F485337

General Info

Members Datasets Scaffolds Average Seq Length
906 279 820 168

Family's Representative Sequence

Representative Sequence 3300039062|Ga0400483_036566|Ga0400483_036566_27459_28028
Length 189
Sequence VYKSLQGGVVKLPSAKVLESKKKAVEDLTNELKAANSIILADYRGLTVEQDTEMRAALRKEGINYKVIKNSITSFAAKNCGLDGLENHLKGPTSVAMSEDVVAPAKVLSEFAKKYDVLELKAGVLEGEVIDMDKIKALASLPSKEELIAQVVAGFNAPISGFVNVLNGNLRNLATVISAIAEKKGKEEE

Samples

Sample ID Description Type Environment
1 2511231119 Bacillus velezensis CAU B946 Isolate Rhizosphere
2 2540341094 Bacillus subtilis XF-1 Isolate Rhizosphere
3 2545555800 Bacillus amyloliquefaciens EGD-AQ14 Isolate Rhizosphere
4 2551306519 Bacillus sp. WBUNB004 Isolate Rhizosphere
5 2576861599 Bacillus amyloliquefaciens EGD-AQ14 Isolate Rhizosphere
6 2593339131 Bacillus sp. UNCCL81 Isolate Unclassified
7 2643221729 Bacillus sp. Root11 Isolate Unclassified
8 2643221730 Bacillus sp. Root131 Isolate Unclassified
9 2648501850 Bacillus amyloliquefaciens RHNK22 Isolate Rhizosphere
10 2671180330 Peribacillus simplex SH-B26 Isolate Unclassified
11 2671180844 Bacillus amyloliquefaciens Bs006 Isolate Unclassified
12 2684622632 Bacillus cereus 905 Isolate Unclassified
13 2695420354 Bacillus sp. Co1-6 Isolate Unclassified
14 2695420987 Bacillus thuringiensis KNU-07 Isolate Unclassified
15 2703719227 Bacillus mycoides GOE6 Isolate Rhizosphere
16 2716884898 Bacillus methylotrophicus FKM10 Isolate Rhizosphere
17 2718218445 Bacillus sp. B25(2016b) Isolate Rhizosphere
18 2738541295 Bacillus sp. OK085 Isolate Unclassified
19 2738541358 Bacillus sp. OV752 Isolate Unclassified
20 2738543006 Bacillus sp. OK077 Isolate Unclassified
21 2738543010 Bacillus sp. YR335 Isolate Unclassified
22 2738543017 Bacillus sp. OV186 Isolate Unclassified
23 2757320391 Bacillus sp. NFR08 Isolate Rhizoplane
24 2775507177 Bacillus sp. AFS055030 Isolate Unclassified
25 2775507192 Bacillus sp. AFS041924 Isolate Unclassified
26 2802429420 Priestia filamentosa HL2HP6 Isolate Unclassified
27 2808606364 Bacillus sp. SLBN-3 Isolate Unclassified
28 2808606399 Bacillus sp. SJZ110 Isolate Rhizosphere
29 2816332186 Peribacillus frigoritolerans 3612 Isolate Unclassified
30 2816332295 Bacillus paralicheniformis MDJK30 Isolate Rhizosphere
31 2818991441 Niallia circulans 3243 Isolate Rhizosphere
32 2818991443 Bacillus thuringiensis 1230 Isolate Unclassified
33 2842682962 Bacillus sp. R-72492 Isolate Unclassified
34 2849139964 Bacillus sp. R-71875 Isolate Unclassified
35 2852673933 Sporosarcina sp. JAI121 Isolate Rhizosphere
36 2857581216 Bacillus sp. R-71922 Isolate Unclassified
37 2857586860 Bacillus sp. R-71935 Isolate Unclassified
38 2857604169 Domibacillus sp. R-71921 Isolate Unclassified
39 2857609550 Domibacillus sp. R-71929 Isolate Unclassified
40 2860837431 Bacillus sp. WR11 Isolate Unclassified
41 2877768649 Bacillus amyloliquefaciens Y14 Isolate Rhizosphere
42 2880169592 Bacillus velezensis T20E-257 Isolate Unclassified
43 2897109615 Bacillus amyloliquefaciens YP6 Isolate Unclassified
44 2904560550 Bacillus velezensis 1780 Isolate Rhizosphere
45 2916971899 Alkalihalobacillus miscanthi AK13 Isolate Rhizosphere
46 2919414237 Neobacillus niacini 3240 Isolate Rhizosphere
47 2929233124 Bacillus sp. R-74298 Hybrid assembly Isolate Unclassified
48 2936340661 Gottfriedia acidiceleris 1-17 Isolate Rhizosphere
49 2936361878 Neobacillus endophyticus BRMEA1 Isolate Unclassified
50 2938917290 Bacillus sp. CR71 Isolate Unclassified
51 2947426588 Bacillus sp. RZ2MS9 Isolate Rhizosphere
52 2956897341 Ectobacillus funiculus W18-2 Isolate Rhizosphere
53 2962290636 Bacillus subtilis TLO3 Isolate Rhizosphere
54 2965761152 Bacillus sp. COPE52 Isolate Unclassified
55 2969136845 Bacillus subtilis TLO3 Isolate Rhizosphere
56 2969141011 Bacillus velezensis MH25 Isolate Unclassified
57 2969765954 Bacillus intestinalis GM2 Isolate Rhizosphere
58 2969770375 Bacillus subtilis GM5 Isolate Rhizosphere
59 2971893375 Bacillus sp. HNA3 Isolate Rhizosphere
60 2977254563 Bacillus sp. SORGH_AS 510 Isolate Unclassified
61 2979083700 Bacillus toyonensis SORGH_AS 407 Isolate Unclassified
62 2980492589 Bacillus subtilis GQJK2 Isolate Rhizosphere
63 2990275345 Bacillus sp. SLBN-46 Isolate Unclassified
64 3001267043 Bacillus sp. FJAT-49870 Isolate Rhizosphere
65 3001272096 Lederbergia citrisecunda FJAT-49732 Isolate Rhizosphere
66 3001892409 Neobacillus rhizophilus FJAT-49825 Isolate Rhizosphere
67 3006826541 Bacillus haikouensis CrR16 Isolate Unclassified
68 3006858327 Bacillus paralicheniformis SUBG0010 Isolate Unclassified
69 3006879489 Bacillus atrophaeus UCMB-5137 Isolate Rhizosphere
70 3006969106 Bacillus sp. FJAT-50079 Isolate Rhizosphere
71 3006973921 Bacillus sp. FJAT-49736 Isolate Rhizosphere
72 3006978542 Bacillus sp. FJAT-49705 Isolate Rhizosphere
73 3006984091 Lederbergia citrea FJAT-49754 Isolate Rhizosphere
74 3006988479 Bacillus sp. FJAT-49711 Isolate Rhizosphere
75 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
76 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
77 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
78 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
79 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
80 3300003567 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - metaT NBMF1_04_fullP_mix3_d1 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
81 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
82 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
83 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
84 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
85 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
86 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
87 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
88 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
89 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
90 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
91 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
92 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
93 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
94 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
95 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
96 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
97 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
98 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
99 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
100 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
101 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
102 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
103 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
104 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
105 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
106 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
107 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
108 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
109 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
110 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
111 3300023309 Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B2.ctcc.R1 Metatranscriptome Rhizosphere
112 3300023436 Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B2.stno.R1 Metatranscriptome Rhizosphere
113 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
114 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
115 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
116 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
117 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
118 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
119 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
120 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
121 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
138 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
139 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
140 3300029273 Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B1.stno.R1 Metatranscriptome Rhizosphere
141 3300029280 Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B3.stcc.R1 Metatranscriptome Rhizosphere
142 3300030083 Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JPPOOL-T1 Metagenome Unclassified
143 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
144 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
145 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
146 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
147 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
148 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
149 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
150 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
151 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
152 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
153 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
154 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
155 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
156 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
157 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
158 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
159 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
160 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
161 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
162 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
163 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
164 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
165 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
166 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
167 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
168 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
169 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
170 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
171 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
172 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
173 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
174 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
175 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
176 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
177 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
178 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
179 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
180 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
181 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
182 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
183 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
184 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
185 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
186 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
187 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
188 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
189 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
190 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
191 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
192 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
193 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
194 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
195 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
196 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
197 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
198 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
199 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
200 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
201 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
202 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
203 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
204 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
205 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
206 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
207 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
208 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
209 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
210 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
211 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
212 3300049131 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
213 3300049132 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
214 3300049133 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
215 3300049134 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
216 3300049160 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
217 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
218 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
219 3300049163 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
220 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
221 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
222 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
223 3300049529 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
224 3300049530 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
225 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
226 3300049532 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
227 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
228 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
229 3300049535 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
230 3300049536 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
231 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
232 3300049538 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
233 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
234 3300049540 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
235 3300049541 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
236 3300049542 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
237 3300049543 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
238 3300049544 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
239 3300049545 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
240 3300049546 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_B_4_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
241 3300049547 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_A_5_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
242 3300049548 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
243 3300049549 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
244 3300049550 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
245 3300049551 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
246 3300049552 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
247 3300049553 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_A_7_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
248 3300049554 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_A_7_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
249 3300049555 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
250 3300049556 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
251 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
252 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
253 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
254 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
255 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
256 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
257 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
258 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
259 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
260 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
261 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
262 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
263 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
264 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
265 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
266 3300059604 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 63R_AD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
267 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
268 8022621104 Bacillus sp. PIC28 Isolate Rhizosphere
269 8022630665 Bacillus sp. PW192 Isolate Rhizosphere
270 8022653035 Bacillus sp. Rc4 Isolate Unclassified
271 8022792930 Bacillus sp. Xin Isolate Rhizosphere
272 8022948649 Bacillus endophyticus FH5 Isolate Rhizosphere
273 8023438354 Bacillus sp. BH2 Isolate Unclassified
274 8023444577 Bacillus sp. BH32 Isolate Unclassified
275 8051952484 Bacillus amyloliquefaciens K2 Isolate Rhizosphere
276 8052174270 Bacillus velezensis CH13 Isolate Rhizosphere
277 8054280661 Metabacillus kandeliae GX 13764 Isolate Rhizosphere
278 8057582654 Bacillus arachidis YX15 Isolate Rhizosphere
279 8057632132 Cytobacillus kochii RZ2 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 22.08
Metatranscriptomes 68.43
Isolates 9.49

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.87
Nodule 0
Rhizoplane 3.64
Rhizosphere 86.87
Stem 0
Stem Tuber 0
Unclassified 6.62

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25159J45721_1010242 3300002987 Bacteria 2405
2 JGI25151J46595_10003308 3300003187 Bacteria 8947
3 JGI25151J46595_10015464 3300003187 Bacteria 3361
4 JGI25151J46595_10020964 3300003187 Bacteria 2743
5 JGI25151J46595_10120394 3300003187 Bacteria 670
6 rootH1_10000848 3300003316 Bacteria 58943
7 rootL2_10052955 3300003322 Bacteria 32035
8 rootH1_10338537 3300003323 Bacteria 1547
9 Ga0006554J51385_1040874 3300003567 Bacteria 795
10 Ga0006562J51391_1000046 3300003578 Bacteria 48312
11 Ga0006562J51391_1001816 3300003578 Bacteria 7498
12 Ga0055532_1000639 3300003758 Bacteria 13542
13 Ga0055532_1011725 3300003758 Bacteria 1027
14 Ga0055536_1017217 3300003781 Bacteria 2376
15 Ga0055528_1001614 3300003790 Bacteria 13323
16 Ga0065704_10199215 3300005289 Bacteria 1154
17 Ga0070676_10006452 3300005328 Bacteria 6271
18 Ga0070670_100020078 3300005331 Bacteria 5738
19 Ga0070668_100878893 3300005347 Bacteria 800
20 Ga0070675_100353975 3300005354 Bacteria 1302
21 Ga0070671_100011607 3300005355 Bacteria 7086
22 Ga0070673_101155415 3300005364 Bacteria 724
23 Ga0070714_100368702 3300005435 Bacteria 1352
24 Ga0070672_100025082 3300005543 Bacteria 4417
25 Ga0068851_10240610 3300005834 Bacteria 1023
26 Ga0075364_10154797 3300006051 Bacteria 1546
27 Ga0105251_10084853 3300009011 Bacteria 1460
28 Ga0105251_10190388 3300009011 Bacteria 924
29 Ga0105251_10240151 3300009011 Bacteria 816
30 Ga0105244_10002721 3300009036 Bacteria 13218
31 Ga0105244_10026966 3300009036 Bacteria 3103
32 Ga0105250_10018759 3300009092 Bacteria 2800
33 Ga0105245_10129583 3300009098 Bacteria 2365
34 Ga0105247_10000354 3300009101 Bacteria 39709
35 Ga0105243_10000301 3300009148 Bacteria 54622
36 Ga0105242_10004076 3300009176 Bacteria 11356
37 Ga0105249_10045229 3300009553 Bacteria 4003
38 Ga0105249_10150804 3300009553 Bacteria 2238
39 Ga0105246_10000077 3300011119 Bacteria 41151
40 Ga0105246_10069223 3300011119 Bacteria 2478
41 Ga0105246_11096725 3300011119 Bacteria 727
42 Ga0157374_10013578 3300013296 Bacteria 7114
43 Ga0157378_10000237 3300013297 Bacteria 53846
44 Ga0157372_10031582 3300013307 Bacteria 5798
45 Ga0157377_10002894 3300014745 Bacteria 7675
46 Ga0157376_10014258 3300014969 Bacteria 5959
47 Ga0224712_10143126 3300022467 Bacteria 1054
48 Ga0256744_107689 3300023309 Bacteria 1028
49 Ga0256743_121847 3300023436 Bacteria 1019
50 Ga0209147_100198 3300025229 Bacteria 67714
51 Ga0209147_100385 3300025229 Bacteria 30752
52 Ga0209147_100806 3300025229 Bacteria 15071
53 Ga0209673_1001881 3300025273 Bacteria 16921
54 Ga0209130_1010542 3300025284 Bacteria 2539
55 Ga0209130_1031812 3300025284 Bacteria 1079
56 Ga0209675_1017850 3300025291 Bacteria 2009
57 Ga0209676_1002029 3300025292 Bacteria 15879
58 Ga0209025_1001468 3300025294 Bacteria 30750
59 Ga0209025_1002868 3300025294 Bacteria 17284
60 Ga0209025_1005659 3300025294 Bacteria 10066
61 Ga0209025_1012291 3300025294 Bacteria 5511
62 Ga0209025_1021451 3300025294 Bacteria 3478
63 Ga0209256_1042538 3300025299 Bacteria 1146
64 Ga0207426_1008659 3300025302 Bacteria 4084
65 Ga0207696_1004774 3300025711 Bacteria 5763
66 Ga0207696_1026745 3300025711 Bacteria 1783
67 Ga0207696_1026746 3300025711 Bacteria 1783
68 Ga0207696_1048628 3300025711 Bacteria 1219
69 Ga0207655_1002102 3300025728 Bacteria 16693
70 Ga0207655_1007619 3300025728 Bacteria 6993
71 Ga0207655_1037450 3300025728 Bacteria 2136
72 Ga0207713_1000405 3300025735 Bacteria 46074
73 Ga0207713_1030881 3300025735 Bacteria 2379
74 Ga0207710_10081486 3300025900 Bacteria 1502
75 Ga0207688_10252699 3300025901 Bacteria 1068
76 Ga0207685_10072512 3300025905 Bacteria 1400
77 Ga0207645_10036479 3300025907 Bacteria 3156
78 Ga0207650_10013760 3300025925 Bacteria 5611
79 Ga0207687_10095721 3300025927 Bacteria 2175
80 Ga0207664_10183769 3300025929 Bacteria 1796
81 Ga0207644_10001801 3300025931 Bacteria 13903
82 Ga0207686_10004946 3300025934 Bacteria 7173
83 Ga0207709_10000416 3300025935 Bacteria 41461
84 Ga0207709_10036548 3300025935 Bacteria 2911
85 Ga0207691_10039329 3300025940 Bacteria 4375
86 Ga0207651_11010711 3300025960 Bacteria 743
87 Ga0207712_10048314 3300025961 Bacteria 2959
88 Ga0207712_10566351 3300025961 Bacteria 979
89 Ga0209371_1002074 3300027312 Bacteria 11934
90 Ga0209970_1002684 3300027614 Bacteria 3012
91 Ga0209974_10123404 3300027876 Bacteria 919
92 Ga0311008_128370 3300029273 Bacteria 812
93 Ga0311011_132806 3300029280 Bacteria 696
94 Ga0237817_10339 3300030083 Bacteria 8841
95 Ga0268256_1001830 3300030500 Bacteria 11934
96 Ga0307408_100017547 3300031548 Bacteria 4790
97 Ga0307408_100032918 3300031548 Bacteria 3617
98 Ga0307408_100084584 3300031548 Bacteria 2380
99 Ga0307405_10021522 3300031731 Bacteria 3627
100 Ga0307410_10121991 3300031852 Bacteria 1902
101 Ga0307406_10133880 3300031901 Bacteria 1744
102 Ga0307407_10029070 3300031903 Bacteria 2964
103 Ga0307412_10067261 3300031911 Bacteria 2432
104 Ga0307412_11135294 3300031911 Bacteria 697
105 Ga0307409_100018876 3300031995 Bacteria 4652
106 Ga0307409_100071775 3300031995 Bacteria 2754
107 Ga0307409_100088345 3300031995 Bacteria 2530
108 Ga0307416_100018258 3300032002 Bacteria 4936
109 Ga0307416_100044091 3300032002 Bacteria 3498
110 Ga0307416_100078459 3300032002 Bacteria 2778
111 Ga0307416_100078727 3300032002 Bacteria 2775
112 Ga0307416_101756763 3300032002 Bacteria 724
113 Ga0307416_101880348 3300032002 Bacteria 702
114 Ga0316593_10001905 3300032168 Bacteria 4786
115 Ga0316593_10140254 3300032168 Bacteria 875
116 Ga0316593_10279196 3300032168 Bacteria 629
117 Ga0316592_1019780 3300033524 Bacteria 1426
118 Ga0316596_1022867 3300033541 Unclassified 1599
119 Ga0373925_1096714 3300037068 Bacteria 655
120 Ga0395898_0345618 3300037466 Bacteria 1419
121 Ga0395901_1207195 3300038443 Bacteria 722
122 Ga0237819_01772 3300038705 Bacteria 5057
123 Ga0400483_036566 3300039062 Bacteria 40882
124 Ga0450903_006304 3300042138 Bacteria 1974
125 Ga0466970_0084252 3300044765 Bacteria 1721
126 Ga0466957_0189338 3300044842 Bacteria 1347
127 Ga0466967_0016145 3300045976 Bacteria 5879
128 Ga0495603_0158016 3300046455 Bacteria 1315
129 Ga0495590_0209419 3300046457 Bacteria 718
130 Ga0495605_0031123 3300046474 Bacteria 2728
131 Ga0495605_0262900 3300046474 Bacteria 736
132 Ga0495585_0012105 3300046492 Bacteria 5090
133 Ga0495607_0172495 3300046501 Bacteria 1091
134 Ga0495607_0172829 3300046501 Bacteria 1090
135 Ga0495620_0076343 3300046515 Bacteria 1362
136 Ga0495631_0049769 3300046518 Bacteria 1834
137 Ga0495637_0032797 3300046520 Bacteria 2286
138 Ga0495654_0109347 3300046530 Bacteria 1263
139 Ga0495654_0142436 3300046530 Bacteria 1067
140 Ga0495622_0074070 3300046557 Bacteria 1570
141 Ga0495633_0169536 3300046558 Bacteria 1006
142 Ga0495633_0186861 3300046558 Bacteria 953
143 Ga0495661_0071169 3300046665 Bacteria 2033
144 Ga0495661_0100675 3300046665 Bacteria 1627
145 Ga0495588_0137532 3300046674 Bacteria 1290
146 Ga0495649_0154990 3300046694 Bacteria 1202
147 Ga0495589_0058132 3300046794 Bacteria 1902
148 Ga0495589_0153466 3300046794 Bacteria 1099
149 Ga0495660_0031747 3300046810 Bacteria 2968
150 Ga0495676_0059397 3300047321 Bacteria 3003
151 Ga0495683_0040440 3300047323 Bacteria 2356
152 Ga0495614_0511392 3300048089 Bacteria 572
153 Ga0495626_0095378 3300048091 Bacteria 1303
154 Ga0495626_0096944 3300048091 Bacteria 1290
155 Ga0495626_0288536 3300048091 Bacteria 650
156 Ga0496100_0005282 3300048903 Bacteria 6938
157 Ga0496100_0024474 3300048903 Bacteria 3684
158 Ga0496101_0005141 3300048904 Bacteria 8323
159 Ga0496101_1153832 3300048904 Bacteria 608
160 Ga0496102_0004480 3300048905 Bacteria 11790
161 Ga0496102_0010275 3300048905 Bacteria 8048
162 Ga0496102_0088719 3300048905 Bacteria 2860
163 Ga0496102_0395441 3300048905 Bacteria 1300
164 Ga0496103_0001500 3300048906 Bacteria 15621
165 Ga0496103_0084122 3300048906 Bacteria 2004
166 Ga0496103_0157507 3300048906 Bacteria 1456
167 Ga0496104_0001186 3300048907 Bacteria 22389
168 Ga0496104_0461315 3300048907 Bacteria 1182
169 Ga0496104_1160721 3300048907 Bacteria 676
170 Ga0496105_0000964 3300048908 Bacteria 19760
171 Ga0496106_0000361 3300048909 Bacteria 32313
172 Ga0496107_0000282 3300048910 Bacteria 26883
173 Ga0496107_0949094 3300048910 Bacteria 626
174 Ga0496108_0000443 3300048911 Bacteria 33208
175 Ga0496108_0581022 3300048911 Bacteria 977
176 Ga0496109_0000778 3300048912 Bacteria 26502
177 Ga0496109_0663898 3300048912 Bacteria 980
178 Ga0496110_0002382 3300048913 Bacteria 14089
179 Ga0496110_0017564 3300048913 Bacteria 5983
180 Ga0496110_0200253 3300048913 Bacteria 1814
181 Ga0496110_0412443 3300048913 Bacteria 1231
182 Ga0496111_0000191 3300048914 Bacteria 28382
183 Ga0496111_0254096 3300048914 Bacteria 1304
184 Ga0496112_0006179 3300048915 Bacteria 10476
185 Ga0496112_0584989 3300048915 Bacteria 1049
186 Ga0496113_0001366 3300048916 Bacteria 13528
187 Ga0496113_0421841 3300048916 Bacteria 1072
188 Ga0496116_0001671 3300048919 Bacteria 24360
189 Ga0496118_0128487 3300048921 Bacteria 1633
190 Ga0496119_0005613 3300048922 Bacteria 11930
191 Ga0496120_0007962 3300048923 Bacteria 7802
192 Ga0496121_0190119 3300048924 Bacteria 1473
193 Ga0496122_0013343 3300048925 Bacteria 8048
194 Ga0496123_0004637 3300048926 Bacteria 14282
195 Ga0496124_0366352 3300048927 Bacteria 1013
196 Ga0496125_0004215 3300048928 Bacteria 16755
197 Ga0496126_0005295 3300048929 Bacteria 14809
198 Ga0496126_0203454 3300048929 Bacteria 1671
199 Ga0501306_000031 3300049127 Bacteria 7963
200 Ga0501306_000487 3300049127 Bacteria 3061
201 Ga0501306_000497 3300049127 Bacteria 3050
202 Ga0501306_000655 3300049127 Bacteria 2790
203 Ga0501306_000823 3300049127 Bacteria 2631
204 Ga0501306_002549 3300049127 Bacteria 1881
205 Ga0501306_002657 3300049127 Bacteria 1858
206 Ga0501306_002851 3300049127 Bacteria 1812
207 Ga0501306_005690 3300049127 Bacteria 1439
208 Ga0501306_008207 3300049127 Bacteria 1269
209 Ga0501306_010846 3300049127 Bacteria 1153
210 Ga0501306_010893 3300049127 Bacteria 1151
211 Ga0501306_016240 3300049127 Bacteria 998
212 Ga0501306_018331 3300049127 Bacteria 957
213 Ga0501306_025160 3300049127 Bacteria 855
214 Ga0501308_000210 3300049128 Bacteria 3315
215 Ga0501308_000287 3300049128 Bacteria 3046
216 Ga0501308_001173 3300049128 Bacteria 2022
217 Ga0501308_001804 3300049128 Bacteria 1789
218 Ga0501308_002976 3300049128 Bacteria 1533
219 Ga0501308_007120 3300049128 Bacteria 1164
220 Ga0501308_007631 3300049128 Bacteria 1138
221 Ga0501308_009537 3300049128 Bacteria 1062
222 Ga0501308_010300 3300049128 Bacteria 1036
223 Ga0501308_015575 3300049128 Bacteria 902
224 Ga0501308_015714 3300049128 Bacteria 899
225 Ga0501308_049974 3300049128 Bacteria 610
226 Ga0501309_000397 3300049129 Bacteria 3395
227 Ga0501309_000721 3300049129 Bacteria 2871
228 Ga0501309_001124 3300049129 Bacteria 2506
229 Ga0501309_001463 3300049129 Bacteria 2329
230 Ga0501309_004530 3300049129 Bacteria 1623
231 Ga0501309_009266 3300049129 Bacteria 1254
232 Ga0501309_009744 3300049129 Bacteria 1230
233 Ga0501309_010365 3300049129 Bacteria 1201
234 Ga0501309_010425 3300049129 Bacteria 1198
235 Ga0501309_011785 3300049129 Bacteria 1144
236 Ga0501309_012054 3300049129 Bacteria 1134
237 Ga0501309_016993 3300049129 Bacteria 996
238 Ga0501309_018957 3300049129 Bacteria 954
239 Ga0501309_020222 3300049129 Bacteria 930
240 Ga0501309_041714 3300049129 Bacteria 703
241 Ga0501310_000371 3300049130 Bacteria 4033
242 Ga0501310_000609 3300049130 Bacteria 3152
243 Ga0501310_000857 3300049130 Bacteria 2718
244 Ga0501310_002612 3300049130 Bacteria 1720
245 Ga0501310_004235 3300049130 Bacteria 1435
246 Ga0501310_006601 3300049130 Bacteria 1221
247 Ga0501310_006974 3300049130 Bacteria 1198
248 Ga0501310_009588 3300049130 Bacteria 1070
249 Ga0501310_010851 3300049130 Bacteria 1023
250 Ga0501310_022388 3300049130 Bacteria 797
251 Ga0501310_022856 3300049130 Bacteria 792
252 Ga0501310_027440 3300049130 Bacteria 742
253 Ga0501341_00221 3300049131 Bacteria 2117
254 Ga0501341_00334 3300049131 Bacteria 1872
255 Ga0501341_00479 3300049131 Bacteria 1692
256 Ga0501341_00629 3300049131 Bacteria 1550
257 Ga0501341_00736 3300049131 Bacteria 1473
258 Ga0501341_01229 3300049131 Bacteria 1252
259 Ga0501341_01444 3300049131 Bacteria 1188
260 Ga0501341_01463 3300049131 Bacteria 1184
261 Ga0501341_01501 3300049131 Bacteria 1173
262 Ga0501341_01688 3300049131 Bacteria 1131
263 Ga0501341_01901 3300049131 Bacteria 1090
264 Ga0501341_01954 3300049131 Bacteria 1080
265 Ga0501341_02729 3300049131 Bacteria 969
266 Ga0501341_03484 3300049131 Bacteria 890
267 Ga0501341_06393 3300049131 Bacteria 724
268 Ga0501341_07510 3300049131 Bacteria 683
269 Ga0501341_08287 3300049131 Bacteria 662
270 Ga0501343_000282 3300049132 Bacteria 2803
271 Ga0501343_000622 3300049132 Bacteria 2146
272 Ga0501343_000822 3300049132 Bacteria 1952
273 Ga0501343_000841 3300049132 Bacteria 1944
274 Ga0501343_001825 3300049132 Bacteria 1475
275 Ga0501343_002064 3300049132 Bacteria 1413
276 Ga0501343_002725 3300049132 Bacteria 1272
277 Ga0501343_002867 3300049132 Bacteria 1248
278 Ga0501343_002941 3300049132 Bacteria 1237
279 Ga0501343_002942 3300049132 Bacteria 1237
280 Ga0501343_003032 3300049132 Bacteria 1224
281 Ga0501343_003075 3300049132 Bacteria 1217
282 Ga0501343_003404 3300049132 Bacteria 1167
283 Ga0501343_003447 3300049132 Bacteria 1164
284 Ga0501343_005490 3300049132 Bacteria 973
285 Ga0501343_006259 3300049132 Bacteria 926
286 Ga0501343_007696 3300049132 Bacteria 853
287 Ga0501343_014255 3300049132 Bacteria 670
288 Ga0501343_017786 3300049132 Bacteria 615
289 Ga0501344_00110 3300049133 Bacteria 2706
290 Ga0501344_00296 3300049133 Bacteria 1949
291 Ga0501344_00443 3300049133 Bacteria 1716
292 Ga0501344_00782 3300049133 Bacteria 1424
293 Ga0501344_01461 3300049133 Bacteria 1148
294 Ga0501344_01568 3300049133 Bacteria 1120
295 Ga0501344_01598 3300049133 Bacteria 1111
296 Ga0501344_02594 3300049133 Bacteria 936
297 Ga0501344_02712 3300049133 Bacteria 921
298 Ga0501344_03336 3300049133 Bacteria 854
299 Ga0501344_03362 3300049133 Bacteria 852
300 Ga0501344_05698 3300049133 Bacteria 707
301 Ga0501344_07923 3300049133 Bacteria 629
302 Ga0501344_08662 3300049133 Bacteria 608
303 Ga0501345_00223 3300049134 Bacteria 1711
304 Ga0501345_00388 3300049134 Bacteria 1444
305 Ga0501345_00658 3300049134 Bacteria 1210
306 Ga0501345_00864 3300049134 Bacteria 1094
307 Ga0501345_00976 3300049134 Bacteria 1049
308 Ga0501345_01623 3300049134 Bacteria 877
309 Ga0501345_02453 3300049134 Bacteria 768
310 Ga0501304_001473 3300049160 Bacteria 1518
311 Ga0501304_001807 3300049160 Bacteria 1421
312 Ga0501304_002559 3300049160 Bacteria 1275
313 Ga0501304_003756 3300049160 Bacteria 1126
314 Ga0501304_009973 3300049160 Bacteria 823
315 Ga0501304_010840 3300049160 Bacteria 802
316 Ga0501305_000002 3300049161 Bacteria 17524
317 Ga0501305_000036 3300049161 Bacteria 7597
318 Ga0501305_000182 3300049161 Bacteria 4371
319 Ga0501305_000320 3300049161 Bacteria 3757
320 Ga0501305_000675 3300049161 Bacteria 2932
321 Ga0501305_000790 3300049161 Bacteria 2796
322 Ga0501305_000923 3300049161 Bacteria 2664
323 Ga0501305_001238 3300049161 Bacteria 2448
324 Ga0501305_001538 3300049161 Bacteria 2283
325 Ga0501305_003224 3300049161 Bacteria 1834
326 Ga0501305_004826 3300049161 Bacteria 1605
327 Ga0501305_006509 3300049161 Bacteria 1453
328 Ga0501305_006940 3300049161 Bacteria 1421
329 Ga0501305_007330 3300049161 Bacteria 1396
330 Ga0501305_008334 3300049161 Bacteria 1339
331 Ga0501305_010732 3300049161 Bacteria 1228
332 Ga0501305_012790 3300049161 Bacteria 1152
333 Ga0501305_033744 3300049161 Bacteria 809
334 Ga0501307_000012 3300049162 Bacteria 6382
335 Ga0501307_000146 3300049162 Bacteria 3691
336 Ga0501307_000209 3300049162 Bacteria 3392
337 Ga0501307_000679 3300049162 Bacteria 2494
338 Ga0501307_003339 3300049162 Bacteria 1568
339 Ga0501307_003522 3300049162 Bacteria 1540
340 Ga0501307_004011 3300049162 Bacteria 1478
341 Ga0501307_004831 3300049162 Bacteria 1397
342 Ga0501307_006195 3300049162 Bacteria 1284
343 Ga0501307_007711 3300049162 Bacteria 1193
344 Ga0501307_011252 3300049162 Bacteria 1049
345 Ga0501307_012768 3300049162 Bacteria 1004
346 Ga0501307_027395 3300049162 Bacteria 775
347 Ga0501307_029643 3300049162 Bacteria 753
348 Ga0501342_00196 3300049163 Bacteria 1468
349 Ga0501342_00234 3300049163 Bacteria 1392
350 Ga0501342_00390 3300049163 Bacteria 1157
351 Ga0501342_00411 3300049163 Bacteria 1130
352 Ga0501342_00879 3300049163 Bacteria 876
353 Ga0501342_01364 3300049163 Bacteria 770
354 Ga0501342_01789 3300049163 Bacteria 702
355 Ga0501342_02889 3300049163 Bacteria 594
356 Ga0501290_009776 3300049513 Bacteria 1222
357 Ga0501311_000004 3300049527 Bacteria 9566
358 Ga0501311_000007 3300049527 Bacteria 8668
359 Ga0501311_001097 3300049527 Bacteria 2240
360 Ga0501311_001420 3300049527 Bacteria 2075
361 Ga0501311_001468 3300049527 Bacteria 2058
362 Ga0501311_001684 3300049527 Bacteria 1988
363 Ga0501311_003772 3300049527 Bacteria 1575
364 Ga0501311_004262 3300049527 Bacteria 1512
365 Ga0501311_005319 3300049527 Bacteria 1407
366 Ga0501311_006182 3300049527 Bacteria 1340
367 Ga0501311_007391 3300049527 Bacteria 1264
368 Ga0501311_008514 3300049527 Bacteria 1205
369 Ga0501311_008908 3300049527 Bacteria 1188
370 Ga0501311_009804 3300049527 Bacteria 1150
371 Ga0501311_010377 3300049527 Bacteria 1129
372 Ga0501311_010523 3300049527 Bacteria 1124
373 Ga0501311_011732 3300049527 Bacteria 1084
374 Ga0501311_013414 3300049527 Bacteria 1034
375 Ga0501311_029488 3300049527 Bacteria 788
376 Ga0501311_040605 3300049527 Bacteria 704
377 Ga0501312_000003 3300049528 Bacteria 16850
378 Ga0501312_000006 3300049528 Bacteria 10477
379 Ga0501312_000567 3300049528 Bacteria 3090
380 Ga0501312_000589 3300049528 Bacteria 3053
381 Ga0501312_000598 3300049528 Bacteria 3037
382 Ga0501312_000704 3300049528 Bacteria 2870
383 Ga0501312_000730 3300049528 Bacteria 2840
384 Ga0501312_000761 3300049528 Bacteria 2807
385 Ga0501312_000887 3300049528 Bacteria 2696
386 Ga0501312_001707 3300049528 Bacteria 2230
387 Ga0501312_004363 3300049528 Bacteria 1663
388 Ga0501312_005721 3300049528 Bacteria 1523
389 Ga0501312_006095 3300049528 Bacteria 1491
390 Ga0501312_006142 3300049528 Bacteria 1488
391 Ga0501312_006812 3300049528 Bacteria 1440
392 Ga0501312_009786 3300049528 Bacteria 1270
393 Ga0501312_011548 3300049528 Bacteria 1202
394 Ga0501312_011808 3300049528 Bacteria 1193
395 Ga0501312_012455 3300049528 Bacteria 1170
396 Ga0501312_015939 3300049528 Bacteria 1070
397 Ga0501312_017404 3300049528 Bacteria 1037
398 Ga0501312_036124 3300049528 Bacteria 793
399 Ga0501312_038175 3300049528 Bacteria 777
400 Ga0501312_045048 3300049528 Bacteria 730
401 Ga0501313_000017 3300049529 Bacteria 8074
402 Ga0501313_000080 3300049529 Bacteria 4457
403 Ga0501313_000518 3300049529 Bacteria 2688
404 Ga0501313_000585 3300049529 Bacteria 2623
405 Ga0501313_001232 3300049529 Bacteria 2150
406 Ga0501313_003745 3300049529 Bacteria 1529
407 Ga0501313_004028 3300049529 Bacteria 1492
408 Ga0501313_004068 3300049529 Bacteria 1487
409 Ga0501313_005376 3300049529 Bacteria 1351
410 Ga0501313_005980 3300049529 Bacteria 1304
411 Ga0501313_007837 3300049529 Bacteria 1181
412 Ga0501313_008090 3300049529 Bacteria 1166
413 Ga0501313_008565 3300049529 Bacteria 1140
414 Ga0501313_010473 3300049529 Bacteria 1057
415 Ga0501313_011824 3300049529 Bacteria 1011
416 Ga0501313_013217 3300049529 Bacteria 968
417 Ga0501313_013554 3300049529 Bacteria 958
418 Ga0501313_014503 3300049529 Bacteria 933
419 Ga0501313_014520 3300049529 Bacteria 933
420 Ga0501313_015683 3300049529 Bacteria 905
421 Ga0501313_016560 3300049529 Bacteria 886
422 Ga0501313_021377 3300049529 Bacteria 802
423 Ga0501313_024510 3300049529 Bacteria 760
424 Ga0501314_000256 3300049530 Bacteria 3073
425 Ga0501314_000364 3300049530 Bacteria 2732
426 Ga0501314_000376 3300049530 Bacteria 2713
427 Ga0501314_000408 3300049530 Bacteria 2651
428 Ga0501314_000534 3300049530 Bacteria 2405
429 Ga0501314_000966 3300049530 Bacteria 1949
430 Ga0501314_001203 3300049530 Bacteria 1831
431 Ga0501314_002552 3300049530 Bacteria 1416
432 Ga0501314_003916 3300049530 Bacteria 1217
433 Ga0501314_005768 3300049530 Bacteria 1064
434 Ga0501314_008046 3300049530 Bacteria 946
435 Ga0501314_008400 3300049530 Bacteria 933
436 Ga0501315_000019 3300049531 Bacteria 7980
437 Ga0501315_000121 3300049531 Bacteria 4217
438 Ga0501315_000389 3300049531 Bacteria 2964
439 Ga0501315_000420 3300049531 Bacteria 2887
440 Ga0501315_000455 3300049531 Bacteria 2824
441 Ga0501315_000870 3300049531 Bacteria 2338
442 Ga0501315_001784 3300049531 Bacteria 1918
443 Ga0501315_003271 3300049531 Bacteria 1607
444 Ga0501315_004375 3300049531 Bacteria 1474
445 Ga0501315_005706 3300049531 Bacteria 1359
446 Ga0501315_007515 3300049531 Bacteria 1244
447 Ga0501315_007585 3300049531 Bacteria 1240
448 Ga0501315_009142 3300049531 Bacteria 1166
449 Ga0501315_009293 3300049531 Bacteria 1159
450 Ga0501315_009781 3300049531 Bacteria 1140
451 Ga0501315_010071 3300049531 Bacteria 1129
452 Ga0501315_010989 3300049531 Bacteria 1098
453 Ga0501315_013388 3300049531 Bacteria 1026
454 Ga0501315_019582 3300049531 Bacteria 902
455 Ga0501315_024693 3300049531 Bacteria 833
456 Ga0501315_037205 3300049531 Bacteria 724
457 Ga0501316_000029 3300049532 Bacteria 5933
458 Ga0501316_000057 3300049532 Bacteria 4894
459 Ga0501316_000077 3300049532 Bacteria 4588
460 Ga0501316_000101 3300049532 Bacteria 4292
461 Ga0501316_000267 3300049532 Bacteria 3270
462 Ga0501316_000523 3300049532 Bacteria 2695
463 Ga0501316_000578 3300049532 Bacteria 2626
464 Ga0501316_001796 3300049532 Bacteria 1896
465 Ga0501316_002250 3300049532 Bacteria 1766
466 Ga0501316_002843 3300049532 Bacteria 1637
467 Ga0501316_003117 3300049532 Bacteria 1589
468 Ga0501316_004133 3300049532 Bacteria 1444
469 Ga0501316_004575 3300049532 Bacteria 1394
470 Ga0501316_004648 3300049532 Bacteria 1387
471 Ga0501316_006448 3300049532 Bacteria 1249
472 Ga0501316_008843 3300049532 Bacteria 1119
473 Ga0501316_010286 3300049532 Bacteria 1063
474 Ga0501316_027862 3300049532 Bacteria 744
475 Ga0501317_000001 3300049533 Bacteria 21405
476 Ga0501317_000015 3300049533 Bacteria 8499
477 Ga0501317_000025 3300049533 Bacteria 7145
478 Ga0501317_000117 3300049533 Bacteria 4257
479 Ga0501317_000283 3300049533 Bacteria 3283
480 Ga0501317_000743 3300049533 Bacteria 2483
481 Ga0501317_001549 3300049533 Bacteria 2004
482 Ga0501317_003545 3300049533 Bacteria 1564
483 Ga0501317_004078 3300049533 Bacteria 1500
484 Ga0501317_004435 3300049533 Bacteria 1460
485 Ga0501317_004480 3300049533 Bacteria 1455
486 Ga0501317_005927 3300049533 Bacteria 1327
487 Ga0501317_006031 3300049533 Bacteria 1319
488 Ga0501317_009156 3300049533 Bacteria 1157
489 Ga0501317_010514 3300049533 Bacteria 1107
490 Ga0501317_011703 3300049533 Bacteria 1071
491 Ga0501317_013036 3300049533 Bacteria 1034
492 Ga0501317_013935 3300049533 Bacteria 1012
493 Ga0501317_014287 3300049533 Bacteria 1004
494 Ga0501317_015543 3300049533 Bacteria 977
495 Ga0501317_015684 3300049533 Bacteria 974
496 Ga0501317_016831 3300049533 Bacteria 953
497 Ga0501317_022106 3300049533 Bacteria 869
498 Ga0501317_028468 3300049533 Bacteria 799
499 Ga0501318_000001 3300049534 Bacteria 17462
500 Ga0501318_000024 3300049534 Bacteria 6225
501 Ga0501318_000298 3300049534 Bacteria 2899
502 Ga0501318_000818 3300049534 Bacteria 2175
503 Ga0501318_001644 3300049534 Bacteria 1804
504 Ga0501318_002490 3300049534 Bacteria 1601
505 Ga0501318_002759 3300049534 Bacteria 1554
506 Ga0501318_003424 3300049534 Bacteria 1451
507 Ga0501318_003792 3300049534 Bacteria 1410
508 Ga0501318_004315 3300049534 Bacteria 1358
509 Ga0501318_005676 3300049534 Bacteria 1247
510 Ga0501318_011019 3300049534 Bacteria 1015
511 Ga0501318_011670 3300049534 Bacteria 997
512 Ga0501318_011879 3300049534 Bacteria 991
513 Ga0501318_012197 3300049534 Bacteria 982
514 Ga0501318_013420 3300049534 Bacteria 952
515 Ga0501318_013608 3300049534 Bacteria 948
516 Ga0501318_018572 3300049534 Bacteria 860
517 Ga0501318_023432 3300049534 Bacteria 797
518 Ga0501318_040625 3300049534 Bacteria 664
519 Ga0501319_000019 3300049535 Bacteria 5995
520 Ga0501319_000069 3300049535 Bacteria 3482
521 Ga0501319_000384 3300049535 Bacteria 2044
522 Ga0501319_000645 3300049535 Bacteria 1754
523 Ga0501319_000706 3300049535 Bacteria 1699
524 Ga0501319_001463 3300049535 Bacteria 1369
525 Ga0501319_008689 3300049535 Bacteria 786
526 Ga0501320_000031 3300049536 Bacteria 7449
527 Ga0501320_000127 3300049536 Bacteria 3488
528 Ga0501320_000269 3300049536 Bacteria 2795
529 Ga0501320_000417 3300049536 Bacteria 2438
530 Ga0501320_001978 3300049536 Bacteria 1587
531 Ga0501320_002015 3300049536 Bacteria 1578
532 Ga0501320_002282 3300049536 Bacteria 1519
533 Ga0501320_002373 3300049536 Bacteria 1501
534 Ga0501320_002700 3300049536 Bacteria 1442
535 Ga0501320_002917 3300049536 Bacteria 1408
536 Ga0501320_003165 3300049536 Bacteria 1377
537 Ga0501320_004689 3300049536 Bacteria 1216
538 Ga0501320_009426 3300049536 Bacteria 977
539 Ga0501320_012074 3300049536 Bacteria 903
540 Ga0501320_016044 3300049536 Bacteria 824
541 Ga0501320_019099 3300049536 Bacteria 779
542 Ga0501320_020162 3300049536 Bacteria 765
543 Ga0501320_020691 3300049536 Bacteria 759
544 Ga0501320_021555 3300049536 Bacteria 749
545 Ga0501321_000001 3300049537 Bacteria 16207
546 Ga0501321_000032 3300049537 Bacteria 6962
547 Ga0501321_000087 3300049537 Bacteria 4286
548 Ga0501321_000347 3300049537 Bacteria 2848
549 Ga0501321_000467 3300049537 Bacteria 2611
550 Ga0501321_000491 3300049537 Bacteria 2548
551 Ga0501321_000499 3300049537 Bacteria 2534
552 Ga0501321_001102 3300049537 Bacteria 2049
553 Ga0501321_002236 3300049537 Bacteria 1652
554 Ga0501321_002729 3300049537 Bacteria 1558
555 Ga0501321_002739 3300049537 Bacteria 1556
556 Ga0501321_002957 3300049537 Bacteria 1522
557 Ga0501321_003429 3300049537 Bacteria 1449
558 Ga0501321_004237 3300049537 Bacteria 1361
559 Ga0501321_005141 3300049537 Bacteria 1282
560 Ga0501321_006160 3300049537 Bacteria 1211
561 Ga0501322_000105 3300049538 Bacteria 3214
562 Ga0501322_000132 3300049538 Bacteria 2858
563 Ga0501322_000252 3300049538 Bacteria 2333
564 Ga0501322_000299 3300049538 Bacteria 2191
565 Ga0501322_000543 3300049538 Bacteria 1820
566 Ga0501322_000928 3300049538 Bacteria 1525
567 Ga0501322_001241 3300049538 Bacteria 1403
568 Ga0501322_001460 3300049538 Bacteria 1336
569 Ga0501322_001536 3300049538 Bacteria 1315
570 Ga0501322_001589 3300049538 Bacteria 1300
571 Ga0501322_001850 3300049538 Bacteria 1244
572 Ga0501322_002157 3300049538 Bacteria 1187
573 Ga0501322_002560 3300049538 Bacteria 1124
574 Ga0501322_003636 3300049538 Bacteria 1007
575 Ga0501322_004003 3300049538 Bacteria 976
576 Ga0501322_005597 3300049538 Bacteria 873
577 Ga0501322_007581 3300049538 Bacteria 793
578 Ga0501323_000031 3300049539 Bacteria 6387
579 Ga0501323_000123 3300049539 Bacteria 4354
580 Ga0501323_000356 3300049539 Bacteria 3260
581 Ga0501323_000970 3300049539 Bacteria 2369
582 Ga0501323_002019 3300049539 Bacteria 1913
583 Ga0501323_002333 3300049539 Bacteria 1827
584 Ga0501323_002480 3300049539 Bacteria 1791
585 Ga0501323_003662 3300049539 Bacteria 1582
586 Ga0501323_003725 3300049539 Bacteria 1573
587 Ga0501323_005810 3300049539 Bacteria 1363
588 Ga0501323_011309 3300049539 Bacteria 1076
589 Ga0501323_012089 3300049539 Bacteria 1050
590 Ga0501323_016255 3300049539 Bacteria 947
591 Ga0501323_017966 3300049539 Bacteria 912
592 Ga0501323_018051 3300049539 Bacteria 911
593 Ga0501323_033996 3300049539 Bacteria 726
594 Ga0501323_040674 3300049539 Bacteria 681
595 Ga0501324_000001 3300049540 Bacteria 20831
596 Ga0501324_000376 3300049540 Bacteria 2340
597 Ga0501324_000524 3300049540 Bacteria 2114
598 Ga0501324_000689 3300049540 Bacteria 1967
599 Ga0501324_000710 3300049540 Bacteria 1950
600 Ga0501324_000785 3300049540 Bacteria 1900
601 Ga0501324_001688 3300049540 Bacteria 1510
602 Ga0501324_001963 3300049540 Bacteria 1444
603 Ga0501324_003669 3300049540 Bacteria 1188
604 Ga0501324_005987 3300049540 Bacteria 1011
605 Ga0501324_006194 3300049540 Bacteria 1001
606 Ga0501324_006563 3300049540 Bacteria 984
607 Ga0501324_013357 3300049540 Bacteria 777
608 Ga0501325_001449 3300049541 Bacteria 1458
609 Ga0501325_005651 3300049541 Bacteria 1001
610 Ga0501325_006348 3300049541 Bacteria 970
611 Ga0501325_007150 3300049541 Bacteria 938
612 Ga0501325_007390 3300049541 Bacteria 928
613 Ga0501325_014923 3300049541 Bacteria 761
614 Ga0501326_00044 3300049542 Bacteria 3880
615 Ga0501326_00062 3300049542 Bacteria 3234
616 Ga0501326_00067 3300049542 Bacteria 3110
617 Ga0501326_00091 3300049542 Bacteria 2798
618 Ga0501326_00871 3300049542 Bacteria 1305
619 Ga0501326_01125 3300049542 Bacteria 1200
620 Ga0501326_01158 3300049542 Bacteria 1188
621 Ga0501326_04771 3300049542 Bacteria 726
622 Ga0501326_04864 3300049542 Bacteria 721
623 Ga0501326_05272 3300049542 Bacteria 701
624 Ga0501326_05480 3300049542 Bacteria 691
625 Ga0501327_00019 3300049543 Bacteria 5888
626 Ga0501327_00117 3300049543 Bacteria 2454
627 Ga0501327_00746 3300049543 Bacteria 1410
628 Ga0501327_00790 3300049543 Bacteria 1387
629 Ga0501327_00838 3300049543 Bacteria 1359
630 Ga0501327_01108 3300049543 Bacteria 1246
631 Ga0501327_02463 3300049543 Bacteria 963
632 Ga0501327_03045 3300049543 Bacteria 903
633 Ga0501327_04294 3300049543 Bacteria 813
634 Ga0501327_05770 3300049543 Bacteria 738
635 Ga0501327_07798 3300049543 Bacteria 672
636 Ga0501328_00436 3300049544 Bacteria 1394
637 Ga0501328_00481 3300049544 Bacteria 1346
638 Ga0501328_00645 3300049544 Bacteria 1218
639 Ga0501328_00952 3300049544 Bacteria 1080
640 Ga0501328_00989 3300049544 Bacteria 1066
641 Ga0501328_01099 3300049544 Bacteria 1029
642 Ga0501328_01243 3300049544 Bacteria 990
643 Ga0501328_01317 3300049544 Bacteria 969
644 Ga0501328_03444 3300049544 Bacteria 734
645 Ga0501329_00035 3300049545 Bacteria 3186
646 Ga0501329_00315 3300049545 Bacteria 1585
647 Ga0501329_00800 3300049545 Bacteria 1236
648 Ga0501329_00866 3300049545 Bacteria 1207
649 Ga0501329_00892 3300049545 Bacteria 1195
650 Ga0501329_01244 3300049545 Bacteria 1088
651 Ga0501329_02225 3300049545 Bacteria 918
652 Ga0501329_07717 3300049545 Bacteria 635
653 Ga0501330_000008 3300049546 Bacteria 6041
654 Ga0501330_000037 3300049546 Bacteria 3347
655 Ga0501330_000125 3300049546 Bacteria 2480
656 Ga0501330_000317 3300049546 Bacteria 1918
657 Ga0501330_000407 3300049546 Bacteria 1782
658 Ga0501330_000492 3300049546 Bacteria 1701
659 Ga0501330_000601 3300049546 Bacteria 1605
660 Ga0501330_001760 3300049546 Bacteria 1165
661 Ga0501330_001811 3300049546 Bacteria 1156
662 Ga0501330_002688 3300049546 Bacteria 1018
663 Ga0501330_003838 3300049546 Bacteria 914
664 Ga0501330_005449 3300049546 Bacteria 811
665 Ga0501330_005465 3300049546 Bacteria 810
666 Ga0501330_006129 3300049546 Bacteria 781
667 Ga0501330_006271 3300049546 Bacteria 775
668 Ga0501330_006936 3300049546 Bacteria 751
669 Ga0501330_007249 3300049546 Bacteria 740
670 Ga0501330_009894 3300049546 Bacteria 671
671 Ga0501331_00059 3300049547 Bacteria 3195
672 Ga0501331_00433 3300049547 Bacteria 1713
673 Ga0501331_00629 3300049547 Bacteria 1512
674 Ga0501331_00696 3300049547 Bacteria 1462
675 Ga0501331_00926 3300049547 Bacteria 1333
676 Ga0501331_00936 3300049547 Bacteria 1328
677 Ga0501331_01647 3300049547 Bacteria 1111
678 Ga0501331_01698 3300049547 Bacteria 1100
679 Ga0501331_02076 3300049547 Bacteria 1025
680 Ga0501331_02440 3300049547 Bacteria 964
681 Ga0501331_02682 3300049547 Bacteria 932
682 Ga0501331_03622 3300049547 Bacteria 837
683 Ga0501332_00020 3300049548 Bacteria 4348
684 Ga0501332_00078 3300049548 Bacteria 2904
685 Ga0501332_00243 3300049548 Bacteria 2175
686 Ga0501332_00266 3300049548 Bacteria 2132
687 Ga0501332_00341 3300049548 Bacteria 1961
688 Ga0501332_00637 3300049548 Bacteria 1616
689 Ga0501332_00665 3300049548 Bacteria 1594
690 Ga0501332_00684 3300049548 Bacteria 1578
691 Ga0501332_01348 3300049548 Bacteria 1272
692 Ga0501332_01615 3300049548 Bacteria 1198
693 Ga0501332_01672 3300049548 Bacteria 1185
694 Ga0501332_01675 3300049548 Bacteria 1184
695 Ga0501332_01723 3300049548 Bacteria 1175
696 Ga0501332_02115 3300049548 Bacteria 1093
697 Ga0501332_02342 3300049548 Bacteria 1056
698 Ga0501332_02477 3300049548 Bacteria 1034
699 Ga0501332_05071 3300049548 Bacteria 799
700 Ga0501332_05167 3300049548 Bacteria 795
701 Ga0501332_08201 3300049548 Bacteria 675
702 Ga0501333_000472 3300049549 Bacteria 1851
703 Ga0501333_000570 3300049549 Bacteria 1750
704 Ga0501333_000866 3300049549 Bacteria 1522
705 Ga0501333_000901 3300049549 Bacteria 1503
706 Ga0501333_001066 3300049549 Bacteria 1418
707 Ga0501333_001090 3300049549 Bacteria 1410
708 Ga0501333_001171 3300049549 Bacteria 1374
709 Ga0501333_001406 3300049549 Bacteria 1295
710 Ga0501333_001759 3300049549 Bacteria 1208
711 Ga0501333_003430 3300049549 Bacteria 967
712 Ga0501333_005443 3300049549 Bacteria 826
713 Ga0501333_016820 3300049549 Bacteria 562
714 Ga0501334_00027 3300049550 Bacteria 4527
715 Ga0501334_00363 3300049550 Bacteria 2010
716 Ga0501334_00459 3300049550 Bacteria 1856
717 Ga0501334_00734 3300049550 Bacteria 1619
718 Ga0501334_00737 3300049550 Bacteria 1619
719 Ga0501334_00968 3300049550 Bacteria 1498
720 Ga0501334_01673 3300049550 Bacteria 1255
721 Ga0501334_02009 3300049550 Bacteria 1176
722 Ga0501334_02111 3300049550 Bacteria 1160
723 Ga0501334_02951 3300049550 Bacteria 1035
724 Ga0501334_03141 3300049550 Bacteria 1014
725 Ga0501334_04281 3300049550 Bacteria 912
726 Ga0501334_06114 3300049550 Bacteria 806
727 Ga0501334_06310 3300049550 Bacteria 797
728 Ga0501334_07694 3300049550 Bacteria 746
729 Ga0501334_09103 3300049550 Bacteria 703
730 Ga0501334_09125 3300049550 Bacteria 702
731 Ga0501334_12023 3300049550 Bacteria 639
732 Ga0501334_15255 3300049550 Bacteria 587
733 Ga0501335_000302 3300049551 Bacteria 2914
734 Ga0501335_000498 3300049551 Bacteria 2548
735 Ga0501335_000773 3300049551 Bacteria 2220
736 Ga0501335_001090 3300049551 Bacteria 2005
737 Ga0501335_001188 3300049551 Bacteria 1952
738 Ga0501335_001538 3300049551 Bacteria 1781
739 Ga0501335_002243 3300049551 Bacteria 1556
740 Ga0501335_002274 3300049551 Bacteria 1546
741 Ga0501335_002567 3300049551 Bacteria 1483
742 Ga0501335_002676 3300049551 Bacteria 1459
743 Ga0501335_002687 3300049551 Bacteria 1456
744 Ga0501335_003105 3300049551 Bacteria 1390
745 Ga0501335_003177 3300049551 Bacteria 1380
746 Ga0501335_003478 3300049551 Bacteria 1336
747 Ga0501335_005174 3300049551 Bacteria 1159
748 Ga0501335_005478 3300049551 Bacteria 1134
749 Ga0501335_006284 3300049551 Bacteria 1079
750 Ga0501335_007098 3300049551 Bacteria 1030
751 Ga0501335_007283 3300049551 Bacteria 1021
752 Ga0501335_007830 3300049551 Bacteria 994
753 Ga0501335_013736 3300049551 Bacteria 812
754 Ga0501335_016994 3300049551 Bacteria 753
755 Ga0501335_025230 3300049551 Bacteria 651
756 Ga0501335_030659 3300049551 Bacteria 607
757 Ga0501336_000609 3300049552 Bacteria 1866
758 Ga0501336_000828 3300049552 Bacteria 1688
759 Ga0501336_001137 3300049552 Bacteria 1533
760 Ga0501336_001437 3300049552 Bacteria 1416
761 Ga0501336_002910 3300049552 Bacteria 1129
762 Ga0501336_006544 3300049552 Bacteria 867
763 Ga0501336_010732 3300049552 Bacteria 738
764 Ga0501336_013469 3300049552 Bacteria 685
765 Ga0501337_000088 3300049553 Bacteria 3392
766 Ga0501337_000166 3300049553 Bacteria 2709
767 Ga0501337_000595 3300049553 Bacteria 1839
768 Ga0501337_000600 3300049553 Bacteria 1834
769 Ga0501337_000691 3300049553 Bacteria 1748
770 Ga0501337_000787 3300049553 Bacteria 1673
771 Ga0501337_000931 3300049553 Bacteria 1583
772 Ga0501337_001054 3300049553 Bacteria 1518
773 Ga0501337_001378 3300049553 Bacteria 1382
774 Ga0501337_002200 3300049553 Bacteria 1179
775 Ga0501337_003060 3300049553 Bacteria 1051
776 Ga0501337_003654 3300049553 Bacteria 984
777 Ga0501337_003656 3300049553 Bacteria 983
778 Ga0501337_006352 3300049553 Bacteria 806
779 Ga0501337_009883 3300049553 Bacteria 689
780 Ga0501338_00091 3300049554 Bacteria 2839
781 Ga0501338_00372 3300049554 Bacteria 1954
782 Ga0501338_00462 3300049554 Bacteria 1834
783 Ga0501338_00522 3300049554 Bacteria 1765
784 Ga0501338_00860 3300049554 Bacteria 1501
785 Ga0501338_01003 3300049554 Bacteria 1431
786 Ga0501338_01138 3300049554 Bacteria 1371
787 Ga0501338_01360 3300049554 Bacteria 1295
788 Ga0501338_02114 3300049554 Bacteria 1116
789 Ga0501338_02435 3300049554 Bacteria 1059
790 Ga0501338_02726 3300049554 Bacteria 1016
791 Ga0501338_03865 3300049554 Bacteria 897
792 Ga0501338_05806 3300049554 Bacteria 771
793 Ga0501339_00045 3300049555 Bacteria 1563
794 Ga0501339_00190 3300049555 Bacteria 1078
795 Ga0501339_01020 3300049555 Bacteria 663
796 Ga0501340_000099 3300049556 Bacteria 2752
797 Ga0501340_000251 3300049556 Bacteria 2075
798 Ga0501340_000443 3300049556 Bacteria 1806
799 Ga0501340_001102 3300049556 Bacteria 1394
800 Ga0501340_002204 3300049556 Bacteria 1112
801 Ga0501340_005656 3300049556 Bacteria 821
802 Ga0501340_007990 3300049556 Bacteria 739
803 Ga0501340_008097 3300049556 Bacteria 736
804 Ga0501036_0848464 3300049572 Bacteria 751
805 Ga0501198_016157 3300049649 Bacteria 1152
806 Ga0501207_087078 3300049654 Bacteria 609
807 Ga0501216_160988 3300049660 Bacteria 538
808 Ga0501217_004344 3300049661 Bacteria 2908
809 Ga0501224_008303 3300049664 Bacteria 1514
810 Ga0501235_063173 3300049669 Bacteria 869
811 Ga0501221_007234 3300049704 Bacteria 1898
812 Ga0501234_049249 3300049707 Bacteria 699
813 Ga0501081_0481337 3300049743 Bacteria 924
814 Ga0501266_050672 3300049763 Bacteria 641
815 Ga0501270_001993 3300049767 Bacteria 2040
816 Ga0501279_005794 3300049775 Bacteria 1626
817 nmdc:mga00v17_52062_c2 3300050491 Bacteria 1747
818 Ga0587084_005577 3300059477 Bacteria 1495
819 Ga0587098_012104 3300059604 Bacteria 983
820 Ga0587072_080691 3300059643 Bacteria 702

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049128 Ga0501308_009537 Ga0501308_009537_409_951 161
2 3300049163 Ga0501342_00411 Ga0501342_00411_510_1052 161
3 3300032168 Ga0316593_10001905 Ga0316593_100019054 162
4 3300032168 Ga0316593_10140254 Ga0316593_101402541 162
5 3300032168 Ga0316593_10279196 Ga0316593_102791961 162
6 3300033524 Ga0316592_1019780 Ga0316592_10197802 162
7 3300033541 Ga0316596_1022867 Ga0316596_10228673 162
8 3300049133 Ga0501344_07923 Ga0501344_07923_28_516 162
9 iso_pu_bacteria 2511231119 2511697987 162
10 iso_pu_bacteria 2540341094 2540605211 162
11 iso_pu_bacteria 2545555800 2545559774 162
12 iso_pu_bacteria 2551306519 2553395065 162
13 iso_pu_bacteria 2576861599 2578930731 162
14 iso_pu_bacteria 2593339131 2595092257 162
15 iso_pu_bacteria 2643221729 2644705745 162
16 iso_pu_bacteria 2643221730 2644713266 162
17 iso_pu_bacteria 2648501850 2651530342 162
18 iso_pu_bacteria 2671180330 2672333574 162
19 iso_pu_bacteria 2671180844 2674421103 162
20 iso_pu_bacteria 2684622632 2685148222 162
21 iso_pu_bacteria 2695420354 2695629907 162
22 iso_pu_bacteria 2695420987 2698319648 162
23 iso_pu_bacteria 2703719227 2705991993 162
24 iso_pu_bacteria 2716884898 2717918194 162
25 iso_pu_bacteria 2718218445 2721503421 162
26 iso_pu_bacteria 2738541295 2738817088 162
27 iso_pu_bacteria 2738541358 2739160150 162
28 iso_pu_bacteria 2738543006 2739212624 162
29 iso_pu_bacteria 2738543010 2739234650 162
30 iso_pu_bacteria 2738543017 2739271678 162
31 iso_pu_bacteria 2757320391 2757568892 162
32 iso_pu_bacteria 2775507177 2777764223 162
33 iso_pu_bacteria 2775507192 2777837298 162
34 iso_pu_bacteria 2808606364 2808871163 162
35 iso_pu_bacteria 2808606399 2809057200 162
36 iso_pu_bacteria 2816332186 2816866393 162
37 iso_pu_bacteria 2816332295 2817478176 162
38 iso_pu_bacteria 2818991441 2819571016 162
39 iso_pu_bacteria 2818991443 2819585022 162
40 iso_pu_bacteria 2842682962 2842688261 162
41 iso_pu_bacteria 2849139964 2849144955 162
42 iso_pu_bacteria 2852673933 2852676603 162
43 iso_pu_bacteria 2857581216 2857586497 162
44 iso_pu_bacteria 2857586860 2857590970 162
45 iso_pu_bacteria 2857604169 2857608883 162
46 iso_pu_bacteria 2857609550 2857613406 162
47 iso_pu_bacteria 2860837431 2860837566 162
48 iso_pu_bacteria 2877768649 2877768785 162
49 iso_pu_bacteria 2880169592 2880169727 162
50 iso_pu_bacteria 2897109615 2897109754 162
51 iso_pu_bacteria 2904560550 2904564576 162
52 iso_pu_bacteria 2916971899 2916972063 162
53 iso_pu_bacteria 2919414237 2919419340 162
54 iso_pu_bacteria 2929233124 2929233248 162
55 iso_pu_bacteria 2936340661 2936343045 162
56 iso_pu_bacteria 2936361878 2936363679 162
57 iso_pu_bacteria 2938917290 2938917418 162
58 iso_pu_bacteria 2947426588 2947426716 162
59 iso_pu_bacteria 2956897341 2956900784 162
60 iso_pu_bacteria 2962290636 2962290777 162
61 iso_pu_bacteria 2965761152 2965761280 162
62 iso_pu_bacteria 2969136845 2969136984 162
63 iso_pu_bacteria 2969141011 2969141153 162
64 iso_pu_bacteria 2969765954 2969766267 162
65 iso_pu_bacteria 2969770375 2969774935 162
66 iso_pu_bacteria 2971893375 2971893514 162
67 iso_pu_bacteria 2977254563 2977254708 162
68 iso_pu_bacteria 2979083700 2979083726 162
69 iso_pu_bacteria 2980492589 2980492728 162
70 iso_pu_bacteria 2990275345 2990275711 162
71 iso_pu_bacteria 3001267043 3001271856 162
72 iso_pu_bacteria 3001272096 3001275942 162
73 iso_pu_bacteria 3001892409 3001898809 162
74 iso_pu_bacteria 3006858327 3006858504 162
75 iso_pu_bacteria 3006879489 3006883615 162
76 iso_pu_bacteria 3006969106 3006973798 162
77 iso_pu_bacteria 3006973921 3006978371 162
78 iso_pu_bacteria 3006978542 3006980041 162
79 iso_pu_bacteria 3006984091 3006988364 162
80 iso_pu_bacteria 3006988479 3006993229 162
81 iso_pu_bacteria 8022621104 8022621201 162
82 iso_pu_bacteria 8022630665 8022631654 162
83 iso_pu_bacteria 8022653035 8022655864 162
84 iso_pu_bacteria 8022792930 8022799041 162
85 iso_pu_bacteria 8022948649 8022950785 162
86 iso_pu_bacteria 8023438354 8023439797 162
87 iso_pu_bacteria 8023444577 8023447376 162
88 iso_pu_bacteria 8051952484 8051956497 162
89 iso_pu_bacteria 8052174270 8052174973 162
90 iso_pu_bacteria 8054280661 8054282850 162
91 iso_pu_bacteria 8057582654 8057582783 162
92 iso_pu_bacteria 8057632132 8057632269 162
93 3300039062 Ga0400483_036566 Ga0400483_036566_27459_28028 163
94 iso_pu_bacteria 3006826541 3006828900 163
95 3300049128 Ga0501308_007631 Ga0501308_007631_262_759 165
96 3300049131 Ga0501341_01688 Ga0501341_01688_492_1043 165
97 3300049132 Ga0501343_003404 Ga0501343_003404_492_1043 165
98 3300049161 Ga0501305_007330 Ga0501305_007330_521_1072 165
99 3300049527 Ga0501311_006182 Ga0501311_006182_289_840 165
100 3300049528 Ga0501312_011808 Ga0501312_011808_121_672 165
101 3300049531 Ga0501315_009293 Ga0501315_009293_267_767 165
102 3300049532 Ga0501316_004648 Ga0501316_004648_504_1055 165
103 3300049533 Ga0501317_010514 Ga0501317_010514_498_1049 165
104 3300049537 Ga0501321_006160 Ga0501321_006160_156_707 165
105 3300049538 Ga0501322_000928 Ga0501322_000928_281_781 165
106 3300049538 Ga0501322_001460 Ga0501322_001460_646_1197 165
107 3300049539 Ga0501323_003662 Ga0501323_003662_324_824 165
108 3300049547 Ga0501331_01647 Ga0501331_01647_78_629 165
109 3300049548 Ga0501332_02115 Ga0501332_02115_492_1043 165
110 3300049549 Ga0501333_001171 Ga0501333_001171_473_1024 165
111 3300049552 Ga0501336_013469 Ga0501336_013469_35_532 165
112 3300049554 Ga0501338_02114 Ga0501338_02114_484_1035 165
113 3300002987 JGI25159J45721_1010242 JGI25159J45721_10102423 166
114 3300003187 JGI25151J46595_10003308 JGI25151J46595_1000330813 166
115 3300003187 JGI25151J46595_10015464 JGI25151J46595_100154643 166
116 3300003187 JGI25151J46595_10020964 JGI25151J46595_100209643 166
117 3300003187 JGI25151J46595_10120394 JGI25151J46595_101203941 166
118 3300003316 rootH1_10000848 rootH1_1000084822 166
119 3300003322 rootL2_10052955 rootL2_1005295522 166
120 3300003323 rootH1_10338537 rootH1_103385371 166
121 3300003567 Ga0006554J51385_1040874 Ga0006554J51385_10408741 166
122 3300003578 Ga0006562J51391_1000046 Ga0006562J51391_100004622 166
123 3300003578 Ga0006562J51391_1001816 Ga0006562J51391_100181611 166
124 3300003758 Ga0055532_1000639 Ga0055532_10006392 166
125 3300003758 Ga0055532_1011725 Ga0055532_10117251 166
126 3300003781 Ga0055536_1017217 Ga0055536_10172173 166
127 3300003790 Ga0055528_1001614 Ga0055528_100161415 166
128 3300005289 Ga0065704_10199215 Ga0065704_101992151 166
129 3300005328 Ga0070676_10006452 Ga0070676_100064523 166
130 3300005331 Ga0070670_100020078 Ga0070670_1000200783 166
131 3300005347 Ga0070668_100878893 Ga0070668_1008788931 166
132 3300005354 Ga0070675_100353975 Ga0070675_1003539753 166
133 3300005355 Ga0070671_100011607 Ga0070671_1000116073 166
134 3300005364 Ga0070673_101155415 Ga0070673_1011554151 166
135 3300005435 Ga0070714_100368702 Ga0070714_1003687022 166
136 3300005543 Ga0070672_100025082 Ga0070672_1000250827 166
137 3300005834 Ga0068851_10240610 Ga0068851_102406102 166
138 3300006051 Ga0075364_10154797 Ga0075364_101547972 166
139 3300009011 Ga0105251_10084853 Ga0105251_100848532 166
140 3300009011 Ga0105251_10190388 Ga0105251_101903881 166
141 3300009011 Ga0105251_10240151 Ga0105251_102401511 166
142 3300009036 Ga0105244_10002721 Ga0105244_100027216 166
143 3300009036 Ga0105244_10026966 Ga0105244_100269664 166
144 3300009092 Ga0105250_10018759 Ga0105250_100187592 166
145 3300009098 Ga0105245_10129583 Ga0105245_101295832 166
146 3300009101 Ga0105247_10000354 Ga0105247_1000035450 166
147 3300009148 Ga0105243_10000301 Ga0105243_1000030149 166
148 3300009176 Ga0105242_10004076 Ga0105242_100040764 166
149 3300009553 Ga0105249_10045229 Ga0105249_100452294 166
150 3300009553 Ga0105249_10150804 Ga0105249_101508043 166
151 3300011119 Ga0105246_10000077 Ga0105246_1000007715 166
152 3300011119 Ga0105246_10069223 Ga0105246_100692232 166
153 3300011119 Ga0105246_11096725 Ga0105246_110967252 166
154 3300013296 Ga0157374_10013578 Ga0157374_100135787 166
155 3300013297 Ga0157378_10000237 Ga0157378_1000023748 166
156 3300013307 Ga0157372_10031582 Ga0157372_100315822 166
157 3300014745 Ga0157377_10002894 Ga0157377_1000289411 166
158 3300014969 Ga0157376_10014258 Ga0157376_100142582 166
159 3300022467 Ga0224712_10143126 Ga0224712_101431262 166
160 3300023309 Ga0256744_107689 Ga0256744_1076891 166
161 3300023436 Ga0256743_121847 Ga0256743_1218471 166
162 3300025229 Ga0209147_100198 Ga0209147_10019822 166
163 3300025229 Ga0209147_100385 Ga0209147_1003858 166
164 3300025229 Ga0209147_100806 Ga0209147_1008067 166
165 3300025273 Ga0209673_1001881 Ga0209673_100188111 166
166 3300025284 Ga0209130_1010542 Ga0209130_10105422 166
167 3300025284 Ga0209130_1031812 Ga0209130_10318122 166
168 3300025291 Ga0209675_1017850 Ga0209675_10178502 166
169 3300025292 Ga0209676_1002029 Ga0209676_10020294 166
170 3300025294 Ga0209025_1001468 Ga0209025_10014688 166
171 3300025294 Ga0209025_1002868 Ga0209025_100286812 166
172 3300025294 Ga0209025_1005659 Ga0209025_10056598 166
173 3300025294 Ga0209025_1012291 Ga0209025_10122917 166
174 3300025294 Ga0209025_1021451 Ga0209025_10214514 166
175 3300025299 Ga0209256_1042538 Ga0209256_10425382 166
176 3300025302 Ga0207426_1008659 Ga0207426_10086594 166
177 3300025711 Ga0207696_1004774 Ga0207696_10047749 166
178 3300025711 Ga0207696_1026745 Ga0207696_10267452 166
179 3300025711 Ga0207696_1026746 Ga0207696_10267462 166
180 3300025711 Ga0207696_1048628 Ga0207696_10486281 166
181 3300025728 Ga0207655_1002102 Ga0207655_10021025 166
182 3300025728 Ga0207655_1007619 Ga0207655_10076192 166
183 3300025728 Ga0207655_1037450 Ga0207655_10374503 166
184 3300025735 Ga0207713_1000405 Ga0207713_100040555 166
185 3300025735 Ga0207713_1030881 Ga0207713_10308813 166
186 3300025900 Ga0207710_10081486 Ga0207710_100814862 166
187 3300025901 Ga0207688_10252699 Ga0207688_102526992 166
188 3300025905 Ga0207685_10072512 Ga0207685_100725122 166
189 3300025907 Ga0207645_10036479 Ga0207645_100364793 166
190 3300025925 Ga0207650_10013760 Ga0207650_100137609 166
191 3300025927 Ga0207687_10095721 Ga0207687_100957212 166
192 3300025929 Ga0207664_10183769 Ga0207664_101837692 166
193 3300025931 Ga0207644_10001801 Ga0207644_100018018 166
194 3300025934 Ga0207686_10004946 Ga0207686_1000494611 166
195 3300025935 Ga0207709_10000416 Ga0207709_1000041653 166
196 3300025935 Ga0207709_10036548 Ga0207709_100365484 166
197 3300025940 Ga0207691_10039329 Ga0207691_100393293 166
198 3300025960 Ga0207651_11010711 Ga0207651_110107111 166
199 3300025961 Ga0207712_10048314 Ga0207712_100483144 166
200 3300025961 Ga0207712_10566351 Ga0207712_105663511 166
201 3300027312 Ga0209371_1002074 Ga0209371_10020743 166
202 3300027614 Ga0209970_1002684 Ga0209970_10026843 166
203 3300027876 Ga0209974_10123404 Ga0209974_101234042 166
204 3300029273 Ga0311008_128370 Ga0311008_1283702 166
205 3300029280 Ga0311011_132806 Ga0311011_1328061 166
206 3300030083 Ga0237817_10339 Ga0237817_103395 166
207 3300030500 Ga0268256_1001830 Ga0268256_10018308 166
208 3300031548 Ga0307408_100017547 Ga0307408_1000175473 166
209 3300031548 Ga0307408_100032918 Ga0307408_1000329184 166
210 3300031548 Ga0307408_100084584 Ga0307408_1000845842 166
211 3300031731 Ga0307405_10021522 Ga0307405_100215223 166
212 3300031852 Ga0307410_10121991 Ga0307410_101219912 166
213 3300031901 Ga0307406_10133880 Ga0307406_101338802 166
214 3300031903 Ga0307407_10029070 Ga0307407_100290703 166
215 3300031911 Ga0307412_10067261 Ga0307412_100672612 166
216 3300031911 Ga0307412_11135294 Ga0307412_111352942 166
217 3300031995 Ga0307409_100018876 Ga0307409_1000188767 166
218 3300031995 Ga0307409_100071775 Ga0307409_1000717753 166
219 3300031995 Ga0307409_100088345 Ga0307409_1000883453 166
220 3300032002 Ga0307416_100018258 Ga0307416_1000182584 166
221 3300032002 Ga0307416_100044091 Ga0307416_1000440914 166
222 3300032002 Ga0307416_100078459 Ga0307416_1000784593 166
223 3300032002 Ga0307416_100078727 Ga0307416_1000787272 166
224 3300032002 Ga0307416_101756763 Ga0307416_1017567631 166
225 3300032002 Ga0307416_101880348 Ga0307416_1018803482 166
226 3300037068 Ga0373925_1096714 Ga0373925_1096714_112_612 166
227 3300037466 Ga0395898_0345618 Ga0395898_0345618_515_1015 166
228 3300038443 Ga0395901_1207195 Ga0395901_1207195_76_576 166
229 3300038705 Ga0237819_01772 Ga0237819_01772_2441_2941 166
230 3300042138 Ga0450903_006304 Ga0450903_006304_1327_1860 166
231 3300044765 Ga0466970_0084252 Ga0466970_0084252_694_1194 166
232 3300044842 Ga0466957_0189338 Ga0466957_0189338_810_1310 166
233 3300045976 Ga0466967_0016145 Ga0466967_0016145_3323_3823 166
234 3300046455 Ga0495603_0158016 Ga0495603_0158016_276_776 166
235 3300046457 Ga0495590_0209419 Ga0495590_0209419_21_521 166
236 3300046474 Ga0495605_0031123 Ga0495605_0031123_554_1054 166
237 3300046474 Ga0495605_0262900 Ga0495605_0262900_115_615 166
238 3300046492 Ga0495585_0012105 Ga0495585_0012105_3936_4436 166
239 3300046501 Ga0495607_0172495 Ga0495607_0172495_375_875 166
240 3300046501 Ga0495607_0172829 Ga0495607_0172829_49_549 166
241 3300046515 Ga0495620_0076343 Ga0495620_0076343_557_1090 166
242 3300046518 Ga0495631_0049769 Ga0495631_0049769_478_978 166
243 3300046520 Ga0495637_0032797 Ga0495637_0032797_1526_2026 166
244 3300046530 Ga0495654_0109347 Ga0495654_0109347_334_834 166
245 3300046530 Ga0495654_0142436 Ga0495654_0142436_492_992 166
246 3300046557 Ga0495622_0074070 Ga0495622_0074070_15_515 166
247 3300046558 Ga0495633_0169536 Ga0495633_0169536_423_923 166
248 3300046558 Ga0495633_0186861 Ga0495633_0186861_56_556 166
249 3300046665 Ga0495661_0071169 Ga0495661_0071169_990_1490 166
250 3300046665 Ga0495661_0100675 Ga0495661_0100675_139_639 166
251 3300046674 Ga0495588_0137532 Ga0495588_0137532_494_994 166
252 3300046694 Ga0495649_0154990 Ga0495649_0154990_215_715 166
253 3300046794 Ga0495589_0058132 Ga0495589_0058132_122_622 166
254 3300046794 Ga0495589_0153466 Ga0495589_0153466_13_513 166
255 3300046810 Ga0495660_0031747 Ga0495660_0031747_996_1496 166
256 3300047321 Ga0495676_0059397 Ga0495676_0059397_275_775 166
257 3300047323 Ga0495683_0040440 Ga0495683_0040440_449_949 166
258 3300048089 Ga0495614_0511392 Ga0495614_0511392_28_528 166
259 3300048091 Ga0495626_0095378 Ga0495626_0095378_348_848 166
260 3300048091 Ga0495626_0096944 Ga0495626_0096944_770_1270 166
261 3300048091 Ga0495626_0288536 Ga0495626_0288536_116_616 166
262 3300048903 Ga0496100_0005282 Ga0496100_0005282_3782_4282 166
263 3300048903 Ga0496100_0024474 Ga0496100_0024474_1042_1542 166
264 3300048904 Ga0496101_0005141 Ga0496101_0005141_549_1049 166
265 3300048904 Ga0496101_1153832 Ga0496101_1153832_31_531 166
266 3300048905 Ga0496102_0004480 Ga0496102_0004480_8034_8534 166
267 3300048905 Ga0496102_0010275 Ga0496102_0010275_4892_5392 166
268 3300048905 Ga0496102_0088719 Ga0496102_0088719_2081_2581 166
269 3300048905 Ga0496102_0395441 Ga0496102_0395441_14_514 166
270 3300048906 Ga0496103_0001500 Ga0496103_0001500_5020_5520 166
271 3300048906 Ga0496103_0084122 Ga0496103_0084122_281_781 166
272 3300048906 Ga0496103_0157507 Ga0496103_0157507_848_1348 166
273 3300048907 Ga0496104_0001186 Ga0496104_0001186_7275_7775 166
274 3300048907 Ga0496104_0461315 Ga0496104_0461315_337_837 166
275 3300048907 Ga0496104_1160721 Ga0496104_1160721_139_639 166
276 3300048908 Ga0496105_0000964 Ga0496105_0000964_19157_19657 166
277 3300048909 Ga0496106_0000361 Ga0496106_0000361_19156_19656 166
278 3300048910 Ga0496107_0000282 Ga0496107_0000282_7266_7766 166
279 3300048910 Ga0496107_0949094 Ga0496107_0949094_15_515 166
280 3300048911 Ga0496108_0000443 Ga0496108_0000443_27351_27851 166
281 3300048911 Ga0496108_0581022 Ga0496108_0581022_252_785 166
282 3300048912 Ga0496109_0000778 Ga0496109_0000778_1380_1880 166
283 3300048912 Ga0496109_0663898 Ga0496109_0663898_177_677 166
284 3300048913 Ga0496110_0002382 Ga0496110_0002382_9808_10308 166
285 3300048913 Ga0496110_0017564 Ga0496110_0017564_371_904 166
286 3300048913 Ga0496110_0200253 Ga0496110_0200253_408_908 166
287 3300048913 Ga0496110_0412443 Ga0496110_0412443_306_806 166
288 3300048914 Ga0496111_0000191 Ga0496111_0000191_25064_25564 166
289 3300048914 Ga0496111_0254096 Ga0496111_0254096_338_871 166
290 3300048915 Ga0496112_0006179 Ga0496112_0006179_1508_2008 166
291 3300048915 Ga0496112_0584989 Ga0496112_0584989_165_665 166
292 3300048916 Ga0496113_0001366 Ga0496113_0001366_9119_9619 166
293 3300048916 Ga0496113_0421841 Ga0496113_0421841_196_765 166
294 3300048919 Ga0496116_0001671 Ga0496116_0001671_4531_5031 166
295 3300048921 Ga0496118_0128487 Ga0496118_0128487_407_907 166
296 3300048922 Ga0496119_0005613 Ga0496119_0005613_4461_4961 166
297 3300048923 Ga0496120_0007962 Ga0496120_0007962_406_906 166
298 3300048924 Ga0496121_0190119 Ga0496121_0190119_685_1185 166
299 3300048925 Ga0496122_0013343 Ga0496122_0013343_2657_3157 166
300 3300048926 Ga0496123_0004637 Ga0496123_0004637_2278_2778 166
301 3300048927 Ga0496124_0366352 Ga0496124_0366352_432_932 166
302 3300048928 Ga0496125_0004215 Ga0496125_0004215_5367_5867 166
303 3300048929 Ga0496126_0005295 Ga0496126_0005295_4493_4993 166
304 3300048929 Ga0496126_0203454 Ga0496126_0203454_731_1231 166
305 3300049127 Ga0501306_000031 Ga0501306_000031_4685_5185 166
306 3300049127 Ga0501306_000487 Ga0501306_000487_1491_1991 166
307 3300049127 Ga0501306_000497 Ga0501306_000497_148_648 166
308 3300049127 Ga0501306_000655 Ga0501306_000655_1804_2337 166
309 3300049127 Ga0501306_000823 Ga0501306_000823_1641_2141 166
310 3300049127 Ga0501306_002549 Ga0501306_002549_977_1534 166
311 3300049127 Ga0501306_002657 Ga0501306_002657_1312_1812 166
312 3300049127 Ga0501306_002851 Ga0501306_002851_896_1429 166
313 3300049127 Ga0501306_005690 Ga0501306_005690_596_1096 166
314 3300049127 Ga0501306_008207 Ga0501306_008207_423_923 166
315 3300049127 Ga0501306_010846 Ga0501306_010846_153_653 166
316 3300049127 Ga0501306_010893 Ga0501306_010893_220_771 166
317 3300049127 Ga0501306_016240 Ga0501306_016240_382_915 166
318 3300049127 Ga0501306_018331 Ga0501306_018331_283_783 166
319 3300049127 Ga0501306_025160 Ga0501306_025160_138_695 166
320 3300049128 Ga0501308_000210 Ga0501308_000210_490_990 166
321 3300049128 Ga0501308_000287 Ga0501308_000287_436_936 166
322 3300049128 Ga0501308_001173 Ga0501308_001173_1169_1669 166
323 3300049128 Ga0501308_001804 Ga0501308_001804_348_905 166
324 3300049128 Ga0501308_002976 Ga0501308_002976_501_1034 166
325 3300049128 Ga0501308_007120 Ga0501308_007120_516_1016 166
326 3300049128 Ga0501308_010300 Ga0501308_010300_362_862 166
327 3300049128 Ga0501308_015575 Ga0501308_015575_184_684 166
328 3300049128 Ga0501308_015714 Ga0501308_015714_123_623 166
329 3300049128 Ga0501308_049974 Ga0501308_049974_56_556 166
330 3300049129 Ga0501309_000397 Ga0501309_000397_700_1200 166
331 3300049129 Ga0501309_000721 Ga0501309_000721_697_1197 166
332 3300049129 Ga0501309_001124 Ga0501309_001124_1544_2077 166
333 3300049129 Ga0501309_001463 Ga0501309_001463_574_1074 166
334 3300049129 Ga0501309_004530 Ga0501309_004530_530_1087 166
335 3300049129 Ga0501309_009266 Ga0501309_009266_144_644 166
336 3300049129 Ga0501309_009744 Ga0501309_009744_575_1093 166
337 3300049129 Ga0501309_010365 Ga0501309_010365_306_806 166
338 3300049129 Ga0501309_010425 Ga0501309_010425_551_1051 166
339 3300049129 Ga0501309_011785 Ga0501309_011785_336_836 166
340 3300049129 Ga0501309_012054 Ga0501309_012054_294_794 166
341 3300049129 Ga0501309_016993 Ga0501309_016993_390_890 166
342 3300049129 Ga0501309_018957 Ga0501309_018957_156_656 166
343 3300049129 Ga0501309_020222 Ga0501309_020222_386_886 166
344 3300049129 Ga0501309_041714 Ga0501309_041714_69_647 166
345 3300049130 Ga0501310_000371 Ga0501310_000371_2845_3345 166
346 3300049130 Ga0501310_000609 Ga0501310_000609_2318_2818 166
347 3300049130 Ga0501310_000857 Ga0501310_000857_1725_2282 166
348 3300049130 Ga0501310_002612 Ga0501310_002612_633_1133 166
349 3300049130 Ga0501310_004235 Ga0501310_004235_538_1071 166
350 3300049130 Ga0501310_006601 Ga0501310_006601_121_621 166
351 3300049130 Ga0501310_006974 Ga0501310_006974_555_1055 166
352 3300049130 Ga0501310_009588 Ga0501310_009588_506_1039 166
353 3300049130 Ga0501310_010851 Ga0501310_010851_396_896 166
354 3300049130 Ga0501310_022388 Ga0501310_022388_118_618 166
355 3300049130 Ga0501310_022856 Ga0501310_022856_116_616 166
356 3300049130 Ga0501310_027440 Ga0501310_027440_72_572 166
357 3300049131 Ga0501341_00221 Ga0501341_00221_1066_1566 166
358 3300049131 Ga0501341_00334 Ga0501341_00334_1176_1676 166
359 3300049131 Ga0501341_00479 Ga0501341_00479_629_1129 166
360 3300049131 Ga0501341_00629 Ga0501341_00629_500_1033 166
361 3300049131 Ga0501341_00736 Ga0501341_00736_593_1093 166
362 3300049131 Ga0501341_01229 Ga0501341_01229_437_994 166
363 3300049131 Ga0501341_01444 Ga0501341_01444_58_558 166
364 3300049131 Ga0501341_01463 Ga0501341_01463_336_836 166
365 3300049131 Ga0501341_01501 Ga0501341_01501_58_558 166
366 3300049131 Ga0501341_01901 Ga0501341_01901_199_699 166
367 3300049131 Ga0501341_01954 Ga0501341_01954_345_845 166
368 3300049131 Ga0501341_02729 Ga0501341_02729_337_837 166
369 3300049131 Ga0501341_03484 Ga0501341_03484_15_515 166
370 3300049131 Ga0501341_06393 Ga0501341_06393_79_579 166
371 3300049131 Ga0501341_07510 Ga0501341_07510_38_538 166
372 3300049131 Ga0501341_08287 Ga0501341_08287_27_527 166
373 3300049132 Ga0501343_000282 Ga0501343_000282_512_1012 166
374 3300049132 Ga0501343_000622 Ga0501343_000622_137_637 166
375 3300049132 Ga0501343_000822 Ga0501343_000822_1030_1530 166
376 3300049132 Ga0501343_000841 Ga0501343_000841_793_1293 166
377 3300049132 Ga0501343_001825 Ga0501343_001825_549_1049 166
378 3300049132 Ga0501343_002064 Ga0501343_002064_265_765 166
379 3300049132 Ga0501343_002725 Ga0501343_002725_630_1130 166
380 3300049132 Ga0501343_002867 Ga0501343_002867_416_973 166
381 3300049132 Ga0501343_002941 Ga0501343_002941_478_1011 166
382 3300049132 Ga0501343_002942 Ga0501343_002942_92_592 166
383 3300049132 Ga0501343_003032 Ga0501343_003032_397_897 166
384 3300049132 Ga0501343_003075 Ga0501343_003075_162_686 166
385 3300049132 Ga0501343_003447 Ga0501343_003447_562_1062 166
386 3300049132 Ga0501343_005490 Ga0501343_005490_183_755 166
387 3300049132 Ga0501343_006259 Ga0501343_006259_155_655 166
388 3300049132 Ga0501343_007696 Ga0501343_007696_205_705 166
389 3300049132 Ga0501343_014255 Ga0501343_014255_101_601 166
390 3300049132 Ga0501343_017786 Ga0501343_017786_58_558 166
391 3300049133 Ga0501344_00110 Ga0501344_00110_697_1197 166
392 3300049133 Ga0501344_00296 Ga0501344_00296_820_1320 166
393 3300049133 Ga0501344_00443 Ga0501344_00443_584_1084 166
394 3300049133 Ga0501344_00782 Ga0501344_00782_358_858 166
395 3300049133 Ga0501344_01461 Ga0501344_01461_340_840 166
396 3300049133 Ga0501344_01568 Ga0501344_01568_49_606 166
397 3300049133 Ga0501344_01598 Ga0501344_01598_59_559 166
398 3300049133 Ga0501344_02594 Ga0501344_02594_219_719 166
399 3300049133 Ga0501344_02712 Ga0501344_02712_103_603 166
400 3300049133 Ga0501344_03336 Ga0501344_03336_237_737 166
401 3300049133 Ga0501344_03362 Ga0501344_03362_246_746 166
402 3300049133 Ga0501344_05698 Ga0501344_05698_40_558 166
403 3300049133 Ga0501344_08662 Ga0501344_08662_16_549 166
404 3300049134 Ga0501345_00223 Ga0501345_00223_407_907 166
405 3300049134 Ga0501345_00388 Ga0501345_00388_467_1024 166
406 3300049134 Ga0501345_00658 Ga0501345_00658_567_1067 166
407 3300049134 Ga0501345_00864 Ga0501345_00864_116_616 166
408 3300049134 Ga0501345_00976 Ga0501345_00976_402_902 166
409 3300049134 Ga0501345_01623 Ga0501345_01623_28_528 166
410 3300049134 Ga0501345_02453 Ga0501345_02453_124_624 166
411 3300049160 Ga0501304_001473 Ga0501304_001473_585_1085 166
412 3300049160 Ga0501304_001807 Ga0501304_001807_353_910 166
413 3300049160 Ga0501304_002559 Ga0501304_002559_632_1132 166
414 3300049160 Ga0501304_003756 Ga0501304_003756_446_946 166
415 3300049160 Ga0501304_009973 Ga0501304_009973_180_680 166
416 3300049160 Ga0501304_010840 Ga0501304_010840_174_674 166
417 3300049161 Ga0501305_000002 Ga0501305_000002_13564_14064 166
418 3300049161 Ga0501305_000036 Ga0501305_000036_4775_5308 166
419 3300049161 Ga0501305_000182 Ga0501305_000182_634_1134 166
420 3300049161 Ga0501305_000320 Ga0501305_000320_2382_2882 166
421 3300049161 Ga0501305_000675 Ga0501305_000675_1939_2496 166
422 3300049161 Ga0501305_000790 Ga0501305_000790_1720_2220 166
423 3300049161 Ga0501305_000923 Ga0501305_000923_287_787 166
424 3300049161 Ga0501305_001238 Ga0501305_001238_352_852 166
425 3300049161 Ga0501305_001538 Ga0501305_001538_69_569 166
426 3300049161 Ga0501305_003224 Ga0501305_003224_1098_1598 166
427 3300049161 Ga0501305_004826 Ga0501305_004826_382_882 166
428 3300049161 Ga0501305_006509 Ga0501305_006509_549_1049 166
429 3300049161 Ga0501305_006940 Ga0501305_006940_620_1120 166
430 3300049161 Ga0501305_008334 Ga0501305_008334_607_1107 166
431 3300049161 Ga0501305_010732 Ga0501305_010732_571_1104 166
432 3300049161 Ga0501305_012790 Ga0501305_012790_175_675 166
433 3300049161 Ga0501305_033744 Ga0501305_033744_139_639 166
434 3300049162 Ga0501307_000012 Ga0501307_000012_1012_1569 166
435 3300049162 Ga0501307_000146 Ga0501307_000146_2781_3281 166
436 3300049162 Ga0501307_000209 Ga0501307_000209_2242_2742 166
437 3300049162 Ga0501307_000679 Ga0501307_000679_1544_2077 166
438 3300049162 Ga0501307_003339 Ga0501307_003339_630_1130 166
439 3300049162 Ga0501307_003522 Ga0501307_003522_335_835 166
440 3300049162 Ga0501307_004011 Ga0501307_004011_555_1055 166
441 3300049162 Ga0501307_004831 Ga0501307_004831_567_1067 166
442 3300049162 Ga0501307_006195 Ga0501307_006195_370_903 166
443 3300049162 Ga0501307_007711 Ga0501307_007711_564_1064 166
444 3300049162 Ga0501307_011252 Ga0501307_011252_195_695 166
445 3300049162 Ga0501307_012768 Ga0501307_012768_327_827 166
446 3300049162 Ga0501307_027395 Ga0501307_027395_171_671 166
447 3300049162 Ga0501307_029643 Ga0501307_029643_121_621 166
448 3300049163 Ga0501342_00196 Ga0501342_00196_621_1121 166
449 3300049163 Ga0501342_00234 Ga0501342_00234_325_825 166
450 3300049163 Ga0501342_00390 Ga0501342_00390_286_810 166
451 3300049163 Ga0501342_00879 Ga0501342_00879_262_804 166
452 3300049163 Ga0501342_01364 Ga0501342_01364_157_657 166
453 3300049163 Ga0501342_01789 Ga0501342_01789_153_653 166
454 3300049163 Ga0501342_02889 Ga0501342_02889_41_541 166
455 3300049513 Ga0501290_009776 Ga0501290_009776_669_1169 166
456 3300049527 Ga0501311_000004 Ga0501311_000004_7209_7742 166
457 3300049527 Ga0501311_000007 Ga0501311_000007_4702_5202 166
458 3300049527 Ga0501311_001097 Ga0501311_001097_1312_1812 166
459 3300049527 Ga0501311_001420 Ga0501311_001420_850_1350 166
460 3300049527 Ga0501311_001468 Ga0501311_001468_1394_1894 166
461 3300049527 Ga0501311_001684 Ga0501311_001684_213_713 166
462 3300049527 Ga0501311_003772 Ga0501311_003772_437_994 166
463 3300049527 Ga0501311_004262 Ga0501311_004262_578_1078 166
464 3300049527 Ga0501311_005319 Ga0501311_005319_559_1059 166
465 3300049527 Ga0501311_007391 Ga0501311_007391_177_677 166
466 3300049527 Ga0501311_008514 Ga0501311_008514_88_588 166
467 3300049527 Ga0501311_008908 Ga0501311_008908_525_1058 166
468 3300049527 Ga0501311_009804 Ga0501311_009804_327_845 166
469 3300049527 Ga0501311_010377 Ga0501311_010377_64_597 166
470 3300049527 Ga0501311_010523 Ga0501311_010523_285_785 166
471 3300049527 Ga0501311_011732 Ga0501311_011732_208_708 166
472 3300049527 Ga0501311_013414 Ga0501311_013414_145_645 166
473 3300049527 Ga0501311_029488 Ga0501311_029488_125_649 166
474 3300049527 Ga0501311_040605 Ga0501311_040605_65_565 166
475 3300049528 Ga0501312_000003 Ga0501312_000003_12884_13384 166
476 3300049528 Ga0501312_000006 Ga0501312_000006_7301_7834 166
477 3300049528 Ga0501312_000567 Ga0501312_000567_438_995 166
478 3300049528 Ga0501312_000589 Ga0501312_000589_2056_2556 166
479 3300049528 Ga0501312_000598 Ga0501312_000598_2210_2710 166
480 3300049528 Ga0501312_000704 Ga0501312_000704_1653_2153 166
481 3300049528 Ga0501312_000730 Ga0501312_000730_865_1365 166
482 3300049528 Ga0501312_000761 Ga0501312_000761_698_1198 166
483 3300049528 Ga0501312_000887 Ga0501312_000887_751_1251 166
484 3300049528 Ga0501312_001707 Ga0501312_001707_1572_2072 166
485 3300049528 Ga0501312_004363 Ga0501312_004363_1003_1536 166
486 3300049528 Ga0501312_005721 Ga0501312_005721_396_896 166
487 3300049528 Ga0501312_006095 Ga0501312_006095_593_1093 166
488 3300049528 Ga0501312_006142 Ga0501312_006142_592_1092 166
489 3300049528 Ga0501312_006812 Ga0501312_006812_558_1058 166
490 3300049528 Ga0501312_009786 Ga0501312_009786_385_885 166
491 3300049528 Ga0501312_011548 Ga0501312_011548_526_1059 166
492 3300049528 Ga0501312_012455 Ga0501312_012455_13_513 166
493 3300049528 Ga0501312_015939 Ga0501312_015939_164_664 166
494 3300049528 Ga0501312_017404 Ga0501312_017404_163_663 166
495 3300049528 Ga0501312_036124 Ga0501312_036124_124_657 166
496 3300049528 Ga0501312_038175 Ga0501312_038175_13_513 166
497 3300049528 Ga0501312_045048 Ga0501312_045048_166_666 166
498 3300049529 Ga0501313_000017 Ga0501313_000017_4796_5296 166
499 3300049529 Ga0501313_000080 Ga0501313_000080_1969_2502 166
500 3300049529 Ga0501313_000518 Ga0501313_000518_806_1306 166
501 3300049529 Ga0501313_000585 Ga0501313_000585_847_1347 166
502 3300049529 Ga0501313_001232 Ga0501313_001232_1000_1557 166
503 3300049529 Ga0501313_003745 Ga0501313_003745_588_1088 166
504 3300049529 Ga0501313_004028 Ga0501313_004028_265_765 166
505 3300049529 Ga0501313_004068 Ga0501313_004068_654_1154 166
506 3300049529 Ga0501313_005376 Ga0501313_005376_112_612 166
507 3300049529 Ga0501313_005980 Ga0501313_005980_621_1121 166
508 3300049529 Ga0501313_007837 Ga0501313_007837_538_1071 166
509 3300049529 Ga0501313_008090 Ga0501313_008090_549_1049 166
510 3300049529 Ga0501313_008565 Ga0501313_008565_416_916 166
511 3300049529 Ga0501313_010473 Ga0501313_010473_539_1039 166
512 3300049529 Ga0501313_011824 Ga0501313_011824_327_827 166
513 3300049529 Ga0501313_013217 Ga0501313_013217_165_665 166
514 3300049529 Ga0501313_013554 Ga0501313_013554_313_837 166
515 3300049529 Ga0501313_014503 Ga0501313_014503_84_584 166
516 3300049529 Ga0501313_014520 Ga0501313_014520_415_915 166
517 3300049529 Ga0501313_015683 Ga0501313_015683_137_637 166
518 3300049529 Ga0501313_016560 Ga0501313_016560_268_768 166
519 3300049529 Ga0501313_021377 Ga0501313_021377_172_672 166
520 3300049529 Ga0501313_024510 Ga0501313_024510_133_633 166
521 3300049530 Ga0501314_000256 Ga0501314_000256_2186_2686 166
522 3300049530 Ga0501314_000364 Ga0501314_000364_1739_2239 166
523 3300049530 Ga0501314_000376 Ga0501314_000376_1532_2065 166
524 3300049530 Ga0501314_000408 Ga0501314_000408_722_1222 166
525 3300049530 Ga0501314_000534 Ga0501314_000534_1858_2358 166
526 3300049530 Ga0501314_000966 Ga0501314_000966_432_989 166
527 3300049530 Ga0501314_001203 Ga0501314_001203_705_1205 166
528 3300049530 Ga0501314_002552 Ga0501314_002552_570_1070 166
529 3300049530 Ga0501314_003916 Ga0501314_003916_595_1095 166
530 3300049530 Ga0501314_005768 Ga0501314_005768_363_863 166
531 3300049530 Ga0501314_008046 Ga0501314_008046_102_602 166
532 3300049530 Ga0501314_008400 Ga0501314_008400_238_771 166
533 3300049531 Ga0501315_000019 Ga0501315_000019_4702_5202 166
534 3300049531 Ga0501315_000121 Ga0501315_000121_3057_3557 166
535 3300049531 Ga0501315_000389 Ga0501315_000389_805_1362 166
536 3300049531 Ga0501315_000420 Ga0501315_000420_718_1218 166
537 3300049531 Ga0501315_000455 Ga0501315_000455_1186_1686 166
538 3300049531 Ga0501315_000870 Ga0501315_000870_324_854 166
539 3300049531 Ga0501315_001784 Ga0501315_001784_1191_1724 166
540 3300049531 Ga0501315_003271 Ga0501315_003271_381_881 166
541 3300049531 Ga0501315_004375 Ga0501315_004375_344_877 166
542 3300049531 Ga0501315_005706 Ga0501315_005706_618_1118 166
543 3300049531 Ga0501315_007515 Ga0501315_007515_421_921 166
544 3300049531 Ga0501315_007585 Ga0501315_007585_540_1040 166
545 3300049531 Ga0501315_009142 Ga0501315_009142_497_997 166
546 3300049531 Ga0501315_009781 Ga0501315_009781_160_660 166
547 3300049531 Ga0501315_010071 Ga0501315_010071_243_743 166
548 3300049531 Ga0501315_010989 Ga0501315_010989_28_561 166
549 3300049531 Ga0501315_013388 Ga0501315_013388_348_881 166
550 3300049531 Ga0501315_019582 Ga0501315_019582_140_640 166
551 3300049531 Ga0501315_024693 Ga0501315_024693_36_536 166
552 3300049531 Ga0501315_037205 Ga0501315_037205_80_601 166
553 3300049532 Ga0501316_000029 Ga0501316_000029_1755_2288 166
554 3300049532 Ga0501316_000057 Ga0501316_000057_739_1239 166
555 3300049532 Ga0501316_000077 Ga0501316_000077_3474_3974 166
556 3300049532 Ga0501316_000101 Ga0501316_000101_3074_3574 166
557 3300049532 Ga0501316_000267 Ga0501316_000267_451_1008 166
558 3300049532 Ga0501316_000523 Ga0501316_000523_728_1228 166
559 3300049532 Ga0501316_000578 Ga0501316_000578_1673_2206 166
560 3300049532 Ga0501316_001796 Ga0501316_001796_708_1208 166
561 3300049532 Ga0501316_002250 Ga0501316_002250_847_1347 166
562 3300049532 Ga0501316_002843 Ga0501316_002843_493_993 166
563 3300049532 Ga0501316_003117 Ga0501316_003117_438_938 166
564 3300049532 Ga0501316_004133 Ga0501316_004133_611_1111 166
565 3300049532 Ga0501316_004575 Ga0501316_004575_337_870 166
566 3300049532 Ga0501316_006448 Ga0501316_006448_593_1126 166
567 3300049532 Ga0501316_008843 Ga0501316_008843_239_739 166
568 3300049532 Ga0501316_010286 Ga0501316_010286_180_680 166
569 3300049532 Ga0501316_027862 Ga0501316_027862_90_590 166
570 3300049533 Ga0501317_000001 Ga0501317_000001_18127_18627 166
571 3300049533 Ga0501317_000015 Ga0501317_000015_2136_2669 166
572 3300049533 Ga0501317_000025 Ga0501317_000025_3078_3578 166
573 3300049533 Ga0501317_000117 Ga0501317_000117_2103_2660 166
574 3300049533 Ga0501317_000283 Ga0501317_000283_388_888 166
575 3300049533 Ga0501317_000743 Ga0501317_000743_166_666 166
576 3300049533 Ga0501317_001549 Ga0501317_001549_654_1154 166
577 3300049533 Ga0501317_003545 Ga0501317_003545_373_873 166
578 3300049533 Ga0501317_004078 Ga0501317_004078_435_935 166
579 3300049533 Ga0501317_004435 Ga0501317_004435_364_864 166
580 3300049533 Ga0501317_004480 Ga0501317_004480_581_1114 166
581 3300049533 Ga0501317_005927 Ga0501317_005927_567_1100 166
582 3300049533 Ga0501317_006031 Ga0501317_006031_177_677 166
583 3300049533 Ga0501317_009156 Ga0501317_009156_348_848 166
584 3300049533 Ga0501317_011703 Ga0501317_011703_253_753 166
585 3300049533 Ga0501317_013036 Ga0501317_013036_343_843 166
586 3300049533 Ga0501317_013935 Ga0501317_013935_338_838 166
587 3300049533 Ga0501317_014287 Ga0501317_014287_160_660 166
588 3300049533 Ga0501317_015543 Ga0501317_015543_26_526 166
589 3300049533 Ga0501317_015684 Ga0501317_015684_261_794 166
590 3300049533 Ga0501317_016831 Ga0501317_016831_56_556 166
591 3300049533 Ga0501317_022106 Ga0501317_022106_223_747 166
592 3300049533 Ga0501317_028468 Ga0501317_028468_183_683 166
593 3300049534 Ga0501318_000001 Ga0501318_000001_13502_14002 166
594 3300049534 Ga0501318_000024 Ga0501318_000024_3731_4264 166
595 3300049534 Ga0501318_000298 Ga0501318_000298_1286_1786 166
596 3300049534 Ga0501318_000818 Ga0501318_000818_610_1110 166
597 3300049534 Ga0501318_001644 Ga0501318_001644_340_873 166
598 3300049534 Ga0501318_002490 Ga0501318_002490_608_1165 166
599 3300049534 Ga0501318_002759 Ga0501318_002759_911_1411 166
600 3300049534 Ga0501318_003424 Ga0501318_003424_399_899 166
601 3300049534 Ga0501318_003792 Ga0501318_003792_346_846 166
602 3300049534 Ga0501318_004315 Ga0501318_004315_99_599 166
603 3300049534 Ga0501318_005676 Ga0501318_005676_331_831 166
604 3300049534 Ga0501318_011019 Ga0501318_011019_352_852 166
605 3300049534 Ga0501318_011670 Ga0501318_011670_62_562 166
606 3300049534 Ga0501318_011879 Ga0501318_011879_345_845 166
607 3300049534 Ga0501318_012197 Ga0501318_012197_405_905 166
608 3300049534 Ga0501318_013420 Ga0501318_013420_216_716 166
609 3300049534 Ga0501318_013608 Ga0501318_013608_375_875 166
610 3300049534 Ga0501318_018572 Ga0501318_018572_44_544 166
611 3300049534 Ga0501318_023432 Ga0501318_023432_129_629 166
612 3300049534 Ga0501318_040625 Ga0501318_040625_146_646 166
613 3300049535 Ga0501319_000019 Ga0501319_000019_1802_2335 166
614 3300049535 Ga0501319_000069 Ga0501319_000069_801_1301 166
615 3300049535 Ga0501319_000384 Ga0501319_000384_737_1237 166
616 3300049535 Ga0501319_000645 Ga0501319_000645_764_1321 166
617 3300049535 Ga0501319_000706 Ga0501319_000706_523_1023 166
618 3300049535 Ga0501319_001463 Ga0501319_001463_634_1134 166
619 3300049535 Ga0501319_008689 Ga0501319_008689_74_574 166
620 3300049536 Ga0501320_000031 Ga0501320_000031_4736_5236 166
621 3300049536 Ga0501320_000127 Ga0501320_000127_1491_1991 166
622 3300049536 Ga0501320_000269 Ga0501320_000269_2210_2710 166
623 3300049536 Ga0501320_000417 Ga0501320_000417_1531_2064 166
624 3300049536 Ga0501320_001978 Ga0501320_001978_955_1455 166
625 3300049536 Ga0501320_002015 Ga0501320_002015_585_1142 166
626 3300049536 Ga0501320_002282 Ga0501320_002282_432_932 166
627 3300049536 Ga0501320_002373 Ga0501320_002373_576_1076 166
628 3300049536 Ga0501320_002700 Ga0501320_002700_396_896 166
629 3300049536 Ga0501320_002917 Ga0501320_002917_575_1075 166
630 3300049536 Ga0501320_003165 Ga0501320_003165_377_877 166
631 3300049536 Ga0501320_004689 Ga0501320_004689_263_763 166
632 3300049536 Ga0501320_009426 Ga0501320_009426_343_843 166
633 3300049536 Ga0501320_012074 Ga0501320_012074_177_677 166
634 3300049536 Ga0501320_016044 Ga0501320_016044_186_686 166
635 3300049536 Ga0501320_019099 Ga0501320_019099_118_618 166
636 3300049536 Ga0501320_020162 Ga0501320_020162_182_694 166
637 3300049536 Ga0501320_020691 Ga0501320_020691_131_631 166
638 3300049536 Ga0501320_021555 Ga0501320_021555_128_628 166
639 3300049537 Ga0501321_000001 Ga0501321_000001_2824_3324 166
640 3300049537 Ga0501321_000032 Ga0501321_000032_2372_2905 166
641 3300049537 Ga0501321_000087 Ga0501321_000087_3068_3568 166
642 3300049537 Ga0501321_000347 Ga0501321_000347_2029_2529 166
643 3300049537 Ga0501321_000467 Ga0501321_000467_1677_2177 166
644 3300049537 Ga0501321_000491 Ga0501321_000491_1668_2168 166
645 3300049537 Ga0501321_000499 Ga0501321_000499_1629_2129 166
646 3300049537 Ga0501321_001102 Ga0501321_001102_1491_1991 166
647 3300049537 Ga0501321_002236 Ga0501321_002236_626_1126 166
648 3300049537 Ga0501321_002729 Ga0501321_002729_718_1218 166
649 3300049537 Ga0501321_002739 Ga0501321_002739_318_818 166
650 3300049537 Ga0501321_002957 Ga0501321_002957_432_989 166
651 3300049537 Ga0501321_003429 Ga0501321_003429_363_863 166
652 3300049537 Ga0501321_004237 Ga0501321_004237_803_1303 166
653 3300049537 Ga0501321_005141 Ga0501321_005141_355_855 166
654 3300049538 Ga0501322_000105 Ga0501322_000105_2234_2734 166
655 3300049538 Ga0501322_000132 Ga0501322_000132_498_1031 166
656 3300049538 Ga0501322_000252 Ga0501322_000252_417_974 166
657 3300049538 Ga0501322_000299 Ga0501322_000299_1188_1688 166
658 3300049538 Ga0501322_000543 Ga0501322_000543_25_525 166
659 3300049538 Ga0501322_001241 Ga0501322_001241_559_1059 166
660 3300049538 Ga0501322_001536 Ga0501322_001536_296_796 166
661 3300049538 Ga0501322_001589 Ga0501322_001589_634_1134 166
662 3300049538 Ga0501322_001850 Ga0501322_001850_157_657 166
663 3300049538 Ga0501322_002157 Ga0501322_002157_294_794 166
664 3300049538 Ga0501322_002560 Ga0501322_002560_363_863 166
665 3300049538 Ga0501322_003636 Ga0501322_003636_325_825 166
666 3300049538 Ga0501322_004003 Ga0501322_004003_312_812 166
667 3300049538 Ga0501322_005597 Ga0501322_005597_99_599 166
668 3300049538 Ga0501322_007581 Ga0501322_007581_132_632 166
669 3300049539 Ga0501323_000031 Ga0501323_000031_1811_2344 166
670 3300049539 Ga0501323_000123 Ga0501323_000123_3497_3997 166
671 3300049539 Ga0501323_000356 Ga0501323_000356_634_1134 166
672 3300049539 Ga0501323_000970 Ga0501323_000970_1628_2128 166
673 3300049539 Ga0501323_002019 Ga0501323_002019_981_1538 166
674 3300049539 Ga0501323_002333 Ga0501323_002333_727_1227 166
675 3300049539 Ga0501323_002480 Ga0501323_002480_725_1225 166
676 3300049539 Ga0501323_003725 Ga0501323_003725_535_1086 166
677 3300049539 Ga0501323_005810 Ga0501323_005810_328_861 166
678 3300049539 Ga0501323_011309 Ga0501323_011309_541_1041 166
679 3300049539 Ga0501323_012089 Ga0501323_012089_369_869 166
680 3300049539 Ga0501323_016255 Ga0501323_016255_179_679 166
681 3300049539 Ga0501323_017966 Ga0501323_017966_47_634 166
682 3300049539 Ga0501323_018051 Ga0501323_018051_162_662 166
683 3300049539 Ga0501323_033996 Ga0501323_033996_69_569 166
684 3300049539 Ga0501323_040674 Ga0501323_040674_65_565 166
685 3300049540 Ga0501324_000001 Ga0501324_000001_18141_18641 166
686 3300049540 Ga0501324_000376 Ga0501324_000376_1677_2177 166
687 3300049540 Ga0501324_000524 Ga0501324_000524_1501_2001 166
688 3300049540 Ga0501324_000689 Ga0501324_000689_38_538 166
689 3300049540 Ga0501324_000710 Ga0501324_000710_125_625 166
690 3300049540 Ga0501324_000785 Ga0501324_000785_237_770 166
691 3300049540 Ga0501324_001688 Ga0501324_001688_658_1158 166
692 3300049540 Ga0501324_001963 Ga0501324_001963_353_961 166
693 3300049540 Ga0501324_003669 Ga0501324_003669_526_1026 166
694 3300049540 Ga0501324_005987 Ga0501324_005987_387_887 166
695 3300049540 Ga0501324_006194 Ga0501324_006194_358_858 166
696 3300049540 Ga0501324_006563 Ga0501324_006563_100_600 166
697 3300049540 Ga0501324_013357 Ga0501324_013357_58_558 166
698 3300049541 Ga0501325_001449 Ga0501325_001449_327_827 166
699 3300049541 Ga0501325_005651 Ga0501325_005651_145_645 166
700 3300049541 Ga0501325_006348 Ga0501325_006348_427_927 166
701 3300049541 Ga0501325_007150 Ga0501325_007150_258_815 166
702 3300049541 Ga0501325_007390 Ga0501325_007390_362_862 166
703 3300049541 Ga0501325_014923 Ga0501325_014923_155_655 166
704 3300049542 Ga0501326_00044 Ga0501326_00044_2787_3287 166
705 3300049542 Ga0501326_00062 Ga0501326_00062_428_985 166
706 3300049542 Ga0501326_00067 Ga0501326_00067_420_920 166
707 3300049542 Ga0501326_00091 Ga0501326_00091_1793_2326 166
708 3300049542 Ga0501326_00871 Ga0501326_00871_177_677 166
709 3300049542 Ga0501326_01125 Ga0501326_01125_656_1156 166
710 3300049542 Ga0501326_01158 Ga0501326_01158_571_1071 166
711 3300049542 Ga0501326_04771 Ga0501326_04771_105_605 166
712 3300049542 Ga0501326_04864 Ga0501326_04864_40_627 166
713 3300049542 Ga0501326_05272 Ga0501326_05272_157_657 166
714 3300049542 Ga0501326_05480 Ga0501326_05480_66_566 166
715 3300049543 Ga0501327_00019 Ga0501327_00019_4698_5198 166
716 3300049543 Ga0501327_00117 Ga0501327_00117_1543_2076 166
717 3300049543 Ga0501327_00746 Ga0501327_00746_559_1059 166
718 3300049543 Ga0501327_00790 Ga0501327_00790_510_1067 166
719 3300049543 Ga0501327_00838 Ga0501327_00838_562_1062 166
720 3300049543 Ga0501327_01108 Ga0501327_01108_97_597 166
721 3300049543 Ga0501327_02463 Ga0501327_02463_437_937 166
722 3300049543 Ga0501327_03045 Ga0501327_03045_23_523 166
723 3300049543 Ga0501327_04294 Ga0501327_04294_147_647 166
724 3300049543 Ga0501327_05770 Ga0501327_05770_13_513 166
725 3300049543 Ga0501327_07798 Ga0501327_07798_29_577 166
726 3300049544 Ga0501328_00436 Ga0501328_00436_567_1067 166
727 3300049544 Ga0501328_00481 Ga0501328_00481_506_1063 166
728 3300049544 Ga0501328_00645 Ga0501328_00645_165_665 166
729 3300049544 Ga0501328_00952 Ga0501328_00952_427_927 166
730 3300049544 Ga0501328_00989 Ga0501328_00989_136_636 166
731 3300049544 Ga0501328_01099 Ga0501328_01099_129_629 166
732 3300049544 Ga0501328_01243 Ga0501328_01243_116_616 166
733 3300049544 Ga0501328_01317 Ga0501328_01317_414_914 166
734 3300049544 Ga0501328_03444 Ga0501328_03444_122_622 166
735 3300049545 Ga0501329_00035 Ga0501329_00035_432_932 166
736 3300049545 Ga0501329_00315 Ga0501329_00315_515_1015 166
737 3300049545 Ga0501329_00800 Ga0501329_00800_183_683 166
738 3300049545 Ga0501329_00866 Ga0501329_00866_544_1044 166
739 3300049545 Ga0501329_00892 Ga0501329_00892_344_901 166
740 3300049545 Ga0501329_01244 Ga0501329_01244_158_658 166
741 3300049545 Ga0501329_02225 Ga0501329_02225_269_769 166
742 3300049545 Ga0501329_07717 Ga0501329_07717_21_521 166
743 3300049546 Ga0501330_000008 Ga0501330_000008_1864_2397 166
744 3300049546 Ga0501330_000037 Ga0501330_000037_2238_2738 166
745 3300049546 Ga0501330_000125 Ga0501330_000125_305_862 166
746 3300049546 Ga0501330_000317 Ga0501330_000317_991_1491 166
747 3300049546 Ga0501330_000407 Ga0501330_000407_633_1133 166
748 3300049546 Ga0501330_000492 Ga0501330_000492_714_1214 166
749 3300049546 Ga0501330_000601 Ga0501330_000601_919_1419 166
750 3300049546 Ga0501330_001760 Ga0501330_001760_449_982 166
751 3300049546 Ga0501330_001811 Ga0501330_001811_497_997 166
752 3300049546 Ga0501330_002688 Ga0501330_002688_382_909 166
753 3300049546 Ga0501330_003838 Ga0501330_003838_271_771 166
754 3300049546 Ga0501330_005449 Ga0501330_005449_153_653 166
755 3300049546 Ga0501330_005465 Ga0501330_005465_161_661 166
756 3300049546 Ga0501330_006129 Ga0501330_006129_262_762 166
757 3300049546 Ga0501330_006271 Ga0501330_006271_72_572 166
758 3300049546 Ga0501330_006936 Ga0501330_006936_125_625 166
759 3300049546 Ga0501330_007249 Ga0501330_007249_184_684 166
760 3300049546 Ga0501330_009894 Ga0501330_009894_156_656 166
761 3300049547 Ga0501331_00059 Ga0501331_00059_2352_2852 166
762 3300049547 Ga0501331_00433 Ga0501331_00433_574_1131 166
763 3300049547 Ga0501331_00629 Ga0501331_00629_544_1077 166
764 3300049547 Ga0501331_00696 Ga0501331_00696_639_1139 166
765 3300049547 Ga0501331_00926 Ga0501331_00926_482_982 166
766 3300049547 Ga0501331_00936 Ga0501331_00936_649_1149 166
767 3300049547 Ga0501331_01698 Ga0501331_01698_50_583 166
768 3300049547 Ga0501331_02076 Ga0501331_02076_100_678 166
769 3300049547 Ga0501331_02440 Ga0501331_02440_230_730 166
770 3300049547 Ga0501331_02682 Ga0501331_02682_313_837 166
771 3300049547 Ga0501331_03622 Ga0501331_03622_119_619 166
772 3300049548 Ga0501332_00020 Ga0501332_00020_1957_2490 166
773 3300049548 Ga0501332_00078 Ga0501332_00078_1764_2264 166
774 3300049548 Ga0501332_00243 Ga0501332_00243_158_658 166
775 3300049548 Ga0501332_00266 Ga0501332_00266_490_1023 166
776 3300049548 Ga0501332_00341 Ga0501332_00341_1067_1567 166
777 3300049548 Ga0501332_00637 Ga0501332_00637_953_1477 166
778 3300049548 Ga0501332_00665 Ga0501332_00665_746_1246 166
779 3300049548 Ga0501332_00684 Ga0501332_00684_535_1092 166
780 3300049548 Ga0501332_01348 Ga0501332_01348_557_1057 166
781 3300049548 Ga0501332_01615 Ga0501332_01615_176_676 166
782 3300049548 Ga0501332_01672 Ga0501332_01672_402_902 166
783 3300049548 Ga0501332_01675 Ga0501332_01675_116_616 166
784 3300049548 Ga0501332_01723 Ga0501332_01723_561_1061 166
785 3300049548 Ga0501332_02342 Ga0501332_02342_41_541 166
786 3300049548 Ga0501332_02477 Ga0501332_02477_398_898 166
787 3300049548 Ga0501332_05071 Ga0501332_05071_149_682 166
788 3300049548 Ga0501332_05167 Ga0501332_05167_137_637 166
789 3300049548 Ga0501332_08201 Ga0501332_08201_112_612 166
790 3300049549 Ga0501333_000472 Ga0501333_000472_222_722 166
791 3300049549 Ga0501333_000570 Ga0501333_000570_656_1156 166
792 3300049549 Ga0501333_000866 Ga0501333_000866_309_842 166
793 3300049549 Ga0501333_000901 Ga0501333_000901_432_932 166
794 3300049549 Ga0501333_001066 Ga0501333_001066_339_896 166
795 3300049549 Ga0501333_001090 Ga0501333_001090_571_1071 166
796 3300049549 Ga0501333_001406 Ga0501333_001406_181_681 166
797 3300049549 Ga0501333_001759 Ga0501333_001759_568_1068 166
798 3300049549 Ga0501333_003430 Ga0501333_003430_102_602 166
799 3300049549 Ga0501333_005443 Ga0501333_005443_155_655 166
800 3300049549 Ga0501333_016820 Ga0501333_016820_43_543 166
801 3300049550 Ga0501334_00027 Ga0501334_00027_2234_2767 166
802 3300049550 Ga0501334_00363 Ga0501334_00363_431_931 166
803 3300049550 Ga0501334_00459 Ga0501334_00459_717_1274 166
804 3300049550 Ga0501334_00734 Ga0501334_00734_392_892 166
805 3300049550 Ga0501334_00737 Ga0501334_00737_558_1058 166
806 3300049550 Ga0501334_00968 Ga0501334_00968_711_1211 166
807 3300049550 Ga0501334_01673 Ga0501334_01673_106_630 166
808 3300049550 Ga0501334_02009 Ga0501334_02009_666_1166 166
809 3300049550 Ga0501334_02111 Ga0501334_02111_497_997 166
810 3300049550 Ga0501334_02951 Ga0501334_02951_13_546 166
811 3300049550 Ga0501334_03141 Ga0501334_03141_353_853 166
812 3300049550 Ga0501334_04281 Ga0501334_04281_65_565 166
813 3300049550 Ga0501334_06114 Ga0501334_06114_147_647 166
814 3300049550 Ga0501334_06310 Ga0501334_06310_72_572 166
815 3300049550 Ga0501334_07694 Ga0501334_07694_125_625 166
816 3300049550 Ga0501334_09103 Ga0501334_09103_49_549 166
817 3300049550 Ga0501334_09125 Ga0501334_09125_14_514 166
818 3300049550 Ga0501334_12023 Ga0501334_12023_56_556 166
819 3300049550 Ga0501334_15255 Ga0501334_15255_60_560 166
820 3300049551 Ga0501335_000302 Ga0501335_000302_1846_2379 166
821 3300049551 Ga0501335_000498 Ga0501335_000498_404_904 166
822 3300049551 Ga0501335_000773 Ga0501335_000773_1184_1684 166
823 3300049551 Ga0501335_001090 Ga0501335_001090_860_1360 166
824 3300049551 Ga0501335_001188 Ga0501335_001188_1075_1575 166
825 3300049551 Ga0501335_001538 Ga0501335_001538_573_1073 166
826 3300049551 Ga0501335_002243 Ga0501335_002243_395_895 166
827 3300049551 Ga0501335_002274 Ga0501335_002274_478_978 166
828 3300049551 Ga0501335_002567 Ga0501335_002567_527_1060 166
829 3300049551 Ga0501335_002676 Ga0501335_002676_619_1119 166
830 3300049551 Ga0501335_002687 Ga0501335_002687_385_918 166
831 3300049551 Ga0501335_003105 Ga0501335_003105_625_1149 166
832 3300049551 Ga0501335_003177 Ga0501335_003177_715_1215 166
833 3300049551 Ga0501335_003478 Ga0501335_003478_160_660 166
834 3300049551 Ga0501335_005174 Ga0501335_005174_124_624 166
835 3300049551 Ga0501335_005478 Ga0501335_005478_419_919 166
836 3300049551 Ga0501335_006284 Ga0501335_006284_345_845 166
837 3300049551 Ga0501335_007098 Ga0501335_007098_368_868 166
838 3300049551 Ga0501335_007283 Ga0501335_007283_373_873 166
839 3300049551 Ga0501335_007830 Ga0501335_007830_381_881 166
840 3300049551 Ga0501335_013736 Ga0501335_013736_147_680 166
841 3300049551 Ga0501335_016994 Ga0501335_016994_80_580 166
842 3300049551 Ga0501335_025230 Ga0501335_025230_43_543 166
843 3300049551 Ga0501335_030659 Ga0501335_030659_78_578 166
844 3300049552 Ga0501336_000609 Ga0501336_000609_797_1297 166
845 3300049552 Ga0501336_000828 Ga0501336_000828_654_1154 166
846 3300049552 Ga0501336_001137 Ga0501336_001137_761_1261 166
847 3300049552 Ga0501336_001437 Ga0501336_001437_533_1033 166
848 3300049552 Ga0501336_002910 Ga0501336_002910_522_1079 166
849 3300049552 Ga0501336_006544 Ga0501336_006544_163_741 166
850 3300049552 Ga0501336_010732 Ga0501336_010732_127_627 166
851 3300049553 Ga0501337_000088 Ga0501337_000088_633_1133 166
852 3300049553 Ga0501337_000166 Ga0501337_000166_1728_2261 166
853 3300049553 Ga0501337_000595 Ga0501337_000595_416_973 166
854 3300049553 Ga0501337_000600 Ga0501337_000600_434_934 166
855 3300049553 Ga0501337_000691 Ga0501337_000691_1110_1610 166
856 3300049553 Ga0501337_000787 Ga0501337_000787_631_1131 166
857 3300049553 Ga0501337_000931 Ga0501337_000931_965_1465 166
858 3300049553 Ga0501337_001054 Ga0501337_001054_664_1164 166
859 3300049553 Ga0501337_001378 Ga0501337_001378_522_1055 166
860 3300049553 Ga0501337_002200 Ga0501337_002200_559_1059 166
861 3300049553 Ga0501337_003060 Ga0501337_003060_165_665 166
862 3300049553 Ga0501337_003654 Ga0501337_003654_106_606 166
863 3300049553 Ga0501337_003656 Ga0501337_003656_13_513 166
864 3300049553 Ga0501337_006352 Ga0501337_006352_165_689 166
865 3300049553 Ga0501337_009883 Ga0501337_009883_165_665 166
866 3300049554 Ga0501338_00091 Ga0501338_00091_1811_2344 166
867 3300049554 Ga0501338_00372 Ga0501338_00372_774_1274 166
868 3300049554 Ga0501338_00462 Ga0501338_00462_988_1488 166
869 3300049554 Ga0501338_00522 Ga0501338_00522_532_1065 166
870 3300049554 Ga0501338_00860 Ga0501338_00860_758_1258 166
871 3300049554 Ga0501338_01003 Ga0501338_01003_523_1080 166
872 3300049554 Ga0501338_01138 Ga0501338_01138_343_843 166
873 3300049554 Ga0501338_01360 Ga0501338_01360_630_1130 166
874 3300049554 Ga0501338_02435 Ga0501338_02435_547_1047 166
875 3300049554 Ga0501338_02726 Ga0501338_02726_169_669 166
876 3300049554 Ga0501338_03865 Ga0501338_03865_209_709 166
877 3300049554 Ga0501338_05806 Ga0501338_05806_80_658 166
878 3300049555 Ga0501339_00045 Ga0501339_00045_489_989 166
879 3300049555 Ga0501339_00190 Ga0501339_00190_117_674 166
880 3300049555 Ga0501339_01020 Ga0501339_01020_134_634 166
881 3300049556 Ga0501340_000099 Ga0501340_000099_1610_2110 166
882 3300049556 Ga0501340_000251 Ga0501340_000251_1170_1727 166
883 3300049556 Ga0501340_000443 Ga0501340_000443_644_1144 166
884 3300049556 Ga0501340_001102 Ga0501340_001102_527_1060 166
885 3300049556 Ga0501340_002204 Ga0501340_002204_362_862 166
886 3300049556 Ga0501340_005656 Ga0501340_005656_157_663 166
887 3300049556 Ga0501340_007990 Ga0501340_007990_37_615 166
888 3300049556 Ga0501340_008097 Ga0501340_008097_115_615 166
889 3300049572 Ga0501036_0848464 Ga0501036_0848464_25_525 166
890 3300049649 Ga0501198_016157 Ga0501198_016157_539_1039 166
891 3300049654 Ga0501207_087078 Ga0501207_087078_53_553 166
892 3300049660 Ga0501216_160988 Ga0501216_160988_16_516 166
893 3300049661 Ga0501217_004344 Ga0501217_004344_653_1153 166
894 3300049664 Ga0501224_008303 Ga0501224_008303_298_798 166
895 3300049669 Ga0501235_063173 Ga0501235_063173_270_770 166
896 3300049704 Ga0501221_007234 Ga0501221_007234_148_648 166
897 3300049707 Ga0501234_049249 Ga0501234_049249_62_562 166
898 3300049743 Ga0501081_0481337 Ga0501081_0481337_40_540 166
899 3300049763 Ga0501266_050672 Ga0501266_050672_124_624 166
900 3300049767 Ga0501270_001993 Ga0501270_001993_1444_1944 166
901 3300049775 Ga0501279_005794 Ga0501279_005794_271_771 166
902 3300050491 nmdc:mga00v17_52062_c2 nmdc:mga00v17_52062_c2_702_1202 166
903 3300059477 Ga0587084_005577 Ga0587084_005577_385_885 166
904 3300059604 Ga0587098_012104 Ga0587098_012104_165_665 166
905 3300059643 Ga0587072_080691 Ga0587072_080691_39_539 166
906 iso_pu_bacteria 2802429420 2805348316 166

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00466

Ribosomal_L10

Ribosomal protein L10

16

113

0.98

Feature Viewer

pLDDT pTM Quality
67.62 0.49 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map