F485347

General Info

Members Datasets Scaffolds Average Seq Length
907 205 907 156

Family's Representative Sequence

Representative Sequence 3300005339|Ga0070660_100235123|Ga0070660_1002351232
Length 157
Sequence MNRSALLLLVPLLAGCNVHSKNPADGDENVSIHADDSGHVSFNLPIAQGQVKLPEGMMNHGDVDIDGVKLMPGSKISGFNLDASKGRGANIDMSFTTPAAPDAVRAYYVDQFKQKGVNAAVSGDEVIGKSKDGSPFAIHVSPAGSGSQGKIEIQSKD

Samples

Sample ID Description Type Environment
1 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
2 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
3 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
4 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
5 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
6 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
7 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
8 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
9 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
10 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
11 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
12 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
13 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
14 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
15 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
16 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
17 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
18 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
19 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
20 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
21 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
22 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
23 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
24 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
25 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
26 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
27 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
28 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
29 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
30 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
31 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
32 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
33 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
34 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
35 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
36 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
37 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
38 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
39 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
40 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
41 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
42 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
43 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
44 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
45 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
46 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
47 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
48 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
49 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
50 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
51 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
52 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
53 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
54 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
55 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
56 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
57 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
58 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
59 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
60 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
61 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
62 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
63 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
64 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
65 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
66 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
67 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
69 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
70 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
71 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
72 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
73 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
74 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
75 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
76 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
77 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
78 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
79 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
80 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
81 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
82 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
83 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
84 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
85 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
86 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
87 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
88 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
89 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
90 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
91 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
92 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
93 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
94 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
95 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
96 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
156 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
157 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
158 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
159 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
160 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
161 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
162 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
163 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
164 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
165 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
166 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
167 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
168 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
169 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
170 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
171 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
172 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
173 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
174 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
175 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
176 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
177 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
178 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
179 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
180 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
181 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
182 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
183 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
184 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
185 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
186 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
187 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
188 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
189 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
190 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
191 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
192 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
193 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
194 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
195 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
196 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
197 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
198 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
199 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
200 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
201 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
202 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
203 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
204 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
205 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.78
Metatranscriptomes 0.22
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.11
Nodule 0
Rhizoplane 2.87
Rhizosphere 97.02
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MBSR1b_contig_3901366 2162886012 Unclassified 907
2 JGI24736J21556_1000552 3300001904 Bacteria 6943
3 JGI24736J21556_1060891 3300001904 Bacteria 584
4 JGI24741J21665_1014104 3300001915 Bacteria 1342
5 JGI24741J21665_1024611 3300001915 Bacteria 924
6 JGI24740J21852_10003534 3300001979 Bacteria 6848
7 JGI24740J21852_10067831 3300001979 Unclassified 964
8 JGI24740J21852_10084198 3300001979 Bacteria 828
9 JGI24739J22299_10046713 3300001989 Bacteria 1417
10 JGI24739J22299_10078037 3300001989 Bacteria 1020
11 JGI24739J22299_10081533 3300001989 Unclassified 993
12 JGI24737J22298_10014900 3300001990 Bacteria 2520
13 JGI24737J22298_10025626 3300001990 Unclassified 1864
14 JGI24737J22298_10027909 3300001990 Bacteria 1777
15 JGI24737J22298_10035477 3300001990 Bacteria 1543
16 JGI24735J21928_10004351 3300002067 Unclassified 4767
17 JGI24735J21928_10018727 3300002067 Bacteria 2134
18 JGI24735J21928_10045242 3300002067 Bacteria 1278
19 JGI24735J21928_10118783 3300002067 Unclassified 761
20 JGI24738J21930_10025675 3300002075 Unclassified 1210
21 JGI24742J22300_10018345 3300002244 Unclassified 1186
22 Ga0065715_10376615 3300005293 Unclassified 913
23 Ga0070658_10001059 3300005327 Bacteria 23534
24 Ga0070658_10006084 3300005327 Bacteria 9787
25 Ga0070658_10010912 3300005327 Bacteria 7282
26 Ga0070658_10025330 3300005327 Bacteria 4757
27 Ga0070658_10027312 3300005327 Unclassified 4581
28 Ga0070658_10028127 3300005327 Bacteria 4512
29 Ga0070658_10033301 3300005327 Bacteria 4145
30 Ga0070658_10037459 3300005327 Bacteria 3910
31 Ga0070658_10046195 3300005327 Bacteria 3524
32 Ga0070658_10055270 3300005327 Bacteria 3225
33 Ga0070658_10094610 3300005327 Bacteria 2465
34 Ga0070658_10209762 3300005327 Unclassified 1645
35 Ga0070658_10319130 3300005327 Bacteria 1326
36 Ga0070658_10321502 3300005327 Bacteria 1321
37 Ga0070658_10742290 3300005327 Unclassified 852
38 Ga0070658_11788814 3300005327 Unclassified 531
39 Ga0070676_10009417 3300005328 Bacteria 5276
40 Ga0070676_10028593 3300005328 Bacteria 3167
41 Ga0070676_10853525 3300005328 Bacteria 675
42 Ga0070683_100002352 3300005329 Bacteria 15007
43 Ga0070683_100010291 3300005329 Bacteria 8042
44 Ga0070683_100011241 3300005329 Bacteria 7725
45 Ga0070683_100017603 3300005329 Bacteria 6315
46 Ga0070683_100076356 3300005329 Unclassified 3131
47 Ga0070683_100084126 3300005329 Bacteria 2981
48 Ga0070683_100128814 3300005329 Bacteria 2394
49 Ga0070683_100188605 3300005329 Bacteria 1957
50 Ga0070683_100194542 3300005329 Bacteria 1925
51 Ga0070690_100001940 3300005330 Bacteria 10999
52 Ga0070670_100035205 3300005331 Bacteria 4311
53 Ga0070670_100087962 3300005331 Bacteria 2670
54 Ga0070670_100097664 3300005331 Bacteria 2527
55 Ga0070677_10310448 3300005333 Bacteria 804
56 Ga0068869_100492788 3300005334 Unclassified 1022
57 Ga0070666_10046909 3300005335 Bacteria 2900
58 Ga0070666_10071459 3300005335 Bacteria 2362
59 Ga0070666_10162683 3300005335 Bacteria 1560
60 Ga0070680_100002086 3300005336 Bacteria 14765
61 Ga0070680_100029920 3300005336 Unclassified 4372
62 Ga0070680_100063318 3300005336 Bacteria 3029
63 Ga0070680_100193655 3300005336 Bacteria 1713
64 Ga0070680_100294072 3300005336 Unclassified 1377
65 Ga0070680_100332761 3300005336 Bacteria 1290
66 Ga0070682_101774573 3300005337 Bacteria 538
67 Ga0068868_100207813 3300005338 Bacteria 1635
68 Ga0068868_100704398 3300005338 Bacteria 904
69 Ga0068868_101404688 3300005338 Unclassified 651
70 Ga0070660_100001066 3300005339 Bacteria 18437
71 Ga0070660_100004104 3300005339 Bacteria 10048
72 Ga0070660_100004893 3300005339 Bacteria 9259
73 Ga0070660_100006075 3300005339 Bacteria 8348
74 Ga0070660_100038290 3300005339 Unclassified 3640
75 Ga0070660_100040368 3300005339 Bacteria 3551
76 Ga0070660_100176930 3300005339 Bacteria 1726
77 Ga0070660_100235123 3300005339 Bacteria 1491
78 Ga0070660_100248088 3300005339 Bacteria 1451
79 Ga0070660_100302458 3300005339 Bacteria 1312
80 Ga0070660_100316304 3300005339 Unclassified 1282
81 Ga0070660_100379702 3300005339 Bacteria 1166
82 Ga0070660_100391715 3300005339 Bacteria 1148
83 Ga0070660_100544103 3300005339 Unclassified 968
84 Ga0070660_100544974 3300005339 Unclassified 967
85 Ga0070660_100826061 3300005339 Unclassified 780
86 Ga0070689_100411128 3300005340 Unclassified 1145
87 Ga0070689_100683091 3300005340 Bacteria 895
88 Ga0070691_10057063 3300005341 Bacteria 1873
89 Ga0070691_10094839 3300005341 Unclassified 1475
90 Ga0070687_100055699 3300005343 Bacteria 2066
91 Ga0070661_100048313 3300005344 Bacteria 3115
92 Ga0070661_100083291 3300005344 Unclassified 2362
93 Ga0070661_100093985 3300005344 Bacteria 2222
94 Ga0070661_100110514 3300005344 Unclassified 2052
95 Ga0070661_100126598 3300005344 Bacteria 1917
96 Ga0070661_100522673 3300005344 Bacteria 952
97 Ga0070661_100635221 3300005344 Bacteria 866
98 Ga0070692_10004340 3300005345 Bacteria 5903
99 Ga0070692_10015921 3300005345 Bacteria 3567
100 Ga0070692_10027776 3300005345 Bacteria 2808
101 Ga0070668_100001286 3300005347 Bacteria 17955
102 Ga0070668_100776819 3300005347 Bacteria 849
103 Ga0070669_100032571 3300005353 Bacteria 3766
104 Ga0070669_100044449 3300005353 Bacteria 3237
105 Ga0070669_100126181 3300005353 Bacteria 1958
106 Ga0070669_100234211 3300005353 Bacteria 1456
107 Ga0070675_100028041 3300005354 Bacteria 4528
108 Ga0070671_100012392 3300005355 Bacteria 6866
109 Ga0070671_100013777 3300005355 Bacteria 6524
110 Ga0070671_100444704 3300005355 Unclassified 1112
111 Ga0070671_100666346 3300005355 Bacteria 901
112 Ga0070674_100086579 3300005356 Bacteria 2251
113 Ga0070674_100516506 3300005356 Bacteria 997
114 Ga0070673_100019324 3300005364 Bacteria 4889
115 Ga0070673_100032563 3300005364 Bacteria 3927
116 Ga0070673_100367739 3300005364 Bacteria 1280
117 Ga0070673_100987308 3300005364 Bacteria 784
118 Ga0070673_101399267 3300005364 Unclassified 658
119 Ga0070673_101517028 3300005364 Archaea 632
120 Ga0070659_100027757 3300005366 Bacteria 4364
121 Ga0070659_100040547 3300005366 Unclassified 3639
122 Ga0070659_100056994 3300005366 Bacteria 3080
123 Ga0070659_100072463 3300005366 Bacteria 2741
124 Ga0070659_100234021 3300005366 Bacteria 1518
125 Ga0070659_100261271 3300005366 Bacteria 1436
126 Ga0070659_100282428 3300005366 Unclassified 1381
127 Ga0070659_100360934 3300005366 Bacteria 1220
128 Ga0070659_100370003 3300005366 Unclassified 1205
129 Ga0070659_101033573 3300005366 Unclassified 722
130 Ga0070659_101453834 3300005366 Unclassified 610
131 Ga0070667_100015330 3300005367 Bacteria 6335
132 Ga0070667_100016094 3300005367 Bacteria 6187
133 Ga0070667_100027448 3300005367 Bacteria 4736
134 Ga0070667_100044503 3300005367 Bacteria 3728
135 Ga0070667_100069083 3300005367 Bacteria 3006
136 Ga0070667_100130482 3300005367 Unclassified 2193
137 Ga0070667_100995219 3300005367 Bacteria 782
138 Ga0070714_100066116 3300005435 Bacteria 3116
139 Ga0070714_100212968 3300005435 Bacteria 1772
140 Ga0070714_101476683 3300005435 Unclassified 664
141 Ga0070713_100090119 3300005436 Unclassified 2636
142 Ga0070713_100142598 3300005436 Bacteria 2124
143 Ga0070713_100217534 3300005436 Bacteria 1732
144 Ga0070713_100765947 3300005436 Unclassified 924
145 Ga0070663_100009418 3300005455 Bacteria 6047
146 Ga0070663_100020325 3300005455 Bacteria 4394
147 Ga0070663_100066797 3300005455 Unclassified 2606
148 Ga0070663_100075182 3300005455 Unclassified 2468
149 Ga0070663_100080020 3300005455 Bacteria 2399
150 Ga0070663_100104644 3300005455 Bacteria 2117
151 Ga0070663_100151822 3300005455 Bacteria 1777
152 Ga0070663_100293832 3300005455 Bacteria 1298
153 Ga0070678_100001234 3300005456 Bacteria 13521
154 Ga0070678_100007599 3300005456 Bacteria 6439
155 Ga0070678_100219278 3300005456 Bacteria 1580
156 Ga0070662_100001528 3300005457 Bacteria 14251
157 Ga0070662_100013099 3300005457 Bacteria 5512
158 Ga0070662_100089994 3300005457 Bacteria 2302
159 Ga0070662_100552774 3300005457 Bacteria 965
160 Ga0070681_10029554 3300005458 Bacteria 5503
161 Ga0070681_10033864 3300005458 Bacteria 5129
162 Ga0070681_10134884 3300005458 Bacteria 2399
163 Ga0070681_10158337 3300005458 Bacteria 2189
164 Ga0070681_10419118 3300005458 Bacteria 1251
165 Ga0070681_11055223 3300005458 Unclassified 733
166 Ga0068867_100003001 3300005459 Bacteria 11895
167 Ga0068867_100054308 3300005459 Bacteria 2960
168 Ga0070679_100044847 3300005530 Bacteria 4405
169 Ga0070679_100188227 3300005530 Bacteria 2033
170 Ga0070679_100507604 3300005530 Unclassified 1150
171 Ga0070679_100835127 3300005530 Bacteria 864
172 Ga0070679_101087547 3300005530 Unclassified 744
173 Ga0070684_100005764 3300005535 Bacteria 9523
174 Ga0070684_100027736 3300005535 Bacteria 4783
175 Ga0070684_100041133 3300005535 Bacteria 3983
176 Ga0070684_100068277 3300005535 Bacteria 3124
177 Ga0070684_100380114 3300005535 Bacteria 1301
178 Ga0070684_100791554 3300005535 Bacteria 886
179 Ga0068853_100049699 3300005539 Bacteria 3604
180 Ga0068853_100055862 3300005539 Bacteria 3403
181 Ga0068853_100110115 3300005539 Bacteria 2446
182 Ga0068853_100112183 3300005539 Bacteria 2423
183 Ga0068853_100218369 3300005539 Bacteria 1740
184 Ga0068853_100342405 3300005539 Bacteria 1389
185 Ga0068853_100672999 3300005539 Unclassified 986
186 Ga0068853_101528987 3300005539 Bacteria 646
187 Ga0070672_100107434 3300005543 Bacteria 2271
188 Ga0070672_100157906 3300005543 Bacteria 1879
189 Ga0070672_100169434 3300005543 Bacteria 1815
190 Ga0070672_100775145 3300005543 Unclassified 843
191 Ga0070672_100885947 3300005543 Bacteria 788
192 Ga0070686_100006151 3300005544 Bacteria 6663
193 Ga0070693_100254209 3300005547 Bacteria 1166
194 Ga0070693_100513808 3300005547 Bacteria 852
195 Ga0070665_100002247 3300005548 Bacteria 21484
196 Ga0070665_100214481 3300005548 Bacteria 1926
197 Ga0068855_100001731 3300005563 Bacteria 27264
198 Ga0068855_100010658 3300005563 Bacteria 11088
199 Ga0068855_100099331 3300005563 Bacteria 3352
200 Ga0068855_100152308 3300005563 Plasmid 2629
201 Ga0068855_100227712 3300005563 Bacteria 2089
202 Ga0068855_100274131 3300005563 Bacteria 1875
203 Ga0068855_100301014 3300005563 Bacteria 1776
204 Ga0068855_100432369 3300005563 Bacteria 1439
205 Ga0068855_100440682 3300005563 Unclassified 1423
206 Ga0068855_100587278 3300005563 Bacteria 1202
207 Ga0068855_101286345 3300005563 Bacteria 757
208 Ga0068855_101779700 3300005563 Bacteria 626
209 Ga0070664_100070531 3300005564 Bacteria 2993
210 Ga0070664_100088195 3300005564 Bacteria 2682
211 Ga0070664_100225395 3300005564 Bacteria 1678
212 Ga0070664_100367554 3300005564 Unclassified 1311
213 Ga0070664_100692067 3300005564 Unclassified 949
214 Ga0068857_100038767 3300005577 Bacteria 4218
215 Ga0068857_100150310 3300005577 Bacteria 2109
216 Ga0068857_100192759 3300005577 Bacteria 1856
217 Ga0068857_100253878 3300005577 Unclassified 1612
218 Ga0068857_100398991 3300005577 Bacteria 1280
219 Ga0068854_100003269 3300005578 Bacteria 10091
220 Ga0068854_100016457 3300005578 Bacteria 4931
221 Ga0068854_100062527 3300005578 Bacteria 2699
222 Ga0068854_100132539 3300005578 Bacteria 1904
223 Ga0068854_100208980 3300005578 Bacteria 1539
224 Ga0068854_100314604 3300005578 Bacteria 1271
225 Ga0068854_100447582 3300005578 Bacteria 1078
226 Ga0068856_100145825 3300005614 Bacteria 2375
227 Ga0068856_100259834 3300005614 Bacteria 1752
228 Ga0068856_100302052 3300005614 Unclassified 1618
229 Ga0068856_100305255 3300005614 Bacteria 1609
230 Ga0068856_100653949 3300005614 Bacteria 1072
231 Ga0068856_100833706 3300005614 Bacteria 941
232 Ga0068856_101790846 3300005614 Unclassified 626
233 Ga0068852_100011021 3300005616 Bacteria 6785
234 Ga0068852_100036057 3300005616 Bacteria 4134
235 Ga0068852_100049902 3300005616 Bacteria 3582
236 Ga0068852_100054284 3300005616 Bacteria 3453
237 Ga0068852_100071360 3300005616 Bacteria 3049
238 Ga0068852_100129720 3300005616 Bacteria 2320
239 Ga0068852_100276139 3300005616 Unclassified 1618
240 Ga0068852_100322826 3300005616 Bacteria 1500
241 Ga0068852_100356531 3300005616 Bacteria 1430
242 Ga0068852_101579040 3300005616 Unclassified 678
243 Ga0068852_101682666 3300005616 Bacteria 657
244 Ga0068859_100004108 3300005617 Bacteria 14849
245 Ga0068859_100006190 3300005617 Bacteria 12161
246 Ga0068859_100146943 3300005617 Unclassified 2433
247 Ga0068859_100599653 3300005617 Bacteria 1194
248 Ga0068859_101166422 3300005617 Bacteria 848
249 Ga0068859_101268805 3300005617 Bacteria 812
250 Ga0068864_100000078 3300005618 Bacteria 103622
251 Ga0068864_100006927 3300005618 Bacteria 9298
252 Ga0068864_100015480 3300005618 Bacteria 6341
253 Ga0068866_10004059 3300005718 Bacteria 6009
254 Ga0068861_100878910 3300005719 Unclassified 847
255 Ga0068851_10003418 3300005834 Bacteria 7070
256 Ga0068851_10030209 3300005834 Bacteria 2686
257 Ga0068851_10621863 3300005834 Unclassified 659
258 Ga0068870_10514764 3300005840 Bacteria 800
259 Ga0068863_100001062 3300005841 Bacteria 27480
260 Ga0068863_100002294 3300005841 Bacteria 19017
261 Ga0068863_100013130 3300005841 Bacteria 7994
262 Ga0068863_100041578 3300005841 Unclassified 4371
263 Ga0068863_100217307 3300005841 Bacteria 1841
264 Ga0068863_100326740 3300005841 Bacteria 1491
265 Ga0068863_100633459 3300005841 Bacteria 1060
266 Ga0068858_100000832 3300005842 Bacteria 32118
267 Ga0068858_100034723 3300005842 Bacteria 4678
268 Ga0068858_100122481 3300005842 Bacteria 2433
269 Ga0068858_101126955 3300005842 Bacteria 770
270 Ga0068860_100019591 3300005843 Bacteria 6561
271 Ga0068860_100022937 3300005843 Bacteria 6036
272 Ga0068862_100013397 3300005844 Bacteria 6784
273 Ga0068862_100016074 3300005844 Bacteria 6223
274 Ga0068862_100043250 3300005844 Bacteria 3840
275 Ga0068862_100087527 3300005844 Bacteria 2709
276 Ga0070717_10003063 3300006028 Bacteria 11920
277 Ga0097621_100071595 3300006237 Bacteria 2865
278 Ga0097621_100912540 3300006237 Bacteria 819
279 Ga0068871_100003089 3300006358 Bacteria 11424
280 Ga0068871_100397174 3300006358 Unclassified 1227
281 Ga0075434_100473611 3300006871 Bacteria 1273
282 Ga0068865_100010621 3300006881 Bacteria 5737
283 Ga0068865_100022816 3300006881 Bacteria 4089
284 Ga0068865_100088865 3300006881 Bacteria 2236
285 Ga0097620_100004108 3300006931 Bacteria 14849
286 Ga0097620_100006190 3300006931 Bacteria 12161
287 Ga0097620_100146933 3300006931 Unclassified 2433
288 Ga0097620_100599681 3300006931 Bacteria 1194
289 Ga0097620_101166663 3300006931 Bacteria 848
290 Ga0097620_101268871 3300006931 Bacteria 812
291 Ga0105250_10007968 3300009092 Unclassified 4524
292 Ga0105240_10050236 3300009093 Bacteria 5259
293 Ga0105240_10194411 3300009093 Bacteria 2383
294 Ga0105240_10444586 3300009093 Bacteria 1452
295 Ga0105240_10752685 3300009093 Bacteria 1059
296 Ga0105240_10937664 3300009093 Bacteria 929
297 Ga0105245_10007757 3300009098 Bacteria 9400
298 Ga0105245_10087663 3300009098 Bacteria 2857
299 Ga0105245_11972101 3300009098 Unclassified 637
300 Ga0105247_10043627 3300009101 Bacteria 2748
301 Ga0105247_10212470 3300009101 Unclassified 1305
302 Ga0105243_10162174 3300009148 Bacteria 1929
303 Ga0105241_10129894 3300009174 Unclassified 2038
304 Ga0105241_10399250 3300009174 Bacteria 1205
305 Ga0105241_10526535 3300009174 Bacteria 1058
306 Ga0105241_11708626 3300009174 Bacteria 612
307 Ga0105242_10004543 3300009176 Bacteria 10768
308 Ga0105248_10000317 3300009177 Bacteria 57281
309 Ga0105248_10007594 3300009177 Bacteria 11910
310 Ga0105248_10031869 3300009177 Bacteria 5890
311 Ga0105248_10047109 3300009177 Bacteria 4834
312 Ga0105248_10128072 3300009177 Bacteria 2864
313 Ga0105248_10226323 3300009177 Bacteria 2105
314 Ga0105248_11029102 3300009177 Unclassified 930
315 Ga0105237_10054165 3300009545 Unclassified 4019
316 Ga0105237_10360551 3300009545 Bacteria 1458
317 Ga0105238_10005701 3300009551 Bacteria 12311
318 Ga0105238_10012286 3300009551 Bacteria 8635
319 Ga0105238_10018068 3300009551 Bacteria 7167
320 Ga0105238_10043273 3300009551 Bacteria 4556
321 Ga0105238_10091512 3300009551 Bacteria 3029
322 Ga0105238_11135206 3300009551 Bacteria 805
323 Ga0105238_11194347 3300009551 Bacteria 785
324 Ga0105249_10021911 3300009553 Bacteria 5723
325 Ga0105249_10310597 3300009553 Unclassified 1585
326 Ga0105239_10039721 3300010375 Bacteria 5156
327 Ga0105239_10332933 3300010375 Bacteria 1713
328 Ga0105239_10780273 3300010375 Bacteria 1094
329 Ga0157373_10028283 3300013100 Bacteria 4044
330 Ga0157373_10068349 3300013100 Bacteria 2511
331 Ga0157373_10077773 3300013100 Bacteria 2340
332 Ga0157373_10098139 3300013100 Bacteria 2062
333 Ga0157373_10104908 3300013100 Bacteria 1988
334 Ga0157373_10221695 3300013100 Bacteria 1334
335 Ga0157373_10320232 3300013100 Unclassified 1103
336 Ga0157373_10364494 3300013100 Bacteria 1032
337 Ga0157373_10433800 3300013100 Bacteria 944
338 Ga0157373_10554035 3300013100 Bacteria 834
339 Ga0157373_10729125 3300013100 Bacteria 728
340 Ga0157373_10991722 3300013100 Bacteria 626
341 Ga0157373_11217331 3300013100 Unclassified 568
342 Ga0157371_10006438 3300013102 Bacteria 9689
343 Ga0157371_10011021 3300013102 Bacteria 7003
344 Ga0157371_10030841 3300013102 Bacteria 3864
345 Ga0157371_10038215 3300013102 Bacteria 3435
346 Ga0157371_10109280 3300013102 Bacteria 1963
347 Ga0157371_10115053 3300013102 Bacteria 1910
348 Ga0157371_10135059 3300013102 Bacteria 1756
349 Ga0157371_10147501 3300013102 Unclassified 1677
350 Ga0157371_10165351 3300013102 Bacteria 1580
351 Ga0157371_10180132 3300013102 Bacteria 1511
352 Ga0157371_10193743 3300013102 Unclassified 1456
353 Ga0157371_10312332 3300013102 Bacteria 1139
354 Ga0157371_10322457 3300013102 Bacteria 1121
355 Ga0157370_10001982 3300013104 Bacteria 25168
356 Ga0157370_10006925 3300013104 Bacteria 12393
357 Ga0157370_10041121 3300013104 Bacteria 4462
358 Ga0157370_10092352 3300013104 Bacteria 2841
359 Ga0157370_10112994 3300013104 Bacteria 2538
360 Ga0157370_10150487 3300013104 Bacteria 2166
361 Ga0157370_10160214 3300013104 Bacteria 2094
362 Ga0157370_10194700 3300013104 Bacteria 1881
363 Ga0157370_10412460 3300013104 Bacteria 1243
364 Ga0157370_10416437 3300013104 Unclassified 1236
365 Ga0157370_10672111 3300013104 Bacteria 946
366 Ga0157370_11004289 3300013104 Unclassified 755
367 Ga0157369_10001843 3300013105 Bacteria 25619
368 Ga0157369_10004559 3300013105 Bacteria 16291
369 Ga0157369_10005483 3300013105 Bacteria 14744
370 Ga0157369_10008947 3300013105 Bacteria 11468
371 Ga0157369_10034227 3300013105 Bacteria 5577
372 Ga0157369_10052669 3300013105 Bacteria 4402
373 Ga0157369_10064152 3300013105 Unclassified 3956
374 Ga0157369_10152947 3300013105 Bacteria 2438
375 Ga0157369_10175631 3300013105 Bacteria 2255
376 Ga0157369_10182031 3300013105 Bacteria 2211
377 Ga0157369_10194208 3300013105 Bacteria 2132
378 Ga0157369_10200560 3300013105 Bacteria 2094
379 Ga0157369_10225983 3300013105 Bacteria 1958
380 Ga0157369_10341022 3300013105 Bacteria 1557
381 Ga0157369_10343534 3300013105 Unclassified 1550
382 Ga0157369_10477428 3300013105 Unclassified 1290
383 Ga0157369_10622533 3300013105 Bacteria 1114
384 Ga0157378_10021202 3300013297 Bacteria 5715
385 Ga0157378_10468967 3300013297 Bacteria 1253
386 Ga0157378_10582986 3300013297 Bacteria 1127
387 Ga0157378_11648158 3300013297 Bacteria 688
388 Ga0163162_10023564 3300013306 Bacteria 6076
389 Ga0163162_10342990 3300013306 Unclassified 1626
390 Ga0163162_10500927 3300013306 Bacteria 1345
391 Ga0163162_10697970 3300013306 Unclassified 1136
392 Ga0163162_11494311 3300013306 Bacteria 769
393 Ga0157372_10077490 3300013307 Bacteria 3755
394 Ga0157372_10140692 3300013307 Bacteria 2780
395 Ga0157372_10249753 3300013307 Unclassified 2059
396 Ga0157372_10257550 3300013307 Bacteria 2026
397 Ga0157372_10301746 3300013307 Bacteria 1863
398 Ga0157372_10686889 3300013307 Bacteria 1191
399 Ga0157372_11255121 3300013307 Bacteria 856
400 Ga0157372_11509030 3300013307 Bacteria 774
401 Ga0157372_12792639 3300013307 Unclassified 560
402 Ga0157375_10038959 3300013308 Bacteria 4568
403 Ga0157375_10078204 3300013308 Bacteria 3340
404 Ga0157375_10703658 3300013308 Bacteria 1164
405 Ga0163163_10000588 3300014325 Bacteria 32034
406 Ga0163163_10053130 3300014325 Bacteria 3999
407 Ga0163163_10890374 3300014325 Bacteria 953
408 Ga0157379_10004364 3300014968 Bacteria 12098
409 Ga0157379_10318702 3300014968 Unclassified 1419
410 Ga0157376_10010903 3300014969 Bacteria 6676
411 Ga0206353_10682203 3300020082 Bacteria 1905
412 Ga0206353_10745388 3300020082 Bacteria 5040
413 Ga0207697_10027441 3300025315 Bacteria 2327
414 Ga0207697_10047791 3300025315 Bacteria 1765
415 Ga0207697_10088251 3300025315 Bacteria 1313
416 Ga0207697_10113511 3300025315 Bacteria 1161
417 Ga0207656_10033980 3300025321 Bacteria 2126
418 Ga0207656_10172714 3300025321 Bacteria 1034
419 Ga0207656_10388224 3300025321 Unclassified 700
420 Ga0207692_10991115 3300025898 Unclassified 555
421 Ga0207710_10055419 3300025900 Bacteria 1787
422 Ga0207710_10244135 3300025900 Unclassified 896
423 Ga0207688_10077484 3300025901 Bacteria 1895
424 Ga0207680_10060456 3300025903 Bacteria 2306
425 Ga0207680_10170414 3300025903 Bacteria 1466
426 Ga0207647_10004534 3300025904 Bacteria 10298
427 Ga0207647_10009334 3300025904 Bacteria 6974
428 Ga0207647_10009752 3300025904 Bacteria 6815
429 Ga0207647_10020016 3300025904 Bacteria 4493
430 Ga0207647_10033379 3300025904 Bacteria 3296
431 Ga0207647_10153406 3300025904 Bacteria 1345
432 Ga0207647_10168496 3300025904 Bacteria 1276
433 Ga0207647_10170323 3300025904 Unclassified 1268
434 Ga0207647_10279340 3300025904 Bacteria 953
435 Ga0207647_10636827 3300025904 Unclassified 586
436 Ga0207685_10098367 3300025905 Unclassified 1246
437 Ga0207699_10881228 3300025906 Bacteria 660
438 Ga0207645_10008618 3300025907 Bacteria 7100
439 Ga0207645_10027192 3300025907 Bacteria 3696
440 Ga0207645_10198663 3300025907 Unclassified 1319
441 Ga0207705_10000003 3300025909 Bacteria 709270
442 Ga0207705_10000330 3300025909 Bacteria 43029
443 Ga0207705_10000849 3300025909 Bacteria 25053
444 Ga0207705_10003040 3300025909 Bacteria 12799
445 Ga0207705_10007372 3300025909 Bacteria 8087
446 Ga0207705_10017586 3300025909 Bacteria 5117
447 Ga0207705_10028963 3300025909 Unclassified 3949
448 Ga0207705_10050158 3300025909 Bacteria 3004
449 Ga0207705_10072544 3300025909 Unclassified 2497
450 Ga0207705_10075705 3300025909 Bacteria 2445
451 Ga0207705_10128658 3300025909 Bacteria 1883
452 Ga0207705_10203785 3300025909 Bacteria 1499
453 Ga0207705_10236944 3300025909 Bacteria 1389
454 Ga0207705_10269728 3300025909 Bacteria 1301
455 Ga0207705_10330261 3300025909 Bacteria 1173
456 Ga0207705_10512807 3300025909 Unclassified 931
457 Ga0207705_10755561 3300025909 Bacteria 755
458 Ga0207705_11231502 3300025909 Bacteria 573
459 Ga0207705_11469741 3300025909 Bacteria 517
460 Ga0207654_10414445 3300025911 Bacteria 939
461 Ga0207654_10530533 3300025911 Bacteria 834
462 Ga0207707_10008275 3300025912 Bacteria 9025
463 Ga0207707_10017864 3300025912 Bacteria 6185
464 Ga0207707_10045315 3300025912 Bacteria 3832
465 Ga0207707_10115325 3300025912 Bacteria 2347
466 Ga0207695_10003916 3300025913 Bacteria 20603
467 Ga0207695_10011845 3300025913 Bacteria 10520
468 Ga0207695_10014239 3300025913 Bacteria 9434
469 Ga0207695_10083383 3300025913 Bacteria 3229
470 Ga0207671_10663058 3300025914 Bacteria 830
471 Ga0207671_11028237 3300025914 Bacteria 649
472 Ga0207671_11252062 3300025914 Bacteria 579
473 Ga0207660_10010608 3300025917 Bacteria 5983
474 Ga0207660_10237570 3300025917 Bacteria 1435
475 Ga0207662_10135776 3300025918 Bacteria 1554
476 Ga0207657_10001406 3300025919 Bacteria 25663
477 Ga0207657_10001980 3300025919 Bacteria 22107
478 Ga0207657_10002175 3300025919 Bacteria 21237
479 Ga0207657_10029567 3300025919 Bacteria 4986
480 Ga0207657_10033755 3300025919 Bacteria 4609
481 Ga0207657_10058542 3300025919 Bacteria 3315
482 Ga0207657_10119079 3300025919 Bacteria 2173
483 Ga0207657_10127025 3300025919 Bacteria 2093
484 Ga0207657_10351753 3300025919 Bacteria 1162
485 Ga0207657_10391709 3300025919 Bacteria 1093
486 Ga0207657_10434120 3300025919 Bacteria 1031
487 Ga0207657_10556311 3300025919 Bacteria 897
488 Ga0207657_10592711 3300025919 Unclassified 865
489 Ga0207657_10969144 3300025919 Unclassified 653
490 Ga0207649_10000772 3300025920 Bacteria 20748
491 Ga0207649_10019753 3300025920 Bacteria 3856
492 Ga0207649_10089632 3300025920 Bacteria 2011
493 Ga0207649_10106952 3300025920 Bacteria 1862
494 Ga0207649_10130759 3300025920 Bacteria 1704
495 Ga0207649_10207945 3300025920 Unclassified 1387
496 Ga0207649_10519875 3300025920 Bacteria 907
497 Ga0207649_10531495 3300025920 Unclassified 898
498 Ga0207649_11030047 3300025920 Unclassified 648
499 Ga0207652_10001926 3300025921 Bacteria 17959
500 Ga0207652_10174770 3300025921 Bacteria 1928
501 Ga0207652_10181205 3300025921 Unclassified 1893
502 Ga0207652_10414871 3300025921 Bacteria 1214
503 Ga0207652_10739687 3300025921 Bacteria 876
504 Ga0207652_11219166 3300025921 Bacteria 654
505 Ga0207681_10046161 3300025923 Bacteria 2929
506 Ga0207681_10058253 3300025923 Bacteria 2644
507 Ga0207681_10130379 3300025923 Bacteria 1858
508 Ga0207694_10011357 3300025924 Bacteria 6723
509 Ga0207694_10090507 3300025924 Bacteria 2414
510 Ga0207694_10102958 3300025924 Bacteria 2264
511 Ga0207694_10106853 3300025924 Unclassified 2223
512 Ga0207694_10226122 3300025924 Bacteria 1527
513 Ga0207650_10059230 3300025925 Unclassified 2854
514 Ga0207650_10065306 3300025925 Bacteria 2726
515 Ga0207659_10018215 3300025926 Bacteria 4600
516 Ga0207659_10137110 3300025926 Bacteria 1895
517 Ga0207687_10013240 3300025927 Bacteria 5386
518 Ga0207700_10034869 3300025928 Bacteria 3617
519 Ga0207700_10246501 3300025928 Bacteria 1525
520 Ga0207664_10040862 3300025929 Bacteria 3610
521 Ga0207664_10058961 3300025929 Bacteria 3056
522 Ga0207664_10583630 3300025929 Bacteria 1003
523 Ga0207664_11756472 3300025929 Unclassified 543
524 Ga0207644_10000377 3300025931 Bacteria 29090
525 Ga0207644_10000761 3300025931 Bacteria 20421
526 Ga0207690_10008683 3300025932 Bacteria 6027
527 Ga0207690_10034954 3300025932 Bacteria 3241
528 Ga0207690_10107352 3300025932 Bacteria 2005
529 Ga0207690_10113321 3300025932 Bacteria 1957
530 Ga0207690_10130242 3300025932 Bacteria 1840
531 Ga0207690_10181260 3300025932 Unclassified 1586
532 Ga0207690_10239172 3300025932 Unclassified 1398
533 Ga0207690_10292357 3300025932 Unclassified 1272
534 Ga0207690_10345991 3300025932 Bacteria 1175
535 Ga0207690_10458172 3300025932 Bacteria 1026
536 Ga0207690_11191783 3300025932 Unclassified 636
537 Ga0207690_11588508 3300025932 Unclassified 547
538 Ga0207706_10002422 3300025933 Bacteria 18208
539 Ga0207706_10002447 3300025933 Bacteria 18128
540 Ga0207706_10006297 3300025933 Bacteria 11027
541 Ga0207706_10064608 3300025933 Bacteria 3222
542 Ga0207706_10080595 3300025933 Bacteria 2862
543 Ga0207706_10228953 3300025933 Unclassified 1627
544 Ga0207706_10262366 3300025933 Unclassified 1508
545 Ga0207706_11311776 3300025933 Unclassified 598
546 Ga0207686_10032911 3300025934 Unclassified 3089
547 Ga0207670_10574440 3300025936 Bacteria 923
548 Ga0207670_10803765 3300025936 Unclassified 784
549 Ga0207670_10922807 3300025936 Bacteria 732
550 Ga0207669_10227943 3300025937 Unclassified 1372
551 Ga0207669_10538155 3300025937 Bacteria 940
552 Ga0207704_10013369 3300025938 Bacteria 4105
553 Ga0207704_10032251 3300025938 Bacteria 2962
554 Ga0207691_10001629 3300025940 Bacteria 22285
555 Ga0207691_10144167 3300025940 Bacteria 2097
556 Ga0207691_10148811 3300025940 Bacteria 2060
557 Ga0207691_10164459 3300025940 Bacteria 1945
558 Ga0207691_10566938 3300025940 Bacteria 962
559 Ga0207691_11170864 3300025940 Bacteria 638
560 Ga0207711_10000042 3300025941 Bacteria 158782
561 Ga0207711_10001092 3300025941 Bacteria 25881
562 Ga0207711_10002613 3300025941 Bacteria 15972
563 Ga0207711_10009979 3300025941 Bacteria 7891
564 Ga0207711_10023952 3300025941 Bacteria 5109
565 Ga0207711_10314665 3300025941 Bacteria 1446
566 Ga0207711_10852290 3300025941 Unclassified 848
567 Ga0207661_10008096 3300025944 Bacteria 7496
568 Ga0207661_10035813 3300025944 Bacteria 3870
569 Ga0207661_10038014 3300025944 Bacteria 3770
570 Ga0207661_10053688 3300025944 Bacteria 3226
571 Ga0207661_10057068 3300025944 Unclassified 3138
572 Ga0207661_10481880 3300025944 Bacteria 1132
573 Ga0207679_10139904 3300025945 Bacteria 1955
574 Ga0207679_10154809 3300025945 Bacteria 1870
575 Ga0207679_10315832 3300025945 Bacteria 1351
576 Ga0207679_10413694 3300025945 Bacteria 1189
577 Ga0207679_10433349 3300025945 Bacteria 1163
578 Ga0207667_10008143 3300025949 Bacteria 12481
579 Ga0207667_10011763 3300025949 Bacteria 10146
580 Ga0207667_10020737 3300025949 Bacteria 7301
581 Ga0207667_10079355 3300025949 Unclassified 3402
582 Ga0207667_10134678 3300025949 Bacteria 2544
583 Ga0207667_10188406 3300025949 Bacteria 2117
584 Ga0207667_10190689 3300025949 Bacteria 2103
585 Ga0207667_10199228 3300025949 Bacteria 2054
586 Ga0207667_10220712 3300025949 Bacteria 1942
587 Ga0207667_10350980 3300025949 Unclassified 1504
588 Ga0207667_10364156 3300025949 Bacteria 1474
589 Ga0207667_10654649 3300025949 Bacteria 1056
590 Ga0207667_10680133 3300025949 Unclassified 1033
591 Ga0207667_11104273 3300025949 Unclassified 776
592 Ga0207651_10012248 3300025960 Bacteria 4844
593 Ga0207651_10029987 3300025960 Bacteria 3456
594 Ga0207651_10069899 3300025960 Bacteria 2481
595 Ga0207651_10840430 3300025960 Bacteria 815
596 Ga0207651_11165375 3300025960 Unclassified 691
597 Ga0207712_10037341 3300025961 Unclassified 3314
598 Ga0207712_10429226 3300025961 Unclassified 1117
599 Ga0207668_10000021 3300025972 Bacteria 137592
600 Ga0207668_10063826 3300025972 Bacteria 2600
601 Ga0207668_10596949 3300025972 Bacteria 961
602 Ga0207640_10006096 3300025981 Bacteria 6590
603 Ga0207640_10017205 3300025981 Bacteria 4224
604 Ga0207640_10053821 3300025981 Bacteria 2629
605 Ga0207640_10221939 3300025981 Bacteria 1448
606 Ga0207640_10381963 3300025981 Bacteria 1141
607 Ga0207640_10455499 3300025981 Bacteria 1055
608 Ga0207640_10876741 3300025981 Bacteria 782
609 Ga0207640_11895282 3300025981 Unclassified 539
610 Ga0207658_10008807 3300025986 Bacteria 6850
611 Ga0207658_10028355 3300025986 Bacteria 3943
612 Ga0207658_10048129 3300025986 Unclassified 3124
613 Ga0207658_10070817 3300025986 Bacteria 2639
614 Ga0207658_10084818 3300025986 Bacteria 2438
615 Ga0207658_10094441 3300025986 Bacteria 2327
616 Ga0207658_10474387 3300025986 Bacteria 1111
617 Ga0207658_10526392 3300025986 Bacteria 1055
618 Ga0207677_10002683 3300026023 Bacteria 9380
619 Ga0207703_10001950 3300026035 Bacteria 18229
620 Ga0207703_10118270 3300026035 Bacteria 2271
621 Ga0207703_10579307 3300026035 Unclassified 1060
622 Ga0207703_10753075 3300026035 Bacteria 928
623 Ga0207639_10004789 3300026041 Bacteria 9130
624 Ga0207639_10027246 3300026041 Bacteria 4161
625 Ga0207639_10060824 3300026041 Bacteria 2915
626 Ga0207639_10088491 3300026041 Unclassified 2471
627 Ga0207639_10161494 3300026041 Bacteria 1888
628 Ga0207639_10177690 3300026041 Bacteria 1808
629 Ga0207639_10179388 3300026041 Unclassified 1800
630 Ga0207639_11678158 3300026041 Unclassified 595
631 Ga0207678_10005957 3300026067 Bacteria 10856
632 Ga0207678_10009880 3300026067 Bacteria 8378
633 Ga0207678_10016367 3300026067 Bacteria 6511
634 Ga0207678_10019855 3300026067 Bacteria 5906
635 Ga0207678_10021279 3300026067 Bacteria 5686
636 Ga0207678_10045859 3300026067 Bacteria 3780
637 Ga0207678_10141097 3300026067 Bacteria 2056
638 Ga0207678_10153872 3300026067 Bacteria 1963
639 Ga0207678_10353353 3300026067 Unclassified 1268
640 Ga0207678_10603239 3300026067 Unclassified 962
641 Ga0207678_10875863 3300026067 Bacteria 794
642 Ga0207702_10004836 3300026078 Bacteria 11862
643 Ga0207702_10011160 3300026078 Bacteria 7495
644 Ga0207702_10032603 3300026078 Bacteria 4347
645 Ga0207702_10060344 3300026078 Unclassified 3233
646 Ga0207702_10270300 3300026078 Unclassified 1603
647 Ga0207702_10347039 3300026078 Bacteria 1419
648 Ga0207702_10458048 3300026078 Bacteria 1238
649 Ga0207702_10692457 3300026078 Bacteria 1004
650 Ga0207702_10932036 3300026078 Bacteria 861
651 Ga0207702_11769438 3300026078 Unclassified 610
652 Ga0207641_10000626 3300026088 Bacteria 38602
653 Ga0207641_10016292 3300026088 Bacteria 6087
654 Ga0207641_10032881 3300026088 Bacteria 4308
655 Ga0207641_10057122 3300026088 Bacteria 3319
656 Ga0207641_10133940 3300026088 Bacteria 2228
657 Ga0207641_10927746 3300026088 Unclassified 865
658 Ga0207641_11491519 3300026088 Bacteria 678
659 Ga0207648_10002753 3300026089 Bacteria 18692
660 Ga0207648_10004648 3300026089 Bacteria 14054
661 Ga0207648_10073599 3300026089 Bacteria 2977
662 Ga0207676_10000740 3300026095 Bacteria 25562
663 Ga0207676_10083141 3300026095 Bacteria 2606
664 Ga0207674_10007185 3300026116 Bacteria 13000
665 Ga0207674_10017411 3300026116 Bacteria 7842
666 Ga0207674_10072276 3300026116 Bacteria 3465
667 Ga0207674_10077358 3300026116 Bacteria 3333
668 Ga0207674_10108140 3300026116 Bacteria 2758
669 Ga0207674_10434366 3300026116 Bacteria 1269
670 Ga0207674_10436906 3300026116 Bacteria 1265
671 Ga0207675_101632560 3300026118 Unclassified 665
672 Ga0207683_10001237 3300026121 Bacteria 23185
673 Ga0207683_10078985 3300026121 Bacteria 2917
674 Ga0207683_10265375 3300026121 Bacteria 1568
675 Ga0207698_10009484 3300026142 Bacteria 6211
676 Ga0207698_10010531 3300026142 Bacteria 5951
677 Ga0207698_10055237 3300026142 Bacteria 3059
678 Ga0207698_10061542 3300026142 Bacteria 2926
679 Ga0207698_10088174 3300026142 Bacteria 2530
680 Ga0207698_10137031 3300026142 Bacteria 2102
681 Ga0207698_10163309 3300026142 Bacteria 1951
682 Ga0207698_10224166 3300026142 Bacteria 1701
683 Ga0207698_10597575 3300026142 Bacteria 1087
684 Ga0207698_10922742 3300026142 Bacteria 881
685 Ga0268266_10012280 3300028379 Bacteria 7411
686 Ga0268266_10110061 3300028379 Bacteria 2440
687 Ga0268265_10004081 3300028380 Bacteria 10259
688 Ga0268265_10005187 3300028380 Bacteria 8927
689 Ga0268264_10004535 3300028381 Bacteria 11838
690 Ga0268264_10004576 3300028381 Bacteria 11775
691 Ga0268264_10028173 3300028381 Bacteria 4593
692 Ga0307408_100059138 3300031548 Bacteria 2789
693 Ga0373936_0098054 3300035113 Unclassified 1234
694 Ga0373954_0082841 3300035118 Bacteria 1534
695 Ga0373960_0037189 3300035121 Unclassified 1390
696 Ga0373943_0007752 3300035170 Bacteria 4821
697 Ga0373946_0340239 3300035171 Unclassified 748
698 Ga0373955_0113431 3300035172 Bacteria 1569
699 Ga0373962_0227010 3300035242 Unclassified 641
700 Ga0373935_0209995 3300035692 Bacteria 1349
701 Ga0373947_0014930 3300035725 Bacteria 4458
702 Ga0373937_0644867 3300036401 Bacteria 1004
703 Ga0395899_0000825 3300037312 Bacteria 30147
704 Ga0395899_0012306 3300037312 Bacteria 6554
705 Ga0395899_0012651 3300037312 Bacteria 6468
706 Ga0395899_0014183 3300037312 Bacteria 6080
707 Ga0395899_0015735 3300037312 Bacteria 5767
708 Ga0395899_0017081 3300037312 Bacteria 5528
709 Ga0395899_0030161 3300037312 Bacteria 4079
710 Ga0395899_0032567 3300037312 Bacteria 3915
711 Ga0395899_0041288 3300037312 Bacteria 3447
712 Ga0395899_0058038 3300037312 Bacteria 2855
713 Ga0395899_0092103 3300037312 Bacteria 2195
714 Ga0395899_0109112 3300037312 Bacteria 1991
715 Ga0395899_0151186 3300037312 Bacteria 1645
716 Ga0395899_0174625 3300037312 Bacteria 1511
717 Ga0395899_0197559 3300037312 Bacteria 1404
718 Ga0395900_0000031 3300037418 Bacteria 262393
719 Ga0395900_0003797 3300037418 Bacteria 16176
720 Ga0395900_0005341 3300037418 Bacteria 13461
721 Ga0395900_0015806 3300037418 Bacteria 7694
722 Ga0395900_0021490 3300037418 Bacteria 6599
723 Ga0395900_0028834 3300037418 Bacteria 5690
724 Ga0395900_0029797 3300037418 Bacteria 5601
725 Ga0395900_0031281 3300037418 Bacteria 5467
726 Ga0395900_0046213 3300037418 Bacteria 4484
727 Ga0395900_0089677 3300037418 Bacteria 3160
728 Ga0395900_0112444 3300037418 Bacteria 2796
729 Ga0395900_0125455 3300037418 Bacteria 2633
730 Ga0395900_0126688 3300037418 Bacteria 2619
731 Ga0395900_0154421 3300037418 Bacteria 2344
732 Ga0395900_0165284 3300037418 Bacteria 2255
733 Ga0395900_0206270 3300037418 Bacteria 1986
734 Ga0395900_0212392 3300037418 Bacteria 1953
735 Ga0395900_0236929 3300037418 Bacteria 1832
736 Ga0395900_0272748 3300037418 Bacteria 1686
737 Ga0395900_0292819 3300037418 Unclassified 1616
738 Ga0395900_0329362 3300037418 Bacteria 1505
739 Ga0395900_0382184 3300037418 Bacteria 1376
740 Ga0395900_0489495 3300037418 Viruses 1181
741 Ga0395900_0551325 3300037418 Bacteria 1097
742 Ga0395900_1149459 3300037418 Unclassified 693
743 Ga0395898_0007616 3300037466 Bacteria 11494
744 Ga0395898_0050617 3300037466 Bacteria 4065
745 Ga0395898_0055001 3300037466 Bacteria 3882
746 Ga0395898_0063175 3300037466 Bacteria 3593
747 Ga0395898_0072531 3300037466 Bacteria 3327
748 Ga0395898_0081284 3300037466 Bacteria 3124
749 Ga0395898_0085303 3300037466 Bacteria 3044
750 Ga0395898_0107023 3300037466 Unclassified 2682
751 Ga0395898_0121258 3300037466 Bacteria 2505
752 Ga0395898_0147787 3300037466 Bacteria 2249
753 Ga0395898_0185717 3300037466 Bacteria 1986
754 Ga0395898_0220164 3300037466 Bacteria 1810
755 Ga0395898_0238736 3300037466 Bacteria 1733
756 Ga0395898_0255105 3300037466 Bacteria 1672
757 Ga0395898_0313144 3300037466 Bacteria 1497
758 Ga0395898_0336909 3300037466 Bacteria 1438
759 Ga0395898_0588166 3300037466 Bacteria 1055
760 Ga0395898_0739838 3300037466 Bacteria 925
761 Ga0395905_0009056 3300037471 Bacteria 9764
762 Ga0395905_0014618 3300037471 Bacteria 7488
763 Ga0395905_0017567 3300037471 Bacteria 6789
764 Ga0395905_0026745 3300037471 Bacteria 5440
765 Ga0395905_0035451 3300037471 Bacteria 4685
766 Ga0395905_0043478 3300037471 Bacteria 4214
767 Ga0395905_0056145 3300037471 Unclassified 3684
768 Ga0395905_0056757 3300037471 Bacteria 3662
769 Ga0395905_0067363 3300037471 Bacteria 3354
770 Ga0395905_0107409 3300037471 Bacteria 2620
771 Ga0395905_0121967 3300037471 Bacteria 2450
772 Ga0395905_0129736 3300037471 Bacteria 2371
773 Ga0395905_0189328 3300037471 Bacteria 1930
774 Ga0395905_0206166 3300037471 Bacteria 1842
775 Ga0395905_0231710 3300037471 Bacteria 1727
776 Ga0395905_0279915 3300037471 Bacteria 1554
777 Ga0395905_0318577 3300037471 Bacteria 1444
778 Ga0395905_0417135 3300037471 Bacteria 1238
779 Ga0395905_0435155 3300037471 Unclassified 1209
780 Ga0395905_0537813 3300037471 Bacteria 1069
781 Ga0395905_0631338 3300037471 Bacteria 973
782 Ga0395905_0697671 3300037471 Viruses 917
783 Ga0395905_1111830 3300037471 Bacteria 693
784 Ga0395901_0000260 3300038443 Bacteria 66084
785 Ga0395901_0005146 3300038443 Bacteria 13202
786 Ga0395901_0019627 3300038443 Bacteria 6908
787 Ga0395901_0025571 3300038443 Bacteria 6060
788 Ga0395901_0026422 3300038443 Bacteria 5960
789 Ga0395901_0042983 3300038443 Bacteria 4687
790 Ga0395901_0046372 3300038443 Bacteria 4514
791 Ga0395901_0136800 3300038443 Bacteria 2574
792 Ga0395901_0143619 3300038443 Bacteria 2508
793 Ga0395901_0313017 3300038443 Bacteria 1625
794 Ga0395901_0314088 3300038443 Bacteria 1622
795 Ga0395901_0333964 3300038443 Bacteria 1566
796 Ga0395901_0591758 3300038443 Bacteria 1119
797 Ga0395901_0605312 3300038443 Viruses 1104
798 Ga0395901_1122904 3300038443 Bacteria 755
799 Ga0395901_1136830 3300038443 Bacteria 750
800 Ga0395901_1336091 3300038443 Bacteria 677
801 Ga0451789_0524974 3300041443 Unclassified 711
802 Ga0466969_0005911 3300044656 Bacteria 6509
803 Ga0466969_0056456 3300044656 Bacteria 1917
804 Ga0466969_0065070 3300044656 Unclassified 1764
805 Ga0466969_0238981 3300044656 Bacteria 825
806 Ga0466965_0180379 3300044683 Bacteria 1114
807 Ga0466966_0000010 3300044684 Bacteria 150868
808 Ga0466966_0014430 3300044684 Bacteria 5231
809 Ga0466966_0025430 3300044684 Bacteria 3867
810 Ga0466966_0039466 3300044684 Bacteria 3040
811 Ga0466961_0002980 3300044693 Bacteria 10518
812 Ga0466961_0087458 3300044693 Bacteria 1969
813 Ga0466961_0483856 3300044693 Unclassified 748
814 Ga0466963_0006016 3300044694 Bacteria 7148
815 Ga0466963_0007643 3300044694 Bacteria 6453
816 Ga0466963_0022631 3300044694 Bacteria 3982
817 Ga0466963_0038008 3300044694 Bacteria 3146
818 Ga0466963_0051744 3300044694 Bacteria 2723
819 Ga0466963_0156439 3300044694 Unclassified 1585
820 Ga0466963_0163438 3300044694 Bacteria 1550
821 Ga0466963_0185850 3300044694 Bacteria 1451
822 Ga0466963_0204904 3300044694 Unclassified 1379
823 Ga0466963_0483060 3300044694 Bacteria 874
824 Ga0466963_0648442 3300044694 Unclassified 745
825 Ga0466964_0037889 3300044706 Bacteria 1938
826 Ga0466964_0122332 3300044706 Bacteria 1175
827 Ga0466964_0290754 3300044706 Unclassified 820
828 Ga0466971_0001547 3300044719 Bacteria 9696
829 Ga0466971_0036307 3300044719 Bacteria 2210
830 Ga0466971_0125951 3300044719 Bacteria 1187
831 Ga0466971_0579019 3300044719 Bacteria 559
832 Ga0466970_0039072 3300044765 Bacteria 2518
833 Ga0466957_0005415 3300044842 Bacteria 7165
834 Ga0466957_0021689 3300044842 Bacteria 3785
835 Ga0466957_0065176 3300044842 Bacteria 2243
836 Ga0466957_0078125 3300044842 Bacteria 2057
837 Ga0466957_0090086 3300044842 Bacteria 1921
838 Ga0466957_0134714 3300044842 Bacteria 1586
839 Ga0466957_0193935 3300044842 Bacteria 1332
840 Ga0466957_0216896 3300044842 Unclassified 1262
841 Ga0466957_0276431 3300044842 Bacteria 1123
842 Ga0466957_1132193 3300044842 Bacteria 565
843 Ga0466960_0082757 3300044901 Bacteria 1621
844 Ga0466960_0262379 3300044901 Unclassified 963
845 Ga0466959_0003693 3300045049 Bacteria 10097
846 Ga0466959_0023036 3300045049 Bacteria 4606
847 Ga0466959_0158903 3300045049 Bacteria 1590
848 Ga0466959_0501869 3300045049 Bacteria 820
849 Ga0466958_0012249 3300045836 Bacteria 4854
850 Ga0466958_0037198 3300045836 Bacteria 2916
851 Ga0466958_0051618 3300045836 Bacteria 2490
852 Ga0466958_0065478 3300045836 Bacteria 2217
853 Ga0466958_0762409 3300045836 Unclassified 631
854 Ga0466967_0037279 3300045976 Bacteria 4159
855 Ga0466967_0058333 3300045976 Bacteria 3412
856 Ga0466967_0072622 3300045976 Bacteria 3084
857 Ga0466967_0097771 3300045976 Bacteria 2679
858 Ga0466967_0129102 3300045976 Bacteria 2345
859 Ga0466967_0169957 3300045976 Bacteria 2050
860 Ga0466967_0176562 3300045976 Bacteria 2012
861 Ga0466967_0194035 3300045976 Unclassified 1920
862 Ga0466967_0222949 3300045976 Bacteria 1792
863 Ga0466967_0264214 3300045976 Bacteria 1647
864 Ga0466967_0341056 3300045976 Bacteria 1449
865 Ga0466967_0413089 3300045976 Bacteria 1314
866 Ga0466967_0631265 3300045976 Bacteria 1058
867 Ga0466967_1059339 3300045976 Bacteria 808
868 Ga0466967_1646042 3300045976 Unclassified 639
869 Ga0466967_1706307 3300045976 Unclassified 627
870 Ga0466967_1811105 3300045976 Unclassified 608
871 Ga0466967_2480839 3300045976 Unclassified 513
872 Ga0495621_0005075 3300046539 Bacteria 3756
873 Ga0495668_0080677 3300046616 Unclassified 1785
874 Ga0495669_0055111 3300046684 Bacteria 1790
875 Ga0495669_0139479 3300046684 Bacteria 1144
876 Ga0495669_0190447 3300046684 Unclassified 979
877 Ga0495670_0005562 3300046691 Bacteria 6183
878 Ga0496100_0107267 3300048903 Bacteria 1935
879 Ga0496101_0005007 3300048904 Bacteria 8416
880 Ga0496101_0973332 3300048904 Bacteria 667
881 Ga0496101_1304085 3300048904 Unclassified 568
882 Ga0496102_0088025 3300048905 Bacteria 2870
883 Ga0496102_0715615 3300048905 Bacteria 924
884 Ga0496102_0795987 3300048905 Unclassified 868
885 Ga0496104_0086155 3300048907 Bacteria 2999
886 Ga0496106_0204749 3300048909 Bacteria 1571
887 Ga0496106_0342156 3300048909 Unclassified 1201
888 Ga0496107_0016434 3300048910 Bacteria 5198
889 Ga0496107_0050072 3300048910 Bacteria 3010
890 Ga0496107_0171331 3300048910 Bacteria 1611
891 Ga0496108_0004195 3300048911 Bacteria 11607
892 Ga0496108_0016972 3300048911 Bacteria 5951
893 Ga0496109_0045477 3300048912 Bacteria 3984
894 Ga0496109_0129215 3300048912 Bacteria 2357
895 Ga0496110_0006176 3300048913 Bacteria 9453
896 Ga0496110_0883129 3300048913 Unclassified 800
897 Ga0496111_0059661 3300048914 Bacteria 2764
898 Ga0496112_0041630 3300048915 Unclassified 4494
899 Ga0496112_0072686 3300048915 Bacteria 3400
900 Ga0496113_0092352 3300048916 Bacteria 2334
901 Ga0496113_0442264 3300048916 Unclassified 1044
902 Ga0496114_0001397 3300048917 Bacteria 18340
903 Ga0501071_0035178 3300049587 Bacteria 3568
904 Ga0501074_0350743 3300049590 Bacteria 1047
905 Ga0500658_0000088 3300053134 Bacteria 42563
906 Ga0466962_0000549 3300061719 Bacteria 16555
907 Ga0466962_0234705 3300061719 Bacteria 900

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300044694 Ga0466963_0648442 Ga0466963_0648442_339_728 127
2 3300005344 Ga0070661_100635221 Ga0070661_1006352211 137
3 3300005539 Ga0068853_100342405 Ga0068853_1003424051 137
4 3300005614 Ga0068856_101790846 Ga0068856_1017908461 137
5 3300013100 Ga0157373_10068349 Ga0157373_100683492 137
6 3300013105 Ga0157369_10341022 Ga0157369_103410222 137
7 3300013307 Ga0157372_12792639 Ga0157372_127926391 137
8 3300025909 Ga0207705_10236944 Ga0207705_102369441 137
9 3300026041 Ga0207639_11678158 Ga0207639_116781581 137
10 3300035692 Ga0373935_0209995 Ga0373935_0209995_918_1337 139
11 3300005336 Ga0070680_100193655 Ga0070680_1001936552 141
12 3300026067 Ga0207678_10045859 Ga0207678_100458595 141
13 3300005436 Ga0070713_100090119 Ga0070713_1000901192 144
14 3300009177 Ga0105248_10047109 Ga0105248_100471092 144
15 3300009553 Ga0105249_10310597 Ga0105249_103105971 144
16 3300013306 Ga0163162_10342990 Ga0163162_103429902 144
17 3300037418 Ga0395900_0551325 Ga0395900_0551325_106_576 144
18 3300037466 Ga0395898_0220164 Ga0395898_0220164_1021_1491 144
19 3300037471 Ga0395905_0017567 Ga0395905_0017567_5283_5753 144
20 3300025914 Ga0207671_11252062 Ga0207671_112520621 145
21 3300048905 Ga0496102_0795987 Ga0496102_0795987_168_605 145
22 3300013102 Ga0157371_10312332 Ga0157371_103123322 147
23 3300013100 Ga0157373_10729125 Ga0157373_107291251 149
24 3300035118 Ga0373954_0082841 Ga0373954_0082841_672_1121 149
25 3300037418 Ga0395900_0126688 Ga0395900_0126688_2155_2604 149
26 3300044684 Ga0466966_0025430 Ga0466966_0025430_2576_3031 149
27 3300044694 Ga0466963_0483060 Ga0466963_0483060_228_677 149
28 3300037471 Ga0395905_0129736 Ga0395905_0129736_290_745 151
29 3300048904 Ga0496101_1304085 Ga0496101_1304085_77_532 151
30 3300001989 JGI24739J22299_10078037 JGI24739J22299_100780371 152
31 3300001990 JGI24737J22298_10027909 JGI24737J22298_100279092 152
32 3300002067 JGI24735J21928_10018727 JGI24735J21928_100187272 152
33 3300005336 Ga0070680_100332761 Ga0070680_1003327612 152
34 3300005344 Ga0070661_100093985 Ga0070661_1000939852 152
35 3300005366 Ga0070659_100261271 Ga0070659_1002612712 152
36 3300005435 Ga0070714_100212968 Ga0070714_1002129682 152
37 3300005548 Ga0070665_100214481 Ga0070665_1002144812 152
38 3300009098 Ga0105245_11972101 Ga0105245_119721011 152
39 3300013102 Ga0157371_10115053 Ga0157371_101150532 152
40 3300013105 Ga0157369_10622533 Ga0157369_106225332 152
41 3300013307 Ga0157372_10686889 Ga0157372_106868892 152
42 3300025909 Ga0207705_10128658 Ga0207705_101286582 152
43 3300025920 Ga0207649_10089632 Ga0207649_100896322 152
44 3300025921 Ga0207652_10174770 Ga0207652_101747702 152
45 3300025932 Ga0207690_10345991 Ga0207690_103459911 152
46 3300026142 Ga0207698_10055237 Ga0207698_100552372 152
47 3300037471 Ga0395905_0014618 Ga0395905_0014618_4784_5245 152
48 3300002244 JGI24742J22300_10018345 JGI24742J22300_100183452 153
49 3300005327 Ga0070658_10046195 Ga0070658_100461952 153
50 3300005327 Ga0070658_10321502 Ga0070658_103215021 153
51 3300005329 Ga0070683_100010291 Ga0070683_1000102919 153
52 3300005339 Ga0070660_100826061 Ga0070660_1008260611 153
53 3300005344 Ga0070661_100110514 Ga0070661_1001105144 153
54 3300005535 Ga0070684_100027736 Ga0070684_1000277363 153
55 3300005563 Ga0068855_100440682 Ga0068855_1004406823 153
56 3300013100 Ga0157373_10991722 Ga0157373_109917221 153
57 3300013102 Ga0157371_10038215 Ga0157371_100382153 153
58 3300013104 Ga0157370_10416437 Ga0157370_104164372 153
59 3300013105 Ga0157369_10052669 Ga0157369_100526692 153
60 3300025909 Ga0207705_10017586 Ga0207705_100175866 153
61 3300025909 Ga0207705_10075705 Ga0207705_100757052 153
62 3300025909 Ga0207705_10269728 Ga0207705_102697282 153
63 3300025909 Ga0207705_11469741 Ga0207705_114697411 153
64 3300025919 Ga0207657_10592711 Ga0207657_105927111 153
65 3300025920 Ga0207649_10207945 Ga0207649_102079453 153
66 3300025944 Ga0207661_10008096 Ga0207661_100080963 153
67 3300025949 Ga0207667_10350980 Ga0207667_103509803 153
68 3300037312 Ga0395899_0015735 Ga0395899_0015735_1126_1590 153
69 3300037312 Ga0395899_0030161 Ga0395899_0030161_2649_3113 153
70 3300037418 Ga0395900_0021490 Ga0395900_0021490_3213_3677 153
71 3300037418 Ga0395900_0089677 Ga0395900_0089677_1316_1780 153
72 3300037466 Ga0395898_0081284 Ga0395898_0081284_1293_1757 153
73 3300037471 Ga0395905_0056145 Ga0395905_0056145_2048_2512 153
74 3300037471 Ga0395905_0107409 Ga0395905_0107409_332_796 153
75 3300038443 Ga0395901_0025571 Ga0395901_0025571_915_1379 153
76 3300038443 Ga0395901_0026422 Ga0395901_0026422_1701_2165 153
77 3300001904 JGI24736J21556_1000552 JGI24736J21556_10005522 154
78 3300001915 JGI24741J21665_1014104 JGI24741J21665_10141041 154
79 3300001979 JGI24740J21852_10084198 JGI24740J21852_100841981 154
80 3300001989 JGI24739J22299_10046713 JGI24739J22299_100467135 154
81 3300001989 JGI24739J22299_10081533 JGI24739J22299_100815331 154
82 3300001990 JGI24737J22298_10014900 JGI24737J22298_100149003 154
83 3300001990 JGI24737J22298_10035477 JGI24737J22298_100354772 154
84 3300002075 JGI24738J21930_10025675 JGI24738J21930_100256751 154
85 3300005327 Ga0070658_10027312 Ga0070658_100273125 154
86 3300005328 Ga0070676_10009417 Ga0070676_100094174 154
87 3300005329 Ga0070683_100084126 Ga0070683_1000841263 154
88 3300005330 Ga0070690_100001940 Ga0070690_1000019404 154
89 3300005331 Ga0070670_100087962 Ga0070670_1000879621 154
90 3300005335 Ga0070666_10046909 Ga0070666_100469097 154
91 3300005339 Ga0070660_100004893 Ga0070660_1000048936 154
92 3300005339 Ga0070660_100248088 Ga0070660_1002480881 154
93 3300005340 Ga0070689_100411128 Ga0070689_1004111282 154
94 3300005343 Ga0070687_100055699 Ga0070687_1000556992 154
95 3300005356 Ga0070674_100086579 Ga0070674_1000865796 154
96 3300005366 Ga0070659_100056994 Ga0070659_1000569944 154
97 3300005366 Ga0070659_100282428 Ga0070659_1002824282 154
98 3300005367 Ga0070667_100015330 Ga0070667_1000153306 154
99 3300005455 Ga0070663_100066797 Ga0070663_1000667972 154
100 3300005455 Ga0070663_100104644 Ga0070663_1001046442 154
101 3300005456 Ga0070678_100001234 Ga0070678_1000012349 154
102 3300005457 Ga0070662_100013099 Ga0070662_1000130996 154
103 3300005459 Ga0068867_100003001 Ga0068867_10000300111 154
104 3300005535 Ga0070684_100380114 Ga0070684_1003801142 154
105 3300005539 Ga0068853_100672999 Ga0068853_1006729992 154
106 3300005543 Ga0070672_100169434 Ga0070672_1001694345 154
107 3300005544 Ga0070686_100006151 Ga0070686_1000061516 154
108 3300005563 Ga0068855_100227712 Ga0068855_1002277126 154
109 3300005577 Ga0068857_100398991 Ga0068857_1003989912 154
110 3300005578 Ga0068854_100003269 Ga0068854_1000032692 154
111 3300005578 Ga0068854_100016457 Ga0068854_1000164572 154
112 3300005614 Ga0068856_100305255 Ga0068856_1003052552 154
113 3300005614 Ga0068856_100833706 Ga0068856_1008337062 154
114 3300005616 Ga0068852_100036057 Ga0068852_1000360572 154
115 3300005616 Ga0068852_101579040 Ga0068852_1015790402 154
116 3300005617 Ga0068859_100006190 Ga0068859_10000619011 154
117 3300005718 Ga0068866_10004059 Ga0068866_100040597 154
118 3300005719 Ga0068861_100878910 Ga0068861_1008789101 154
119 3300005834 Ga0068851_10003418 Ga0068851_100034183 154
120 3300005834 Ga0068851_10621863 Ga0068851_106218631 154
121 3300005841 Ga0068863_100002294 Ga0068863_1000022947 154
122 3300005842 Ga0068858_100122481 Ga0068858_1001224813 154
123 3300005843 Ga0068860_100022937 Ga0068860_1000229379 154
124 3300006237 Ga0097621_100071595 Ga0097621_1000715959 154
125 3300006358 Ga0068871_100003089 Ga0068871_10000308915 154
126 3300006881 Ga0068865_100010621 Ga0068865_1000106216 154
127 3300006931 Ga0097620_100006190 Ga0097620_10000619011 154
128 3300009093 Ga0105240_10050236 Ga0105240_100502367 154
129 3300009093 Ga0105240_10194411 Ga0105240_101944112 154
130 3300009098 Ga0105245_10007757 Ga0105245_1000775710 154
131 3300009101 Ga0105247_10212470 Ga0105247_102124702 154
132 3300009148 Ga0105243_10162174 Ga0105243_101621742 154
133 3300009176 Ga0105242_10004543 Ga0105242_1000454311 154
134 3300009177 Ga0105248_10128072 Ga0105248_101280722 154
135 3300009551 Ga0105238_10005701 Ga0105238_1000570114 154
136 3300009551 Ga0105238_10018068 Ga0105238_100180684 154
137 3300010375 Ga0105239_10039721 Ga0105239_1003972111 154
138 3300010375 Ga0105239_10780273 Ga0105239_107802732 154
139 3300013100 Ga0157373_10098139 Ga0157373_100981392 154
140 3300013102 Ga0157371_10006438 Ga0157371_1000643814 154
141 3300013102 Ga0157371_10322457 Ga0157371_103224572 154
142 3300013104 Ga0157370_10194700 Ga0157370_101947002 154
143 3300013104 Ga0157370_10412460 Ga0157370_104124603 154
144 3300013105 Ga0157369_10001843 Ga0157369_100018436 154
145 3300013105 Ga0157369_10004559 Ga0157369_1000455913 154
146 3300013105 Ga0157369_10064152 Ga0157369_100641524 154
147 3300013105 Ga0157369_10343534 Ga0157369_103435342 154
148 3300013297 Ga0157378_10021202 Ga0157378_100212027 154
149 3300013306 Ga0163162_10023564 Ga0163162_100235648 154
150 3300013307 Ga0157372_10140692 Ga0157372_101406922 154
151 3300013308 Ga0157375_10078204 Ga0157375_100782042 154
152 3300014325 Ga0163163_10053130 Ga0163163_100531309 154
153 3300014968 Ga0157379_10318702 Ga0157379_103187022 154
154 3300014969 Ga0157376_10010903 Ga0157376_100109037 154
155 3300025315 Ga0207697_10027441 Ga0207697_100274412 154
156 3300025321 Ga0207656_10033980 Ga0207656_100339807 154
157 3300025321 Ga0207656_10388224 Ga0207656_103882241 154
158 3300025900 Ga0207710_10244135 Ga0207710_102441352 154
159 3300025903 Ga0207680_10060456 Ga0207680_100604568 154
160 3300025904 Ga0207647_10033379 Ga0207647_100333795 154
161 3300025904 Ga0207647_10168496 Ga0207647_101684961 154
162 3300025907 Ga0207645_10008618 Ga0207645_100086189 154
163 3300025909 Ga0207705_10000003 Ga0207705_10000003392 154
164 3300025909 Ga0207705_10028963 Ga0207705_100289634 154
165 3300025909 Ga0207705_10050158 Ga0207705_100501582 154
166 3300025913 Ga0207695_10003916 Ga0207695_1000391610 154
167 3300025913 Ga0207695_10014239 Ga0207695_100142392 154
168 3300025918 Ga0207662_10135776 Ga0207662_101357766 154
169 3300025919 Ga0207657_10033755 Ga0207657_100337554 154
170 3300025919 Ga0207657_10119079 Ga0207657_101190793 154
171 3300025920 Ga0207649_10000772 Ga0207649_1000077222 154
172 3300025920 Ga0207649_10519875 Ga0207649_105198752 154
173 3300025924 Ga0207694_10090507 Ga0207694_100905072 154
174 3300025924 Ga0207694_10226122 Ga0207694_102261223 154
175 3300025925 Ga0207650_10065306 Ga0207650_100653065 154
176 3300025927 Ga0207687_10013240 Ga0207687_100132402 154
177 3300025929 Ga0207664_10583630 Ga0207664_105836301 154
178 3300025931 Ga0207644_10000761 Ga0207644_1000076120 154
179 3300025932 Ga0207690_10239172 Ga0207690_102391722 154
180 3300025932 Ga0207690_10292357 Ga0207690_102923574 154
181 3300025933 Ga0207706_10002447 Ga0207706_1000244717 154
182 3300025934 Ga0207686_10032911 Ga0207686_100329118 154
183 3300025936 Ga0207670_10803765 Ga0207670_108037652 154
184 3300025936 Ga0207670_10922807 Ga0207670_109228071 154
185 3300025937 Ga0207669_10227943 Ga0207669_102279433 154
186 3300025940 Ga0207691_10001629 Ga0207691_100016297 154
187 3300025941 Ga0207711_10002613 Ga0207711_1000261313 154
188 3300025944 Ga0207661_10053688 Ga0207661_100536885 154
189 3300025949 Ga0207667_10020737 Ga0207667_100207373 154
190 3300025949 Ga0207667_10199228 Ga0207667_101992282 154
191 3300025949 Ga0207667_11104273 Ga0207667_111042732 154
192 3300025960 Ga0207651_10029987 Ga0207651_100299872 154
193 3300025981 Ga0207640_10006096 Ga0207640_100060964 154
194 3300025986 Ga0207658_10084818 Ga0207658_100848189 154
195 3300026023 Ga0207677_10002683 Ga0207677_100026837 154
196 3300026035 Ga0207703_10579307 Ga0207703_105793073 154
197 3300026041 Ga0207639_10179388 Ga0207639_101793882 154
198 3300026067 Ga0207678_10153872 Ga0207678_101538722 154
199 3300026067 Ga0207678_10353353 Ga0207678_103533532 154
200 3300026078 Ga0207702_10032603 Ga0207702_100326033 154
201 3300026078 Ga0207702_10270300 Ga0207702_102703001 154
202 3300026078 Ga0207702_10932036 Ga0207702_109320362 154
203 3300026089 Ga0207648_10002753 Ga0207648_1000275320 154
204 3300026116 Ga0207674_10077358 Ga0207674_100773582 154
205 3300026118 Ga0207675_101632560 Ga0207675_1016325602 154
206 3300026121 Ga0207683_10001237 Ga0207683_1000123722 154
207 3300026142 Ga0207698_10061542 Ga0207698_100615429 154
208 3300026142 Ga0207698_10088174 Ga0207698_100881742 154
209 3300028379 Ga0268266_10110061 Ga0268266_101100617 154
210 3300028381 Ga0268264_10028173 Ga0268264_100281737 154
211 3300035121 Ga0373960_0037189 Ga0373960_0037189_633_1106 154
212 3300035242 Ga0373962_0227010 Ga0373962_0227010_119_592 154
213 3300037312 Ga0395899_0012651 Ga0395899_0012651_4475_4948 154
214 3300037312 Ga0395899_0032567 Ga0395899_0032567_3110_3577 154
215 3300037312 Ga0395899_0041288 Ga0395899_0041288_1412_1882 154
216 3300037312 Ga0395899_0197559 Ga0395899_0197559_635_1105 154
217 3300037418 Ga0395900_0031281 Ga0395900_0031281_394_864 154
218 3300037418 Ga0395900_0206270 Ga0395900_0206270_631_1104 154
219 3300037466 Ga0395898_0055001 Ga0395898_0055001_799_1269 154
220 3300037466 Ga0395898_0185717 Ga0395898_0185717_883_1356 154
221 3300037466 Ga0395898_0238736 Ga0395898_0238736_338_805 154
222 3300037466 Ga0395898_0336909 Ga0395898_0336909_431_901 154
223 3300037471 Ga0395905_0279915 Ga0395905_0279915_279_749 154
224 3300038443 Ga0395901_0042983 Ga0395901_0042983_2209_2679 154
225 3300038443 Ga0395901_0046372 Ga0395901_0046372_102_575 154
226 3300038443 Ga0395901_0143619 Ga0395901_0143619_1842_2309 154
227 3300044656 Ga0466969_0005911 Ga0466969_0005911_521_991 154
228 3300044684 Ga0466966_0000010 Ga0466966_0000010_124371_124841 154
229 3300044684 Ga0466966_0014430 Ga0466966_0014430_1294_1764 154
230 3300044693 Ga0466961_0002980 Ga0466961_0002980_9505_9975 154
231 3300044694 Ga0466963_0006016 Ga0466963_0006016_477_947 154
232 3300044694 Ga0466963_0051744 Ga0466963_0051744_2127_2594 154
233 3300044694 Ga0466963_0156439 Ga0466963_0156439_921_1388 154
234 3300044719 Ga0466971_0001547 Ga0466971_0001547_7278_7748 154
235 3300044765 Ga0466970_0039072 Ga0466970_0039072_1293_1763 154
236 3300044842 Ga0466957_0005415 Ga0466957_0005415_1084_1554 154
237 3300044842 Ga0466957_0090086 Ga0466957_0090086_636_1109 154
238 3300045049 Ga0466959_0003693 Ga0466959_0003693_3827_4297 154
239 3300045836 Ga0466958_0065478 Ga0466958_0065478_655_1125 154
240 3300045976 Ga0466967_0631265 Ga0466967_0631265_69_536 154
241 3300045976 Ga0466967_1706307 Ga0466967_1706307_81_548 154
242 3300045976 Ga0466967_1811105 Ga0466967_1811105_11_484 154
243 3300048904 Ga0496101_0005007 Ga0496101_0005007_7639_8112 154
244 3300048905 Ga0496102_0088025 Ga0496102_0088025_934_1407 154
245 3300048907 Ga0496104_0086155 Ga0496104_0086155_2333_2806 154
246 3300048909 Ga0496106_0342156 Ga0496106_0342156_250_723 154
247 3300048910 Ga0496107_0050072 Ga0496107_0050072_1013_1486 154
248 3300048911 Ga0496108_0004195 Ga0496108_0004195_2825_3298 154
249 3300048912 Ga0496109_0129215 Ga0496109_0129215_1357_1830 154
250 3300048913 Ga0496110_0006176 Ga0496110_0006176_6329_6802 154
251 3300048914 Ga0496111_0059661 Ga0496111_0059661_732_1205 154
252 3300048915 Ga0496112_0041630 Ga0496112_0041630_2191_2664 154
253 3300048916 Ga0496113_0092352 Ga0496113_0092352_1444_1917 154
254 3300049587 Ga0501071_0035178 Ga0501071_0035178_58_528 154
255 3300061719 Ga0466962_0000549 Ga0466962_0000549_3515_3985 154
256 3300001904 JGI24736J21556_1060891 JGI24736J21556_10608911 155
257 3300001915 JGI24741J21665_1024611 JGI24741J21665_10246111 155
258 3300001979 JGI24740J21852_10067831 JGI24740J21852_100678311 155
259 3300001990 JGI24737J22298_10025626 JGI24737J22298_100256263 155
260 3300002067 JGI24735J21928_10004351 JGI24735J21928_100043513 155
261 3300002067 JGI24735J21928_10045242 JGI24735J21928_100452422 155
262 3300005327 Ga0070658_10001059 Ga0070658_1000105910 155
263 3300005327 Ga0070658_10006084 Ga0070658_100060843 155
264 3300005327 Ga0070658_10010912 Ga0070658_100109125 155
265 3300005327 Ga0070658_10025330 Ga0070658_100253305 155
266 3300005327 Ga0070658_10028127 Ga0070658_100281273 155
267 3300005327 Ga0070658_10033301 Ga0070658_100333013 155
268 3300005327 Ga0070658_10037459 Ga0070658_100374594 155
269 3300005327 Ga0070658_10094610 Ga0070658_100946105 155
270 3300005327 Ga0070658_10209762 Ga0070658_102097622 155
271 3300005327 Ga0070658_10319130 Ga0070658_103191302 155
272 3300005327 Ga0070658_10742290 Ga0070658_107422902 155
273 3300005327 Ga0070658_11788814 Ga0070658_117888141 155
274 3300005328 Ga0070676_10853525 Ga0070676_108535251 155
275 3300005329 Ga0070683_100002352 Ga0070683_1000023523 155
276 3300005329 Ga0070683_100011241 Ga0070683_1000112413 155
277 3300005329 Ga0070683_100076356 Ga0070683_1000763566 155
278 3300005329 Ga0070683_100128814 Ga0070683_1001288141 155
279 3300005329 Ga0070683_100188605 Ga0070683_1001886052 155
280 3300005329 Ga0070683_100194542 Ga0070683_1001945422 155
281 3300005331 Ga0070670_100035205 Ga0070670_1000352051 155
282 3300005333 Ga0070677_10310448 Ga0070677_103104482 155
283 3300005335 Ga0070666_10071459 Ga0070666_100714594 155
284 3300005335 Ga0070666_10162683 Ga0070666_101626832 155
285 3300005336 Ga0070680_100029920 Ga0070680_1000299202 155
286 3300005336 Ga0070680_100063318 Ga0070680_1000633182 155
287 3300005336 Ga0070680_100294072 Ga0070680_1002940723 155
288 3300005337 Ga0070682_101774573 Ga0070682_1017745731 155
289 3300005338 Ga0068868_100207813 Ga0068868_1002078131 155
290 3300005338 Ga0068868_100704398 Ga0068868_1007043982 155
291 3300005338 Ga0068868_101404688 Ga0068868_1014046881 155
292 3300005339 Ga0070660_100001066 Ga0070660_10000106611 155
293 3300005339 Ga0070660_100004104 Ga0070660_1000041048 155
294 3300005339 Ga0070660_100038290 Ga0070660_1000382902 155
295 3300005339 Ga0070660_100040368 Ga0070660_1000403682 155
296 3300005339 Ga0070660_100176930 Ga0070660_1001769302 155
297 3300005339 Ga0070660_100235123 Ga0070660_1002351232 155
298 3300005339 Ga0070660_100302458 Ga0070660_1003024582 155
299 3300005339 Ga0070660_100316304 Ga0070660_1003163042 155
300 3300005339 Ga0070660_100379702 Ga0070660_1003797022 155
301 3300005339 Ga0070660_100391715 Ga0070660_1003917152 155
302 3300005339 Ga0070660_100544103 Ga0070660_1005441032 155
303 3300005339 Ga0070660_100544974 Ga0070660_1005449742 155
304 3300005340 Ga0070689_100683091 Ga0070689_1006830912 155
305 3300005341 Ga0070691_10057063 Ga0070691_100570632 155
306 3300005341 Ga0070691_10094839 Ga0070691_100948392 155
307 3300005344 Ga0070661_100048313 Ga0070661_1000483136 155
308 3300005344 Ga0070661_100083291 Ga0070661_1000832912 155
309 3300005344 Ga0070661_100126598 Ga0070661_1001265984 155
310 3300005345 Ga0070692_10004340 Ga0070692_100043404 155
311 3300005345 Ga0070692_10015921 Ga0070692_100159214 155
312 3300005353 Ga0070669_100044449 Ga0070669_1000444492 155
313 3300005354 Ga0070675_100028041 Ga0070675_1000280412 155
314 3300005355 Ga0070671_100012392 Ga0070671_1000123922 155
315 3300005355 Ga0070671_100013777 Ga0070671_1000137778 155
316 3300005355 Ga0070671_100666346 Ga0070671_1006663462 155
317 3300005364 Ga0070673_100367739 Ga0070673_1003677392 155
318 3300005364 Ga0070673_101399267 Ga0070673_1013992671 155
319 3300005366 Ga0070659_100027757 Ga0070659_1000277572 155
320 3300005366 Ga0070659_100040547 Ga0070659_1000405472 155
321 3300005366 Ga0070659_100072463 Ga0070659_1000724633 155
322 3300005366 Ga0070659_100234021 Ga0070659_1002340212 155
323 3300005366 Ga0070659_100360934 Ga0070659_1003609342 155
324 3300005366 Ga0070659_100370003 Ga0070659_1003700032 155
325 3300005366 Ga0070659_101033573 Ga0070659_1010335732 155
326 3300005366 Ga0070659_101453834 Ga0070659_1014538341 155
327 3300005367 Ga0070667_100995219 Ga0070667_1009952192 155
328 3300005435 Ga0070714_100066116 Ga0070714_1000661163 155
329 3300005435 Ga0070714_101476683 Ga0070714_1014766831 155
330 3300005436 Ga0070713_100142598 Ga0070713_1001425982 155
331 3300005436 Ga0070713_100217534 Ga0070713_1002175343 155
332 3300005436 Ga0070713_100765947 Ga0070713_1007659471 155
333 3300005455 Ga0070663_100020325 Ga0070663_1000203257 155
334 3300005455 Ga0070663_100075182 Ga0070663_1000751822 155
335 3300005455 Ga0070663_100151822 Ga0070663_1001518222 155
336 3300005455 Ga0070663_100293832 Ga0070663_1002938322 155
337 3300005457 Ga0070662_100001528 Ga0070662_10000152814 155
338 3300005457 Ga0070662_100089994 Ga0070662_1000899944 155
339 3300005457 Ga0070662_100552774 Ga0070662_1005527741 155
340 3300005458 Ga0070681_10033864 Ga0070681_100338645 155
341 3300005458 Ga0070681_10134884 Ga0070681_101348841 155
342 3300005458 Ga0070681_10158337 Ga0070681_101583374 155
343 3300005458 Ga0070681_10419118 Ga0070681_104191182 155
344 3300005458 Ga0070681_11055223 Ga0070681_110552231 155
345 3300005459 Ga0068867_100054308 Ga0068867_1000543084 155
346 3300005530 Ga0070679_100188227 Ga0070679_1001882273 155
347 3300005530 Ga0070679_100507604 Ga0070679_1005076042 155
348 3300005530 Ga0070679_100835127 Ga0070679_1008351272 155
349 3300005530 Ga0070679_101087547 Ga0070679_1010875471 155
350 3300005535 Ga0070684_100005764 Ga0070684_1000057643 155
351 3300005535 Ga0070684_100041133 Ga0070684_1000411335 155
352 3300005535 Ga0070684_100791554 Ga0070684_1007915542 155
353 3300005539 Ga0068853_100049699 Ga0068853_1000496995 155
354 3300005539 Ga0068853_100055862 Ga0068853_1000558622 155
355 3300005539 Ga0068853_100110115 Ga0068853_1001101153 155
356 3300005539 Ga0068853_100112183 Ga0068853_1001121833 155
357 3300005539 Ga0068853_100218369 Ga0068853_1002183692 155
358 3300005543 Ga0070672_100775145 Ga0070672_1007751452 155
359 3300005543 Ga0070672_100885947 Ga0070672_1008859471 155
360 3300005547 Ga0070693_100254209 Ga0070693_1002542091 155
361 3300005547 Ga0070693_100513808 Ga0070693_1005138081 155
362 3300005563 Ga0068855_100001731 Ga0068855_10000173132 155
363 3300005563 Ga0068855_100099331 Ga0068855_1000993311 155
364 3300005563 Ga0068855_100152308 Ga0068855_1001523082 155
365 3300005563 Ga0068855_100274131 Ga0068855_1002741312 155
366 3300005563 Ga0068855_100301014 Ga0068855_1003010141 155
367 3300005563 Ga0068855_100432369 Ga0068855_1004323692 155
368 3300005563 Ga0068855_100587278 Ga0068855_1005872782 155
369 3300005563 Ga0068855_101286345 Ga0068855_1012863451 155
370 3300005563 Ga0068855_101779700 Ga0068855_1017797001 155
371 3300005564 Ga0070664_100070531 Ga0070664_1000705314 155
372 3300005564 Ga0070664_100088195 Ga0070664_1000881953 155
373 3300005564 Ga0070664_100225395 Ga0070664_1002253953 155
374 3300005564 Ga0070664_100367554 Ga0070664_1003675543 155
375 3300005564 Ga0070664_100692067 Ga0070664_1006920672 155
376 3300005577 Ga0068857_100038767 Ga0068857_1000387671 155
377 3300005577 Ga0068857_100150310 Ga0068857_1001503103 155
378 3300005577 Ga0068857_100192759 Ga0068857_1001927592 155
379 3300005577 Ga0068857_100253878 Ga0068857_1002538782 155
380 3300005578 Ga0068854_100062527 Ga0068854_1000625273 155
381 3300005578 Ga0068854_100208980 Ga0068854_1002089802 155
382 3300005578 Ga0068854_100314604 Ga0068854_1003146043 155
383 3300005578 Ga0068854_100447582 Ga0068854_1004475822 155
384 3300005614 Ga0068856_100145825 Ga0068856_1001458252 155
385 3300005614 Ga0068856_100259834 Ga0068856_1002598343 155
386 3300005614 Ga0068856_100302052 Ga0068856_1003020522 155
387 3300005614 Ga0068856_100653949 Ga0068856_1006539492 155
388 3300005616 Ga0068852_100011021 Ga0068852_1000110217 155
389 3300005616 Ga0068852_100049902 Ga0068852_1000499023 155
390 3300005616 Ga0068852_100054284 Ga0068852_1000542842 155
391 3300005616 Ga0068852_100071360 Ga0068852_1000713601 155
392 3300005616 Ga0068852_100129720 Ga0068852_1001297203 155
393 3300005616 Ga0068852_100276139 Ga0068852_1002761392 155
394 3300005616 Ga0068852_100322826 Ga0068852_1003228262 155
395 3300005616 Ga0068852_100356531 Ga0068852_1003565312 155
396 3300005616 Ga0068852_101682666 Ga0068852_1016826662 155
397 3300005617 Ga0068859_100599653 Ga0068859_1005996531 155
398 3300005617 Ga0068859_101268805 Ga0068859_1012688052 155
399 3300005618 Ga0068864_100006927 Ga0068864_10000692710 155
400 3300005618 Ga0068864_100015480 Ga0068864_1000154806 155
401 3300005834 Ga0068851_10030209 Ga0068851_100302093 155
402 3300005841 Ga0068863_100013130 Ga0068863_1000131302 155
403 3300005841 Ga0068863_100326740 Ga0068863_1003267402 155
404 3300005842 Ga0068858_100034723 Ga0068858_1000347236 155
405 3300006028 Ga0070717_10003063 Ga0070717_1000306310 155
406 3300006237 Ga0097621_100912540 Ga0097621_1009125402 155
407 3300006931 Ga0097620_100599681 Ga0097620_1005996812 155
408 3300006931 Ga0097620_101268871 Ga0097620_1012688712 155
409 3300009093 Ga0105240_10444586 Ga0105240_104445862 155
410 3300009093 Ga0105240_10752685 Ga0105240_107526851 155
411 3300009093 Ga0105240_10937664 Ga0105240_109376641 155
412 3300009098 Ga0105245_10087663 Ga0105245_100876634 155
413 3300009174 Ga0105241_10129894 Ga0105241_101298942 155
414 3300009174 Ga0105241_10399250 Ga0105241_103992502 155
415 3300009174 Ga0105241_10526535 Ga0105241_105265352 155
416 3300009174 Ga0105241_11708626 Ga0105241_117086262 155
417 3300009177 Ga0105248_10007594 Ga0105248_1000759412 155
418 3300009177 Ga0105248_10031869 Ga0105248_100318692 155
419 3300009177 Ga0105248_11029102 Ga0105248_110291022 155
420 3300009545 Ga0105237_10054165 Ga0105237_100541652 155
421 3300009545 Ga0105237_10360551 Ga0105237_103605512 155
422 3300009551 Ga0105238_10012286 Ga0105238_100122866 155
423 3300009551 Ga0105238_10043273 Ga0105238_100432735 155
424 3300009551 Ga0105238_10091512 Ga0105238_100915124 155
425 3300009551 Ga0105238_11135206 Ga0105238_111352062 155
426 3300009551 Ga0105238_11194347 Ga0105238_111943472 155
427 3300010375 Ga0105239_10332933 Ga0105239_103329333 155
428 3300013100 Ga0157373_10028283 Ga0157373_100282834 155
429 3300013100 Ga0157373_10077773 Ga0157373_100777733 155
430 3300013100 Ga0157373_10104908 Ga0157373_101049082 155
431 3300013100 Ga0157373_10221695 Ga0157373_102216952 155
432 3300013100 Ga0157373_10320232 Ga0157373_103202322 155
433 3300013100 Ga0157373_10364494 Ga0157373_103644942 155
434 3300013100 Ga0157373_10433800 Ga0157373_104338002 155
435 3300013100 Ga0157373_10554035 Ga0157373_105540352 155
436 3300013100 Ga0157373_11217331 Ga0157373_112173311 155
437 3300013102 Ga0157371_10011021 Ga0157371_100110212 155
438 3300013102 Ga0157371_10030841 Ga0157371_100308415 155
439 3300013102 Ga0157371_10109280 Ga0157371_101092802 155
440 3300013102 Ga0157371_10147501 Ga0157371_101475012 155
441 3300013102 Ga0157371_10165351 Ga0157371_101653512 155
442 3300013102 Ga0157371_10180132 Ga0157371_101801322 155
443 3300013102 Ga0157371_10193743 Ga0157371_101937432 155
444 3300013104 Ga0157370_10001982 Ga0157370_1000198212 155
445 3300013104 Ga0157370_10041121 Ga0157370_100411213 155
446 3300013104 Ga0157370_10092352 Ga0157370_100923522 155
447 3300013104 Ga0157370_10112994 Ga0157370_101129942 155
448 3300013104 Ga0157370_10150487 Ga0157370_101504872 155
449 3300013104 Ga0157370_10160214 Ga0157370_101602143 155
450 3300013104 Ga0157370_10672111 Ga0157370_106721112 155
451 3300013104 Ga0157370_11004289 Ga0157370_110042891 155
452 3300013105 Ga0157369_10005483 Ga0157369_1000548312 155
453 3300013105 Ga0157369_10008947 Ga0157369_100089476 155
454 3300013105 Ga0157369_10152947 Ga0157369_101529475 155
455 3300013105 Ga0157369_10175631 Ga0157369_101756313 155
456 3300013105 Ga0157369_10182031 Ga0157369_101820314 155
457 3300013105 Ga0157369_10194208 Ga0157369_101942082 155
458 3300013105 Ga0157369_10200560 Ga0157369_102005603 155
459 3300013105 Ga0157369_10225983 Ga0157369_102259832 155
460 3300013105 Ga0157369_10477428 Ga0157369_104774281 155
461 3300013297 Ga0157378_10468967 Ga0157378_104689671 155
462 3300013297 Ga0157378_10582986 Ga0157378_105829862 155
463 3300013297 Ga0157378_11648158 Ga0157378_116481582 155
464 3300013306 Ga0163162_10500927 Ga0163162_105009272 155
465 3300013307 Ga0157372_10077490 Ga0157372_100774904 155
466 3300013307 Ga0157372_10249753 Ga0157372_102497532 155
467 3300013307 Ga0157372_10257550 Ga0157372_102575502 155
468 3300013307 Ga0157372_10301746 Ga0157372_103017462 155
469 3300013307 Ga0157372_11255121 Ga0157372_112551212 155
470 3300013307 Ga0157372_11509030 Ga0157372_115090302 155
471 3300013308 Ga0157375_10703658 Ga0157375_107036582 155
472 3300014325 Ga0163163_10890374 Ga0163163_108903741 155
473 3300020082 Ga0206353_10745388 Ga0206353_107453883 155
474 3300025315 Ga0207697_10088251 Ga0207697_100882512 155
475 3300025321 Ga0207656_10172714 Ga0207656_101727142 155
476 3300025898 Ga0207692_10991115 Ga0207692_109911151 155
477 3300025903 Ga0207680_10170414 Ga0207680_101704141 155
478 3300025904 Ga0207647_10009334 Ga0207647_100093346 155
479 3300025904 Ga0207647_10009752 Ga0207647_100097524 155
480 3300025904 Ga0207647_10020016 Ga0207647_100200163 155
481 3300025904 Ga0207647_10153406 Ga0207647_101534062 155
482 3300025904 Ga0207647_10170323 Ga0207647_101703231 155
483 3300025904 Ga0207647_10279340 Ga0207647_102793402 155
484 3300025905 Ga0207685_10098367 Ga0207685_100983672 155
485 3300025906 Ga0207699_10881228 Ga0207699_108812281 155
486 3300025907 Ga0207645_10198663 Ga0207645_101986632 155
487 3300025909 Ga0207705_10000849 Ga0207705_1000084912 155
488 3300025909 Ga0207705_10003040 Ga0207705_100030407 155
489 3300025909 Ga0207705_10007372 Ga0207705_100073728 155
490 3300025909 Ga0207705_10072544 Ga0207705_100725442 155
491 3300025909 Ga0207705_10203785 Ga0207705_102037852 155
492 3300025909 Ga0207705_10330261 Ga0207705_103302611 155
493 3300025909 Ga0207705_10512807 Ga0207705_105128071 155
494 3300025909 Ga0207705_10755561 Ga0207705_107555612 155
495 3300025909 Ga0207705_11231502 Ga0207705_112315021 155
496 3300025911 Ga0207654_10414445 Ga0207654_104144452 155
497 3300025911 Ga0207654_10530533 Ga0207654_105305331 155
498 3300025912 Ga0207707_10008275 Ga0207707_1000827510 155
499 3300025912 Ga0207707_10017864 Ga0207707_100178644 155
500 3300025912 Ga0207707_10115325 Ga0207707_101153252 155
501 3300025913 Ga0207695_10011845 Ga0207695_100118457 155
502 3300025913 Ga0207695_10083383 Ga0207695_100833834 155
503 3300025914 Ga0207671_10663058 Ga0207671_106630582 155
504 3300025914 Ga0207671_11028237 Ga0207671_110282371 155
505 3300025917 Ga0207660_10010608 Ga0207660_100106084 155
506 3300025917 Ga0207660_10237570 Ga0207660_102375701 155
507 3300025919 Ga0207657_10001406 Ga0207657_1000140622 155
508 3300025919 Ga0207657_10001980 Ga0207657_1000198020 155
509 3300025919 Ga0207657_10002175 Ga0207657_1000217518 155
510 3300025919 Ga0207657_10029567 Ga0207657_100295671 155
511 3300025919 Ga0207657_10058542 Ga0207657_100585422 155
512 3300025919 Ga0207657_10127025 Ga0207657_101270251 155
513 3300025919 Ga0207657_10351753 Ga0207657_103517532 155
514 3300025919 Ga0207657_10391709 Ga0207657_103917092 155
515 3300025919 Ga0207657_10434120 Ga0207657_104341202 155
516 3300025919 Ga0207657_10556311 Ga0207657_105563111 155
517 3300025919 Ga0207657_10969144 Ga0207657_109691442 155
518 3300025920 Ga0207649_10019753 Ga0207649_100197536 155
519 3300025920 Ga0207649_10106952 Ga0207649_101069522 155
520 3300025920 Ga0207649_10531495 Ga0207649_105314951 155
521 3300025920 Ga0207649_11030047 Ga0207649_110300471 155
522 3300025921 Ga0207652_10181205 Ga0207652_101812051 155
523 3300025921 Ga0207652_10414871 Ga0207652_104148712 155
524 3300025921 Ga0207652_10739687 Ga0207652_107396872 155
525 3300025921 Ga0207652_11219166 Ga0207652_112191661 155
526 3300025923 Ga0207681_10130379 Ga0207681_101303792 155
527 3300025924 Ga0207694_10011357 Ga0207694_100113573 155
528 3300025924 Ga0207694_10102958 Ga0207694_101029583 155
529 3300025924 Ga0207694_10106853 Ga0207694_101068531 155
530 3300025925 Ga0207650_10059230 Ga0207650_100592301 155
531 3300025926 Ga0207659_10018215 Ga0207659_100182152 155
532 3300025928 Ga0207700_10034869 Ga0207700_100348693 155
533 3300025928 Ga0207700_10246501 Ga0207700_102465013 155
534 3300025929 Ga0207664_10040862 Ga0207664_100408622 155
535 3300025929 Ga0207664_10058961 Ga0207664_100589613 155
536 3300025929 Ga0207664_11756472 Ga0207664_117564721 155
537 3300025931 Ga0207644_10000377 Ga0207644_1000037721 155
538 3300025932 Ga0207690_10008683 Ga0207690_100086836 155
539 3300025932 Ga0207690_10034954 Ga0207690_100349542 155
540 3300025932 Ga0207690_10107352 Ga0207690_101073521 155
541 3300025932 Ga0207690_10113321 Ga0207690_101133214 155
542 3300025932 Ga0207690_10130242 Ga0207690_101302422 155
543 3300025932 Ga0207690_10181260 Ga0207690_101812602 155
544 3300025932 Ga0207690_10458172 Ga0207690_104581721 155
545 3300025932 Ga0207690_11191783 Ga0207690_111917831 155
546 3300025932 Ga0207690_11588508 Ga0207690_115885081 155
547 3300025933 Ga0207706_10002422 Ga0207706_100024226 155
548 3300025933 Ga0207706_10006297 Ga0207706_100062976 155
549 3300025933 Ga0207706_10064608 Ga0207706_100646084 155
550 3300025933 Ga0207706_10080595 Ga0207706_100805955 155
551 3300025933 Ga0207706_10228953 Ga0207706_102289532 155
552 3300025933 Ga0207706_10262366 Ga0207706_102623662 155
553 3300025933 Ga0207706_11311776 Ga0207706_113117761 155
554 3300025940 Ga0207691_10144167 Ga0207691_101441674 155
555 3300025940 Ga0207691_10566938 Ga0207691_105669381 155
556 3300025940 Ga0207691_11170864 Ga0207691_111708641 155
557 3300025941 Ga0207711_10001092 Ga0207711_1000109216 155
558 3300025941 Ga0207711_10009979 Ga0207711_100099799 155
559 3300025941 Ga0207711_10852290 Ga0207711_108522902 155
560 3300025944 Ga0207661_10035813 Ga0207661_100358135 155
561 3300025944 Ga0207661_10038014 Ga0207661_100380145 155
562 3300025944 Ga0207661_10057068 Ga0207661_100570682 155
563 3300025944 Ga0207661_10481880 Ga0207661_104818801 155
564 3300025945 Ga0207679_10139904 Ga0207679_101399043 155
565 3300025945 Ga0207679_10154809 Ga0207679_101548093 155
566 3300025945 Ga0207679_10315832 Ga0207679_103158322 155
567 3300025945 Ga0207679_10413694 Ga0207679_104136942 155
568 3300025945 Ga0207679_10433349 Ga0207679_104333492 155
569 3300025949 Ga0207667_10011763 Ga0207667_100117633 155
570 3300025949 Ga0207667_10079355 Ga0207667_100793554 155
571 3300025949 Ga0207667_10134678 Ga0207667_101346782 155
572 3300025949 Ga0207667_10188406 Ga0207667_101884062 155
573 3300025949 Ga0207667_10190689 Ga0207667_101906892 155
574 3300025949 Ga0207667_10220712 Ga0207667_102207122 155
575 3300025949 Ga0207667_10364156 Ga0207667_103641562 155
576 3300025949 Ga0207667_10654649 Ga0207667_106546492 155
577 3300025949 Ga0207667_10680133 Ga0207667_106801331 155
578 3300025960 Ga0207651_11165375 Ga0207651_111653752 155
579 3300025981 Ga0207640_10017205 Ga0207640_100172054 155
580 3300025981 Ga0207640_10053821 Ga0207640_100538213 155
581 3300025981 Ga0207640_10221939 Ga0207640_102219393 155
582 3300025981 Ga0207640_10381963 Ga0207640_103819632 155
583 3300025981 Ga0207640_10876741 Ga0207640_108767412 155
584 3300025981 Ga0207640_11895282 Ga0207640_118952821 155
585 3300025986 Ga0207658_10474387 Ga0207658_104743872 155
586 3300026035 Ga0207703_10118270 Ga0207703_101182704 155
587 3300026035 Ga0207703_10753075 Ga0207703_107530752 155
588 3300026041 Ga0207639_10004789 Ga0207639_100047893 155
589 3300026041 Ga0207639_10027246 Ga0207639_100272464 155
590 3300026041 Ga0207639_10060824 Ga0207639_100608241 155
591 3300026041 Ga0207639_10088491 Ga0207639_100884914 155
592 3300026041 Ga0207639_10161494 Ga0207639_101614941 155
593 3300026041 Ga0207639_10177690 Ga0207639_101776902 155
594 3300026067 Ga0207678_10005957 Ga0207678_100059576 155
595 3300026067 Ga0207678_10009880 Ga0207678_100098804 155
596 3300026067 Ga0207678_10016367 Ga0207678_100163672 155
597 3300026067 Ga0207678_10019855 Ga0207678_100198553 155
598 3300026067 Ga0207678_10141097 Ga0207678_101410972 155
599 3300026067 Ga0207678_10875863 Ga0207678_108758632 155
600 3300026078 Ga0207702_10004836 Ga0207702_100048368 155
601 3300026078 Ga0207702_10060344 Ga0207702_100603442 155
602 3300026078 Ga0207702_10347039 Ga0207702_103470393 155
603 3300026078 Ga0207702_10458048 Ga0207702_104580482 155
604 3300026078 Ga0207702_10692457 Ga0207702_106924572 155
605 3300026078 Ga0207702_11769438 Ga0207702_117694382 155
606 3300026088 Ga0207641_10016292 Ga0207641_100162922 155
607 3300026088 Ga0207641_10927746 Ga0207641_109277462 155
608 3300026088 Ga0207641_11491519 Ga0207641_114915191 155
609 3300026089 Ga0207648_10073599 Ga0207648_100735993 155
610 3300026095 Ga0207676_10083141 Ga0207676_100831412 155
611 3300026116 Ga0207674_10007185 Ga0207674_100071856 155
612 3300026116 Ga0207674_10017411 Ga0207674_100174114 155
613 3300026116 Ga0207674_10072276 Ga0207674_100722764 155
614 3300026116 Ga0207674_10108140 Ga0207674_101081401 155
615 3300026116 Ga0207674_10434366 Ga0207674_104343663 155
616 3300026116 Ga0207674_10436906 Ga0207674_104369063 155
617 3300026142 Ga0207698_10009484 Ga0207698_100094843 155
618 3300026142 Ga0207698_10010531 Ga0207698_100105312 155
619 3300026142 Ga0207698_10137031 Ga0207698_101370312 155
620 3300026142 Ga0207698_10163309 Ga0207698_101633093 155
621 3300026142 Ga0207698_10224166 Ga0207698_102241663 155
622 3300026142 Ga0207698_10597575 Ga0207698_105975752 155
623 3300026142 Ga0207698_10922742 Ga0207698_109227422 155
624 3300035113 Ga0373936_0098054 Ga0373936_0098054_414_884 155
625 3300035170 Ga0373943_0007752 Ga0373943_0007752_576_1046 155
626 3300035171 Ga0373946_0340239 Ga0373946_0340239_196_666 155
627 3300035172 Ga0373955_0113431 Ga0373955_0113431_424_894 155
628 3300035725 Ga0373947_0014930 Ga0373947_0014930_3170_3640 155
629 3300036401 Ga0373937_0644867 Ga0373937_0644867_191_661 155
630 3300037312 Ga0395899_0000825 Ga0395899_0000825_20438_20908 155
631 3300037312 Ga0395899_0012306 Ga0395899_0012306_4871_5341 155
632 3300037312 Ga0395899_0017081 Ga0395899_0017081_3520_3990 155
633 3300037312 Ga0395899_0058038 Ga0395899_0058038_1762_2238 155
634 3300037312 Ga0395899_0092103 Ga0395899_0092103_20_490 155
635 3300037312 Ga0395899_0109112 Ga0395899_0109112_618_1094 155
636 3300037312 Ga0395899_0151186 Ga0395899_0151186_974_1444 155
637 3300037312 Ga0395899_0174625 Ga0395899_0174625_862_1332 155
638 3300037418 Ga0395900_0000031 Ga0395900_0000031_18761_19231 155
639 3300037418 Ga0395900_0003797 Ga0395900_0003797_9869_10339 155
640 3300037418 Ga0395900_0005341 Ga0395900_0005341_8714_9184 155
641 3300037418 Ga0395900_0028834 Ga0395900_0028834_2989_3465 155
642 3300037418 Ga0395900_0046213 Ga0395900_0046213_3723_4193 155
643 3300037418 Ga0395900_0112444 Ga0395900_0112444_772_1248 155
644 3300037418 Ga0395900_0125455 Ga0395900_0125455_1762_2232 155
645 3300037418 Ga0395900_0154421 Ga0395900_0154421_311_787 155
646 3300037418 Ga0395900_0165284 Ga0395900_0165284_28_552 155
647 3300037418 Ga0395900_0212392 Ga0395900_0212392_481_951 155
648 3300037418 Ga0395900_0236929 Ga0395900_0236929_203_673 155
649 3300037418 Ga0395900_0292819 Ga0395900_0292819_943_1413 155
650 3300037418 Ga0395900_0329362 Ga0395900_0329362_168_638 155
651 3300037418 Ga0395900_0382184 Ga0395900_0382184_145_621 155
652 3300037418 Ga0395900_0489495 Ga0395900_0489495_88_564 155
653 3300037418 Ga0395900_1149459 Ga0395900_1149459_192_668 155
654 3300037466 Ga0395898_0007616 Ga0395898_0007616_4150_4620 155
655 3300037466 Ga0395898_0050617 Ga0395898_0050617_942_1412 155
656 3300037466 Ga0395898_0072531 Ga0395898_0072531_2153_2629 155
657 3300037466 Ga0395898_0085303 Ga0395898_0085303_1971_2441 155
658 3300037466 Ga0395898_0107023 Ga0395898_0107023_1539_2015 155
659 3300037466 Ga0395898_0121258 Ga0395898_0121258_62_532 155
660 3300037466 Ga0395898_0147787 Ga0395898_0147787_295_765 155
661 3300037466 Ga0395898_0255105 Ga0395898_0255105_615_1091 155
662 3300037466 Ga0395898_0313144 Ga0395898_0313144_332_802 155
663 3300037466 Ga0395898_0588166 Ga0395898_0588166_406_876 155
664 3300037466 Ga0395898_0739838 Ga0395898_0739838_248_721 155
665 3300037471 Ga0395905_0026745 Ga0395905_0026745_2815_3291 155
666 3300037471 Ga0395905_0035451 Ga0395905_0035451_2786_3256 155
667 3300037471 Ga0395905_0056757 Ga0395905_0056757_2592_3062 155
668 3300037471 Ga0395905_0067363 Ga0395905_0067363_2450_2926 155
669 3300037471 Ga0395905_0121967 Ga0395905_0121967_293_763 155
670 3300037471 Ga0395905_0189328 Ga0395905_0189328_813_1283 155
671 3300037471 Ga0395905_0206166 Ga0395905_0206166_696_1166 155
672 3300037471 Ga0395905_0318577 Ga0395905_0318577_51_521 155
673 3300037471 Ga0395905_0417135 Ga0395905_0417135_264_734 155
674 3300037471 Ga0395905_0435155 Ga0395905_0435155_207_677 155
675 3300037471 Ga0395905_0537813 Ga0395905_0537813_245_718 155
676 3300037471 Ga0395905_0631338 Ga0395905_0631338_218_688 155
677 3300037471 Ga0395905_0697671 Ga0395905_0697671_389_865 155
678 3300037471 Ga0395905_1111830 Ga0395905_1111830_55_525 155
679 3300038443 Ga0395901_0000260 Ga0395901_0000260_43232_43702 155
680 3300038443 Ga0395901_0005146 Ga0395901_0005146_2162_2632 155
681 3300038443 Ga0395901_0019627 Ga0395901_0019627_4875_5351 155
682 3300038443 Ga0395901_0313017 Ga0395901_0313017_438_908 155
683 3300038443 Ga0395901_0333964 Ga0395901_0333964_391_861 155
684 3300038443 Ga0395901_0591758 Ga0395901_0591758_481_951 155
685 3300038443 Ga0395901_0605312 Ga0395901_0605312_11_487 155
686 3300038443 Ga0395901_1122904 Ga0395901_1122904_114_584 155
687 3300038443 Ga0395901_1136830 Ga0395901_1136830_241_717 155
688 3300038443 Ga0395901_1336091 Ga0395901_1336091_25_495 155
689 3300041443 Ga0451789_0524974 Ga0451789_0524974_128_598 155
690 3300044656 Ga0466969_0056456 Ga0466969_0056456_962_1432 155
691 3300044656 Ga0466969_0065070 Ga0466969_0065070_638_1114 155
692 3300044656 Ga0466969_0238981 Ga0466969_0238981_199_669 155
693 3300044684 Ga0466966_0039466 Ga0466966_0039466_192_668 155
694 3300044693 Ga0466961_0087458 Ga0466961_0087458_566_1039 155
695 3300044693 Ga0466961_0483856 Ga0466961_0483856_87_557 155
696 3300044694 Ga0466963_0007643 Ga0466963_0007643_4622_5098 155
697 3300044694 Ga0466963_0022631 Ga0466963_0022631_2630_3100 155
698 3300044694 Ga0466963_0038008 Ga0466963_0038008_2353_2829 155
699 3300044694 Ga0466963_0163438 Ga0466963_0163438_146_616 155
700 3300044694 Ga0466963_0185850 Ga0466963_0185850_490_963 155
701 3300044694 Ga0466963_0204904 Ga0466963_0204904_107_577 155
702 3300044706 Ga0466964_0037889 Ga0466964_0037889_443_913 155
703 3300044706 Ga0466964_0122332 Ga0466964_0122332_379_849 155
704 3300044706 Ga0466964_0290754 Ga0466964_0290754_215_688 155
705 3300044719 Ga0466971_0036307 Ga0466971_0036307_1073_1546 155
706 3300044719 Ga0466971_0125951 Ga0466971_0125951_411_884 155
707 3300044719 Ga0466971_0579019 Ga0466971_0579019_18_488 155
708 3300044842 Ga0466957_0021689 Ga0466957_0021689_1231_1701 155
709 3300044842 Ga0466957_0065176 Ga0466957_0065176_1715_2185 155
710 3300044842 Ga0466957_0078125 Ga0466957_0078125_1049_1522 155
711 3300044842 Ga0466957_0134714 Ga0466957_0134714_14_484 155
712 3300044842 Ga0466957_0193935 Ga0466957_0193935_486_956 155
713 3300044842 Ga0466957_0216896 Ga0466957_0216896_489_965 155
714 3300044842 Ga0466957_0276431 Ga0466957_0276431_623_1093 155
715 3300044842 Ga0466957_1132193 Ga0466957_1132193_80_550 155
716 3300044901 Ga0466960_0262379 Ga0466960_0262379_191_661 155
717 3300045049 Ga0466959_0023036 Ga0466959_0023036_2137_2613 155
718 3300045049 Ga0466959_0158903 Ga0466959_0158903_188_658 155
719 3300045049 Ga0466959_0501869 Ga0466959_0501869_248_718 155
720 3300045836 Ga0466958_0012249 Ga0466958_0012249_1221_1691 155
721 3300045836 Ga0466958_0037198 Ga0466958_0037198_2248_2724 155
722 3300045836 Ga0466958_0051618 Ga0466958_0051618_1362_1835 155
723 3300045836 Ga0466958_0762409 Ga0466958_0762409_20_496 155
724 3300045976 Ga0466967_0037279 Ga0466967_0037279_2516_2989 155
725 3300045976 Ga0466967_0058333 Ga0466967_0058333_2931_3401 155
726 3300045976 Ga0466967_0072622 Ga0466967_0072622_2533_3009 155
727 3300045976 Ga0466967_0097771 Ga0466967_0097771_1088_1558 155
728 3300045976 Ga0466967_0129102 Ga0466967_0129102_1146_1616 155
729 3300045976 Ga0466967_0169957 Ga0466967_0169957_777_1247 155
730 3300045976 Ga0466967_0176562 Ga0466967_0176562_1460_1930 155
731 3300045976 Ga0466967_0194035 Ga0466967_0194035_716_1186 155
732 3300045976 Ga0466967_0222949 Ga0466967_0222949_1085_1555 155
733 3300045976 Ga0466967_0264214 Ga0466967_0264214_848_1318 155
734 3300045976 Ga0466967_0341056 Ga0466967_0341056_685_1155 155
735 3300045976 Ga0466967_0413089 Ga0466967_0413089_326_796 155
736 3300045976 Ga0466967_1059339 Ga0466967_1059339_44_514 155
737 3300045976 Ga0466967_1646042 Ga0466967_1646042_141_611 155
738 3300045976 Ga0466967_2480839 Ga0466967_2480839_27_497 155
739 3300046539 Ga0495621_0005075 Ga0495621_0005075_2109_2588 155
740 3300046684 Ga0495669_0055111 Ga0495669_0055111_702_1181 155
741 3300046684 Ga0495669_0139479 Ga0495669_0139479_278_748 155
742 3300046684 Ga0495669_0190447 Ga0495669_0190447_188_658 155
743 3300046691 Ga0495670_0005562 Ga0495670_0005562_2113_2592 155
744 3300048903 Ga0496100_0107267 Ga0496100_0107267_1151_1621 155
745 3300048904 Ga0496101_0973332 Ga0496101_0973332_143_622 155
746 3300048905 Ga0496102_0715615 Ga0496102_0715615_378_851 155
747 3300048909 Ga0496106_0204749 Ga0496106_0204749_276_746 155
748 3300048910 Ga0496107_0171331 Ga0496107_0171331_175_648 155
749 3300048911 Ga0496108_0016972 Ga0496108_0016972_5167_5637 155
750 3300048912 Ga0496109_0045477 Ga0496109_0045477_1492_1962 155
751 3300048913 Ga0496110_0883129 Ga0496110_0883129_192_662 155
752 3300048915 Ga0496112_0072686 Ga0496112_0072686_2000_2470 155
753 3300048916 Ga0496113_0442264 Ga0496113_0442264_411_881 155
754 3300048917 Ga0496114_0001397 Ga0496114_0001397_16418_16888 155
755 3300049590 Ga0501074_0350743 Ga0501074_0350743_146_616 155
756 3300061719 Ga0466962_0234705 Ga0466962_0234705_258_728 155
757 2162886012 MBSR1b_contig_3901366 MBSR1b_0564.00000840 156
758 3300001979 JGI24740J21852_10003534 JGI24740J21852_100035345 156
759 3300002067 JGI24735J21928_10118783 JGI24735J21928_101187832 156
760 3300005293 Ga0065715_10376615 Ga0065715_103766152 156
761 3300005327 Ga0070658_10055270 Ga0070658_100552703 156
762 3300005328 Ga0070676_10028593 Ga0070676_100285933 156
763 3300005329 Ga0070683_100017603 Ga0070683_1000176036 156
764 3300005331 Ga0070670_100097664 Ga0070670_1000976642 156
765 3300005334 Ga0068869_100492788 Ga0068869_1004927882 156
766 3300005336 Ga0070680_100002086 Ga0070680_1000020863 156
767 3300005339 Ga0070660_100006075 Ga0070660_1000060753 156
768 3300005344 Ga0070661_100522673 Ga0070661_1005226731 156
769 3300005345 Ga0070692_10027776 Ga0070692_100277762 156
770 3300005347 Ga0070668_100001286 Ga0070668_1000012864 156
771 3300005347 Ga0070668_100776819 Ga0070668_1007768191 156
772 3300005353 Ga0070669_100032571 Ga0070669_1000325713 156
773 3300005353 Ga0070669_100126181 Ga0070669_1001261812 156
774 3300005353 Ga0070669_100234211 Ga0070669_1002342111 156
775 3300005355 Ga0070671_100444704 Ga0070671_1004447041 156
776 3300005356 Ga0070674_100516506 Ga0070674_1005165062 156
777 3300005364 Ga0070673_100019324 Ga0070673_1000193243 156
778 3300005364 Ga0070673_100032563 Ga0070673_1000325634 156
779 3300005364 Ga0070673_100987308 Ga0070673_1009873082 156
780 3300005364 Ga0070673_101517028 Ga0070673_1015170281 156
781 3300005367 Ga0070667_100016094 Ga0070667_1000160942 156
782 3300005367 Ga0070667_100027448 Ga0070667_1000274484 156
783 3300005367 Ga0070667_100044503 Ga0070667_1000445032 156
784 3300005367 Ga0070667_100069083 Ga0070667_1000690832 156
785 3300005367 Ga0070667_100130482 Ga0070667_1001304824 156
786 3300005455 Ga0070663_100009418 Ga0070663_1000094184 156
787 3300005455 Ga0070663_100080020 Ga0070663_1000800204 156
788 3300005456 Ga0070678_100007599 Ga0070678_1000075992 156
789 3300005456 Ga0070678_100219278 Ga0070678_1002192783 156
790 3300005458 Ga0070681_10029554 Ga0070681_100295544 156
791 3300005530 Ga0070679_100044847 Ga0070679_1000448474 156
792 3300005535 Ga0070684_100068277 Ga0070684_1000682771 156
793 3300005539 Ga0068853_101528987 Ga0068853_1015289871 156
794 3300005543 Ga0070672_100107434 Ga0070672_1001074343 156
795 3300005543 Ga0070672_100157906 Ga0070672_1001579061 156
796 3300005548 Ga0070665_100002247 Ga0070665_10000224720 156
797 3300005563 Ga0068855_100010658 Ga0068855_10001065811 156
798 3300005578 Ga0068854_100132539 Ga0068854_1001325393 156
799 3300005617 Ga0068859_100004108 Ga0068859_10000410810 156
800 3300005617 Ga0068859_100146943 Ga0068859_1001469432 156
801 3300005617 Ga0068859_101166422 Ga0068859_1011664222 156
802 3300005618 Ga0068864_100000078 Ga0068864_10000007871 156
803 3300005840 Ga0068870_10514764 Ga0068870_105147641 156
804 3300005841 Ga0068863_100001062 Ga0068863_10000106214 156
805 3300005841 Ga0068863_100041578 Ga0068863_1000415787 156
806 3300005841 Ga0068863_100217307 Ga0068863_1002173074 156
807 3300005841 Ga0068863_100633459 Ga0068863_1006334592 156
808 3300005842 Ga0068858_100000832 Ga0068858_1000008325 156
809 3300005842 Ga0068858_101126955 Ga0068858_1011269552 156
810 3300005843 Ga0068860_100019591 Ga0068860_1000195916 156
811 3300005844 Ga0068862_100013397 Ga0068862_1000133973 156
812 3300005844 Ga0068862_100016074 Ga0068862_1000160742 156
813 3300005844 Ga0068862_100043250 Ga0068862_1000432502 156
814 3300005844 Ga0068862_100087527 Ga0068862_1000875272 156
815 3300006358 Ga0068871_100397174 Ga0068871_1003971741 156
816 3300006871 Ga0075434_100473611 Ga0075434_1004736112 156
817 3300006881 Ga0068865_100022816 Ga0068865_1000228163 156
818 3300006881 Ga0068865_100088865 Ga0068865_1000888652 156
819 3300006931 Ga0097620_100004108 Ga0097620_10000410810 156
820 3300006931 Ga0097620_100146933 Ga0097620_1001469334 156
821 3300006931 Ga0097620_101166663 Ga0097620_1011666632 156
822 3300009092 Ga0105250_10007968 Ga0105250_100079687 156
823 3300009101 Ga0105247_10043627 Ga0105247_100436273 156
824 3300009177 Ga0105248_10000317 Ga0105248_1000031758 156
825 3300009177 Ga0105248_10226323 Ga0105248_102263232 156
826 3300009553 Ga0105249_10021911 Ga0105249_100219118 156
827 3300013102 Ga0157371_10135059 Ga0157371_101350593 156
828 3300013104 Ga0157370_10006925 Ga0157370_100069255 156
829 3300013105 Ga0157369_10034227 Ga0157369_100342274 156
830 3300013306 Ga0163162_10697970 Ga0163162_106979702 156
831 3300013306 Ga0163162_11494311 Ga0163162_114943111 156
832 3300013308 Ga0157375_10038959 Ga0157375_100389592 156
833 3300014325 Ga0163163_10000588 Ga0163163_1000058814 156
834 3300014968 Ga0157379_10004364 Ga0157379_100043642 156
835 3300020082 Ga0206353_10682203 Ga0206353_106822032 156
836 3300025315 Ga0207697_10047791 Ga0207697_100477912 156
837 3300025315 Ga0207697_10113511 Ga0207697_101135112 156
838 3300025900 Ga0207710_10055419 Ga0207710_100554193 156
839 3300025901 Ga0207688_10077484 Ga0207688_100774842 156
840 3300025904 Ga0207647_10004534 Ga0207647_100045344 156
841 3300025904 Ga0207647_10636827 Ga0207647_106368271 156
842 3300025907 Ga0207645_10027192 Ga0207645_100271922 156
843 3300025909 Ga0207705_10000330 Ga0207705_1000033016 156
844 3300025912 Ga0207707_10045315 Ga0207707_100453152 156
845 3300025920 Ga0207649_10130759 Ga0207649_101307591 156
846 3300025921 Ga0207652_10001926 Ga0207652_100019264 156
847 3300025923 Ga0207681_10046161 Ga0207681_100461612 156
848 3300025923 Ga0207681_10058253 Ga0207681_100582533 156
849 3300025926 Ga0207659_10137110 Ga0207659_101371102 156
850 3300025936 Ga0207670_10574440 Ga0207670_105744401 156
851 3300025937 Ga0207669_10538155 Ga0207669_105381552 156
852 3300025938 Ga0207704_10013369 Ga0207704_100133694 156
853 3300025938 Ga0207704_10032251 Ga0207704_100322512 156
854 3300025940 Ga0207691_10148811 Ga0207691_101488112 156
855 3300025940 Ga0207691_10164459 Ga0207691_101644591 156
856 3300025941 Ga0207711_10000042 Ga0207711_1000004219 156
857 3300025941 Ga0207711_10023952 Ga0207711_100239523 156
858 3300025941 Ga0207711_10314665 Ga0207711_103146652 156
859 3300025949 Ga0207667_10008143 Ga0207667_100081435 156
860 3300025960 Ga0207651_10012248 Ga0207651_100122483 156
861 3300025960 Ga0207651_10069899 Ga0207651_100698994 156
862 3300025960 Ga0207651_10840430 Ga0207651_108404301 156
863 3300025961 Ga0207712_10037341 Ga0207712_100373412 156
864 3300025961 Ga0207712_10429226 Ga0207712_104292262 156
865 3300025972 Ga0207668_10000021 Ga0207668_10000021149 156
866 3300025972 Ga0207668_10063826 Ga0207668_100638262 156
867 3300025972 Ga0207668_10596949 Ga0207668_105969492 156
868 3300025981 Ga0207640_10455499 Ga0207640_104554992 156
869 3300025986 Ga0207658_10008807 Ga0207658_100088078 156
870 3300025986 Ga0207658_10028355 Ga0207658_100283552 156
871 3300025986 Ga0207658_10048129 Ga0207658_100481294 156
872 3300025986 Ga0207658_10070817 Ga0207658_100708174 156
873 3300025986 Ga0207658_10094441 Ga0207658_100944413 156
874 3300025986 Ga0207658_10526392 Ga0207658_105263922 156
875 3300026035 Ga0207703_10001950 Ga0207703_1000195014 156
876 3300026067 Ga0207678_10021279 Ga0207678_100212793 156
877 3300026067 Ga0207678_10603239 Ga0207678_106032392 156
878 3300026078 Ga0207702_10011160 Ga0207702_100111604 156
879 3300026088 Ga0207641_10000626 Ga0207641_1000062642 156
880 3300026088 Ga0207641_10032881 Ga0207641_100328812 156
881 3300026088 Ga0207641_10057122 Ga0207641_100571223 156
882 3300026088 Ga0207641_10133940 Ga0207641_101339402 156
883 3300026089 Ga0207648_10004648 Ga0207648_100046486 156
884 3300026095 Ga0207676_10000740 Ga0207676_1000074020 156
885 3300026121 Ga0207683_10078985 Ga0207683_100789853 156
886 3300026121 Ga0207683_10265375 Ga0207683_102653751 156
887 3300028379 Ga0268266_10012280 Ga0268266_100122808 156
888 3300028380 Ga0268265_10004081 Ga0268265_100040816 156
889 3300028380 Ga0268265_10005187 Ga0268265_100051874 156
890 3300028381 Ga0268264_10004535 Ga0268264_1000453510 156
891 3300028381 Ga0268264_10004576 Ga0268264_1000457611 156
892 3300031548 Ga0307408_100059138 Ga0307408_1000591382 156
893 3300037312 Ga0395899_0014183 Ga0395899_0014183_398_874 156
894 3300037418 Ga0395900_0015806 Ga0395900_0015806_6255_6734 156
895 3300037418 Ga0395900_0029797 Ga0395900_0029797_4728_5204 156
896 3300037418 Ga0395900_0272748 Ga0395900_0272748_744_1220 156
897 3300037466 Ga0395898_0063175 Ga0395898_0063175_1417_1893 156
898 3300037471 Ga0395905_0009056 Ga0395905_0009056_5673_6152 156
899 3300037471 Ga0395905_0043478 Ga0395905_0043478_3341_3817 156
900 3300037471 Ga0395905_0231710 Ga0395905_0231710_925_1398 156
901 3300038443 Ga0395901_0136800 Ga0395901_0136800_1701_2177 156
902 3300038443 Ga0395901_0314088 Ga0395901_0314088_664_1143 156
903 3300044683 Ga0466965_0180379 Ga0466965_0180379_133_606 156
904 3300044901 Ga0466960_0082757 Ga0466960_0082757_851_1324 156
905 3300046616 Ga0495668_0080677 Ga0495668_0080677_692_1165 156
906 3300048910 Ga0496107_0016434 Ga0496107_0016434_1238_1720 156
907 3300053134 Ga0500658_0000088 Ga0500658_0000088_33046_33519 156

Structural Annotation

Top 5 Hits

ID Description Score Start End
3q6a-assembly1.cif.gz_D x-ray crystal structure of the protein ssp2350 from staphylococcus saprophyticus, northeast structural genomics consortium target syr116 0.7543 89 154
2ga5-assembly1.cif.gz_A yeast frataxin 0.7269 100 146
2zfd-assembly1.cif.gz_B the crystal structure of plant specific calcium binding protein atcbl2 in complex with the regulatory domain of atcipk14 0.694 89 155
7kiv-assembly1.cif.gz_A crystal structure of pseudomonas aeruginosa pbp3 in complex with avibactam 0.6857 124 156
3c6k-assembly1.cif.gz_B crystal structure of human spermine synthase in complex with spermidine and 5-methylthioadenosine 0.6818 89 154
ID Description Score Start End Superfamily
af_I1L7C7_308_422_3.30.310.80 Alpha Beta;2-Layer Sandwich;TATA-Binding Protein;Kinase associated domain 1, KA1 0.8198 91 152 3.30.310.80
af_Q07540_63_174_3.30.920.10 Alpha Beta;2-Layer Sandwich;Metal Transport, Frataxin; Chain A;Frataxin/CyaY 0.8062 100 138 3.30.920.10
af_P87050_616_740_3.30.310.220 Alpha Beta;2-Layer Sandwich;TATA-Binding Protein;Fungal kinase associated-1 domain 0.805 91 154 3.30.310.220
4nk7A01 Alpha Beta;2-Layer Sandwich;Arylsulfatase, C-terminal domain; 0.7822 116 140 3.30.1120.120
af_B6SH63_306_429_3.30.310.80 Alpha Beta;2-Layer Sandwich;TATA-Binding Protein;Kinase associated domain 1, KA1 0.7478 91 156 3.30.310.80
ID Description Score Start End GO Terms
AF-A0A7W9BC92-F1-model_v4 Uncharacterized protein 0.9182 89 153
AF-A0A534JKV4-F1-model_v4 DUF2207 domain-containing protein 0.9173 95 152 GO:0016020
AF-A0A2M7LBD1-F1-model_v4 deleted 0.9123 89 156
AF-A0A7J2Y590-F1-model_v4 DUF2207 domain-containing protein 0.9106 95 152 GO:0016020
AF-A0A429ERA7-F1-model_v4 Transposase 0.8965 91 154

Feature Viewer

pLDDT pTM Quality
88.6 0.79 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map