F485286

General Info

Members Datasets Scaffolds Average Seq Length
904 567 1808 230

Family's Representative Sequence

Representative Sequence 3300039453|Ga0436362_1173705|Ga0436362_1173705_865_1716
Length 283
Sequence MRTPIMIAGEAFRSGALAPVLKRGNYAISDGSRSCQDDRVKTHFPELAMAEPLQIGLLIFPKVTQLDFTGPLQVFSSLPAHLAKVHLVWKRIEPVASDGPLVLTPTATFADCPQLDVICVPGGIGTDDLVNDEEVLDFIRAQAERAQYVTSVCTGSLVLGAAGLLKGYRAATHWSAMDHLVPFGAIPTKTRVCVDRNRITGGGVTAGIDFALTLVSMLVDRTIAEAVQLRLEYNPAPPFQSGSPDSAPPEVLALIESRMAPFRQRRAEAVVRAAARLNEPASG

Samples

Sample ID Description Type Environment
1 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
2 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
3 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
4 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
5 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
6 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
7 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
8 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
9 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
10 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
11 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
22 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
23 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
24 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
25 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
26 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
27 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
28 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
29 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
30 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
31 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
32 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
33 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
34 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
35 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
36 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
37 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
38 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
39 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
40 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
41 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
42 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
43 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
44 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
45 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
46 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
47 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
48 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
49 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
50 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
51 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
52 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
53 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
54 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
55 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
56 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
57 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
58 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
59 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
60 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
61 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
62 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
63 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
64 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
65 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
66 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
67 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
68 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
70 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
71 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
72 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
73 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
74 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
75 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
76 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
77 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
78 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
79 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
80 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
81 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
82 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
83 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
84 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
85 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
86 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
87 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
88 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
89 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
90 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
91 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
92 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
93 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
94 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
95 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
96 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
97 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
98 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
99 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
100 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
101 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
102 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
103 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
104 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
105 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
106 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
107 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
108 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
109 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
110 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
151 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
152 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
153 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
154 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
156 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
159 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
160 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
161 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
162 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
163 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
164 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
165 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
166 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
167 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
168 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
169 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
170 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
171 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
172 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
173 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
174 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
175 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
176 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
177 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
178 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
179 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
180 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
181 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
182 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
183 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
184 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
185 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
186 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
187 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
188 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
189 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
190 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
191 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
192 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
193 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
194 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
195 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
196 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
197 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
198 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
199 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
200 3300041462 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG Metagenome Rhizoplane
201 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
202 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
203 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
204 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
205 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
206 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
207 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
208 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
209 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
210 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
211 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
212 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
213 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
214 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
215 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
216 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
217 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
218 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
219 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
220 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
221 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
222 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
223 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
224 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
225 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
226 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
227 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
228 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
229 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
230 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
231 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
232 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
233 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
234 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
235 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
236 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
237 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
238 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
239 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
240 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
241 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
242 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
243 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
244 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
245 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
246 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
247 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
248 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
249 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
250 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
251 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
252 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
253 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
254 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
255 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
256 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
257 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
258 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
259 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
260 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
261 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
262 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
263 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
264 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
265 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
266 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
267 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
268 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
269 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
270 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
271 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
272 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
273 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
274 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
275 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
276 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
277 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
278 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
279 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
280 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
281 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
282 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
283 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
284 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
285 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
286 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
287 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
288 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
289 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
290 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
291 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
292 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
293 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
294 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
295 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
296 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
297 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
298 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
299 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
300 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
301 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
302 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
303 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
304 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
305 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
306 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
307 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
308 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
309 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
310 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
311 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
312 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
313 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
314 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
315 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
316 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
317 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
318 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
319 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
320 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
321 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
322 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
323 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
324 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
325 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
326 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
327 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
328 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
329 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
330 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
331 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
332 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
333 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
334 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
335 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
336 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
337 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
338 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
339 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
340 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
341 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
342 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
343 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
344 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
345 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
346 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
347 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
348 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
349 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
350 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
351 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
352 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
353 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
354 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
355 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
356 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
357 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
358 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
359 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
360 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
361 3300053115 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere Metagenome Endosphere
362 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
363 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
364 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
365 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
366 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
367 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
368 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
369 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
370 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
371 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
372 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
373 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
374 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
375 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
376 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
377 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
378 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
379 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
380 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
381 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
382 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
383 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
384 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
385 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
386 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
387 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
388 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
389 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
390 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
391 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
392 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
393 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
394 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
395 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
396 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
397 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
398 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
399 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
400 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
401 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
402 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
403 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
404 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
405 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
406 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
407 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
408 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
409 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
410 2791355199
411 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
412 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
413 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
414 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
415 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
416 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
417 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
418 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
419 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
420 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
421 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
422 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
423 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
424 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
425 2824732956 Bradyrhizobium sp. HAMBI 2153 Isolate Unclassified
426 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
427 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
428 2828305725 Xanthobacter tagetidis DSM 11105 Isolate Unclassified
429 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
430 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
431 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
432 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
433 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
434 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
435 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
436 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
437 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
438 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
439 2851182111 Bosea sp. Tri-44 Isolate Nodule
440 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
441 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
442 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
443 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
444 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
445 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
446 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
447 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
448 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
449 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
450 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
451 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
452 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
453 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
454 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
455 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
456 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
457 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
458 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
459 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
460 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
461 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
462 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
463 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
464 2906610324
465 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
466 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
467 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
468 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
469 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
470 2922368715
471 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
472 2922425934
473 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
474 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
475 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
476 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
477 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
478 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
479 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
480 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
481 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
482 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
483 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
484 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
485 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
486 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
487 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
488 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
489 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
490 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
491 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
492 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
493 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
494 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
495 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
496 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
497 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
498 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
499 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
500 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
501 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
502 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
503 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
504 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
505 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
506 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
507 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
508 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
509 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
510 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
511 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
512 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
513 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
514 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
515 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
516 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
517 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
518 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
519 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
520 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
521 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
522 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
523 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
524 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
525 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
526 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
527 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
528 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
529 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
530 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
531 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
532 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified
533 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
534 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
535 8006926726 Bradyrhizobium guangdongense SM32 Isolate Unclassified
536 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
537 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
538 8016530956 Bradyrhizobium sp. LM6.11 Isolate Nodule
539 8016539877 Bradyrhizobium sp. LM6.10 Isolate Nodule
540 8016548790 Bradyrhizobium sp. LM3.6 Isolate Nodule
541 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
542 8016566248 Bradyrhizobium sp. LM3.2 Isolate Nodule
543 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
544 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
545 8016603502 Bradyrhizobium sp. LB7.2 Isolate Nodule
546 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
547 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
548 8019530166 Bradyrhizobium sp. LM4.3 Isolate Nodule
549 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
550 8019547302 Bradyrhizobium sp. LB1.3 Isolate Nodule
551 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
552 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
553 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
554 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
555 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
556 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
557 8019619141 Bradyrhizobium sp. GM7.3 Isolate Nodule
558 8019638758 Bradyrhizobium sp. GM5.1 Isolate Nodule
559 8019659431 Bradyrhizobium sp. GM22.5 Isolate Nodule
560 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
561 8019678201 Bradyrhizobium sp. GM0.4 Isolate Nodule
562 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
563 8054002106 Azospirillum lipoferum 59b Isolate Unclassified
564 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
565 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule
566 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule
567 8057575449 Rhizobium mayense CCGE526 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 80.22
Metatranscriptomes 0
Isolates 19.78

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.94
Nodule 16.37
Rhizoplane 4.31
Rhizosphere 55.09
Stem 0
Stem Tuber 0
Unclassified 0.11

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0436362_1173705 3300039453 Bacteria 2758
2 JGI25156J39149_1002491 3300002705 Bacteria 6563
3 JGI25154J39366_1000013 3300002738 Bacteria 268260
4 JGI25157J39369_1002059 3300002741 Bacteria 5751
5 JGI25406J46586_10038176 3300003203 Bacteria 1724
6 JGI25153J46596_10001920 3300003215 Bacteria 12337
7 JGI25153J46596_10002312 3300003215 Bacteria 11081
8 JGI25153J46596_10017224 3300003215 Bacteria 2854
9 JGI25160J50197_1000631 3300003354 Bacteria 19703
10 JGI25160J50197_1011095 3300003354 Bacteria 3215
11 JGI25404J52841_10004693 3300003659 Bacteria 2787
12 JGI25404J52841_10005665 3300003659 Bacteria 2583
13 JGI25404J52841_10006333 3300003659 Bacteria 2473
14 JGI25404J52841_10009379 3300003659 Bacteria 2092
15 Ga0055543_1001288 3300004625 Bacteria 10317
16 Ga0065165_1000844 3300005262 Bacteria 40173
17 Ga0065165_1002117 3300005262 Bacteria 18094
18 Ga0065165_1034331 3300005262 Bacteria 1569
19 Ga0070683_100126208 3300005329 Bacteria 2419
20 Ga0070670_100857974 3300005331 Bacteria 822
21 Ga0068869_100177424 3300005334 Bacteria 1668
22 Ga0070680_100036288 3300005336 Bacteria 3982
23 Ga0070680_100064055 3300005336 Bacteria 3012
24 Ga0070680_100246414 3300005336 Bacteria 1511
25 Ga0070682_100080180 3300005337 Bacteria 2110
26 Ga0070682_100185509 3300005337 Bacteria 1457
27 Ga0068868_100267074 3300005338 Bacteria 1445
28 Ga0070668_100140649 3300005347 Bacteria 1945
29 Ga0070668_100327741 3300005347 Bacteria 1291
30 Ga0070671_100081966 3300005355 Bacteria 2697
31 Ga0070671_100198395 3300005355 Bacteria 1701
32 Ga0070674_100513901 3300005356 Bacteria 999
33 Ga0070667_100328787 3300005367 Bacteria 1380
34 Ga0070709_10000943 3300005434 Bacteria 16169
35 Ga0070709_10025859 3300005434 Bacteria 3471
36 Ga0070714_100030050 3300005435 Bacteria 4521
37 Ga0070714_100351354 3300005435 Bacteria 1385
38 Ga0070713_100040544 3300005436 Bacteria 3786
39 Ga0070713_100113099 3300005436 Bacteria 2369
40 Ga0070710_10009412 3300005437 Bacteria 4779
41 Ga0070710_10040690 3300005437 Bacteria 2562
42 Ga0070710_10113435 3300005437 Bacteria 1631
43 Ga0070711_100023513 3300005439 Bacteria 4009
44 Ga0070711_100059522 3300005439 Bacteria 2652
45 Ga0070711_100131823 3300005439 Bacteria 1862
46 Ga0070711_100145658 3300005439 Bacteria 1781
47 Ga0070708_100262255 3300005445 Bacteria 1624
48 Ga0070663_100004463 3300005455 Bacteria 8235
49 Ga0070663_100012305 3300005455 Bacteria 5408
50 Ga0070663_100029168 3300005455 Bacteria 3766
51 Ga0070663_100057859 3300005455 Bacteria 2782
52 Ga0070678_100043979 3300005456 Bacteria 3186
53 Ga0070678_100304889 3300005456 Bacteria 1355
54 Ga0070678_100377632 3300005456 Bacteria 1225
55 Ga0070662_100493385 3300005457 Bacteria 1021
56 Ga0070681_10063273 3300005458 Bacteria 3672
57 Ga0070681_10069007 3300005458 Bacteria 3502
58 Ga0070681_10076578 3300005458 Bacteria 3303
59 Ga0070681_10099623 3300005458 Bacteria 2852
60 Ga0070706_100028347 3300005467 Bacteria 5155
61 Ga0070707_100160957 3300005468 Bacteria 2187
62 Ga0070707_100200939 3300005468 Bacteria 1943
63 Ga0070698_100159783 3300005471 Bacteria 2198
64 Ga0070699_100121669 3300005518 Bacteria 2295
65 Ga0070679_100025804 3300005530 Bacteria 5766
66 Ga0070679_100259285 3300005530 Bacteria 1694
67 Ga0070684_100015676 3300005535 Bacteria 6182
68 Ga0070697_100039465 3300005536 Unclassified 3817
69 Ga0068853_100093363 3300005539 Bacteria 2649
70 Ga0068853_100175317 3300005539 Bacteria 1942
71 Ga0068853_100450923 3300005539 Bacteria 1210
72 Ga0068853_100625265 3300005539 Bacteria 1024
73 Ga0068853_100882191 3300005539 Bacteria 859
74 Ga0070686_100421597 3300005544 Bacteria 1020
75 Ga0070665_100060084 3300005548 Bacteria 3811
76 Ga0070665_100078115 3300005548 Bacteria 3316
77 Ga0070665_100101926 3300005548 Bacteria 2874
78 Ga0070665_100166997 3300005548 Bacteria 2203
79 Ga0070665_100555181 3300005548 Bacteria 1161
80 Ga0068855_100047191 3300005563 Bacteria 5089
81 Ga0068855_100047627 3300005563 Bacteria 5064
82 Ga0068855_100059338 3300005563 Bacteria 4477
83 Ga0068855_100118158 3300005563 Bacteria 3037
84 Ga0070664_100861488 3300005564 Bacteria 849
85 Ga0068856_100133911 3300005614 Bacteria 2483
86 Ga0068856_100182705 3300005614 Bacteria 2111
87 Ga0068856_100543575 3300005614 Bacteria 1183
88 Ga0068856_100724889 3300005614 Bacteria 1014
89 Ga0068852_100198691 3300005616 Bacteria 1897
90 Ga0068852_100260990 3300005616 Bacteria 1663
91 Ga0068852_100379436 3300005616 Bacteria 1386
92 Ga0068852_100943691 3300005616 Bacteria 881
93 Ga0068859_100143562 3300005617 Bacteria 2461
94 Ga0068859_100833652 3300005617 Bacteria 1009
95 Ga0068870_10298658 3300005840 Bacteria 1016
96 Ga0068858_100175128 3300005842 Bacteria 2024
97 Ga0068858_100362299 3300005842 Bacteria 1390
98 Ga0068860_100000589 3300005843 Bacteria 43469
99 Ga0068860_100023488 3300005843 Bacteria 5958
100 Ga0068860_100082950 3300005843 Bacteria 3048
101 Ga0068860_100518562 3300005843 Bacteria 1192
102 Ga0068862_100586181 3300005844 Bacteria 1069
103 Ga0081455_10009042 3300005937 Bacteria 10284
104 Ga0081455_10017212 3300005937 Bacteria 6939
105 Ga0081455_10018811 3300005937 Bacteria 6553
106 Ga0081455_10131983 3300005937 Bacteria 1952
107 Ga0081538_10036981 3300005981 Bacteria 3176
108 Ga0081540_1003394 3300005983 Bacteria 12630
109 Ga0081540_1020867 3300005983 Bacteria 3924
110 Ga0081540_1021640 3300005983 Bacteria 3820
111 Ga0081540_1025247 3300005983 Bacteria 3425
112 Ga0081540_1059621 3300005983 Bacteria 1831
113 Ga0081539_10001398 3300005985 Bacteria 41551
114 Ga0081539_10021340 3300005985 Bacteria 4333
115 Ga0081539_10185926 3300005985 Bacteria 971
116 Ga0070717_10001195 3300006028 Bacteria 17601
117 Ga0075365_10055262 3300006038 Bacteria 2634
118 Ga0075365_10059122 3300006038 Bacteria 2554
119 Ga0075365_10094748 3300006038 Bacteria 2038
120 Ga0075365_10179316 3300006038 Bacteria 1481
121 Ga0075365_10524505 3300006038 Bacteria 837
122 Ga0075368_10000684 3300006042 Bacteria 10294
123 Ga0075368_10128489 3300006042 Bacteria 1052
124 Ga0075363_100025917 3300006048 Bacteria 2995
125 Ga0075363_100027730 3300006048 Bacteria 2906
126 Ga0075363_100032563 3300006048 Bacteria 2709
127 Ga0075363_100367304 3300006048 Bacteria 842
128 Ga0075364_10028098 3300006051 Bacteria 3599
129 Ga0070715_10078082 3300006163 Bacteria 1496
130 Ga0070716_100027312 3300006173 Bacteria 3065
131 Ga0070712_100090277 3300006175 Bacteria 2243
132 Ga0070712_100251741 3300006175 Bacteria 1412
133 Ga0075362_10100664 3300006177 Bacteria 1351
134 Ga0075367_10005646 3300006178 Bacteria 6240
135 Ga0075367_10022133 3300006178 Bacteria 3561
136 Ga0075367_10032972 3300006178 Bacteria 2983
137 Ga0075369_10013223 3300006186 Bacteria 3272
138 Ga0075366_10006129 3300006195 Bacteria 6556
139 Ga0075366_10056251 3300006195 Bacteria 2337
140 Ga0075366_10230277 3300006195 Bacteria 1129
141 Ga0075370_10013795 3300006353 Bacteria 4299
142 Ga0075370_10035483 3300006353 Bacteria 2799
143 Ga0075370_10052216 3300006353 Bacteria 2319
144 Ga0075370_10058296 3300006353 Bacteria 2196
145 Ga0075434_100141157 3300006871 Bacteria 2429
146 Ga0097620_100143560 3300006931 Bacteria 2461
147 Ga0097620_100833682 3300006931 Bacteria 1009
148 Ga0099824_1006510 3300006942 Bacteria 15990
149 Ga0099824_1012401 3300006942 Bacteria 9306
150 Ga0099822_1003886 3300006943 Bacteria 19305
151 Ga0105250_10070491 3300009092 Bacteria 1411
152 Ga0105240_10047643 3300009093 Bacteria 5422
153 Ga0105240_10183132 3300009093 Bacteria 2470
154 Ga0105240_10227884 3300009093 Bacteria 2167
155 Ga0105240_10305136 3300009093 Bacteria 1820
156 Ga0105240_10314687 3300009093 Bacteria 1786
157 Ga0105245_10933204 3300009098 Bacteria 910
158 Ga0105247_10004329 3300009101 Bacteria 9071
159 Ga0105243_10146926 3300009148 Bacteria 2018
160 Ga0105241_10270136 3300009174 Bacteria 1448
161 Ga0105248_10004990 3300009177 Bacteria 14670
162 Ga0105248_10201894 3300009177 Bacteria 2240
163 Ga0105237_10292492 3300009545 Bacteria 1632
164 Ga0105237_10375557 3300009545 Bacteria 1426
165 Ga0105237_10423898 3300009545 Bacteria 1336
166 Ga0105238_10045226 3300009551 Bacteria 4448
167 Ga0105238_10070803 3300009551 Bacteria 3486
168 Ga0105238_10094882 3300009551 Bacteria 2971
169 Ga0105239_10062789 3300010375 Bacteria 4077
170 Ga0105239_10082423 3300010375 Bacteria 3542
171 Ga0105239_10189322 3300010375 Bacteria 2303
172 Ga0105239_10696974 3300010375 Bacteria 1161
173 Ga0105239_10858460 3300010375 Bacteria 1041
174 Ga0105246_10031542 3300011119 Bacteria 3508
175 Ga0157371_10034937 3300013102 Bacteria 3604
176 Ga0157370_10007389 3300013104 Bacteria 11970
177 Ga0157369_10004890 3300013105 Bacteria 15715
178 Ga0157369_10019548 3300013105 Bacteria 7579
179 Ga0157369_10212434 3300013105 Bacteria 2027
180 Ga0157374_10406121 3300013296 Bacteria 1359
181 Ga0157378_10016616 3300013297 Bacteria 6447
182 Ga0157378_10303285 3300013297 Bacteria 1546
183 Ga0163162_10094634 3300013306 Bacteria 3074
184 Ga0163162_10170328 3300013306 Bacteria 2302
185 Ga0157372_10084277 3300013307 Bacteria 3602
186 Ga0157375_10280668 3300013308 Bacteria 1829
187 Ga0163163_10027245 3300014325 Bacteria 5473
188 Ga0163163_10048691 3300014325 Bacteria 4168
189 Ga0163163_10148889 3300014325 Bacteria 2385
190 Ga0157380_10243877 3300014326 Bacteria 1622
191 Ga0182006_1096908 3300015261 Bacteria 1052
192 Ga0214542_1000001 3300021321 Bacteria 1018696
193 Ga0214545_1000001 3300021324 Bacteria 1092817
194 Ga0214543_1000001 3300021327 Bacteria 776921
195 Ga0213876_10006878 3300021384 Bacteria 6200
196 Ga0213876_10106677 3300021384 Bacteria 1486
197 Ga0213875_10029210 3300021388 Bacteria 2615
198 Ga0209435_100006 3300025206 Bacteria 542459
199 Ga0209563_116775 3300025230 Bacteria 893
200 Ga0209646_1000015 3300025246 Bacteria 542459
201 Ga0209026_1000039 3300025250 Bacteria 280608
202 Ga0209677_102871 3300025253 Bacteria 6058
203 Ga0209759_1000005 3300025256 Bacteria 542459
204 Ga0209759_1004195 3300025256 Bacteria 5468
205 Ga0209233_1014518 3300025261 Bacteria 2216
206 Ga0209673_1056165 3300025273 Bacteria 1009
207 Ga0209564_1002211 3300025295 Bacteria 16219
208 Ga0209758_1000021 3300025297 Bacteria 697691
209 Ga0209758_1001025 3300025297 Bacteria 36697
210 Ga0209758_1001133 3300025297 Bacteria 34266
211 Ga0209758_1011526 3300025297 Bacteria 5104
212 Ga0209758_1056350 3300025297 Bacteria 1328
213 Ga0209758_1103550 3300025297 Bacteria 803
214 Ga0209256_1007103 3300025299 Bacteria 5650
215 Ga0209256_1053793 3300025299 Bacteria 962
216 Ga0207426_1000479 3300025302 Bacteria 60939
217 Ga0207426_1000599 3300025302 Bacteria 47456
218 Ga0207426_1042331 3300025302 Bacteria 1406
219 Ga0207697_10034517 3300025315 Bacteria 2071
220 Ga0207692_10005535 3300025898 Bacteria 5068
221 Ga0207692_10185844 3300025898 Bacteria 1213
222 Ga0207710_10008563 3300025900 Bacteria 4312
223 Ga0207710_10140396 3300025900 Bacteria 1166
224 Ga0207688_10034076 3300025901 Bacteria 2818
225 Ga0207680_10145430 3300025903 Bacteria 1575
226 Ga0207680_10319547 3300025903 Bacteria 1085
227 Ga0207647_10200842 3300025904 Bacteria 1153
228 Ga0207685_10067238 3300025905 Bacteria 1440
229 Ga0207685_10136231 3300025905 Bacteria 1096
230 Ga0207699_10028127 3300025906 Bacteria 3121
231 Ga0207699_10031894 3300025906 Bacteria 2963
232 Ga0207707_10014703 3300025912 Bacteria 6821
233 Ga0207707_10057211 3300025912 Bacteria 3394
234 Ga0207707_10176666 3300025912 Bacteria 1865
235 Ga0207707_10314629 3300025912 Bacteria 1352
236 Ga0207695_10117455 3300025913 Bacteria 2632
237 Ga0207695_10119717 3300025913 Bacteria 2602
238 Ga0207695_10150334 3300025913 Bacteria 2268
239 Ga0207695_10310635 3300025913 Bacteria 1467
240 Ga0207671_10122976 3300025914 Bacteria 1985
241 Ga0207671_10407342 3300025914 Bacteria 1082
242 Ga0207671_10407514 3300025914 Bacteria 1081
243 Ga0207671_10575123 3300025914 Bacteria 898
244 Ga0207693_10083933 3300025915 Bacteria 2496
245 Ga0207693_10116277 3300025915 Bacteria 2100
246 Ga0207693_10159435 3300025915 Bacteria 1775
247 Ga0207663_10046369 3300025916 Bacteria 2678
248 Ga0207663_10383236 3300025916 Bacteria 1071
249 Ga0207663_10437369 3300025916 Bacteria 1007
250 Ga0207660_10008250 3300025917 Bacteria 6735
251 Ga0207660_10060220 3300025917 Bacteria 2728
252 Ga0207660_10174352 3300025917 Bacteria 1667
253 Ga0207657_10081542 3300025919 Bacteria 2717
254 Ga0207657_10148768 3300025919 Bacteria 1909
255 Ga0207652_10457691 3300025921 Bacteria 1150
256 Ga0207646_10332735 3300025922 Bacteria 1372
257 Ga0207681_10524860 3300025923 Bacteria 972
258 Ga0207694_10030817 3300025924 Bacteria 4094
259 Ga0207694_10159698 3300025924 Bacteria 1820
260 Ga0207694_10236215 3300025924 Bacteria 1493
261 Ga0207650_10039723 3300025925 Bacteria 3439
262 Ga0207650_10687629 3300025925 Bacteria 864
263 Ga0207700_10022160 3300025928 Bacteria 4352
264 Ga0207700_10052321 3300025928 Bacteria 3053
265 Ga0207664_10052674 3300025929 Bacteria 3219
266 Ga0207664_10134250 3300025929 Bacteria 2086
267 Ga0207644_10275592 3300025931 Bacteria 1349
268 Ga0207706_10331773 3300025933 Bacteria 1323
269 Ga0207709_10248879 3300025935 Bacteria 1297
270 Ga0207669_10284285 3300025937 Bacteria 1249
271 Ga0207665_10001583 3300025939 Bacteria 15351
272 Ga0207711_10150513 3300025941 Bacteria 2099
273 Ga0207711_10608139 3300025941 Bacteria 1020
274 Ga0207661_10391212 3300025944 Bacteria 1259
275 Ga0207667_10265170 3300025949 Bacteria 1756
276 Ga0207667_10335920 3300025949 Bacteria 1542
277 Ga0207667_10336315 3300025949 Bacteria 1541
278 Ga0207667_10533378 3300025949 Bacteria 1188
279 Ga0207668_10329581 3300025972 Bacteria 1270
280 Ga0207668_10705264 3300025972 Bacteria 887
281 Ga0207640_10194183 3300025981 Bacteria 1532
282 Ga0207658_10253221 3300025986 Bacteria 1497
283 Ga0207677_10191226 3300026023 Bacteria 1619
284 Ga0207639_10140392 3300026041 Bacteria 2012
285 Ga0207639_10157319 3300026041 Bacteria 1911
286 Ga0207639_10276002 3300026041 Bacteria 1476
287 Ga0207639_10276975 3300026041 Bacteria 1474
288 Ga0207639_10332409 3300026041 Bacteria 1352
289 Ga0207678_10003569 3300026067 Bacteria 13988
290 Ga0207678_10049928 3300026067 Bacteria 3615
291 Ga0207678_10418767 3300026067 Bacteria 1161
292 Ga0207678_10597085 3300026067 Bacteria 968
293 Ga0207708_10197022 3300026075 Bacteria 1606
294 Ga0207702_10031931 3300026078 Bacteria 4392
295 Ga0207702_10267484 3300026078 Bacteria 1612
296 Ga0207702_10431405 3300026078 Bacteria 1276
297 Ga0207675_100161084 3300026118 Bacteria 2140
298 Ga0207698_10292882 3300026142 Bacteria 1511
299 Ga0207698_10554133 3300026142 Bacteria 1127
300 Ga0207698_10907681 3300026142 Bacteria 888
301 Ga0209389_1000121 3300027296 Bacteria 70490
302 Ga0209589_1000003 3300027357 Bacteria 629130
303 Ga0209589_1002338 3300027357 Bacteria 32739
304 Ga0209489_100003 3300027361 Bacteria 663105
305 Ga0209489_101475 3300027361 Bacteria 48380
306 Ga0209700_100003 3300027363 Bacteria 663105
307 Ga0209179_1000593 3300027512 Bacteria 3811
308 Ga0209813_10036440 3300027866 Bacteria 1478
309 Ga0209813_10085225 3300027866 Bacteria 1052
310 Ga0268266_10001098 3300028379 Bacteria 33929
311 Ga0268266_10017714 3300028379 Bacteria 6069
312 Ga0268266_10143932 3300028379 Bacteria 2141
313 Ga0268266_10150362 3300028379 Bacteria 2098
314 Ga0268264_10000043 3300028381 Bacteria 371761
315 Ga0268264_10524043 3300028381 Bacteria 1159
316 Ga0265325_10027410 3300031241 Bacteria 3079
317 Ga0265340_10036789 3300031247 Bacteria 2425
318 Ga0265316_10357622 3300031344 Bacteria 1056
319 Ga0307513_10164990 3300031456 Bacteria 2101
320 Ga0307509_10060644 3300031507 Bacteria 3997
321 Ga0307408_100036430 3300031548 Bacteria 3459
322 Ga0307508_10000010 3300031616 Bacteria 255747
323 Ga0265314_10285250 3300031711 Bacteria 932
324 Ga0307516_10042681 3300031730 Bacteria 4497
325 Ga0307413_10506479 3300031824 Bacteria 970
326 Ga0307411_10333882 3300032005 Bacteria 1229
327 Ga0307415_100118119 3300032126 Bacteria 1982
328 Ga0307415_100351195 3300032126 Bacteria 1241
329 Ga0307510_10004213 3300033180 Bacteria 16896
330 Ga0307510_10006119 3300033180 Bacteria 14339
331 Ga0307510_10392259 3300033180 Bacteria 832
332 Ga0315911_1000001 3300033442 Bacteria 1088602
333 Ga0373934_0085641 3300035086 Bacteria 1268
334 Ga0373923_0045006 3300035111 Bacteria 1832
335 Ga0373923_0049016 3300035111 Bacteria 1765
336 Ga0373932_0077068 3300035112 Bacteria 1046
337 Ga0373936_0005311 3300035113 Bacteria 4849
338 Ga0373936_0145773 3300035113 Bacteria 1024
339 Ga0373954_0008335 3300035118 Bacteria 4546
340 Ga0373954_0024129 3300035118 Bacteria 2771
341 Ga0373954_0067608 3300035118 Bacteria 1693
342 Ga0373956_0141693 3300035119 Bacteria 1129
343 Ga0373957_0013029 3300035120 Bacteria 2814
344 Ga0373943_0004918 3300035170 Bacteria 6037
345 Ga0373943_0227007 3300035170 Bacteria 1042
346 Ga0373946_0029192 3300035171 Bacteria 2193
347 Ga0373955_0039717 3300035172 Bacteria 2513
348 Ga0373955_0090334 3300035172 Bacteria 1745
349 Ga0373955_0316442 3300035172 Bacteria 942
350 Ga0373924_0009245 3300035410 Bacteria 3609
351 Ga0373924_0027064 3300035410 Bacteria 2279
352 Ga0373931_0215128 3300035691 Bacteria 1155
353 Ga0373931_0222551 3300035691 Bacteria 1137
354 Ga0373935_0055144 3300035692 Bacteria 2532
355 Ga0373927_0173928 3300035695 Bacteria 1412
356 Ga0373927_0306964 3300035695 Bacteria 1044
357 Ga0373927_0327863 3300035695 Bacteria 1008
358 Ga0373927_0357239 3300035695 Bacteria 963
359 Ga0373933_0001930 3300035724 Bacteria 11963
360 Ga0373933_0017121 3300035724 Bacteria 4063
361 Ga0373933_0054487 3300035724 Bacteria 2397
362 Ga0373947_0033109 3300035725 Bacteria 3049
363 Ga0373947_0082641 3300035725 Bacteria 1991
364 Ga0373947_0209247 3300035725 Bacteria 1279
365 Ga0373937_0127645 3300036401 Bacteria 2373
366 Ga0373937_0157888 3300036401 Bacteria 2126
367 Ga0373937_0711775 3300036401 Bacteria 951
368 Ga0373925_0006009 3300037068 Bacteria 8990
369 Ga0373925_0152585 3300037068 Bacteria 1815
370 Ga0395899_0312624 3300037312 Bacteria 1060
371 Ga0395900_0017864 3300037418 Bacteria 7240
372 Ga0395900_0273815 3300037418 Bacteria 1682
373 Ga0395898_0032284 3300037466 Bacteria 5226
374 Ga0395898_0677965 3300037466 Bacteria 973
375 Ga0395905_0007051 3300037471 Bacteria 11231
376 Ga0395905_0250301 3300037471 Bacteria 1655
377 Ga0436364_0991714 3300037853 Bacteria 3338
378 Ga0395901_0129842 3300038443 Bacteria 2648
379 Ga0395901_0377199 3300038443 Bacteria 1460
380 Ga0436365_0866542 3300039437 Bacteria 750
381 Ga0436365_1316672 3300039437 Bacteria 18310
382 Ga0436365_1470075 3300039437 Bacteria 6471
383 Ga0436365_1510814 3300039437 Bacteria 3411
384 Ga0436360_0167622 3300039438 Bacteria 1607
385 Ga0436363_1463179 3300039450 Bacteria 2610
386 Ga0451802_0675589 3300041460 Bacteria 1221
387 Ga0451806_367894 3300041462 Bacteria 3028
388 Ga0451851_0219306 3300041507 Bacteria 1255
389 Ga0451853_3503921 3300041512 Bacteria 1138
390 Ga0451853_3945261 3300041512 Bacteria 1058
391 Ga0466972_0054449 3300044658 Bacteria 1924
392 Ga0466965_0009353 3300044683 Bacteria 4553
393 Ga0466963_0243643 3300044694 Bacteria 1261
394 Ga0466964_0054250 3300044706 Bacteria 1652
395 Ga0466971_0043439 3300044719 Bacteria 2020
396 Ga0466960_0095929 3300044901 Bacteria 1519
397 Ga0466967_0029515 3300045976 Bacteria 4590
398 Ga0466967_0129258 3300045976 Bacteria 2343
399 Ga0495592_0073199 3300046454 Bacteria 2492
400 Ga0495592_0095701 3300046454 Bacteria 2123
401 Ga0495603_0000729 3300046455 Bacteria 18686
402 Ga0495603_0028681 3300046455 Bacteria 3358
403 Ga0495603_0032720 3300046455 Bacteria 3128
404 Ga0495603_0064072 3300046455 Bacteria 2168
405 Ga0495603_0197961 3300046455 Bacteria 1161
406 Ga0495629_0001683 3300046459 Bacteria 17362
407 Ga0495629_0003206 3300046459 Bacteria 12375
408 Ga0495629_0435858 3300046459 Bacteria 888
409 Ga0495638_0012724 3300046460 Bacteria 5754
410 Ga0495638_0152144 3300046460 Bacteria 1341
411 Ga0495641_0010184 3300046461 Bacteria 5486
412 Ga0495651_0013636 3300046462 Bacteria 6281
413 Ga0495653_0181243 3300046463 Bacteria 1445
414 Ga0495653_0192112 3300046463 Bacteria 1392
415 Ga0495580_0001179 3300046472 Bacteria 22977
416 Ga0495580_0025532 3300046472 Bacteria 4318
417 Ga0495580_0067039 3300046472 Bacteria 2512
418 Ga0495582_0011077 3300046473 Bacteria 4965
419 Ga0495639_0000381 3300046475 Bacteria 21245
420 Ga0495639_0029667 3300046475 Bacteria 2428
421 Ga0495639_0060299 3300046475 Bacteria 1738
422 Ga0495662_0001877 3300046476 Bacteria 10527
423 Ga0495662_0032221 3300046476 Bacteria 2532
424 Ga0495664_0008790 3300046477 Bacteria 5642
425 Ga0495664_0015631 3300046477 Bacteria 4316
426 Ga0495664_0029939 3300046477 Bacteria 3186
427 Ga0495584_0078243 3300046491 Bacteria 1664
428 Ga0495584_0124241 3300046491 Bacteria 1307
429 Ga0495584_0158115 3300046491 Bacteria 1152
430 Ga0495585_0035910 3300046492 Bacteria 2798
431 Ga0495594_0004862 3300046499 Bacteria 6916
432 Ga0495583_0089310 3300046506 Bacteria 1329
433 Ga0495606_0011059 3300046507 Bacteria 7403
434 Ga0495610_0139898 3300046512 Bacteria 1043
435 Ga0495616_0169145 3300046513 Bacteria 978
436 Ga0495618_0031969 3300046514 Bacteria 3296
437 Ga0495618_0059713 3300046514 Bacteria 2417
438 Ga0495620_0139887 3300046515 Bacteria 947
439 Ga0495628_0082675 3300046516 Bacteria 2494
440 Ga0495630_0036156 3300046517 Bacteria 3692
441 Ga0495630_0040192 3300046517 Bacteria 3495
442 Ga0495632_0087111 3300046519 Bacteria 1485
443 Ga0495637_0078692 3300046520 Bacteria 1318
444 Ga0495643_0010985 3300046522 Bacteria 5540
445 Ga0495643_0074345 3300046522 Bacteria 1780
446 Ga0495648_0035952 3300046524 Bacteria 3204
447 Ga0495642_0046160 3300046528 Bacteria 1782
448 Ga0495652_0143134 3300046529 Bacteria 1878
449 Ga0495652_0297688 3300046529 Bacteria 1174
450 Ga0495665_0001300 3300046531 Bacteria 13310
451 Ga0495665_0069349 3300046531 Bacteria 1858
452 Ga0495640_0089610 3300046533 Bacteria 2031
453 Ga0495586_0079732 3300046535 Bacteria 1798
454 Ga0495586_0353052 3300046535 Bacteria 845
455 Ga0495587_0003875 3300046536 Bacteria 9926
456 Ga0495598_0095937 3300046537 Bacteria 974
457 Ga0495645_0010706 3300046543 Bacteria 6440
458 Ga0495645_0249765 3300046543 Bacteria 1179
459 Ga0495622_0000825 3300046557 Bacteria 17144
460 Ga0495633_0053666 3300046558 Bacteria 1897
461 Ga0495633_0060589 3300046558 Bacteria 1773
462 Ga0495667_0016472 3300046559 Bacteria 4994
463 Ga0495667_0042567 3300046559 Bacteria 3012
464 Ga0495667_0068796 3300046559 Bacteria 2311
465 Ga0495656_0012999 3300046615 Bacteria 3086
466 Ga0495656_0108522 3300046615 Bacteria 1294
467 Ga0495668_0015342 3300046616 Bacteria 4477
468 Ga0495668_0258780 3300046616 Bacteria 953
469 Ga0495634_0000324 3300046642 Bacteria 46211
470 Ga0495634_0067958 3300046642 Bacteria 2355
471 Ga0495634_0234319 3300046642 Bacteria 1128
472 Ga0495625_0101657 3300046660 Bacteria 1974
473 Ga0495625_0165881 3300046660 Bacteria 1477
474 Ga0495635_0005678 3300046663 Bacteria 8690
475 Ga0495661_0173277 3300046665 Bacteria 1149
476 Ga0495588_0002137 3300046674 Bacteria 8476
477 Ga0495657_0081716 3300046675 Bacteria 2089
478 Ga0495599_0167112 3300046678 Bacteria 1358
479 Ga0495623_0078500 3300046679 Bacteria 2046
480 Ga0495646_0056473 3300046680 Bacteria 2354
481 Ga0495646_0124489 3300046680 Bacteria 1456
482 Ga0495647_0001889 3300046681 Bacteria 6520
483 Ga0495658_0001003 3300046683 Bacteria 14903
484 Ga0495658_0042101 3300046683 Bacteria 2548
485 Ga0495669_0005527 3300046684 Bacteria 5272
486 Ga0495669_0195408 3300046684 Bacteria 966
487 Ga0495613_0004628 3300046689 Bacteria 10328
488 Ga0495613_0063204 3300046689 Bacteria 2709
489 Ga0495613_0188790 3300046689 Bacteria 1457
490 Ga0495613_0337798 3300046689 Bacteria 1037
491 Ga0495624_0024440 3300046690 Bacteria 3975
492 Ga0495624_0049143 3300046690 Bacteria 2675
493 Ga0495649_0091495 3300046694 Bacteria 1621
494 Ga0495600_0092491 3300046809 Bacteria 1972
495 Ga0495600_0097504 3300046809 Bacteria 1916
496 Ga0495581_0000160 3300047315 Bacteria 30015
497 Ga0495581_0058149 3300047315 Bacteria 2232
498 Ga0495581_0182858 3300047315 Bacteria 1226
499 Ga0495604_0020017 3300047317 Bacteria 5348
500 Ga0495604_0103334 3300047317 Bacteria 2090
501 Ga0495636_0122912 3300047318 Bacteria 1149
502 Ga0495674_0008261 3300047319 Bacteria 9932
503 Ga0495674_0211502 3300047319 Bacteria 1606
504 Ga0495674_0220141 3300047319 Bacteria 1569
505 Ga0495672_0038451 3300047320 Bacteria 2919
506 Ga0495676_0023467 3300047321 Bacteria 5356
507 Ga0495676_0041304 3300047321 Bacteria 3798
508 Ga0495676_0170119 3300047321 Bacteria 1534
509 Ga0495676_0185606 3300047321 Bacteria 1454
510 Ga0495676_0435507 3300047321 Bacteria 866
511 Ga0495683_0050687 3300047323 Bacteria 2077
512 Ga0495687_004391 3300047443 Bacteria 9565
513 Ga0495675_0015095 3300047444 Bacteria 4884
514 Ga0495673_0128670 3300047469 Bacteria 997
515 Ga0495684_0044993 3300047471 Bacteria 3378
516 Ga0495684_0054813 3300047471 Bacteria 3041
517 Ga0495593_0000241 3300047673 Bacteria 29466
518 Ga0495593_0027366 3300047673 Bacteria 3140
519 Ga0495602_0044100 3300048088 Bacteria 4049
520 Ga0495614_0072697 3300048089 Bacteria 1484
521 Ga0495614_0184001 3300048089 Bacteria 941
522 Ga0495615_0025646 3300048090 Bacteria 1370
523 Ga0496100_0349753 3300048903 Bacteria 1116
524 Ga0496101_0098205 3300048904 Bacteria 2188
525 Ga0496101_0104458 3300048904 Bacteria 2125
526 Ga0496101_0845653 3300048904 Bacteria 721
527 Ga0496102_0008512 3300048905 Bacteria 8794
528 Ga0496102_0249017 3300048905 Bacteria 1675
529 Ga0496102_0315931 3300048905 Bacteria 1472
530 Ga0496102_0545936 3300048905 Bacteria 1082
531 Ga0496103_0194678 3300048906 Bacteria 1303
532 Ga0496104_0071617 3300048907 Bacteria 3296
533 Ga0496105_0003937 3300048908 Bacteria 11104
534 Ga0496105_0270833 3300048908 Bacteria 1371
535 Ga0496105_0537367 3300048908 Bacteria 914
536 Ga0496106_0003031 3300048909 Bacteria 12509
537 Ga0496107_0295252 3300048910 Bacteria 1206
538 Ga0496107_0617756 3300048910 Bacteria 800
539 Ga0496108_0034979 3300048911 Bacteria 4174
540 Ga0496108_0701988 3300048911 Bacteria 877
541 Ga0496109_0001522 3300048912 Bacteria 19299
542 Ga0496109_0021025 3300048912 Bacteria 5770
543 Ga0496109_0387729 3300048912 Bacteria 1320
544 Ga0496109_0410729 3300048912 Bacteria 1279
545 Ga0496110_0127744 3300048913 Bacteria 2294
546 Ga0496110_0142177 3300048913 Bacteria 2169
547 Ga0496110_0697802 3300048913 Bacteria 916
548 Ga0496111_0307696 3300048914 Bacteria 1174
549 Ga0496112_0000021 3300048915 Bacteria 156561
550 Ga0496112_0020030 3300048915 Bacteria 6333
551 Ga0496112_0122215 3300048915 Bacteria 2574
552 Ga0496112_0175130 3300048915 Bacteria 2110
553 Ga0496112_0659526 3300048915 Bacteria 976
554 Ga0496113_0073481 3300048916 Bacteria 2605
555 Ga0496114_0242587 3300048917 Bacteria 1585
556 Ga0496114_0257887 3300048917 Bacteria 1535
557 Ga0496115_0090778 3300048918 Bacteria 2496
558 Ga0496115_0093708 3300048918 Bacteria 2456
559 Ga0496115_0261510 3300048918 Bacteria 1423
560 Ga0496116_0038168 3300048919 Bacteria 3339
561 Ga0496117_0009110 3300048920 Bacteria 9325
562 Ga0496117_0083106 3300048920 Bacteria 2095
563 Ga0496118_0006337 3300048921 Bacteria 13064
564 Ga0496118_0070194 3300048921 Bacteria 2531
565 Ga0496119_0009371 3300048922 Bacteria 8418
566 Ga0496120_0004023 3300048923 Bacteria 12746
567 Ga0496121_0000183 3300048924 Bacteria 139168
568 Ga0496121_0035667 3300048924 Bacteria 4451
569 Ga0496121_0078095 3300048924 Bacteria 2633
570 Ga0496121_0091317 3300048924 Bacteria 2378
571 Ga0496121_0239551 3300048924 Bacteria 1265
572 Ga0496122_0022521 3300048925 Bacteria 5596
573 Ga0496123_0207705 3300048926 Bacteria 998
574 Ga0496124_0002761 3300048927 Bacteria 22343
575 Ga0496124_0129547 3300048927 Bacteria 2006
576 Ga0496124_0229989 3300048927 Bacteria 1387
577 Ga0496124_0246901 3300048927 Bacteria 1323
578 Ga0496125_0000877 3300048928 Bacteria 47865
579 Ga0496125_0042347 3300048928 Bacteria 3880
580 Ga0496126_0026033 3300048929 Bacteria 5617
581 Ga0496126_0034207 3300048929 Bacteria 4775
582 Ga0496126_0045660 3300048929 Bacteria 4024
583 Ga0496126_0062075 3300048929 Bacteria 3354
584 Ga0496126_0071934 3300048929 Bacteria 3077
585 Ga0496126_0073342 3300048929 Bacteria 3043
586 Ga0496126_0073979 3300048929 Bacteria 3027
587 Ga0496126_0217986 3300048929 Bacteria 1604
588 Ga0496126_0349317 3300048929 Bacteria 1210
589 Ga0495682_0110191 3300049460 Bacteria 986
590 Ga0501031_0001053 3300049568 Bacteria 16721
591 Ga0501032_0000668 3300049569 Bacteria 27884
592 Ga0501032_0038828 3300049569 Bacteria 3240
593 Ga0501033_0000619 3300049570 Bacteria 32912
594 Ga0501033_0023712 3300049570 Bacteria 4627
595 Ga0501033_0047661 3300049570 Bacteria 3185
596 Ga0501033_0119351 3300049570 Bacteria 1915
597 Ga0501033_0419811 3300049570 Bacteria 931
598 Ga0501034_0000232 3300049571 Bacteria 103995
599 Ga0501036_0000371 3300049572 Bacteria 31608
600 Ga0501036_0172083 3300049572 Bacteria 1824
601 Ga0501037_0000303 3300049573 Bacteria 41763
602 Ga0501038_0000112 3300049574 Bacteria 68326
603 Ga0501038_0119220 3300049574 Bacteria 2178
604 Ga0501038_0429941 3300049574 Bacteria 1018
605 Ga0501039_0000789 3300049575 Bacteria 22789
606 Ga0501039_0134692 3300049575 Bacteria 1939
607 Ga0501039_0143546 3300049575 Bacteria 1876
608 Ga0501042_0021071 3300049578 Bacteria 4540
609 Ga0501043_0000035 3300049579 Bacteria 133200
610 Ga0501043_0096029 3300049579 Bacteria 2330
611 Ga0501043_0317318 3300049579 Bacteria 1188
612 Ga0501046_0022126 3300049580 Bacteria 5239
613 Ga0501046_0049382 3300049580 Bacteria 3328
614 Ga0501046_0055323 3300049580 Bacteria 3119
615 Ga0501046_0193513 3300049580 Bacteria 1516
616 Ga0501047_0000085 3300049581 Bacteria 118617
617 Ga0501047_0031163 3300049581 Bacteria 5143
618 Ga0501047_0045461 3300049581 Bacteria 4246
619 Ga0501047_0601769 3300049581 Bacteria 921
620 Ga0501048_0000061 3300049582 Bacteria 54555
621 Ga0501048_0279425 3300049582 Bacteria 1187
622 Ga0501067_0002211 3300049583 Bacteria 10755
623 Ga0501067_0065732 3300049583 Bacteria 2008
624 Ga0501067_0074997 3300049583 Bacteria 1874
625 Ga0501068_0004923 3300049584 Bacteria 7276
626 Ga0501069_0021376 3300049585 Bacteria 3510
627 Ga0501070_0000272 3300049586 Bacteria 48952
628 Ga0501070_0471742 3300049586 Bacteria 1010
629 Ga0501071_0051827 3300049587 Bacteria 2958
630 Ga0501071_0401422 3300049587 Bacteria 1047
631 Ga0501072_0006309 3300049588 Bacteria 9028
632 Ga0501073_0000026 3300049589 Bacteria 124358
633 Ga0501073_0056283 3300049589 Bacteria 2751
634 Ga0501074_0000017 3300049590 Bacteria 76626
635 Ga0501074_0055970 3300049590 Bacteria 2842
636 Ga0501079_0002647 3300049741 Bacteria 13021
637 Ga0501080_0062421 3300049742 Bacteria 3468
638 Ga0501083_0000638 3300049744 Bacteria 22694
639 Ga0501035_0000548 3300049822 Bacteria 41814
640 Ga0501035_0054958 3300049822 Bacteria 3555
641 Ga0501035_0103647 3300049822 Bacteria 2495
642 Ga0501035_0179739 3300049822 Bacteria 1823
643 Ga0501044_0000051 3300049823 Bacteria 143658
644 Ga0501044_0039498 3300049823 Bacteria 4923
645 Ga0501044_0055169 3300049823 Bacteria 4082
646 nmdc:mga03683_2975_c1 3300050489 Bacteria 5362
647 nmdc:mga03n38_103522_c1 3300050490 Bacteria 1376
648 nmdc:mga03n38_12912_c1 3300050490 Bacteria 3159
649 nmdc:mga03n38_180288_c1 3300050490 Bacteria 1082
650 nmdc:mga03n38_18704_c1 3300050490 Bacteria 2739
651 nmdc:mga00v17_296813_c1 3300050491 Bacteria 1049
652 nmdc:mga00v17_63272_c1 3300050491 Bacteria 2278
653 nmdc:mga0yw44_398702_c1 3300050492 Bacteria 930
654 nmdc:mga0yw44_48221_c1 3300050492 Bacteria 2568
655 nmdc:mga0yw44_504413_c1 3300050492 Bacteria 821
656 nmdc:mga0yw44_83360_c1 3300050492 Bacteria 2008
657 nmdc:mga0k408_239432_c1 3300050493 Bacteria 1083
658 nmdc:mga0k408_9279_c1 3300050493 Bacteria 5301
659 nmdc:mga06z11_116980_c1 3300050494 Bacteria 1483
660 nmdc:mga06z11_14996_c1 3300050494 Bacteria 3449
661 nmdc:mga06z11_32574_c1 3300050494 Bacteria 2543
662 nmdc:mga04h51_101074_c1 3300050495 Bacteria 1051
663 nmdc:mga04h51_82482_c1 3300050495 Bacteria 1144
664 nmdc:mga07m45_19502_c2 3300050496 Bacteria 2221
665 nmdc:mga0n895_32103_c1 3300050512 Bacteria 5037
666 nmdc:mga0n895_67036_c1 3300050512 Bacteria 3554
667 nmdc:mga0rr50_433239_c1 3300050513 Bacteria 1113
668 nmdc:mga0sz30_61424_c1 3300050516 Bacteria 1606
669 Ga0495601_0035341 3300053077 Bacteria 3118
670 Ga0495601_0078141 3300053077 Bacteria 2120
671 Ga0495601_0095765 3300053077 Bacteria 1914
672 Ga0495612_0021249 3300053078 Bacteria 2604
673 Ga0495619_0188485 3300053085 Bacteria 1427
674 Ga0495619_0551691 3300053085 Bacteria 790
675 Ga0500578_0125302 3300053086 Bacteria 1613
676 Ga0500578_0146850 3300053086 Bacteria 1471
677 Ga0500643_000015 3300053087 Bacteria 310312
678 Ga0500647_0089674 3300053091 Bacteria 1472
679 Ga0500583_0054905 3300053092 Bacteria 1861
680 Ga0500651_0078337 3300053093 Bacteria 2050
681 Ga0500566_0000028 3300053094 Bacteria 75589
682 Ga0500566_0000988 3300053094 Bacteria 16379
683 Ga0500566_0005062 3300053094 Bacteria 7858
684 Ga0500566_0157997 3300053094 Bacteria 1185
685 Ga0500640_000581 3300053095 Bacteria 9411
686 Ga0500650_0088991 3300053098 Bacteria 1445
687 Ga0500555_000899 3300053103 Bacteria 10566
688 Ga0500557_000022 3300053105 Bacteria 88506
689 Ga0500562_028396 3300053108 Bacteria 1470
690 Ga0500572_000269 3300053111 Bacteria 18807
691 Ga0500591_013572 3300053115 Bacteria 3902
692 Ga0500595_000652 3300053119 Bacteria 20859
693 Ga0500595_004516 3300053119 Bacteria 6229
694 Ga0500595_013151 3300053119 Bacteria 3175
695 Ga0500614_000118 3300053123 Bacteria 18968
696 Ga0500642_0000060 3300053130 Bacteria 64536
697 Ga0500642_0130489 3300053130 Bacteria 1177
698 Ga0500655_017516 3300053133 Bacteria 1326
699 Ga0500559_0002964 3300053136 Bacteria 8527
700 Ga0500559_0014416 3300053136 Bacteria 3340
701 Ga0500559_0057837 3300053136 Bacteria 1723
702 Ga0500568_0024464 3300053139 Bacteria 2557
703 Ga0500573_0073398 3300053140 Bacteria 1949
704 Ga0500577_0041110 3300053142 Bacteria 1685
705 Ga0500589_176028 3300053147 Bacteria 845
706 Ga0500603_000232 3300053150 Bacteria 14579
707 Ga0500603_091129 3300053150 Bacteria 895
708 Ga0500616_0024278 3300053153 Bacteria 3371
709 Ga0500624_000625 3300053157 Bacteria 9453
710 Ga0500634_0140001 3300053161 Bacteria 1147
711 Ga0500639_000001 3300053163 Bacteria 244795
712 Ga0500637_0000104 3300053178 Bacteria 30138
713 Ga0500637_0152982 3300053178 Bacteria 1332
714 Ga0500625_000333 3300053729 Bacteria 11823
715 Ga0500645_008971 3300053730 Bacteria 3380
716 Ga0500609_026835 3300053731 Bacteria 789
717 Ga0500596_000195 3300053735 Bacteria 9974
718 Ga0500599_016819 3300053736 Bacteria 1012
719 Ga0500601_000662 3300053737 Bacteria 4722
720 Ga0501084_0012583 3300054114 Bacteria 7011
721 Ga0500661_000109 3300055283 Bacteria 13318
722 Ga0501082_0003691 3300060353 Bacteria 13369
723 2507508647 2507262055 Bacteria 8048963
724 2508542742 2508501009 Bacteria 7784016
725 2508691499 2508501042 Bacteria 8719808
726 2509150834 2508501128 Bacteria 8613869
727 2511397779 2511231028 Bacteria 8046582
728 2513623097 2513237092 Bacteria 8341956
729 2513645902 2513237095 Bacteria 8976980
730 2513654689 2513237096 Bacteria 8722461
731 2513692476 2513237101 Bacteria 7952346
732 2513705210 2513237102 Bacteria 7703324
733 2513719509 2513237104 Bacteria 10034502
734 2513855900 2513237137 Bacteria 9558895
735 2513872709 2513237139 Bacteria 8737671
736 2513915131 2513237145 Bacteria 8979722
737 2514011914 2513237161 Bacteria 8871253
738 2515628301 2515154112 Bacteria 8294334
739 2517892426 2517572143 Bacteria 9484767
740 2524471038 2524023210 Bacteria 9029266
741 2528851154 2528768022 Bacteria 10457665
742 2617348954 2617270735 Bacteria 9163226
743 2617375829 2617270741 Bacteria 8201522
744 2745074955 2744054633 Bacteria 8678936
745 2793062457 2791355196 Bacteria 7323613
746 2793072093 2791355197 Bacteria 8420563
747 2793080936
748 2805915393 2802429603 Bacteria 8777136
749 2818238970 2816332527 Bacteria 8933356
750 2824617775 2824609381 Bacteria 8672835
751 2824626207 2824617872 Bacteria 8814715
752 2824634894 2824626560 Bacteria 8813858
753 2824643179 2824635225 Bacteria 8785348
754 2824651362 2824644064 Bacteria 8743947
755 2824671067 2824661429 Bacteria 9877870
756 2824679407 2824671348 Bacteria 8369588
757 2824687767 2824679649 Bacteria 8248951
758 2824696055 2824687955 Bacteria 8360029
759 2824701014 2824696289 Bacteria 8335049
760 2824719511 2824714736 Bacteria 8717648
761 2824729931 2824723954 Bacteria 8758240
762 2824740730 2824732956 Bacteria 7810675
763 2824753790 2824746037 Bacteria 7911610
764 2824781345 2824773399 Bacteria 8360218
765 2828309882 2828305725 Bacteria 4916900
766 2838123814 2838122688 Bacteria 8803140
767 2841944057 2841941048 Bacteria 8688029
768 2841949914 2841949485 Bacteria 8680857
769 2841966332 2841966195 Bacteria 8673214
770 2841975066 2841974524 Bacteria 8931498
771 2841983362 2841983080 Bacteria 8395090
772 2842039125 2842038055 Bacteria 8002051
773 2842047928 2842045827 Bacteria 8006841
774 2847946505 2847939898 Bacteria 8606328
775 2849079369 2849076700 Bacteria 7039503
776 2851184694 2851182111 Bacteria 6047226
777 2852394213 2852387548 Bacteria 8025568
778 2857514372 2857509624 Bacteria 7472071
779 2874591547 2874590934 Bacteria 8299676
780 2874605145 2874604998 Bacteria 7834745
781 2874619588 2874612657 Bacteria 8252029
782 2874627158 2874620515 Bacteria 8290088
783 2874631790 2874628541 Bacteria 8630250
784 2874648935 2874645413 Bacteria 8214782
785 2876771962 2876771140 Bacteria 8287509
786 2876822093 2876818435 Bacteria 8274608
787 2879075606 2879074833 Bacteria 8279565
788 2879103300 2879099564 Bacteria 10442239
789 2879135486 2879127579 Bacteria 8294491
790 2879143095 2879142872 Bacteria 8267021
791 2881366994 2881364244 Bacteria 7710352
792 2881671117 2881665667 Bacteria 8175609
793 2885370528 2885366525 Bacteria 8326213
794 2885390705 2885383462 Bacteria 9473874
795 2888384003 2888378607 Bacteria 9652610
796 2888393852 2888388044 Bacteria 7304136
797 2889039886 2889033259 Bacteria 9099371
798 2903749462 2903748898 Bacteria 9972761
799 2903777971 2903768456 Bacteria 9749579
800 2904669859 2904666416 Bacteria 8226587
801 2906618589
802 2906628612 2906626472 Bacteria 8826946
803 2906638754 2906635258 Bacteria 8601019
804 2906651675 2906643746 Bacteria 8722424
805 2906666411 2906660503 Bacteria 8595048
806 2908780115 2908775508 Bacteria 8092255
807 2922374326
808 2922396368 2922393267 Bacteria 8285685
809 2922430248
810 2929618000 2929615660 Bacteria 9193770
811 2929627681 2929624759 Bacteria 9339455
812 2932788220 2932784394 Bacteria 9704911
813 2932797531 2932794094 Bacteria 7915132
814 2932802846 2932801729 Bacteria 7987968
815 2932810630 2932809354 Bacteria 9135765
816 2932821224 2932818245 Bacteria 9955613
817 2932831217 2932828146 Bacteria 9745859
818 2933579928 2933577622 Bacteria 9116884
819 2935608823 2935608549 Bacteria 8203142
820 2935622987 2935616580 Bacteria 9032984
821 2935631694 2935630451 Bacteria 8169952
822 2935642347 2935638405 Bacteria 10015038
823 2935668350 2935665750 Bacteria 9571747
824 2935680483 2935675223 Bacteria 9928132
825 2935692847 2935684952 Bacteria 9590419
826 2935701016 2935694250 Bacteria 9291695
827 2935706205 2935703347 Bacteria 10242284
828 2935721428 2935713505 Bacteria 9608509
829 2935730346 2935722832 Bacteria 9608746
830 2935740359 2935732158 Bacteria 9706831
831 2935749623 2935741537 Bacteria 9707219
832 2935759064 2935750917 Bacteria 9590372
833 2935762606 2935760218 Bacteria 9817913
834 2935773237 2935769743 Bacteria 7878163
835 2935778483 2935777560 Bacteria 8077691
836 2935790398 2935785616 Bacteria 7962367
837 2935798127 2935793552 Bacteria 8012592
838 2935803205 2935801545 Bacteria 9301974
839 2935814525 2935810662 Bacteria 9401221
840 2935821983 2935819856 Bacteria 8261050
841 2935831663 2935827899 Bacteria 10038562
842 2935838517 2935837841 Bacteria 9454360
843 2935847565 2935847175 Bacteria 8228321
844 2935861235 2935855204 Bacteria 9035059
845 2935865773 2935864058 Bacteria 9784707
846 2935878274 2935873716 Bacteria 9632195
847 2935885188 2935883170 Bacteria 7964738
848 2935909168 2935908558 Bacteria 8568796
849 2935919889 2935916978 Bacteria 9113783
850 2935926258 2935926038 Bacteria 8601059
851 2935934708 2935934488 Bacteria 8602579
852 2935943158 2935942939 Bacteria 8599779
853 2935951596 2935951376 Bacteria 8602333
854 2935966428 2935959822 Bacteria 7869783
855 2935967721 2935967501 Bacteria 8603075
856 2935977079 2935975950 Bacteria 8347125
857 2935988233 2935984226 Bacteria 8302647
858 2935994587 2935992306 Bacteria 9802711
859 2936007613 2936002035 Bacteria 9362176
860 2936040082 2936037263 Bacteria 9446081
861 2940564931 2940556831 Bacteria 9590747
862 2941511488 2941507105 Bacteria 8166816
863 2941519189 2941515067 Bacteria 8166720
864 2941526231 2941523033 Bacteria 8169134
865 2941538815 2941538514 Bacteria 9402094
866 3005480178 3005474847 Bacteria 9259049
867 3005487283 3005483717 Bacteria 7877331
868 3005510277 3005506211 Bacteria 6943378
869 3005591071 3005587118 Bacteria 7794411
870 3005714847 3005710791 Bacteria 7622528
871 3005722275 3005718088 Bacteria 8283608
872 8006929950 8006926726 Bacteria 6749210
873 8006998779 8006994254 Bacteria 8309700
874 8016522404 8016511872 Bacteria 9921665
875 8016534888 8016530956 Bacteria 8155261
876 8016548099 8016539877 Bacteria 8155419
877 8016554028 8016548790 Bacteria 8155074
878 8016562402 8016557553 Bacteria 8154380
879 8016573233 8016566248 Bacteria 8158151
880 8016577377 8016575299 Bacteria 8154085
881 8016600202 8016595262 Bacteria 8149947
882 8016610550 8016603502 Bacteria 8731218
883 8016626607 8016622563 Bacteria 7999408
884 8017063156 8017057580 Bacteria 10023680
885 8019534648 8019530166 Bacteria 8155624
886 8019544823 8019538911 Bacteria 7872763
887 8019553714 8019547302 Bacteria 7996444
888 8019556789 8019555841 Bacteria 9642137
889 8019568518 8019565922 Bacteria 9639779
890 8019582590 8019576017 Bacteria 10049540
891 8019590381 8019586578 Bacteria 10212056
892 8019600973 8019597564 Bacteria 10041141
893 8019617580 8019608314 Bacteria 10042931
894 8019628076 8019619141 Bacteria 9218857
895 8019645196 8019638758 Bacteria 9062356
896 8019662424 8019659431 Bacteria 8577854
897 8019671922 8019668869 Bacteria 8791617
898 8019684170 8019678201 Bacteria 8863603
899 8019690010 8019687851 Bacteria 8712826
900 8054007361 8054002106 Bacteria 7987183
901 8055746411 8055742211 Bacteria 9226248
902 8056686638 8056681323 Bacteria 8472857
903 8056693570 8056689827 Bacteria 6712655
904 8057579655 8057575449 Bacteria 7367519
905 Ga0436362_1173705
906 JGI25156J39149_1002491
907 JGI25154J39366_1000013
908 JGI25157J39369_1002059
909 JGI25406J46586_10038176
910 JGI25153J46596_10001920
911 JGI25153J46596_10002312
912 JGI25153J46596_10017224
913 JGI25160J50197_1000631
914 JGI25160J50197_1011095
915 JGI25404J52841_10004693
916 JGI25404J52841_10005665
917 JGI25404J52841_10006333
918 JGI25404J52841_10009379
919 Ga0055543_1001288
920 Ga0065165_1000844
921 Ga0065165_1002117
922 Ga0065165_1034331
923 Ga0070683_100126208
924 Ga0070670_100857974
925 Ga0068869_100177424
926 Ga0070680_100036288
927 Ga0070680_100064055
928 Ga0070680_100246414
929 Ga0070682_100080180
930 Ga0070682_100185509
931 Ga0068868_100267074
932 Ga0070668_100140649
933 Ga0070668_100327741
934 Ga0070671_100081966
935 Ga0070671_100198395
936 Ga0070674_100513901
937 Ga0070667_100328787
938 Ga0070709_10000943
939 Ga0070709_10025859
940 Ga0070714_100030050
941 Ga0070714_100351354
942 Ga0070713_100040544
943 Ga0070713_100113099
944 Ga0070710_10009412
945 Ga0070710_10040690
946 Ga0070710_10113435
947 Ga0070711_100023513
948 Ga0070711_100059522
949 Ga0070711_100131823
950 Ga0070711_100145658
951 Ga0070708_100262255
952 Ga0070663_100004463
953 Ga0070663_100012305
954 Ga0070663_100029168
955 Ga0070663_100057859
956 Ga0070678_100043979
957 Ga0070678_100304889
958 Ga0070678_100377632
959 Ga0070662_100493385
960 Ga0070681_10063273
961 Ga0070681_10069007
962 Ga0070681_10076578
963 Ga0070681_10099623
964 Ga0070706_100028347
965 Ga0070707_100160957
966 Ga0070707_100200939
967 Ga0070698_100159783
968 Ga0070699_100121669
969 Ga0070679_100025804
970 Ga0070679_100259285
971 Ga0070684_100015676
972 Ga0070697_100039465
973 Ga0068853_100093363
974 Ga0068853_100175317
975 Ga0068853_100450923
976 Ga0068853_100625265
977 Ga0068853_100882191
978 Ga0070686_100421597
979 Ga0070665_100060084
980 Ga0070665_100078115
981 Ga0070665_100101926
982 Ga0070665_100166997
983 Ga0070665_100555181
984 Ga0068855_100047191
985 Ga0068855_100047627
986 Ga0068855_100059338
987 Ga0068855_100118158
988 Ga0070664_100861488
989 Ga0068856_100133911
990 Ga0068856_100182705
991 Ga0068856_100543575
992 Ga0068856_100724889
993 Ga0068852_100198691
994 Ga0068852_100260990
995 Ga0068852_100379436
996 Ga0068852_100943691
997 Ga0068859_100143562
998 Ga0068859_100833652
999 Ga0068870_10298658
1000 Ga0068858_100175128
1001 Ga0068858_100362299
1002 Ga0068860_100000589
1003 Ga0068860_100023488
1004 Ga0068860_100082950
1005 Ga0068860_100518562
1006 Ga0068862_100586181
1007 Ga0081455_10009042
1008 Ga0081455_10017212
1009 Ga0081455_10018811
1010 Ga0081455_10131983
1011 Ga0081538_10036981
1012 Ga0081540_1003394
1013 Ga0081540_1020867
1014 Ga0081540_1021640
1015 Ga0081540_1025247
1016 Ga0081540_1059621
1017 Ga0081539_10001398
1018 Ga0081539_10021340
1019 Ga0081539_10185926
1020 Ga0070717_10001195
1021 Ga0075365_10055262
1022 Ga0075365_10059122
1023 Ga0075365_10094748
1024 Ga0075365_10179316
1025 Ga0075365_10524505
1026 Ga0075368_10000684
1027 Ga0075368_10128489
1028 Ga0075363_100025917
1029 Ga0075363_100027730
1030 Ga0075363_100032563
1031 Ga0075363_100367304
1032 Ga0075364_10028098
1033 Ga0070715_10078082
1034 Ga0070716_100027312
1035 Ga0070712_100090277
1036 Ga0070712_100251741
1037 Ga0075362_10100664
1038 Ga0075367_10005646
1039 Ga0075367_10022133
1040 Ga0075367_10032972
1041 Ga0075369_10013223
1042 Ga0075366_10006129
1043 Ga0075366_10056251
1044 Ga0075366_10230277
1045 Ga0075370_10013795
1046 Ga0075370_10035483
1047 Ga0075370_10052216
1048 Ga0075370_10058296
1049 Ga0075434_100141157
1050 Ga0097620_100143560
1051 Ga0097620_100833682
1052 Ga0099824_1006510
1053 Ga0099824_1012401
1054 Ga0099822_1003886
1055 Ga0105250_10070491
1056 Ga0105240_10047643
1057 Ga0105240_10183132
1058 Ga0105240_10227884
1059 Ga0105240_10305136
1060 Ga0105240_10314687
1061 Ga0105245_10933204
1062 Ga0105247_10004329
1063 Ga0105243_10146926
1064 Ga0105241_10270136
1065 Ga0105248_10004990
1066 Ga0105248_10201894
1067 Ga0105237_10292492
1068 Ga0105237_10375557
1069 Ga0105237_10423898
1070 Ga0105238_10045226
1071 Ga0105238_10070803
1072 Ga0105238_10094882
1073 Ga0105239_10062789
1074 Ga0105239_10082423
1075 Ga0105239_10189322
1076 Ga0105239_10696974
1077 Ga0105239_10858460
1078 Ga0105246_10031542
1079 Ga0157371_10034937
1080 Ga0157370_10007389
1081 Ga0157369_10004890
1082 Ga0157369_10019548
1083 Ga0157369_10212434
1084 Ga0157374_10406121
1085 Ga0157378_10016616
1086 Ga0157378_10303285
1087 Ga0163162_10094634
1088 Ga0163162_10170328
1089 Ga0157372_10084277
1090 Ga0157375_10280668
1091 Ga0163163_10027245
1092 Ga0163163_10048691
1093 Ga0163163_10148889
1094 Ga0157380_10243877
1095 Ga0182006_1096908
1096 Ga0214542_1000001
1097 Ga0214545_1000001
1098 Ga0214543_1000001
1099 Ga0213876_10006878
1100 Ga0213876_10106677
1101 Ga0213875_10029210
1102 Ga0209435_100006
1103 Ga0209563_116775
1104 Ga0209646_1000015
1105 Ga0209026_1000039
1106 Ga0209677_102871
1107 Ga0209759_1000005
1108 Ga0209759_1004195
1109 Ga0209233_1014518
1110 Ga0209673_1056165
1111 Ga0209564_1002211
1112 Ga0209758_1000021
1113 Ga0209758_1001025
1114 Ga0209758_1001133
1115 Ga0209758_1011526
1116 Ga0209758_1056350
1117 Ga0209758_1103550
1118 Ga0209256_1007103
1119 Ga0209256_1053793
1120 Ga0207426_1000479
1121 Ga0207426_1000599
1122 Ga0207426_1042331
1123 Ga0207697_10034517
1124 Ga0207692_10005535
1125 Ga0207692_10185844
1126 Ga0207710_10008563
1127 Ga0207710_10140396
1128 Ga0207688_10034076
1129 Ga0207680_10145430
1130 Ga0207680_10319547
1131 Ga0207647_10200842
1132 Ga0207685_10067238
1133 Ga0207685_10136231
1134 Ga0207699_10028127
1135 Ga0207699_10031894
1136 Ga0207707_10014703
1137 Ga0207707_10057211
1138 Ga0207707_10176666
1139 Ga0207707_10314629
1140 Ga0207695_10117455
1141 Ga0207695_10119717
1142 Ga0207695_10150334
1143 Ga0207695_10310635
1144 Ga0207671_10122976
1145 Ga0207671_10407342
1146 Ga0207671_10407514
1147 Ga0207671_10575123
1148 Ga0207693_10083933
1149 Ga0207693_10116277
1150 Ga0207693_10159435
1151 Ga0207663_10046369
1152 Ga0207663_10383236
1153 Ga0207663_10437369
1154 Ga0207660_10008250
1155 Ga0207660_10060220
1156 Ga0207660_10174352
1157 Ga0207657_10081542
1158 Ga0207657_10148768
1159 Ga0207652_10457691
1160 Ga0207646_10332735
1161 Ga0207681_10524860
1162 Ga0207694_10030817
1163 Ga0207694_10159698
1164 Ga0207694_10236215
1165 Ga0207650_10039723
1166 Ga0207650_10687629
1167 Ga0207700_10022160
1168 Ga0207700_10052321
1169 Ga0207664_10052674
1170 Ga0207664_10134250
1171 Ga0207644_10275592
1172 Ga0207706_10331773
1173 Ga0207709_10248879
1174 Ga0207669_10284285
1175 Ga0207665_10001583
1176 Ga0207711_10150513
1177 Ga0207711_10608139
1178 Ga0207661_10391212
1179 Ga0207667_10265170
1180 Ga0207667_10335920
1181 Ga0207667_10336315
1182 Ga0207667_10533378
1183 Ga0207668_10329581
1184 Ga0207668_10705264
1185 Ga0207640_10194183
1186 Ga0207658_10253221
1187 Ga0207677_10191226
1188 Ga0207639_10140392
1189 Ga0207639_10157319
1190 Ga0207639_10276002
1191 Ga0207639_10276975
1192 Ga0207639_10332409
1193 Ga0207678_10003569
1194 Ga0207678_10049928
1195 Ga0207678_10418767
1196 Ga0207678_10597085
1197 Ga0207708_10197022
1198 Ga0207702_10031931
1199 Ga0207702_10267484
1200 Ga0207702_10431405
1201 Ga0207675_100161084
1202 Ga0207698_10292882
1203 Ga0207698_10554133
1204 Ga0207698_10907681
1205 Ga0209389_1000121
1206 Ga0209589_1000003
1207 Ga0209589_1002338
1208 Ga0209489_100003
1209 Ga0209489_101475
1210 Ga0209700_100003
1211 Ga0209179_1000593
1212 Ga0209813_10036440
1213 Ga0209813_10085225
1214 Ga0268266_10001098
1215 Ga0268266_10017714
1216 Ga0268266_10143932
1217 Ga0268266_10150362
1218 Ga0268264_10000043
1219 Ga0268264_10524043
1220 Ga0265325_10027410
1221 Ga0265340_10036789
1222 Ga0265316_10357622
1223 Ga0307513_10164990
1224 Ga0307509_10060644
1225 Ga0307408_100036430
1226 Ga0307508_10000010
1227 Ga0265314_10285250
1228 Ga0307516_10042681
1229 Ga0307413_10506479
1230 Ga0307411_10333882
1231 Ga0307415_100118119
1232 Ga0307415_100351195
1233 Ga0307510_10004213
1234 Ga0307510_10006119
1235 Ga0307510_10392259
1236 Ga0315911_1000001
1237 Ga0373934_0085641
1238 Ga0373923_0045006
1239 Ga0373923_0049016
1240 Ga0373932_0077068
1241 Ga0373936_0005311
1242 Ga0373936_0145773
1243 Ga0373954_0008335
1244 Ga0373954_0024129
1245 Ga0373954_0067608
1246 Ga0373956_0141693
1247 Ga0373957_0013029
1248 Ga0373943_0004918
1249 Ga0373943_0227007
1250 Ga0373946_0029192
1251 Ga0373955_0039717
1252 Ga0373955_0090334
1253 Ga0373955_0316442
1254 Ga0373924_0009245
1255 Ga0373924_0027064
1256 Ga0373931_0215128
1257 Ga0373931_0222551
1258 Ga0373935_0055144
1259 Ga0373927_0173928
1260 Ga0373927_0306964
1261 Ga0373927_0327863
1262 Ga0373927_0357239
1263 Ga0373933_0001930
1264 Ga0373933_0017121
1265 Ga0373933_0054487
1266 Ga0373947_0033109
1267 Ga0373947_0082641
1268 Ga0373947_0209247
1269 Ga0373937_0127645
1270 Ga0373937_0157888
1271 Ga0373937_0711775
1272 Ga0373925_0006009
1273 Ga0373925_0152585
1274 Ga0395899_0312624
1275 Ga0395900_0017864
1276 Ga0395900_0273815
1277 Ga0395898_0032284
1278 Ga0395898_0677965
1279 Ga0395905_0007051
1280 Ga0395905_0250301
1281 Ga0436364_0991714
1282 Ga0395901_0129842
1283 Ga0395901_0377199
1284 Ga0436365_0866542
1285 Ga0436365_1316672
1286 Ga0436365_1470075
1287 Ga0436365_1510814
1288 Ga0436360_0167622
1289 Ga0436363_1463179
1290 Ga0451802_0675589
1291 Ga0451806_367894
1292 Ga0451851_0219306
1293 Ga0451853_3503921
1294 Ga0451853_3945261
1295 Ga0466972_0054449
1296 Ga0466965_0009353
1297 Ga0466963_0243643
1298 Ga0466964_0054250
1299 Ga0466971_0043439
1300 Ga0466960_0095929
1301 Ga0466967_0029515
1302 Ga0466967_0129258
1303 Ga0495592_0073199
1304 Ga0495592_0095701
1305 Ga0495603_0000729
1306 Ga0495603_0028681
1307 Ga0495603_0032720
1308 Ga0495603_0064072
1309 Ga0495603_0197961
1310 Ga0495629_0001683
1311 Ga0495629_0003206
1312 Ga0495629_0435858
1313 Ga0495638_0012724
1314 Ga0495638_0152144
1315 Ga0495641_0010184
1316 Ga0495651_0013636
1317 Ga0495653_0181243
1318 Ga0495653_0192112
1319 Ga0495580_0001179
1320 Ga0495580_0025532
1321 Ga0495580_0067039
1322 Ga0495582_0011077
1323 Ga0495639_0000381
1324 Ga0495639_0029667
1325 Ga0495639_0060299
1326 Ga0495662_0001877
1327 Ga0495662_0032221
1328 Ga0495664_0008790
1329 Ga0495664_0015631
1330 Ga0495664_0029939
1331 Ga0495584_0078243
1332 Ga0495584_0124241
1333 Ga0495584_0158115
1334 Ga0495585_0035910
1335 Ga0495594_0004862
1336 Ga0495583_0089310
1337 Ga0495606_0011059
1338 Ga0495610_0139898
1339 Ga0495616_0169145
1340 Ga0495618_0031969
1341 Ga0495618_0059713
1342 Ga0495620_0139887
1343 Ga0495628_0082675
1344 Ga0495630_0036156
1345 Ga0495630_0040192
1346 Ga0495632_0087111
1347 Ga0495637_0078692
1348 Ga0495643_0010985
1349 Ga0495643_0074345
1350 Ga0495648_0035952
1351 Ga0495642_0046160
1352 Ga0495652_0143134
1353 Ga0495652_0297688
1354 Ga0495665_0001300
1355 Ga0495665_0069349
1356 Ga0495640_0089610
1357 Ga0495586_0079732
1358 Ga0495586_0353052
1359 Ga0495587_0003875
1360 Ga0495598_0095937
1361 Ga0495645_0010706
1362 Ga0495645_0249765
1363 Ga0495622_0000825
1364 Ga0495633_0053666
1365 Ga0495633_0060589
1366 Ga0495667_0016472
1367 Ga0495667_0042567
1368 Ga0495667_0068796
1369 Ga0495656_0012999
1370 Ga0495656_0108522
1371 Ga0495668_0015342
1372 Ga0495668_0258780
1373 Ga0495634_0000324
1374 Ga0495634_0067958
1375 Ga0495634_0234319
1376 Ga0495625_0101657
1377 Ga0495625_0165881
1378 Ga0495635_0005678
1379 Ga0495661_0173277
1380 Ga0495588_0002137
1381 Ga0495657_0081716
1382 Ga0495599_0167112
1383 Ga0495623_0078500
1384 Ga0495646_0056473
1385 Ga0495646_0124489
1386 Ga0495647_0001889
1387 Ga0495658_0001003
1388 Ga0495658_0042101
1389 Ga0495669_0005527
1390 Ga0495669_0195408
1391 Ga0495613_0004628
1392 Ga0495613_0063204
1393 Ga0495613_0188790
1394 Ga0495613_0337798
1395 Ga0495624_0024440
1396 Ga0495624_0049143
1397 Ga0495649_0091495
1398 Ga0495600_0092491
1399 Ga0495600_0097504
1400 Ga0495581_0000160
1401 Ga0495581_0058149
1402 Ga0495581_0182858
1403 Ga0495604_0020017
1404 Ga0495604_0103334
1405 Ga0495636_0122912
1406 Ga0495674_0008261
1407 Ga0495674_0211502
1408 Ga0495674_0220141
1409 Ga0495672_0038451
1410 Ga0495676_0023467
1411 Ga0495676_0041304
1412 Ga0495676_0170119
1413 Ga0495676_0185606
1414 Ga0495676_0435507
1415 Ga0495683_0050687
1416 Ga0495687_004391
1417 Ga0495675_0015095
1418 Ga0495673_0128670
1419 Ga0495684_0044993
1420 Ga0495684_0054813
1421 Ga0495593_0000241
1422 Ga0495593_0027366
1423 Ga0495602_0044100
1424 Ga0495614_0072697
1425 Ga0495614_0184001
1426 Ga0495615_0025646
1427 Ga0496100_0349753
1428 Ga0496101_0098205
1429 Ga0496101_0104458
1430 Ga0496101_0845653
1431 Ga0496102_0008512
1432 Ga0496102_0249017
1433 Ga0496102_0315931
1434 Ga0496102_0545936
1435 Ga0496103_0194678
1436 Ga0496104_0071617
1437 Ga0496105_0003937
1438 Ga0496105_0270833
1439 Ga0496105_0537367
1440 Ga0496106_0003031
1441 Ga0496107_0295252
1442 Ga0496107_0617756
1443 Ga0496108_0034979
1444 Ga0496108_0701988
1445 Ga0496109_0001522
1446 Ga0496109_0021025
1447 Ga0496109_0387729
1448 Ga0496109_0410729
1449 Ga0496110_0127744
1450 Ga0496110_0142177
1451 Ga0496110_0697802
1452 Ga0496111_0307696
1453 Ga0496112_0000021
1454 Ga0496112_0020030
1455 Ga0496112_0122215
1456 Ga0496112_0175130
1457 Ga0496112_0659526
1458 Ga0496113_0073481
1459 Ga0496114_0242587
1460 Ga0496114_0257887
1461 Ga0496115_0090778
1462 Ga0496115_0093708
1463 Ga0496115_0261510
1464 Ga0496116_0038168
1465 Ga0496117_0009110
1466 Ga0496117_0083106
1467 Ga0496118_0006337
1468 Ga0496118_0070194
1469 Ga0496119_0009371
1470 Ga0496120_0004023
1471 Ga0496121_0000183
1472 Ga0496121_0035667
1473 Ga0496121_0078095
1474 Ga0496121_0091317
1475 Ga0496121_0239551
1476 Ga0496122_0022521
1477 Ga0496123_0207705
1478 Ga0496124_0002761
1479 Ga0496124_0129547
1480 Ga0496124_0229989
1481 Ga0496124_0246901
1482 Ga0496125_0000877
1483 Ga0496125_0042347
1484 Ga0496126_0026033
1485 Ga0496126_0034207
1486 Ga0496126_0045660
1487 Ga0496126_0062075
1488 Ga0496126_0071934
1489 Ga0496126_0073342
1490 Ga0496126_0073979
1491 Ga0496126_0217986
1492 Ga0496126_0349317
1493 Ga0495682_0110191
1494 Ga0501031_0001053
1495 Ga0501032_0000668
1496 Ga0501032_0038828
1497 Ga0501033_0000619
1498 Ga0501033_0023712
1499 Ga0501033_0047661
1500 Ga0501033_0119351
1501 Ga0501033_0419811
1502 Ga0501034_0000232
1503 Ga0501036_0000371
1504 Ga0501036_0172083
1505 Ga0501037_0000303
1506 Ga0501038_0000112
1507 Ga0501038_0119220
1508 Ga0501038_0429941
1509 Ga0501039_0000789
1510 Ga0501039_0134692
1511 Ga0501039_0143546
1512 Ga0501042_0021071
1513 Ga0501043_0000035
1514 Ga0501043_0096029
1515 Ga0501043_0317318
1516 Ga0501046_0022126
1517 Ga0501046_0049382
1518 Ga0501046_0055323
1519 Ga0501046_0193513
1520 Ga0501047_0000085
1521 Ga0501047_0031163
1522 Ga0501047_0045461
1523 Ga0501047_0601769
1524 Ga0501048_0000061
1525 Ga0501048_0279425
1526 Ga0501067_0002211
1527 Ga0501067_0065732
1528 Ga0501067_0074997
1529 Ga0501068_0004923
1530 Ga0501069_0021376
1531 Ga0501070_0000272
1532 Ga0501070_0471742
1533 Ga0501071_0051827
1534 Ga0501071_0401422
1535 Ga0501072_0006309
1536 Ga0501073_0000026
1537 Ga0501073_0056283
1538 Ga0501074_0000017
1539 Ga0501074_0055970
1540 Ga0501079_0002647
1541 Ga0501080_0062421
1542 Ga0501083_0000638
1543 Ga0501035_0000548
1544 Ga0501035_0054958
1545 Ga0501035_0103647
1546 Ga0501035_0179739
1547 Ga0501044_0000051
1548 Ga0501044_0039498
1549 Ga0501044_0055169
1550 nmdc:mga03683_2975_c1
1551 nmdc:mga03n38_103522_c1
1552 nmdc:mga03n38_12912_c1
1553 nmdc:mga03n38_180288_c1
1554 nmdc:mga03n38_18704_c1
1555 nmdc:mga00v17_296813_c1
1556 nmdc:mga00v17_63272_c1
1557 nmdc:mga0yw44_398702_c1
1558 nmdc:mga0yw44_48221_c1
1559 nmdc:mga0yw44_504413_c1
1560 nmdc:mga0yw44_83360_c1
1561 nmdc:mga0k408_239432_c1
1562 nmdc:mga0k408_9279_c1
1563 nmdc:mga06z11_116980_c1
1564 nmdc:mga06z11_14996_c1
1565 nmdc:mga06z11_32574_c1
1566 nmdc:mga04h51_101074_c1
1567 nmdc:mga04h51_82482_c1
1568 nmdc:mga07m45_19502_c2
1569 nmdc:mga0n895_32103_c1
1570 nmdc:mga0n895_67036_c1
1571 nmdc:mga0rr50_433239_c1
1572 nmdc:mga0sz30_61424_c1
1573 Ga0495601_0035341
1574 Ga0495601_0078141
1575 Ga0495601_0095765
1576 Ga0495612_0021249
1577 Ga0495619_0188485
1578 Ga0495619_0551691
1579 Ga0500578_0125302
1580 Ga0500578_0146850
1581 Ga0500643_000015
1582 Ga0500647_0089674
1583 Ga0500583_0054905
1584 Ga0500651_0078337
1585 Ga0500566_0000028
1586 Ga0500566_0000988
1587 Ga0500566_0005062
1588 Ga0500566_0157997
1589 Ga0500640_000581
1590 Ga0500650_0088991
1591 Ga0500555_000899
1592 Ga0500557_000022
1593 Ga0500562_028396
1594 Ga0500572_000269
1595 Ga0500591_013572
1596 Ga0500595_000652
1597 Ga0500595_004516
1598 Ga0500595_013151
1599 Ga0500614_000118
1600 Ga0500642_0000060
1601 Ga0500642_0130489
1602 Ga0500655_017516
1603 Ga0500559_0002964
1604 Ga0500559_0014416
1605 Ga0500559_0057837
1606 Ga0500568_0024464
1607 Ga0500573_0073398
1608 Ga0500577_0041110
1609 Ga0500589_176028
1610 Ga0500603_000232
1611 Ga0500603_091129
1612 Ga0500616_0024278
1613 Ga0500624_000625
1614 Ga0500634_0140001
1615 Ga0500639_000001
1616 Ga0500637_0000104
1617 Ga0500637_0152982
1618 Ga0500625_000333
1619 Ga0500645_008971
1620 Ga0500609_026835
1621 Ga0500596_000195
1622 Ga0500599_016819
1623 Ga0500601_000662
1624 Ga0501084_0012583
1625 Ga0500661_000109
1626 Ga0501082_0003691
1627 2507508647
1628 2508542742
1629 2508691499
1630 2509150834
1631 2511397779
1632 2513623097
1633 2513645902
1634 2513654689
1635 2513692476
1636 2513705210
1637 2513719509
1638 2513855900
1639 2513872709
1640 2513915131
1641 2514011914
1642 2515628301
1643 2517892426
1644 2524471038
1645 2528851154
1646 2617348954
1647 2617375829
1648 2745074955
1649 2793062457
1650 2793072093
1651 2793080936
1652 2805915393
1653 2818238970
1654 2824617775
1655 2824626207
1656 2824634894
1657 2824643179
1658 2824651362
1659 2824671067
1660 2824679407
1661 2824687767
1662 2824696055
1663 2824701014
1664 2824719511
1665 2824729931
1666 2824740730
1667 2824753790
1668 2824781345
1669 2828309882
1670 2838123814
1671 2841944057
1672 2841949914
1673 2841966332
1674 2841975066
1675 2841983362
1676 2842039125
1677 2842047928
1678 2847946505
1679 2849079369
1680 2851184694
1681 2852394213
1682 2857514372
1683 2874591547
1684 2874605145
1685 2874619588
1686 2874627158
1687 2874631790
1688 2874648935
1689 2876771962
1690 2876822093
1691 2879075606
1692 2879103300
1693 2879135486
1694 2879143095
1695 2881366994
1696 2881671117
1697 2885370528
1698 2885390705
1699 2888384003
1700 2888393852
1701 2889039886
1702 2903749462
1703 2903777971
1704 2904669859
1705 2906618589
1706 2906628612
1707 2906638754
1708 2906651675
1709 2906666411
1710 2908780115
1711 2922374326
1712 2922396368
1713 2922430248
1714 2929618000
1715 2929627681
1716 2932788220
1717 2932797531
1718 2932802846
1719 2932810630
1720 2932821224
1721 2932831217
1722 2933579928
1723 2935608823
1724 2935622987
1725 2935631694
1726 2935642347
1727 2935668350
1728 2935680483
1729 2935692847
1730 2935701016
1731 2935706205
1732 2935721428
1733 2935730346
1734 2935740359
1735 2935749623
1736 2935759064
1737 2935762606
1738 2935773237
1739 2935778483
1740 2935790398
1741 2935798127
1742 2935803205
1743 2935814525
1744 2935821983
1745 2935831663
1746 2935838517
1747 2935847565
1748 2935861235
1749 2935865773
1750 2935878274
1751 2935885188
1752 2935909168
1753 2935919889
1754 2935926258
1755 2935934708
1756 2935943158
1757 2935951596
1758 2935966428
1759 2935967721
1760 2935977079
1761 2935988233
1762 2935994587
1763 2936007613
1764 2936040082
1765 2940564931
1766 2941511488
1767 2941519189
1768 2941526231
1769 2941538815
1770 3005480178
1771 3005487283
1772 3005510277
1773 3005591071
1774 3005714847
1775 3005722275
1776 8006929950
1777 8006998779
1778 8016522404
1779 8016534888
1780 8016548099
1781 8016554028
1782 8016562402
1783 8016573233
1784 8016577377
1785 8016600202
1786 8016610550
1787 8016626607
1788 8017063156
1789 8019534648
1790 8019544823
1791 8019553714
1792 8019556789
1793 8019568518
1794 8019582590
1795 8019590381
1796 8019600973
1797 8019617580
1798 8019628076
1799 8019645196
1800 8019662424
1801 8019671922
1802 8019684170
1803 8019690010
1804 8054007361
1805 8055746411
1806 8056686638
1807 8056693570
1808 8057579655

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01965

DJ-1_PfpI

DJ-1/PfpI family

54

217

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
3noq-assembly1.cif.gz_A crystal structure of c101s isocyanide hydratase from pseudomonas fluorescens 0.9908 1 221
7la0-assembly1.cif.gz_B pseudomonas fluorescens g150a isocyanide hydratase (g150a-2) at 274k, refmac5-refined 0.9875 1 221
7l9q-assembly1.cif.gz_B wild-type pseudomonas fluorescens isocyanide hydratase (wt-1) at 274k, refmac5-refined 0.9874 1 221
3noo-assembly1.cif.gz_B crystal structure of c101a isocyanide hydratase from pseudomonas fluorescens 0.9807 2 221
3nor-assembly1.cif.gz_A-2 crystal structure of t102s isocyanide hydratase from pseudomonas fluorescens 0.979 1 221
ID Description Score Start End Superfamily
3norA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.979 1 221 3.40.50.880
3ewnA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9443 5 218 3.40.50.880
3norA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9413 1 221 3.40.50.880
af_I6Y6S3_1_186_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9401 28 209 3.40.50.880
af_O16228_2_184_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9284 1 179 3.40.50.880
ID Description Score Start End GO Terms
AF-A0A530GRT2-F1-model_v4 DJ-1/PfpI family protein 0.9985 1 124 GO:0006355
AF-A0A1Z4N4H9-F1-model_v4 ThiJ/PfpI domain-containing protein 0.9908 2 221 GO:0006355
AF-A0A530GRT2-F1-model_v4 DJ-1/PfpI family protein 0.9905 1 124 GO:0006355
AF-A0A6I5P035-F1-model_v4 DJ-1/PfpI family protein 0.9886 1 219 GO:0006355
AF-Q3JJZ1-F1-model_v4 DJ-1/PfpI family protein (EC 4.2.1.103) 0.9879 1 221 GO:0006355
GO:0050549

Map