Unclassified | 1802 |
| 504 | Ga0373932_0044240 | 3300035112 | Bacteria | 1298 |
| 505 | Ga0373936_0002402 | 3300035113 | Bacteria | 7011 |
| 506 | Ga0373936_0006435 | 3300035113 | Bacteria | 4429 |
| 507 | Ga0373939_0000502 | 3300035114 | Bacteria | 9837 |
| 508 | Ga0373939_0004753 | 3300035114 | Unclassified | 3221 |
| 509 | Ga0373941_0000268 | 3300035115 | Bacteria | 10009 |
| 510 | Ga0373941_0003730 | 3300035115 | Bacteria | 3472 |
| 511 | Ga0373941_0018992 | 3300035115 | Bacteria | 1906 |
| 512 | Ga0373945_0011045 | 3300035116 | Bacteria | 2980 |
| 513 | Ga0373945_0012738 | 3300035116 | Bacteria | 2797 |
| 514 | Ga0373954_0006112 | 3300035118 | Bacteria | 5243 |
| 515 | Ga0373954_0007494 | 3300035118 | Bacteria | 4775 |
| 516 | Ga0373954_0008449 | 3300035118 | Bacteria | 4518 |
| 517 | Ga0373954_0022950 | 3300035118 | Bacteria | 2834 |
| 518 | Ga0373956_0019685 | 3300035119 | Bacteria | 2865 |
| 519 | Ga0373956_0020444 | 3300035119 | Bacteria | 2817 |
| 520 | Ga0373957_0001478 | 3300035120 | Bacteria | 6365 |
| 521 | Ga0373957_0001491 | 3300035120 | Bacteria | 6345 |
| 522 | Ga0373957_0006863 | 3300035120 | Bacteria | 3611 |
| 523 | Ga0373957_0059420 | 3300035120 | Bacteria | 1479 |
| 524 | Ga0373943_0003974 | 3300035170 | Bacteria | 6730 |
| 525 | Ga0373943_0005161 | 3300035170 | Bacteria | 5880 |
| 526 | Ga0373943_0044179 | 3300035170 | Bacteria | 2168 |
| 527 | Ga0373943_0106307 | 3300035170 | Bacteria | 1474 |
| 528 | Ga0373946_0003537 | 3300035171 | Bacteria | 5545 |
| 529 | Ga0373946_0007697 | 3300035171 | Bacteria | 3947 |
| 530 | Ga0373946_0025273 | 3300035171 | Bacteria | 2335 |
| 531 | Ga0373946_0036872 | 3300035171 | Bacteria | 1985 |
| 532 | Ga0373955_0001092 | 3300035172 | Bacteria | 11522 |
| 533 | Ga0373955_0001995 | 3300035172 | Bacteria | 8810 |
| 534 | Ga0373955_0002098 | 3300035172 | Bacteria | 8610 |
| 535 | Ga0373955_0013592 | 3300035172 | Bacteria | 3940 |
| 536 | Ga0373955_0033141 | 3300035172 | Bacteria | 2718 |
| 537 | Ga0373955_0148604 | 3300035172 | Bacteria | 1378 |
| 538 | Ga0373942_0000260 | 3300035207 | Bacteria | 14087 |
| 539 | Ga0373942_0026250 | 3300035207 | Unclassified | 1507 |
| 540 | Ga0373961_0000492 | 3300035241 | Bacteria | 15342 |
| 541 | Ga0373962_0000091 | 3300035242 | Bacteria | 19653 |
| 542 | Ga0373962_0005292 | 3300035242 | Unclassified | 3122 |
| 543 | Ga0373924_0010530 | 3300035410 | Bacteria | 3414 |
| 544 | Ga0373924_0018520 | 3300035410 | Bacteria | 2684 |
| 545 | Ga0373924_0061891 | 3300035410 | Bacteria | 1567 |
| 546 | Ga0373931_0000131 | 3300035691 | Bacteria | 34406 |
| 547 | Ga0373931_0007255 | 3300035691 | Bacteria | 5216 |
| 548 | Ga0373935_0000377 | 3300035692 | Bacteria | 22883 |
| 549 | Ga0373935_0014579 | 3300035692 | Bacteria | 4743 |
| 550 | Ga0373927_0018997 | 3300035695 | Bacteria | 4509 |
| 551 | Ga0373927_0021440 | 3300035695 | Bacteria | 4234 |
| 552 | Ga0373927_0031784 | 3300035695 | Bacteria | 3439 |
| 553 | Ga0373927_0040483 | 3300035695 | Bacteria | 3022 |
| 554 | Ga0373933_0001665 | 3300035724 | Bacteria | 12922 |
| 555 | Ga0373933_0002410 | 3300035724 | Bacteria | 10543 |
| 556 | Ga0373933_0007167 | 3300035724 | Bacteria | 6075 |
| 557 | Ga0373933_0032143 | 3300035724 | Bacteria | 3049 |
| 558 | Ga0373947_0004674 | 3300035725 | Bacteria | 8026 |
| 559 | Ga0373947_0009750 | 3300035725 | Bacteria | 5511 |
| 560 | Ga0373947_0013218 | 3300035725 | Plasmid | 4731 |
| 561 | Ga0373947_0179780 | 3300035725 | Bacteria | 1377 |
| 562 | Ga0373937_0001849 | 3300036401 | Bacteria | 17776 |
| 563 | Ga0373937_0003289 | 3300036401 | Bacteria | 13564 |
| 564 | Ga0373937_0005585 | 3300036401 | Bacteria | 10787 |
| 565 | Ga0373937_0007611 | 3300036401 | Bacteria | 9382 |
| 566 | Ga0373937_0011521 | 3300036401 | Bacteria | 7761 |
| 567 | Ga0373937_0014729 | 3300036401 | Bacteria | 6903 |
| 568 | Ga0373937_0073183 | 3300036401 | Bacteria | 3161 |
| 569 | Ga0373925_0000075 | 3300037068 | Bacteria | 105395 |
| 570 | Ga0373925_0001381 | 3300037068 | Bacteria | 21133 |
| 571 | Ga0373925_0006934 | 3300037068 | Bacteria | 8288 |
| 572 | Ga0373925_0068052 | 3300037068 | Bacteria | 2686 |
| 573 | Ga0395900_0021219 | 3300037418 | Bacteria | 6641 |
| 574 | Ga0395900_0111939 | 3300037418 | Bacteria | 2803 |
| 575 | Ga0395898_0028469 | 3300037466 | Bacteria | 5597 |
| 576 | Ga0395898_0074389 | 3300037466 | Bacteria | 3281 |
| 577 | Ga0436364_0429623 | 3300037853 | Bacteria | 2037 |
| 578 | Ga0395901_0042693 | 3300038443 | Bacteria | 4702 |
| 579 | Ga0242420_007157 | 3300038996 | Bacteria | 1784 |
| 580 | Ga0436361_0670413 | 3300039447 | Bacteria | 8708 |
| 581 | Ga0451577_0096577 | 3300042876 | Bacteria | 2638 |
| 582 | Ga0466966_0235473 | 3300044684 | Bacteria | 1104 |
| 583 | Ga0466961_0044652 | 3300044693 | Bacteria | 2836 |
| 584 | Ga0466963_0021946 | 3300044694 | Bacteria | 4036 |
| 585 | Ga0466963_0097864 | 3300044694 | Bacteria | 2005 |
| 586 | Ga0466963_0348571 | 3300044694 | Bacteria | 1043 |
| 587 | Ga0466959_0093858 | 3300045049 | Bacteria | 2153 |
| 588 | Ga0451576_0370562 | 3300045051 | Bacteria | 1500 |
| 589 | Ga0466967_0005150 | 3300045976 | Bacteria | 8993 |
| 590 | Ga0495592_0000060 | 3300046454 | Bacteria | 100113 |
| 591 | Ga0495592_0001425 | 3300046454 | Bacteria | 16601 |
| 592 | Ga0495592_0009799 | 3300046454 | Bacteria | 7210 |
| 593 | Ga0495592_0013763 | 3300046454 | Bacteria | 6151 |
| 594 | Ga0495592_0150509 | 3300046454 | Bacteria | 1610 |
| 595 | Ga0495603_0011449 | 3300046455 | Bacteria | 5369 |
| 596 | Ga0495603_0014137 | 3300046455 | Bacteria | 4829 |
| 597 | Ga0495603_0031146 | 3300046455 | Bacteria | 3211 |
| 598 | Ga0495629_0001317 | 3300046459 | Bacteria | 19520 |
| 599 | Ga0495629_0008135 | 3300046459 | Bacteria | 7717 |
| 600 | Ga0495629_0045196 | 3300046459 | Bacteria | 3090 |
| 601 | Ga0495629_0149354 | 3300046459 | Bacteria | 1624 |
| 602 | Ga0495641_0016070 | 3300046461 | Bacteria | 3957 |
| 603 | Ga0495641_0045562 | 3300046461 | Bacteria | 2019 |
| 604 | Ga0495651_0000181 | 3300046462 | Bacteria | 46803 |
| 605 | Ga0495651_0001028 | 3300046462 | Bacteria | 21603 |
| 606 | Ga0495651_0015441 | 3300046462 | Bacteria | 5907 |
| 607 | Ga0495651_0034700 | 3300046462 | Bacteria | 3932 |
| 608 | Ga0495653_0000740 | 3300046463 | Bacteria | 24927 |
| 609 | Ga0495653_0006880 | 3300046463 | Bacteria | 9345 |
| 610 | Ga0495653_0054077 | 3300046463 | Unclassified | 3069 |
| 611 | Ga0495653_0080174 | 3300046463 | Bacteria | 2416 |
| 612 | Ga0495580_0019190 | 3300046472 | Bacteria | 5081 |
| 613 | Ga0495580_0190472 | 3300046472 | Bacteria | 1414 |
| 614 | Ga0495582_0017639 | 3300046473 | Bacteria | 3905 |
| 615 | Ga0495582_0095894 | 3300046473 | Bacteria | 1657 |
| 616 | Ga0495582_0181874 | 3300046473 | Bacteria | 1198 |
| 617 | Ga0495639_0109009 | 3300046475 | Bacteria | 1312 |
| 618 | Ga0495662_0001139 | 3300046476 | Bacteria | 13118 |
| 619 | Ga0495662_0010017 | 3300046476 | Bacteria | 4651 |
| 620 | Ga0495662_0054291 | 3300046476 | Bacteria | 1935 |
| 621 | Ga0495664_0000003 | 3300046477 | Bacteria | 551602 |
| 622 | Ga0495664_0018434 | 3300046477 | Bacteria | 3999 |
| 623 | Ga0495664_0073130 | 3300046477 | Bacteria | 2049 |
| 624 | Ga0495664_0110244 | 3300046477 | Bacteria | 1661 |
| 625 | Ga0495584_0034777 | 3300046491 | Bacteria | 2547 |
| 626 | Ga0495585_0002983 | 3300046492 | Bacteria | 11691 |
| 627 | Ga0495594_0012852 | 3300046499 | Plasmid | 4366 |
| 628 | Ga0495594_0019492 | 3300046499 | Bacteria | 3604 |
| 629 | Ga0495607_0043814 | 3300046501 | Bacteria | 2643 |
| 630 | Ga0495608_0000011 | 3300046511 | Bacteria | 248514 |
| 631 | Ga0495608_0014132 | 3300046511 | Bacteria | 5538 |
| 632 | Ga0495608_0020336 | 3300046511 | Bacteria | 4562 |
| 633 | Ga0495618_0000044 | 3300046514 | Bacteria | 95526 |
| 634 | Ga0495618_0007217 | 3300046514 | Bacteria | 6729 |
| 635 | Ga0495628_0000001 | 3300046516 | Bacteria | 917742 |
| 636 | Ga0495628_0022511 | 3300046516 | Bacteria | 5177 |
| 637 | Ga0495628_0032380 | 3300046516 | Bacteria | 4220 |
| 638 | Ga0495630_0002317 | 3300046517 | Bacteria | 13234 |
| 639 | Ga0495630_0021258 | 3300046517 | Bacteria | 4791 |
| 640 | Ga0495630_0155716 | 3300046517 | Bacteria | 1739 |
| 641 | Ga0495663_0009174 | 3300046525 | Bacteria | 2743 |
| 642 | Ga0495666_0004239 | 3300046526 | Bacteria | 7232 |
| 643 | Ga0495642_0134687 | 3300046528 | Bacteria | 1065 |
| 644 | Ga0495652_0000002 | 3300046529 | Bacteria | 946606 |
| 645 | Ga0495652_0006243 | 3300046529 | Bacteria | 11114 |
| 646 | Ga0495652_0011130 | 3300046529 | Bacteria | 8150 |
| 647 | Ga0495652_0124986 | 3300046529 | Bacteria | 2045 |
| 648 | Ga0495665_0010657 | 3300046531 | Bacteria | 4978 |
| 649 | Ga0495640_0000002 | 3300046533 | Bacteria | 646434 |
| 650 | Ga0495640_0020787 | 3300046533 | Bacteria | 4824 |
| 651 | Ga0495586_0017488 | 3300046535 | Bacteria | 3811 |
| 652 | Ga0495586_0034792 | 3300046535 | Bacteria | 2706 |
| 653 | Ga0495587_0000001 | 3300046536 | Bacteria | 724132 |
| 654 | Ga0495587_0002763 | 3300046536 | Bacteria | 11717 |
| 655 | Ga0495587_0024297 | 3300046536 | Bacteria | 3716 |
| 656 | Ga0495587_0052312 | 3300046536 | Bacteria | 2410 |
| 657 | Ga0495587_0087367 | 3300046536 | Bacteria | 1804 |
| 658 | Ga0495609_0097524 | 3300046538 | Bacteria | 1275 |
| 659 | Ga0495645_0000002 | 3300046543 | Bacteria | 651644 |
| 660 | Ga0495645_0008509 | 3300046543 | Bacteria | 7166 |
| 661 | Ga0495645_0021269 | 3300046543 | Bacteria | 4688 |
| 662 | Ga0495622_0057450 | 3300046557 | Bacteria | 1803 |
| 663 | Ga0495633_0004123 | 3300046558 | Bacteria | 9362 |
| 664 | Ga0495667_0000039 | 3300046559 | Bacteria | 131308 |
| 665 | Ga0495667_0008435 | 3300046559 | Bacteria | 6995 |
| 666 | Ga0495667_0012303 | 3300046559 | Bacteria | 5800 |
| 667 | Ga0495667_0032436 | 3300046559 | Bacteria | 3501 |
| 668 | Ga0495656_0008098 | 3300046615 | Bacteria | 3741 |
| 669 | Ga0495634_0000010 | 3300046642 | Bacteria | 143792 |
| 670 | Ga0495634_0261133 | 3300046642 | Unclassified | 1056 |
| 671 | Ga0495611_0024831 | 3300046648 | Bacteria | 2608 |
| 672 | Ga0495611_0127150 | 3300046648 | Bacteria | 1189 |
| 673 | Ga0495635_0000001 | 3300046663 | Bacteria | 704901 |
| 674 | Ga0495635_0007978 | 3300046663 | Bacteria | 7401 |
| 675 | Ga0495635_0030375 | 3300046663 | Bacteria | 3755 |
| 676 | Ga0495635_0047505 | 3300046663 | Bacteria | 2960 |
| 677 | Ga0495635_0060232 | 3300046663 | Bacteria | 2609 |
| 678 | Ga0495635_0245434 | 3300046663 | Unclassified | 1208 |
| 679 | Ga0495659_0002157 | 3300046664 | Bacteria | 6410 |
| 680 | Ga0495588_0001979 | 3300046674 | Bacteria | 8763 |
| 681 | Ga0495657_0000042 | 3300046675 | Bacteria | 114669 |
| 682 | Ga0495657_0008832 | 3300046675 | Bacteria | 7673 |
| 683 | Ga0495657_0039023 | 3300046675 | Bacteria | 3265 |
| 684 | Ga0495599_0000013 | 3300046678 | Bacteria | 179828 |
| 685 | Ga0495599_0003683 | 3300046678 | Bacteria | 8982 |
| 686 | Ga0495599_0034547 | 3300046678 | Bacteria | 3176 |
| 687 | Ga0495599_0103341 | 3300046678 | Bacteria | 1775 |
| 688 | Ga0495623_0000050 | 3300046679 | Bacteria | 72959 |
| 689 | Ga0495623_0000554 | 3300046679 | Bacteria | 24925 |
| 690 | Ga0495623_0013487 | 3300046679 | Bacteria | 5299 |
| 691 | Ga0495646_0000009 | 3300046680 | Bacteria | 200698 |
| 692 | Ga0495646_0001248 | 3300046680 | Bacteria | 14920 |
| 693 | Ga0495646_0114340 | 3300046680 | Bacteria | 1533 |
| 694 | Ga0495647_0005005 | 3300046681 | Plasmid | 4339 |
| 695 | Ga0495647_0012267 | 3300046681 | Bacteria | 2948 |
| 696 | Ga0495658_0009945 | 3300046683 | Plasmid | 4745 |
| 697 | Ga0495658_0026882 | 3300046683 | Bacteria | 3089 |
| 698 | Ga0495658_0034922 | 3300046683 | Bacteria | 2762 |
| 699 | Ga0495658_0044686 | 3300046683 | Bacteria | 2483 |
| 700 | Ga0495613_0009440 | 3300046689 | Bacteria | 7236 |
| 701 | Ga0495613_0104514 | 3300046689 | Bacteria | 2044 |
| 702 | Ga0495613_0176622 | 3300046689 | Bacteria | 1513 |
| 703 | Ga0495624_0037597 | 3300046690 | Bacteria | 3112 |
| 704 | Ga0495670_0005312 | 3300046691 | Bacteria | 6339 |
| 705 | Ga0495600_0000209 | 3300046809 | Bacteria | 33688 |
| 706 | Ga0495600_0000989 | 3300046809 | Bacteria | 15327 |
| 707 | Ga0495581_0046167 | 3300047315 | Bacteria | 2516 |
| 708 | Ga0495581_0148665 | 3300047315 | Bacteria | 1368 |
| 709 | Ga0495604_0000069 | 3300047317 | Bacteria | 89935 |
| 710 | Ga0495604_0002886 | 3300047317 | Bacteria | 13771 |
| 711 | Ga0495604_0007911 | 3300047317 | Bacteria | 8420 |
| 712 | Ga0495604_0010413 | 3300047317 | Bacteria | 7366 |
| 713 | Ga0495674_0000002 | 3300047319 | Bacteria | 642785 |
| 714 | Ga0495674_0160145 | 3300047319 | Unclassified | 1883 |
| 715 | Ga0495676_0181764 | 3300047321 | Bacteria | 1473 |
| 716 | Ga0495680_0000328 | 3300047322 | Bacteria | 53287 |
| 717 | Ga0495680_0001832 | 3300047322 | Bacteria | 22412 |
| 718 | Ga0495680_0012338 | 3300047322 | Bacteria | 7524 |
| 719 | Ga0495680_0012693 | 3300047322 | Bacteria | 7397 |
| 720 | Ga0495675_0000245 | 3300047444 | Bacteria | 39142 |
| 721 | Ga0495675_0000625 | 3300047444 | Bacteria | 22516 |
| 722 | Ga0495675_0010798 | 3300047444 | Bacteria | 5723 |
| 723 | Ga0495684_0000016 | 3300047471 | Bacteria | 169338 |
| 724 | Ga0495684_0000517 | 3300047471 | Bacteria | 31334 |
| 725 | Ga0495684_0019009 | 3300047471 | Bacteria | 5290 |
| 726 | Ga0495593_0000555 | 3300047673 | Bacteria | 21201 |
| 727 | Ga0495593_0008554 | 3300047673 | Bacteria | 5951 |
| 728 | Ga0495593_0015415 | 3300047673 | Unclassified | 4328 |
| 729 | Ga0495602_0000024 | 3300048088 | Bacteria | 151162 |
| 730 | Ga0495602_0052529 | 3300048088 | Bacteria | 3619 |
| 731 | Ga0495614_0002673 | 3300048089 | Bacteria | 7926 |
| 732 | Ga0496100_0000183 | 3300048903 | Bacteria | 34629 |
| 733 | Ga0496100_0001822 | 3300048903 | Bacteria | 10654 |
| 734 | Ga0496100_0258012 | 3300048903 | Bacteria | 1292 |
| 735 | Ga0496101_0001253 | 3300048904 | Bacteria | 15192 |
| 736 | Ga0496101_0040079 | 3300048904 | Unclassified | 3335 |
| 737 | Ga0496101_0164103 | 3300048904 | Bacteria | 1705 |
| 738 | Ga0496101_0334210 | 3300048904 | Unclassified | 1189 |
| 739 | Ga0496101_0382203 | 3300048904 | Bacteria | 1108 |
| 740 | Ga0496102_0002101 | 3300048905 | Bacteria | 17126 |
| 741 | Ga0496102_0021368 | 3300048905 | Bacteria | 5724 |
| 742 | Ga0496102_0088318 | 3300048905 | Bacteria | 2865 |
| 743 | Ga0496102_0096806 | 3300048905 | Unclassified | 2736 |
| 744 | Ga0496102_0524865 | 3300048905 | Unclassified | 1106 |
| 745 | Ga0496103_0011705 | 3300048906 | Bacteria | 5203 |
| 746 | Ga0496103_0017302 | 3300048906 | Bacteria | 4314 |
| 747 | Ga0496103_0130887 | 3300048906 | Unclassified | 1602 |
| 748 | Ga0496103_0278367 | 3300048906 | Unclassified | 1076 |
| 749 | Ga0496104_0000055 | 3300048907 | Bacteria | 124267 |
| 750 | Ga0496104_0003403 | 3300048907 | Bacteria | 13734 |
| 751 | Ga0496104_0015277 | 3300048907 | Bacteria | 6952 |
| 752 | Ga0496104_0018261 | 3300048907 | Bacteria | 6398 |
| 753 | Ga0496104_0019231 | 3300048907 | Bacteria | 6244 |
| 754 | Ga0496104_0220516 | 3300048907 | Bacteria | 1809 |
| 755 | Ga0496104_0489944 | 3300048907 | Unclassified | 1140 |
| 756 | Ga0496105_0000918 | 3300048908 | Bacteria | 20094 |
| 757 | Ga0496105_0009881 | 3300048908 | Bacteria | 7482 |
| 758 | Ga0496105_0027876 | 3300048908 | Bacteria | 4618 |
| 759 | Ga0496105_0082136 | 3300048908 | Unclassified | 2661 |
| 760 | Ga0496105_0098212 | 3300048908 | Bacteria | 2418 |
| 761 | Ga0496105_0105948 | 3300048908 | Bacteria | 2321 |
| 762 | Ga0496105_0123171 | 3300048908 | Unclassified | 2137 |
| 763 | Ga0496105_0168598 | 3300048908 | Bacteria | 1795 |
| 764 | Ga0496106_0000317 | 3300048909 | Bacteria | 33879 |
| 765 | Ga0496106_0018123 | 3300048909 | Bacteria | 5206 |
| 766 | Ga0496106_0070350 | 3300048909 | Bacteria | 2672 |
| 767 | Ga0496106_0083591 | 3300048909 | Unclassified | 2455 |
| 768 | Ga0496106_0105027 | 3300048909 | Bacteria | 2194 |
| 769 | Ga0496107_0013389 | 3300048910 | Bacteria | 5731 |
| 770 | Ga0496107_0036332 | 3300048910 | Unclassified | 3533 |
| 771 | Ga0496107_0059899 | 3300048910 | Bacteria | 2755 |
| 772 | Ga0496108_0039369 | 3300048911 | Bacteria | 3940 |
| 773 | Ga0496108_0045630 | 3300048911 | Bacteria | 3660 |
| 774 | Ga0496108_0448220 | 3300048911 | Bacteria | 1127 |
| 775 | Ga0496108_0474916 | 3300048911 | Unclassified | 1092 |
| 776 | Ga0496109_0000812 | 3300048912 | Bacteria | 26052 |
| 777 | Ga0496109_0012200 | 3300048912 | Bacteria | 7413 |
| 778 | Ga0496109_0023439 | 3300048912 | Bacteria | 5480 |
| 779 | Ga0496109_0025460 | 3300048912 | Bacteria | 5273 |
| 780 | Ga0496109_0060469 | 3300048912 | Bacteria | 3462 |
| 781 | Ga0496109_0091515 | 3300048912 | Bacteria | 2813 |
| 782 | Ga0496109_0353745 | 3300048912 | Bacteria | 1387 |
| 783 | Ga0496109_0540583 | 3300048912 | Unclassified | 1099 |
| 784 | Ga0496110_0004023 | 3300048913 | Bacteria | 11334 |
| 785 | Ga0496110_0011433 | 3300048913 | Bacteria | 7265 |
| 786 | Ga0496110_0114645 | 3300048913 | Bacteria | 2425 |
| 787 | Ga0496110_0149856 | 3300048913 | Bacteria | 2112 |
| 788 | Ga0496110_0169558 | 3300048913 | Bacteria | 1980 |
| 789 | Ga0496110_0210917 | 3300048913 | Bacteria | 1766 |
| 790 | Ga0496110_0366230 | 3300048913 | Bacteria | 1313 |
| 791 | Ga0496111_0002977 | 3300048914 | Bacteria | 10382 |
| 792 | Ga0496111_0010259 | 3300048914 | Bacteria | 6277 |
| 793 | Ga0496111_0034534 | 3300048914 | Bacteria | 3611 |
| 794 | Ga0496111_0128046 | 3300048914 | Bacteria | 1878 |
| 795 | Ga0496111_0164330 | 3300048914 | Bacteria | 1648 |
| 796 | Ga0496111_0271515 | 3300048914 | Bacteria | 1258 |
| 797 | Ga0496112_0002948 | 3300048915 | Bacteria | 13879 |
| 798 | Ga0496112_0085171 | 3300048915 | Unclassified | 3127 |
| 799 | Ga0496112_0189571 | 3300048915 | Bacteria | 2018 |
| 800 | Ga0496112_0448991 | 3300048915 | Bacteria | 1227 |
| 801 | Ga0496112_0449956 | 3300048915 | Bacteria | 1226 |
| 802 | Ga0496112_0527334 | 3300048915 | Unclassified | 1115 |
| 803 | Ga0496113_0008320 | 3300048916 | Bacteria | 6752 |
| 804 | Ga0496113_0017093 | 3300048916 | Bacteria | 5028 |
| 805 | Ga0496113_0039433 | 3300048916 | Bacteria | 3476 |
| 806 | Ga0496113_0127122 | 3300048916 | Bacteria | 1997 |
| 807 | Ga0496113_0146657 | 3300048916 | Bacteria | 1860 |
| 808 | Ga0496113_0176087 | 3300048916 | Bacteria | 1695 |
| 809 | Ga0496114_0000430 | 3300048917 | Bacteria | 30988 |
| 810 | Ga0496114_0017159 | 3300048917 | Bacteria | 5838 |
| 811 | Ga0496114_0286747 | 3300048917 | Bacteria | 1452 |
| 812 | Ga0496115_0008581 | 3300048918 | Bacteria | 7564 |
| 813 | Ga0496115_0014487 | 3300048918 | Bacteria | 5970 |
| 814 | Ga0496115_0016124 | 3300048918 | Bacteria | 5683 |
| 815 | Ga0496115_0028379 | 3300048918 | Bacteria | 4386 |
| 816 | Ga0496115_0061613 | 3300048918 | Plasmid | 3024 |
| 817 | Ga0496115_0208973 | 3300048918 | Bacteria | 1612 |
| 818 | Ga0496115_0248324 | 3300048918 | Unclassified | 1465 |
| 819 | Ga0501034_0116753 | 3300049571 | Bacteria | 2657 |
| 820 | Ga0501034_0491120 | 3300049571 | Bacteria | 1142 |
| 821 | Ga0501036_0383857 | 3300049572 | Bacteria | 1172 |
| 822 | Ga0501038_0068280 | 3300049574 | Bacteria | 3022 |
| 823 | Ga0501041_0022050 | 3300049577 | Bacteria | 3813 |
| 824 | Ga0501041_0118359 | 3300049577 | Bacteria | 1645 |
| 825 | Ga0501042_0108724 | 3300049578 | Bacteria | 1996 |
| 826 | Ga0501042_0226953 | 3300049578 | Bacteria | 1347 |
| 827 | Ga0501048_0117761 | 3300049582 | Bacteria | 1876 |
| 828 | Ga0501067_0015744 | 3300049583 | Bacteria | 4184 |
| 829 | Ga0501068_0339936 | 3300049584 | Bacteria | 964 |
| 830 | Ga0501069_0020274 | 3300049585 | Bacteria | 3601 |
| 831 | Ga0501071_0021167 | 3300049587 | Bacteria | 4529 |
| 832 | Ga0501071_0138285 | 3300049587 | Bacteria | 1813 |
| 833 | Ga0501072_0057934 | 3300049588 | Bacteria | 3054 |
| 834 | Ga0501074_0170065 | 3300049590 | Bacteria | 1556 |
| 835 | Ga0501076_0068865 | 3300049592 | Unclassified | 2827 |
| 836 | Ga0501077_0010511 | 3300049593 | Bacteria | 5762 |
| 837 | Ga0501077_0108335 | 3300049593 | Bacteria | 1760 |
| 838 | Ga0501079_0042947 | 3300049741 | Bacteria | 3490 |
| 839 | Ga0501079_0206065 | 3300049741 | Bacteria | 1536 |
| 840 | Ga0501080_0373660 | 3300049742 | Bacteria | 1285 |
| 841 | Ga0501081_0034379 | 3300049743 | Bacteria | 3449 |
| 842 | Ga0501081_0199923 | 3300049743 | Bacteria | 1449 |
| 843 | Ga0501035_0174953 | 3300049822 | Bacteria | 1852 |
| 844 | Ga0501044_0198495 | 3300049823 | Bacteria | 1965 |
| 845 | nmdc:mga00v17_67260_c1 | 3300050491 | Bacteria | 2213 |
| 846 | nmdc:mga06z11_165224_c1 | 3300050494 | Bacteria | 1267 |
| 847 | nmdc:mga05p37_13845_c1 | 3300050507 | Bacteria | 9664 |
| 848 | nmdc:mga05p37_240876_c1 | 3300050507 | Bacteria | 2175 |
| 849 | nmdc:mga05p37_364276_c1 | 3300050507 | Bacteria | 1698 |
| 850 | nmdc:mga05p37_675_c1 | 3300050507 | Bacteria | 37726 |
| 851 | nmdc:mga05p37_76_c1 | 3300050507 | Bacteria | 86726 |
| 852 | nmdc:mga09592_19945_c1 | 3300050508 | Bacteria | 5507 |
| 853 | nmdc:mga09592_31289_c1 | 3300050508 | Bacteria | 4434 |
| 854 | nmdc:mga0qj67_18840_c1 | 3300050509 | Bacteria | 5265 |
| 855 | nmdc:mga0qj67_229_c1 | 3300050509 | Bacteria | 38215 |
| 856 | nmdc:mga06r32_1246_c1 | 3300050510 | Bacteria | 22889 |
| 857 | nmdc:mga06r32_134_c1 | 3300050510 | Bacteria | 54737 |
| 858 | nmdc:mga08y16_1152_c1 | 3300050511 | Bacteria | 26044 |
| 859 | nmdc:mga08y16_34053_c1 | 3300050511 | Bacteria | 5351 |
| 860 | nmdc:mga08y16_4279_c1 | 3300050511 | Bacteria | 14901 |
| 861 | nmdc:mga0n895_24756_c1 | 3300050512 | Bacteria | 5661 |
| 862 | nmdc:mga0n895_511603_c1 | 3300050512 | Bacteria | 1209 |
| 863 | nmdc:mga0n895_73_c1 | 3300050512 | Bacteria | 57709 |
| 864 | nmdc:mga0n895_96637_c1 | 3300050512 | Bacteria | 2959 |
| 865 | nmdc:mga0rr50_222899_c1 | 3300050513 | Unclassified | 1558 |
| 866 | nmdc:mga0rr50_3303_c1 | 3300050513 | Bacteria | 9259 |
| 867 | nmdc:mga0rr50_84908_c1 | 3300050513 | Bacteria | 2452 |
| 868 | nmdc:mga0rr50_98079_c1 | 3300050513 | Bacteria | 2296 |
| 869 | nmdc:mga08x19_134671_c1 | 3300050514 | Bacteria | 1665 |
| 870 | nmdc:mga0a205_4115_c1 | 3300050515 | Bacteria | 13018 |
| 871 | nmdc:mga0a205_59_c1 | 3300050515 | Bacteria | 60447 |
| 872 | Ga0495601_0000001 | 3300053077 | Bacteria | 549454 |
| 873 | Ga0495601_0000357 | 3300053077 | Bacteria | 23996 |
| 874 | Ga0495601_0000555 | 3300053077 | Bacteria | 19790 |
| 875 | Ga0495601_0002958 | 3300053077 | Bacteria | 9661 |
| 876 | Ga0495601_0004584 | 3300053077 | Bacteria | 7993 |
| 877 | Ga0495601_0006469 | 3300053077 | Bacteria | 6852 |
| 878 | Ga0495601_0027022 | 3300053077 | Bacteria | 3546 |
| 879 | Ga0495612_0000017 | 3300053078 | Bacteria | 152112 |
| 880 | Ga0495612_0000539 | 3300053078 | Bacteria | 15250 |
| 881 | Ga0495612_0008398 | 3300053078 | Bacteria | 4188 |
| 882 | Ga0495612_0009333 | 3300053078 | Bacteria | 3981 |
| 883 | Ga0495595_0000010 | 3300053084 | Bacteria | 178819 |
| 884 | Ga0495595_0000939 | 3300053084 | Bacteria | 11212 |
| 885 | Ga0495595_0001313 | 3300053084 | Bacteria | 9655 |
| 886 | Ga0495595_0002410 | 3300053084 | Bacteria | 7299 |
| 887 | Ga0495595_0005308 | 3300053084 | Bacteria | 5212 |
| 888 | Ga0495595_0020334 | 3300053084 | Bacteria | 2889 |
| 889 | Ga0495595_0176394 | 3300053084 | Bacteria | 1059 |
| 890 | Ga0495619_0000004 | 3300053085 | Bacteria | 500068 |
| 891 | Ga0495619_0000085 | 3300053085 | Bacteria | 70073 |
| 892 | Ga0495619_0000380 | 3300053085 | Bacteria | 30640 |
| 893 | Ga0495619_0000636 | 3300053085 | Bacteria | 23148 |
| 894 | Ga0495619_0002427 | 3300053085 | Bacteria | 12237 |
| 895 | Ga0495619_0008402 | 3300053085 | Bacteria | 6529 |
| 896 | Ga0495619_0025705 | 3300053085 | Bacteria | 3783 |
| 897 | Ga0495619_0075100 | 3300053085 | Bacteria | 2268 |
| 898 | Ga0501084_0015606 | 3300054114 | Bacteria | 6300 |
| 899 | Ga0501084_0020609 | 3300054114 | Bacteria | 5498 |
| 900 | Ga0501084_0281571 | 3300054114 | Bacteria | 1404 |
| 901 | Ga0501082_0073106 | 3300060353 | Bacteria | 2953 |
| 902 | Ga0501082_0097469 | 3300060353 | Bacteria | 2542 |
| 903 | Ga0501082_0431542 | 3300060353 | Bacteria | 1151 |
| 904 | Ga0530510_0054647 | 3300061734 | Bacteria | 2886 |
| 905 | Ga0373938_0000189 | |||
| 906 | 2214736890 | |||
| 907 | ARcpr5oldR_c000047 | |||
| 908 | ARSoilYngRDRAFT_c00157 | |||
| 909 | ARcpr5yngRDRAFT_c000017 | |||
| 910 | ARSoilOldRDRAFT_c000006 | |||
| 911 | ARCol0oldRDRAFT_c00392 | |||
| 912 | ARCol0yngRDRAFT_1000043 | |||
| 913 | JGI24032J14994_100260 | |||
| 914 | JGI24741J21665_1002498 | |||
| 915 | JGI24746J21847_1000993 | |||
| 916 | JGI24747J21853_1003133 | |||
| 917 | JGI24737J22298_10001790 | |||
| 918 | JGI24737J22298_10002208 | |||
| 919 | JGI24750J21931_1000171 | |||
| 920 | JGI24745J21846_1000194 | |||
| 921 | JGI24748J21848_1000395 | |||
| 922 | JGI24738J21930_10000071 | |||
| 923 | JGI24744J21845_10001362 | |||
| 924 | JGI24033J26618_1000207 | |||
| 925 | JGI24034J26672_10001193 | |||
| 926 | JGI24742J22300_10000213 | |||
| 927 | JGI24751J29686_10003110 | |||
| 928 | JGI25405J52794_10005976 | |||
| 929 | Ga0065717_1002446 | |||
| 930 | Ga0065716_1001557 | |||
| 931 | Ga0065712_10000757 | |||
| 932 | Ga0065712_10001275 | |||
| 933 | Ga0065712_10004439 | |||
| 934 | Ga0065715_10005549 | |||
| 935 | Ga0065715_10089468 | |||
| 936 | Ga0065715_10096866 | |||
| 937 | Ga0070676_10000243 | |||
| 938 | Ga0070683_100011399 | |||
| 939 | Ga0070683_100053101 | |||
| 940 | Ga0070690_100036222 | |||
| 941 | Ga0070690_100239110 | |||
| 942 | Ga0070670_100017245 | |||
| 943 | Ga0070670_100029525 | |||
| 944 | Ga0070670_100045450 | |||
| 945 | Ga0070677_10000354 | |||
| 946 | Ga0068869_100000203 | |||
| 947 | Ga0070666_10019333 | |||
| 948 | Ga0070666_10022117 | |||
| 949 | Ga0070666_10057341 | |||
| 950 | Ga0070666_10079713 | |||
| 951 | Ga0070680_100002314 | |||
| 952 | Ga0070680_100046059 | |||
| 953 | Ga0070682_100000935 | |||
| 954 | Ga0070682_100034840 | |||
| 955 | Ga0068868_100002681 | |||
| 956 | Ga0070660_100002042 | |||
| 957 | Ga0070660_100017351 | |||
| 958 | Ga0070660_100161124 | |||
| 959 | Ga0070689_100004641 | |||
| 960 | Ga0070689_100007095 | |||
| 961 | Ga0070689_100033260 | |||
| 962 | Ga0070691_10000067 | |||
| 963 | Ga0070687_100000177 | |||
| 964 | Ga0070661_100001273 | |||
| 965 | Ga0070661_100049725 | |||
| 966 | Ga0070692_10000279 | |||
| 967 | Ga0070668_100001472 | |||
| 968 | Ga0070668_100014983 | |||
| 969 | Ga0070668_100397058 | |||
| 970 | Ga0070669_100001453 | |||
| 971 | Ga0070669_100026971 | |||
| 972 | Ga0070675_100009187 | |||
| 973 | Ga0070675_100130105 | |||
| 974 | Ga0070671_100001883 | |||
| 975 | Ga0070671_100358671 | |||
| 976 | Ga0070674_100000681 | |||
| 977 | Ga0070674_100208891 | |||
| 978 | Ga0070673_100000855 | |||
| 979 | Ga0070673_100020847 | |||
| 980 | Ga0070673_100063544 | |||
| 981 | Ga0070688_100003962 | |||
| 982 | Ga0070688_100007807 | |||
| 983 | Ga0070688_100067173 | |||
| 984 | Ga0070659_100000865 | |||
| 985 | Ga0070659_100024645 | |||
| 986 | Ga0070659_100090462 | |||
| 987 | Ga0070667_100002230 | |||
| 988 | Ga0070667_100064439 | |||
| 989 | Ga0070667_100113677 | |||
| 990 | Ga0070667_100304025 | |||
| 991 | Ga0070703_10001642 | |||
| 992 | Ga0070703_10028220 | |||
| 993 | Ga0070709_10000219 | |||
| 994 | Ga0070714_100309849 | |||
| 995 | Ga0070713_100000224 | |||
| 996 | Ga0070713_100315963 | |||
| 997 | Ga0070713_100418523 | |||
| 998 | Ga0070710_10000956 | |||
| 999 | Ga0070710_10024912 | |||
| 1000 | Ga0070710_10064585 | |||
| 1001 | Ga0070701_10005114 | |||
| 1002 | Ga0070701_10007452 | |||
| 1003 | Ga0070711_100046600 | |||
| 1004 | Ga0070711_100074337 | |||
| 1005 | Ga0070711_100093115 | |||
| 1006 | Ga0070711_100108359 | |||
| 1007 | Ga0070705_100005835 | |||
| 1008 | Ga0070700_100005851 | |||
| 1009 | Ga0070700_100187315 | |||
| 1010 | Ga0070694_100003826 | |||
| 1011 | Ga0070694_100006136 | |||
| 1012 | Ga0070708_100109315 | |||
| 1013 | Ga0070663_100006960 | |||
| 1014 | Ga0070663_100173142 | |||
| 1015 | Ga0070663_100365481 | |||
| 1016 | Ga0070678_100001091 | |||
| 1017 | Ga0070678_100005289 | |||
| 1018 | Ga0070678_100467563 | |||
| 1019 | Ga0070662_100002349 | |||
| 1020 | Ga0070662_100070604 | |||
| 1021 | Ga0070681_10024485 | |||
| 1022 | Ga0070681_10053992 | |||
| 1023 | Ga0070681_10143449 | |||
| 1024 | Ga0068867_100000679 | |||
| 1025 | Ga0070685_10004534 | |||
| 1026 | Ga0070685_10009881 | |||
| 1027 | Ga0070707_100398354 | |||
| 1028 | Ga0070698_100334228 | |||
| 1029 | Ga0070699_100042469 | |||
| 1030 | Ga0070679_100023517 | |||
| 1031 | Ga0070679_100072165 | |||
| 1032 | Ga0070679_100237237 | |||
| 1033 | Ga0070684_100009436 | |||
| 1034 | Ga0068853_100005760 | |||
| 1035 | Ga0068853_100066309 | |||
| 1036 | Ga0068853_100372742 | |||
| 1037 | Ga0070672_100006901 | |||
| 1038 | Ga0070672_100179904 | |||
| 1039 | Ga0070672_100369301 | |||
| 1040 | Ga0070686_100001302 | |||
| 1041 | Ga0070686_100007436 | |||
| 1042 | Ga0070686_100008195 | |||
| 1043 | Ga0070695_100002461 | |||
| 1044 | Ga0070695_100035427 | |||
| 1045 | Ga0070696_100001783 | |||
| 1046 | Ga0070696_100063265 | |||
| 1047 | Ga0070696_100207079 | |||
| 1048 | Ga0070693_100002420 | |||
| 1049 | Ga0070693_100020181 | |||
| 1050 | Ga0070693_100032492 | |||
| 1051 | Ga0070665_100007393 | |||
| 1052 | Ga0070665_100044933 | |||
| 1053 | Ga0070665_100270254 | |||
| 1054 | Ga0070665_100285507 | |||
| 1055 | Ga0070704_100004905 | |||
| 1056 | Ga0070704_100008656 | |||
| 1057 | Ga0070704_100300021 | |||
| 1058 | Ga0070704_100385894 | |||
| 1059 | Ga0068855_100010931 | |||
| 1060 | Ga0070664_100008419 | |||
| 1061 | Ga0070664_100080870 | |||
| 1062 | Ga0070664_100187041 | |||
| 1063 | Ga0068857_100000534 | |||
| 1064 | Ga0068857_100221056 | |||
| 1065 | Ga0068854_100007195 | |||
| 1066 | Ga0068856_100000272 | |||
| 1067 | Ga0068856_100395948 | |||
| 1068 | Ga0070702_100006314 | |||
| 1069 | Ga0068852_100003393 | |||
| 1070 | Ga0068859_100003965 | |||
| 1071 | Ga0068859_100041550 | |||
| 1072 | Ga0068859_100082748 | |||
| 1073 | Ga0068859_100232466 | |||
| 1074 | Ga0068864_100006326 | |||
| 1075 | Ga0068864_100009979 | |||
| 1076 | Ga0068864_100582154 | |||
| 1077 | Ga0068866_10000252 | |||
| 1078 | Ga0068866_10040918 | |||
| 1079 | Ga0068861_100001032 | |||
| 1080 | Ga0068861_100046020 | |||
| 1081 | Ga0068861_100213103 | |||
| 1082 | Ga0068870_10000092 | |||
| 1083 | Ga0068863_100017599 | |||
| 1084 | Ga0068863_100103188 | |||
| 1085 | Ga0068863_100260484 | |||
| 1086 | Ga0068863_100472007 | |||
| 1087 | Ga0068858_100003904 | |||
| 1088 | Ga0068858_100007004 | |||
| 1089 | Ga0068858_100060938 | |||
| 1090 | Ga0068858_100105241 | |||
| 1091 | Ga0068858_100107069 | |||
| 1092 | Ga0068860_100003148 | |||
| 1093 | Ga0068860_100062392 | |||
| 1094 | Ga0068860_100314652 | |||
| 1095 | Ga0068862_100019495 | |||
| 1096 | Ga0068862_100053228 | |||
| 1097 | Ga0081455_10000185 | |||
| 1098 | Ga0081455_10010009 | |||
| 1099 | Ga0081455_10048349 | |||
| 1100 | Ga0070717_10000285 | |||
| 1101 | Ga0070717_10201997 | |||
| 1102 | Ga0075365_10006667 | |||
| 1103 | Ga0075368_10053959 | |||
| 1104 | Ga0075432_10000240 | |||
| 1105 | Ga0070715_10007982 | |||
| 1106 | Ga0070715_10054620 | |||
| 1107 | Ga0070716_100004717 | |||
| 1108 | Ga0070716_100268151 | |||
| 1109 | Ga0070712_100034230 | |||
| 1110 | Ga0070712_100039928 | |||
| 1111 | Ga0075367_10123183 | |||
| 1112 | Ga0075427_10001422 | |||
| 1113 | Ga0097621_100003827 | |||
| 1114 | Ga0068871_100000215 | |||
| 1115 | Ga0068871_100001366 | |||
| 1116 | Ga0075428_100012848 | |||
| 1117 | Ga0075428_100037318 | |||
| 1118 | Ga0075428_100122112 | |||
| 1119 | Ga0075430_100000012 | |||
| 1120 | Ga0075431_100000602 | |||
| 1121 | Ga0075431_100030504 | |||
| 1122 | Ga0075433_10000338 | |||
| 1123 | Ga0075433_10175157 | |||
| 1124 | Ga0075434_100000373 | |||
| 1125 | Ga0075434_100000842 | |||
| 1126 | Ga0075434_100193239 | |||
| 1127 | Ga0075429_100007327 | |||
| 1128 | Ga0075429_100025962 | |||
| 1129 | Ga0068865_100000190 | |||
| 1130 | Ga0068865_100009354 | |||
| 1131 | Ga0097620_100003965 | |||
| 1132 | Ga0097620_100041549 | |||
| 1133 | Ga0097620_100082750 | |||
| 1134 | Ga0075435_100011049 | |||
| 1135 | Ga0075435_100024690 | |||
| 1136 | Ga0075435_100109235 | |||
| 1137 | Ga0075435_100235885 | |||
| 1138 | Ga0075435_100243335 | |||
| 1139 | Ga0075435_100346151 | |||
| 1140 | Ga0099794_10137235 | |||
| 1141 | Ga0105251_10020186 | |||
| 1142 | Ga0105251_10035309 | |||
| 1143 | Ga0105250_10035199 | |||
| 1144 | Ga0105240_10027358 | |||
| 1145 | Ga0105240_10070736 | |||
| 1146 | Ga0105240_10251390 | |||
| 1147 | Ga0111539_10000299 | |||
| 1148 | Ga0111539_10000725 | |||
| 1149 | Ga0111539_10005091 | |||
| 1150 | Ga0111539_10005821 | |||
| 1151 | Ga0111539_10429664 | |||
| 1152 | Ga0111539_10779953 | |||
| 1153 | Ga0105245_10000543 | |||
| 1154 | Ga0105245_10035281 | |||
| 1155 | Ga0105245_10057546 | |||
| 1156 | Ga0105245_10347300 | |||
| 1157 | Ga0105247_10003987 | |||
| 1158 | Ga0105247_10005905 | |||
| 1159 | Ga0105247_10014231 | |||
| 1160 | Ga0105247_10198805 | |||
| 1161 | Ga0114129_10000227 | |||
| 1162 | Ga0114129_10015409 | |||
| 1163 | Ga0114129_10019814 | |||
| 1164 | Ga0114129_10192052 | |||
| 1165 | Ga0114129_10218604 | |||
| 1166 | Ga0114129_10609620 | |||
| 1167 | Ga0105243_10023782 | |||
| 1168 | Ga0105243_10034321 | |||
| 1169 | Ga0105243_10039708 | |||
| 1170 | Ga0105241_10002875 | |||
| 1171 | Ga0105241_10020666 | |||
| 1172 | Ga0105241_10166885 | |||
| 1173 | Ga0105242_10001766 | |||
| 1174 | Ga0105242_10148496 | |||
| 1175 | Ga0105242_10495367 | |||
| 1176 | Ga0105248_10000501 | |||
| 1177 | Ga0105248_10041038 | |||
| 1178 | Ga0105248_10083720 | |||
| 1179 | Ga0105248_10252808 | |||
| 1180 | Ga0105248_10382944 | |||
| 1181 | Ga0105248_10542848 | |||
| 1182 | Ga0105237_10011199 | |||
| 1183 | Ga0105237_10014165 | |||
| 1184 | Ga0105237_10039491 | |||
| 1185 | Ga0105237_10112215 | |||
| 1186 | Ga0105238_10102269 | |||
| 1187 | Ga0105249_10006521 | |||
| 1188 | Ga0105249_10039615 | |||
| 1189 | Ga0105239_10005329 | |||
| 1190 | Ga0105246_10003469 | |||
| 1191 | Ga0105246_10165556 | |||
| 1192 | Ga0105246_10197576 | |||
| 1193 | Ga0105246_10422840 | |||
| 1194 | Ga0157342_1000244 | |||
| 1195 | Ga0157373_10068573 | |||
| 1196 | Ga0157371_10034339 | |||
| 1197 | Ga0157369_10293426 | |||
| 1198 | Ga0157374_10062294 | |||
| 1199 | Ga0157374_10164329 | |||
| 1200 | Ga0157374_10561304 | |||
| 1201 | Ga0157378_10013696 | |||
| 1202 | Ga0157378_10127726 | |||
| 1203 | Ga0163162_10004207 | |||
| 1204 | Ga0163162_10036841 | |||
| 1205 | Ga0163162_10085046 | |||
| 1206 | Ga0163162_10441223 | |||
| 1207 | Ga0157372_10014709 | |||
| 1208 | Ga0157372_10168338 | |||
| 1209 | Ga0157375_10002141 | |||
| 1210 | Ga0157375_10031231 | |||
| 1211 | Ga0157375_10130497 | |||
| 1212 | Ga0157375_10490179 | |||
| 1213 | Ga0163163_10003931 | |||
| 1214 | Ga0163163_10005032 | |||
| 1215 | Ga0163163_10055004 | |||
| 1216 | Ga0163163_10079659 | |||
| 1217 | Ga0157380_10000049 | |||
| 1218 | Ga0157377_10078009 | |||
| 1219 | Ga0157379_10015257 | |||
| 1220 | Ga0157379_10015309 | |||
| 1221 | Ga0157379_10021769 | |||
| 1222 | Ga0157379_10377192 | |||
| 1223 | Ga0157376_10000099 | |||
| 1224 | Ga0157376_10016011 | |||
| 1225 | Ga0157376_10025417 | |||
| 1226 | Ga0163161_10000081 | |||
| 1227 | Ga0207666_1000167 | |||
| 1228 | Ga0207673_1000150 | |||
| 1229 | Ga0207697_10002292 | |||
| 1230 | Ga0207653_10000843 | |||
| 1231 | Ga0207653_10024102 | |||
| 1232 | Ga0207682_10000046 | |||
| 1233 | Ga0207692_10036538 | |||
| 1234 | Ga0207642_10000135 | |||
| 1235 | Ga0207642_10009208 | |||
| 1236 | Ga0207710_10000850 | |||
| 1237 | Ga0207710_10000873 | |||
| 1238 | Ga0207710_10017322 | |||
| 1239 | Ga0207688_10001056 | |||
| 1240 | Ga0207680_10005263 | |||
| 1241 | Ga0207647_10007296 | |||
| 1242 | Ga0207647_10077967 | |||
| 1243 | Ga0207685_10031726 | |||
| 1244 | Ga0207699_10000312 | |||
| 1245 | Ga0207699_10087690 | |||
| 1246 | Ga0207699_10212969 | |||
| 1247 | Ga0207645_10000162 | |||
| 1248 | Ga0207645_10157376 | |||
| 1249 | Ga0207643_10000025 | |||
| 1250 | Ga0207684_10084848 | |||
| 1251 | Ga0207654_10001641 | |||
| 1252 | Ga0207654_10070689 | |||
| 1253 | Ga0207707_10002255 | |||
| 1254 | Ga0207693_10003951 | |||
| 1255 | Ga0207693_10006436 | |||
| 1256 | Ga0207663_10040020 | |||
| 1257 | Ga0207663_10172076 | |||
| 1258 | Ga0207660_10001243 | |||
| 1259 | Ga0207660_10073977 | |||
| 1260 | Ga0207660_10099479 | |||
| 1261 | Ga0207662_10024757 | |||
| 1262 | Ga0207662_10285371 | |||
| 1263 | Ga0207657_10009100 | |||
| 1264 | Ga0207657_10101539 | |||
| 1265 | Ga0207657_10128242 | |||
| 1266 | Ga0207649_10000048 | |||
| 1267 | Ga0207649_10067804 | |||
| 1268 | Ga0207652_10026062 | |||
| 1269 | Ga0207652_10071521 | |||
| 1270 | Ga0207652_10245815 | |||
| 1271 | Ga0207652_10284478 | |||
| 1272 | Ga0207681_10000131 | |||
| 1273 | Ga0207681_10018372 | |||
| 1274 | Ga0207650_10012254 | |||
| 1275 | Ga0207659_10000040 | |||
| 1276 | Ga0207687_10000090 | |||
| 1277 | Ga0207700_10000231 | |||
| 1278 | Ga0207700_10359713 | |||
| 1279 | Ga0207664_10197377 | |||
| 1280 | Ga0207644_10000473 | |||
| 1281 | Ga0207644_10063240 | |||
| 1282 | Ga0207690_10000173 | |||
| 1283 | Ga0207690_10305467 | |||
| 1284 | Ga0207706_10015889 | |||
| 1285 | Ga0207686_10014701 | |||
| 1286 | Ga0207686_10069456 | |||
| 1287 | Ga0207709_10000585 | |||
| 1288 | Ga0207709_10077416 | |||
| 1289 | Ga0207709_10119012 | |||
| 1290 | Ga0207670_10002222 | |||
| 1291 | Ga0207670_10006934 | |||
| 1292 | Ga0207670_10273308 | |||
| 1293 | Ga0207669_10000102 | |||
| 1294 | Ga0207669_10147487 | |||
| 1295 | Ga0207704_10000097 | |||
| 1296 | Ga0207704_10020284 | |||
| 1297 | Ga0207665_10000487 | |||
| 1298 | Ga0207665_10009084 | |||
| 1299 | Ga0207665_10116372 | |||
| 1300 | Ga0207665_10216484 | |||
| 1301 | Ga0207691_10007973 | |||
| 1302 | Ga0207711_10000847 | |||
| 1303 | Ga0207711_10001975 | |||
| 1304 | Ga0207711_10286792 | |||
| 1305 | Ga0207689_10000677 | |||
| 1306 | Ga0207689_10003052 | |||
| 1307 | Ga0207661_10000204 | |||
| 1308 | Ga0207661_10074423 | |||
| 1309 | Ga0207661_10105698 | |||
| 1310 | Ga0207661_10188910 | |||
| 1311 | Ga0207679_10000090 | |||
| 1312 | Ga0207679_10145059 | |||
| 1313 | Ga0207679_10180706 | |||
| 1314 | Ga0207679_10188131 | |||
| 1315 | Ga0207651_10000017 | |||
| 1316 | Ga0207651_10026112 | |||
| 1317 | Ga0207712_10000114 | |||
| 1318 | Ga0207712_10070190 | |||
| 1319 | Ga0207668_10000139 | |||
| 1320 | Ga0207668_10058200 | |||
| 1321 | Ga0207668_10360260 | |||
| 1322 | Ga0207668_10429545 | |||
| 1323 | Ga0207640_10000221 | |||
| 1324 | Ga0207640_10063623 | |||
| 1325 | Ga0207658_10005690 | |||
| 1326 | Ga0207658_10011332 | |||
| 1327 | Ga0207677_10002794 | |||
| 1328 | Ga0207677_10040887 | |||
| 1329 | Ga0207703_10001230 | |||
| 1330 | Ga0207703_10009415 | |||
| 1331 | Ga0207639_10001275 | |||
| 1332 | Ga0207639_10075624 | |||
| 1333 | Ga0207678_10000197 | |||
| 1334 | Ga0207678_10010540 | |||
| 1335 | Ga0207708_10004699 | |||
| 1336 | Ga0207708_10013323 | |||
| 1337 | Ga0207702_10000198 | |||
| 1338 | Ga0207702_10081852 | |||
| 1339 | Ga0207702_10309581 | |||
| 1340 | Ga0207641_10000417 | |||
| 1341 | Ga0207641_10265887 | |||
| 1342 | Ga0207648_10000483 | |||
| 1343 | Ga0207676_10000372 | |||
| 1344 | Ga0207676_10001984 | |||
| 1345 | Ga0207674_10003549 | |||
| 1346 | Ga0207674_10142672 | |||
| 1347 | Ga0207675_100007915 | |||
| 1348 | Ga0207675_100020311 | |||
| 1349 | Ga0207675_100057413 | |||
| 1350 | Ga0207683_10000141 | |||
| 1351 | Ga0207683_10000908 | |||
| 1352 | Ga0209984_1002913 | |||
| 1353 | Ga0210002_1001176 | |||
| 1354 | Ga0209971_1005351 | |||
| 1355 | Ga0209966_1001487 | |||
| 1356 | Ga0209998_10000232 | |||
| 1357 | Ga0209998_10001040 | |||
| 1358 | Ga0209974_10005229 | |||
| 1359 | Ga0207428_10000058 | |||
| 1360 | Ga0207428_10001115 | |||
| 1361 | Ga0207428_10002874 | |||
| 1362 | Ga0207428_10008433 | |||
| 1363 | Ga0268266_10002234 | |||
| 1364 | Ga0268265_10013047 | |||
| 1365 | Ga0268264_10000412 | |||
| 1366 | Ga0265337_1006179 | |||
| 1367 | Ga0265334_10050600 | |||
| 1368 | Ga0265338_10041790 | |||
| 1369 | Ga0265330_10011472 | |||
| 1370 | Ga0265330_10024284 | |||
| 1371 | Ga0265325_10000036 | |||
| 1372 | Ga0265325_10007651 | |||
| 1373 | Ga0265325_10059108 | |||
| 1374 | Ga0265340_10022764 | |||
| 1375 | Ga0265339_10014749 | |||
| 1376 | Ga0265316_10034358 | |||
| 1377 | Ga0265313_10001570 | |||
| 1378 | Ga0265313_10019218 | |||
| 1379 | Ga0265313_10103866 | |||
| 1380 | Ga0265314_10006219 | |||
| 1381 | Ga0265314_10007314 | |||
| 1382 | Ga0307416_100080536 | |||
| 1383 | Ga0373948_0003112 | |||
| 1384 | Ga0373958_0000560 | |||
| 1385 | Ga0373958_0005433 | |||
| 1386 | Ga0373959_0001450 | |||
| 1387 | Ga0373938_0000036 | |||
| 1388 | Ga0373938_0015276 | |||
| 1389 | Ga0373926_0033495 | |||
| 1390 | Ga0373926_0062752 | |||
| 1391 | Ga0373928_0000812 | |||
| 1392 | Ga0373929_0002736 | |||
| 1393 | Ga0373929_0017848 | |||
| 1394 | Ga0373934_0004844 | |||
| 1395 | Ga0373934_0109403 | |||
| 1396 | Ga0373940_0000390 | |||
| 1397 | Ga0373944_0006514 | |||
| 1398 | Ga0373944_0011632 | |||
| 1399 | Ga0373949_0001580 | |||
| 1400 | Ga0373949_0003013 | |||
| 1401 | Ga0373951_0000312 | |||
| 1402 | Ga0373952_0000533 | |||
| 1403 | Ga0373923_0000978 | |||
| 1404 | Ga0373923_0007388 | |||
| 1405 | Ga0373932_0001347 | |||
| 1406 | Ga0373932_0002893 | |||
| 1407 | Ga0373932_0018502 | |||
| 1408 | Ga0373932_0044240 | |||
| 1409 | Ga0373936_0002402 | |||
| 1410 | Ga0373936_0006435 | |||
| 1411 | Ga0373939_0000502 | |||
| 1412 | Ga0373939_0004753 | |||
| 1413 | Ga0373941_0000268 | |||
| 1414 | Ga0373941_0003730 | |||
| 1415 | Ga0373941_0018992 | |||
| 1416 | Ga0373945_0011045 | |||
| 1417 | Ga0373945_0012738 | |||
| 1418 | Ga0373954_0006112 | |||
| 1419 | Ga0373954_0007494 | |||
| 1420 | Ga0373954_0008449 | |||
| 1421 | Ga0373954_0022950 | |||
| 1422 | Ga0373956_0019685 | |||
| 1423 | Ga0373956_0020444 | |||
| 1424 | Ga0373957_0001478 | |||
| 1425 | Ga0373957_0001491 | |||
| 1426 | Ga0373957_0006863 | |||
| 1427 | Ga0373957_0059420 | |||
| 1428 | Ga0373943_0003974 | |||
| 1429 | Ga0373943_0005161 | |||
| 1430 | Ga0373943_0044179 | |||
| 1431 | Ga0373943_0106307 | |||
| 1432 | Ga0373946_0003537 | |||
| 1433 | Ga0373946_0007697 | |||
| 1434 | Ga0373946_0025273 | |||
| 1435 | Ga0373946_0036872 | |||
| 1436 | Ga0373955_0001092 | |||
| 1437 | Ga0373955_0001995 | |||
| 1438 | Ga0373955_0002098 | |||
| 1439 | Ga0373955_0013592 | |||
| 1440 | Ga0373955_0033141 | |||
| 1441 | Ga0373955_0148604 | |||
| 1442 | Ga0373942_0000260 | |||
| 1443 | Ga0373942_0026250 | |||
| 1444 | Ga0373961_0000492 | |||
| 1445 | Ga0373962_0000091 | |||
| 1446 | Ga0373962_0005292 | |||
| 1447 | Ga0373924_0010530 | |||
| 1448 | Ga0373924_0018520 | |||
| 1449 | Ga0373924_0061891 | |||
| 1450 | Ga0373931_0000131 | |||
| 1451 | Ga0373931_0007255 | |||
| 1452 | Ga0373935_0000377 | |||
| 1453 | Ga0373935_0014579 | |||
| 1454 | Ga0373927_0018997 | |||
| 1455 | Ga0373927_0021440 | |||
| 1456 | Ga0373927_0031784 | |||
| 1457 | Ga0373927_0040483 | |||
| 1458 | Ga0373933_0001665 | |||
| 1459 | Ga0373933_0002410 | |||
| 1460 | Ga0373933_0007167 | |||
| 1461 | Ga0373933_0032143 | |||
| 1462 | Ga0373947_0004674 | |||
| 1463 | Ga0373947_0009750 | |||
| 1464 | Ga0373947_0013218 | |||
| 1465 | Ga0373947_0179780 | |||
| 1466 | Ga0373937_0001849 | |||
| 1467 | Ga0373937_0003289 | |||
| 1468 | Ga0373937_0005585 | |||
| 1469 | Ga0373937_0007611 | |||
| 1470 | Ga0373937_0011521 | |||
| 1471 | Ga0373937_0014729 | |||
| 1472 | Ga0373937_0073183 | |||
| 1473 | Ga0373925_0000075 | |||
| 1474 | Ga0373925_0001381 | |||
| 1475 | Ga0373925_0006934 | |||
| 1476 | Ga0373925_0068052 | |||
| 1477 | Ga0395900_0021219 | |||
| 1478 | Ga0395900_0111939 | |||
| 1479 | Ga0395898_0028469 | |||
| 1480 | Ga0395898_0074389 | |||
| 1481 | Ga0436364_0429623 | |||
| 1482 | Ga0395901_0042693 | |||
| 1483 | Ga0242420_007157 | |||
| 1484 | Ga0436361_0670413 | |||
| 1485 | Ga0451577_0096577 | |||
| 1486 | Ga0466966_0235473 | |||
| 1487 | Ga0466961_0044652 | |||
| 1488 | Ga0466963_0021946 | |||
| 1489 | Ga0466963_0097864 | |||
| 1490 | Ga0466963_0348571 | |||
| 1491 | Ga0466959_0093858 | |||
| 1492 | Ga0451576_0370562 | |||
| 1493 | Ga0466967_0005150 | |||
| 1494 | Ga0495592_0000060 | |||
| 1495 | Ga0495592_0001425 | |||
| 1496 | Ga0495592_0009799 | |||
| 1497 | Ga0495592_0013763 | |||
| 1498 | Ga0495592_0150509 | |||
| 1499 | Ga0495603_0011449 | |||
| 1500 | Ga0495603_0014137 | |||
| 1501 | Ga0495603_0031146 | |||
| 1502 | Ga0495629_0001317 | |||
| 1503 | Ga0495629_0008135 | |||
| 1504 | Ga0495629_0045196 | |||
| 1505 | Ga0495629_0149354 | |||
| 1506 | Ga0495641_0016070 | |||
| 1507 | Ga0495641_0045562 | |||
| 1508 | Ga0495651_0000181 | |||
| 1509 | Ga0495651_0001028 | |||
| 1510 | Ga0495651_0015441 | |||
| 1511 | Ga0495651_0034700 | |||
| 1512 | Ga0495653_0000740 | |||
| 1513 | Ga0495653_0006880 | |||
| 1514 | Ga0495653_0054077 | |||
| 1515 | Ga0495653_0080174 | |||
| 1516 | Ga0495580_0019190 | |||
| 1517 | Ga0495580_0190472 | |||
| 1518 | Ga0495582_0017639 | |||
| 1519 | Ga0495582_0095894 | |||
| 1520 | Ga0495582_0181874 | |||
| 1521 | Ga0495639_0109009 | |||
| 1522 | Ga0495662_0001139 | |||
| 1523 | Ga0495662_0010017 | |||
| 1524 | Ga0495662_0054291 | |||
| 1525 | Ga0495664_0000003 | |||
| 1526 | Ga0495664_0018434 | |||
| 1527 | Ga0495664_0073130 | |||
| 1528 | Ga0495664_0110244 | |||
| 1529 | Ga0495584_0034777 | |||
| 1530 | Ga0495585_0002983 | |||
| 1531 | Ga0495594_0012852 | |||
| 1532 | Ga0495594_0019492 | |||
| 1533 | Ga0495607_0043814 | |||
| 1534 | Ga0495608_0000011 | |||
| 1535 | Ga0495608_0014132 | |||
| 1536 | Ga0495608_0020336 | |||
| 1537 | Ga0495618_0000044 | |||
| 1538 | Ga0495618_0007217 | |||
| 1539 | Ga0495628_0000001 | |||
| 1540 | Ga0495628_0022511 | |||
| 1541 | Ga0495628_0032380 | |||
| 1542 | Ga0495630_0002317 | |||
| 1543 | Ga0495630_0021258 | |||
| 1544 | Ga0495630_0155716 | |||
| 1545 | Ga0495663_0009174 | |||
| 1546 | Ga0495666_0004239 | |||
| 1547 | Ga0495642_0134687 | |||
| 1548 | Ga0495652_0000002 | |||
| 1549 | Ga0495652_0006243 | |||
| 1550 | Ga0495652_0011130 | |||
| 1551 | Ga0495652_0124986 | |||
| 1552 | Ga0495665_0010657 | |||
| 1553 | Ga0495640_0000002 | |||
| 1554 | Ga0495640_0020787 | |||
| 1555 | Ga0495586_0017488 | |||
| 1556 | Ga0495586_0034792 | |||
| 1557 | Ga0495587_0000001 | |||
| 1558 | Ga0495587_0002763 | |||
| 1559 | Ga0495587_0024297 | |||
| 1560 | Ga0495587_0052312 | |||
| 1561 | Ga0495587_0087367 | |||
| 1562 | Ga0495609_0097524 | |||
| 1563 | Ga0495645_0000002 | |||
| 1564 | Ga0495645_0008509 | |||
| 1565 | Ga0495645_0021269 | |||
| 1566 | Ga0495622_0057450 | |||
| 1567 | Ga0495633_0004123 | |||
| 1568 | Ga0495667_0000039 | |||
| 1569 | Ga0495667_0008435 | |||
| 1570 | Ga0495667_0012303 | |||
| 1571 | Ga0495667_0032436 | |||
| 1572 | Ga0495656_0008098 | |||
| 1573 | Ga0495634_0000010 | |||
| 1574 | Ga0495634_0261133 | |||
| 1575 | Ga0495611_0024831 | |||
| 1576 | Ga0495611_0127150 | |||
| 1577 | Ga0495635_0000001 | |||
| 1578 | Ga0495635_0007978 | |||
| 1579 | Ga0495635_0030375 | |||
| 1580 | Ga0495635_0047505 | |||
| 1581 | Ga0495635_0060232 | |||
| 1582 | Ga0495635_0245434 | |||
| 1583 | Ga0495659_0002157 | |||
| 1584 | Ga0495588_0001979 | |||
| 1585 | Ga0495657_0000042 | |||
| 1586 | Ga0495657_0008832 | |||
| 1587 | Ga0495657_0039023 | |||
| 1588 | Ga0495599_0000013 | |||
| 1589 | Ga0495599_0003683 | |||
| 1590 | Ga0495599_0034547 | |||
| 1591 | Ga0495599_0103341 | |||
| 1592 | Ga0495623_0000050 | |||
| 1593 | Ga0495623_0000554 | |||
| 1594 | Ga0495623_0013487 | |||
| 1595 | Ga0495646_0000009 | |||
| 1596 | Ga0495646_0001248 | |||
| 1597 | Ga0495646_0114340 | |||
| 1598 | Ga0495647_0005005 | |||
| 1599 | Ga0495647_0012267 | |||
| 1600 | Ga0495658_0009945 | |||
| 1601 | Ga0495658_0026882 | |||
| 1602 | Ga0495658_0034922 | |||
| 1603 | Ga0495658_0044686 | |||
| 1604 | Ga0495613_0009440 | |||
| 1605 | Ga0495613_0104514 | |||
| 1606 | Ga0495613_0176622 | |||
| 1607 | Ga0495624_0037597 | |||
| 1608 | Ga0495670_0005312 | |||
| 1609 | Ga0495600_0000209 | |||
| 1610 | Ga0495600_0000989 | |||
| 1611 | Ga0495581_0046167 | |||
| 1612 | Ga0495581_0148665 | |||
| 1613 | Ga0495604_0000069 | |||
| 1614 | Ga0495604_0002886 | |||
| 1615 | Ga0495604_0007911 | |||
| 1616 | Ga0495604_0010413 | |||
| 1617 | Ga0495674_0000002 | |||
| 1618 | Ga0495674_0160145 | |||
| 1619 | Ga0495676_0181764 | |||
| 1620 | Ga0495680_0000328 | |||
| 1621 | Ga0495680_0001832 | |||
| 1622 | Ga0495680_0012338 | |||
| 1623 | Ga0495680_0012693 | |||
| 1624 | Ga0495675_0000245 | |||
| 1625 | Ga0495675_0000625 | |||
| 1626 | Ga0495675_0010798 | |||
| 1627 | Ga0495684_0000016 | |||
| 1628 | Ga0495684_0000517 | |||
| 1629 | Ga0495684_0019009 | |||
| 1630 | Ga0495593_0000555 | |||
| 1631 | Ga0495593_0008554 | |||
| 1632 | Ga0495593_0015415 | |||
| 1633 | Ga0495602_0000024 | |||
| 1634 | Ga0495602_0052529 | |||
| 1635 | Ga0495614_0002673 | |||
| 1636 | Ga0496100_0000183 | |||
| 1637 | Ga0496100_0001822 | |||
| 1638 | Ga0496100_0258012 | |||
| 1639 | Ga0496101_0001253 | |||
| 1640 | Ga0496101_0040079 | |||
| 1641 | Ga0496101_0164103 | |||
| 1642 | Ga0496101_0334210 | |||
| 1643 | Ga0496101_0382203 | |||
| 1644 | Ga0496102_0002101 | |||
| 1645 | Ga0496102_0021368 | |||
| 1646 | Ga0496102_0088318 | |||
| 1647 | Ga0496102_0096806 | |||
| 1648 | Ga0496102_0524865 | |||
| 1649 | Ga0496103_0011705 | |||
| 1650 | Ga0496103_0017302 | |||
| 1651 | Ga0496103_0130887 | |||
| 1652 | Ga0496103_0278367 | |||
| 1653 | Ga0496104_0000055 | |||
| 1654 | Ga0496104_0003403 | |||
| 1655 | Ga0496104_0015277 | |||
| 1656 | Ga0496104_0018261 | |||
| 1657 | Ga0496104_0019231 | |||
| 1658 | Ga0496104_0220516 | |||
| 1659 | Ga0496104_0489944 | |||
| 1660 | Ga0496105_0000918 | |||
| 1661 | Ga0496105_0009881 | |||
| 1662 | Ga0496105_0027876 | |||
| 1663 | Ga0496105_0082136 | |||
| 1664 | Ga0496105_0098212 | |||
| 1665 | Ga0496105_0105948 | |||
| 1666 | Ga0496105_0123171 | |||
| 1667 | Ga0496105_0168598 | |||
| 1668 | Ga0496106_0000317 | |||
| 1669 | Ga0496106_0018123 | |||
| 1670 | Ga0496106_0070350 | |||
| 1671 | Ga0496106_0083591 | |||
| 1672 | Ga0496106_0105027 | |||
| 1673 | Ga0496107_0013389 | |||
| 1674 | Ga0496107_0036332 | |||
| 1675 | Ga0496107_0059899 | |||
| 1676 | Ga0496108_0039369 | |||
| 1677 | Ga0496108_0045630 | |||
| 1678 | Ga0496108_0448220 | |||
| 1679 | Ga0496108_0474916 | |||
| 1680 | Ga0496109_0000812 | |||
| 1681 | Ga0496109_0012200 | |||
| 1682 | Ga0496109_0023439 | |||
| 1683 | Ga0496109_0025460 | |||
| 1684 | Ga0496109_0060469 | |||
| 1685 | Ga0496109_0091515 | |||
| 1686 | Ga0496109_0353745 | |||
| 1687 | Ga0496109_0540583 | |||
| 1688 | Ga0496110_0004023 | |||
| 1689 | Ga0496110_0011433 | |||
| 1690 | Ga0496110_0114645 | |||
| 1691 | Ga0496110_0149856 | |||
| 1692 | Ga0496110_0169558 | |||
| 1693 | Ga0496110_0210917 | |||
| 1694 | Ga0496110_0366230 | |||
| 1695 | Ga0496111_0002977 | |||
| 1696 | Ga0496111_0010259 | |||
| 1697 | Ga0496111_0034534 | |||
| 1698 | Ga0496111_0128046 | |||
| 1699 | Ga0496111_0164330 | |||
| 1700 | Ga0496111_0271515 | |||
| 1701 | Ga0496112_0002948 | |||
| 1702 | Ga0496112_0085171 | |||
| 1703 | Ga0496112_0189571 | |||
| 1704 | Ga0496112_0448991 | |||
| 1705 | Ga0496112_0449956 | |||
| 1706 | Ga0496112_0527334 | |||
| 1707 | Ga0496113_0008320 | |||
| 1708 | Ga0496113_0017093 | |||
| 1709 | Ga0496113_0039433 | |||
| 1710 | Ga0496113_0127122 | |||
| 1711 | Ga0496113_0146657 | |||
| 1712 | Ga0496113_0176087 | |||
| 1713 | Ga0496114_0000430 | |||
| 1714 | Ga0496114_0017159 | |||
| 1715 | Ga0496114_0286747 | |||
| 1716 | Ga0496115_0008581 | |||
| 1717 | Ga0496115_0014487 | |||
| 1718 | Ga0496115_0016124 | |||
| 1719 | Ga0496115_0028379 | |||
| 1720 | Ga0496115_0061613 | |||
| 1721 | Ga0496115_0208973 | |||
| 1722 | Ga0496115_0248324 | |||
| 1723 | Ga0501034_0116753 | |||
| 1724 | Ga0501034_0491120 | |||
| 1725 | Ga0501036_0383857 | |||
| 1726 | Ga0501038_0068280 | |||
| 1727 | Ga0501041_0022050 | |||
| 1728 | Ga0501041_0118359 | |||
| 1729 | Ga0501042_0108724 | |||
| 1730 | Ga0501042_0226953 | |||
| 1731 | Ga0501048_0117761 | |||
| 1732 | Ga0501067_0015744 | |||
| 1733 | Ga0501068_0339936 | |||
| 1734 | Ga0501069_0020274 | |||
| 1735 | Ga0501071_0021167 | |||
| 1736 | Ga0501071_0138285 | |||
| 1737 | Ga0501072_0057934 | |||
| 1738 | Ga0501074_0170065 | |||
| 1739 | Ga0501076_0068865 | |||
| 1740 | Ga0501077_0010511 | |||
| 1741 | Ga0501077_0108335 | |||
| 1742 | Ga0501079_0042947 | |||
| 1743 | Ga0501079_0206065 | |||
| 1744 | Ga0501080_0373660 | |||
| 1745 | Ga0501081_0034379 | |||
| 1746 | Ga0501081_0199923 | |||
| 1747 | Ga0501035_0174953 | |||
| 1748 | Ga0501044_0198495 | |||
| 1749 | nmdc:mga00v17_67260_c1 | |||
| 1750 | nmdc:mga06z11_165224_c1 | |||
| 1751 | nmdc:mga05p37_13845_c1 | |||
| 1752 | nmdc:mga05p37_240876_c1 | |||
| 1753 | nmdc:mga05p37_364276_c1 | |||
| 1754 | nmdc:mga05p37_675_c1 | |||
| 1755 | nmdc:mga05p37_76_c1 | |||
| 1756 | nmdc:mga09592_19945_c1 | |||
| 1757 | nmdc:mga09592_31289_c1 | |||
| 1758 | nmdc:mga0qj67_18840_c1 | |||
| 1759 | nmdc:mga0qj67_229_c1 | |||
| 1760 | nmdc:mga06r32_1246_c1 | |||
| 1761 | nmdc:mga06r32_134_c1 | |||
| 1762 | nmdc:mga08y16_1152_c1 | |||
| 1763 | nmdc:mga08y16_34053_c1 | |||
| 1764 | nmdc:mga08y16_4279_c1 | |||
| 1765 | nmdc:mga0n895_24756_c1 | |||
| 1766 | nmdc:mga0n895_511603_c1 | |||
| 1767 | nmdc:mga0n895_73_c1 | |||
| 1768 | nmdc:mga0n895_96637_c1 | |||
| 1769 | nmdc:mga0rr50_222899_c1 | |||
| 1770 | nmdc:mga0rr50_3303_c1 | |||
| 1771 | nmdc:mga0rr50_84908_c1 | |||
| 1772 | nmdc:mga0rr50_98079_c1 | |||
| 1773 | nmdc:mga08x19_134671_c1 | |||
| 1774 | nmdc:mga0a205_4115_c1 | |||
| 1775 | nmdc:mga0a205_59_c1 | |||
| 1776 | Ga0495601_0000001 | |||
| 1777 | Ga0495601_0000357 | |||
| 1778 | Ga0495601_0000555 | |||
| 1779 | Ga0495601_0002958 | |||
| 1780 | Ga0495601_0004584 | |||
| 1781 | Ga0495601_0006469 | |||
| 1782 | Ga0495601_0027022 | |||
| 1783 | Ga0495612_0000017 | |||
| 1784 | Ga0495612_0000539 | |||
| 1785 | Ga0495612_0008398 | |||
| 1786 | Ga0495612_0009333 | |||
| 1787 | Ga0495595_0000010 | |||
| 1788 | Ga0495595_0000939 | |||
| 1789 | Ga0495595_0001313 | |||
| 1790 | Ga0495595_0002410 | |||
| 1791 | Ga0495595_0005308 | |||
| 1792 | Ga0495595_0020334 | |||
| 1793 | Ga0495595_0176394 | |||
| 1794 | Ga0495619_0000004 | |||
| 1795 | Ga0495619_0000085 | |||
| 1796 | Ga0495619_0000380 | |||
| 1797 | Ga0495619_0000636 | |||
| 1798 | Ga0495619_0002427 | |||
| 1799 | Ga0495619_0008402 | |||
| 1800 | Ga0495619_0025705 | |||
| 1801 | Ga0495619_0075100 | |||
| 1802 | Ga0501084_0015606 | |||
| 1803 | Ga0501084_0020609 | |||
| 1804 | Ga0501084_0281571 | |||
| 1805 | Ga0501082_0073106 | |||
| 1806 | Ga0501082_0097469 | |||
| 1807 | Ga0501082_0431542 | |||
| 1808 | Ga0530510_0054647 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7va1-assembly1.cif.gz_B | crystal structure of human 3-phosphoglycerate dehydrogenase in complex with gdd-04-35 | 0.9529 | 102 | 284 |
| 6rj6-assembly1.cif.gz_A | crystal structure of phgdh in complex with bi-4924 | 0.947 | 105 | 292 |
| 3ddn-assembly1.cif.gz_A | crystal structure of hydroxypyruvic acid phosphate bound d-3-phosphoglycerate dehydrogenase in mycobacterium tuberculosis | 0.9376 | 2 | 318 |
| 3ddn-assembly1.cif.gz_B-2 | crystal structure of hydroxypyruvic acid phosphate bound d-3-phosphoglycerate dehydrogenase in mycobacterium tuberculosis | 0.9365 | 2 | 319 |
| 3dc2-assembly1.cif.gz_B | crystal structure of serine bound d-3-phosphoglycerate dehydrogenase from mycobacterium tuberculosis | 0.9361 | 4 | 319 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q2FZW9_11_72_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9663 | 39 | 98 | 3.40.50.720 |
| af_Q2FZW9_121_261_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9621 | 145 | 284 | 3.40.50.720 |
| af_Q9VII9_150_293_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9535 | 143 | 284 | 3.40.50.720 |
| af_Q7SZY8_153_293_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9525 | 145 | 284 | 3.40.50.720 |
| af_Q2FVW4_141_284_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9522 | 141 | 284 | 3.40.50.720 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3T1E0P6-F1-model_v4 | deleted | 0.9733 | 141 | 268 |
|
| AF-A0A287XTN6-F1-model_v4 | deleted | 0.9629 | 160 | 319 |
|
| AF-B7FGD0-F1-model_v4 | D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding domain-containing protein | 0.9622 | 144 | 313 |
GO:0016491
GO:0051287 |
| AF-A0A803NNM4-F1-model_v4 | D-3-phosphoglycerate dehydrogenase | 0.9621 | 152 | 313 |
GO:0004617
GO:0051287 |
| AF-A0A6I1ZX03-F1-model_v4 | C-terminal binding protein | 0.962 | 94 | 315 |
GO:0003714
GO:0016616 GO:0051287 |