F485348
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 907 | 449 | 1815 | 258 |
Family's Representative Sequence
| Representative Sequence | 3300005355|Ga0070671_100008975|Ga0070671_1000089756 |
| Length | 278 |
| Sequence | MNESVRIDSDHTMTTPTTTPAEPYCAFPNSFKRRLIAHEPLIGCWCSLANPITTEVLGVAGFDWILLDGEHSPNDVISFIPQLMALKDSVSAPIVRPSWNNPVELKRLLDGGFYNFLIPFIESADEAARAVAATRYPPQGFRGVSVSQRSNKFGSVKDYFTGINDQICVMVQIESRKGVAAAAEIAKVDGIDGIFVGPSDLAAGFGHLGNASHPEVQAAMAEVIAAAKAAGKPIGILAPVEADARRYMAQGVTFVAVGSDLGVFRSGTQALRDRYLAA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 2 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 3 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 4 | 3300002704 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB | Metagenome | Unclassified |
| 5 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 6 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 7 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 8 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 9 | 3300002771 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB | Metagenome | Endosphere |
| 10 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 11 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 12 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 13 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 14 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 15 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 16 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 17 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 18 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 19 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 20 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 21 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 22 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 23 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 24 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 25 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 26 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 27 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 28 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 29 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 30 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 31 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 32 | 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 33 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 34 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 35 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 36 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 37 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 40 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 43 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 45 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 46 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 48 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 49 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 56 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 60 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 62 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 66 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 67 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 68 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 69 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 71 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 72 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 73 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 75 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 76 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 78 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 79 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 80 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 81 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 82 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 83 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 84 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 85 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 86 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 87 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 88 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 89 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 90 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 91 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 92 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 93 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 94 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 95 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 96 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 97 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 98 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 100 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 101 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 102 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300006944 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW | Metagenome | Nodule |
| 104 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 105 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 118 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 119 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 120 | 3300012497 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 | Metagenome | Rhizosphere |
| 121 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 130 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 134 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 135 | 3300025207 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 136 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 137 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 138 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 139 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 140 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 141 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 142 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 143 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 144 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 145 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 146 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 147 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 148 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 149 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 150 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 151 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 152 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 153 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 154 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 155 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 156 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 157 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 158 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 159 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 160 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 161 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 162 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 220 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 221 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 223 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 227 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 228 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 229 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 230 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 231 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 232 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 233 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 234 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 235 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 236 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 237 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 238 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 239 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 240 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 241 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 242 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 243 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 244 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 245 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 246 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 247 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 248 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 249 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 250 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 251 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 252 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 253 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 254 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 255 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 256 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 257 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 258 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 259 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 260 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 261 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 262 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 263 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 264 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 265 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 266 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 267 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 268 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 269 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 270 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 271 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 272 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 273 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 274 | 3300042011 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 | Metagenome | Rhizosphere |
| 275 | 3300042121 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 | Metagenome | Rhizosphere |
| 276 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 277 | 3300042437 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 | Metagenome | Rhizosphere |
| 278 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 279 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 280 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 281 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 282 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 283 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 284 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 338 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 339 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 340 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 341 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 342 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 343 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 344 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 345 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 346 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 347 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 348 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 349 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 350 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 351 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 352 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 353 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 354 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 355 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 356 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 357 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 358 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 359 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 360 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 361 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 362 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 363 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 364 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 365 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 366 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 367 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 368 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 369 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 370 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 371 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 376 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 377 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 378 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 379 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 380 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 381 | 3300053126 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere | Metagenome | Endosphere |
| 382 | 3300053129 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere | Metagenome | Endosphere |
| 383 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 384 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 385 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 386 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 387 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 388 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 389 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 390 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 391 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 392 | 2511231002 | Polaromonas sp. CF318 | Isolate | Rhizosphere |
| 393 | 2585427591 | Rahnella aquatilis OV744 | Isolate | Rhizosphere |
| 394 | 2585427592 | Rahnella aquatilis OV588 | Isolate | Rhizosphere |
| 395 | 2599185169 | Klebsiella quasipneumoniae NFPP35 | Isolate | Rhizoplane |
| 396 | 2599185292 | Achromobacter sp. NFACC18-2 | Isolate | Rhizoplane |
| 397 | 2600255254 | Klebsiella quasipneumoniae NFIX15 | Isolate | Rhizoplane |
| 398 | 2600255255 | Klebsiella quasipneumoniae NFIX23 | Isolate | Rhizoplane |
| 399 | 2600255280 | Klebsiella quasipneumoniae NFIX42 | Isolate | Rhizoplane |
| 400 | 2600255281 | Klebsiella quasipneumoniae NFIX43 | Isolate | Rhizoplane |
| 401 | 2600255287 | Klebsiella quasipneumoniae NFIX11 | Isolate | Rhizoplane |
| 402 | 2600255288 | Klebsiella quasipneumoniae NFIX14 | Isolate | Rhizoplane |
| 403 | 2600255289 | Klebsiella quasipneumoniae NFIX16 | Isolate | Rhizoplane |
| 404 | 2600255290 | Klebsiella quasipneumoniae NFIX17 | Isolate | Rhizoplane |
| 405 | 2600255291 | Klebsiella quasipneumoniae NFIX19 | Isolate | Rhizoplane |
| 406 | 2600255298 | Klebsiella quasipneumoniae NFIX21 | Isolate | Rhizoplane |
| 407 | 2600255299 | Klebsiella quasipneumoniae NFIX22 | Isolate | Rhizoplane |
| 408 | 2600255300 | Klebsiella quasipneumoniae NFIX30 | Isolate | Rhizoplane |
| 409 | 2600255301 | Klebsiella quasipneumoniae NFIX33 | Isolate | Rhizoplane |
| 410 | 2600255302 | Klebsiella quasipneumoniae NFIX35 | Isolate | Rhizoplane |
| 411 | 2600255303 | Klebsiella quasipneumoniae NFIX36 | Isolate | Rhizoplane |
| 412 | 2600255304 | Klebsiella quasipneumoniae NFIX37 | Isolate | Rhizoplane |
| 413 | 2600255305 | Klebsiella quasipneumoniae NFIX41 | Isolate | Rhizoplane |
| 414 | 2600255306 | Klebsiella quasipneumoniae NFIX44 | Isolate | Rhizoplane |
| 415 | 2600255307 | Klebsiella quasipneumoniae NFIX56 | Isolate | Rhizoplane |
| 416 | 2600255309 | Klebsiella sp. NFIX53 | Isolate | Rhizoplane |
| 417 | 2600255392 | Klebsiella quasipneumoniae NFIX54 | Isolate | Rhizoplane |
| 418 | 2602042052 | Klebsiella quasipneumoniae NFIX18 | Isolate | Rhizoplane |
| 419 | 2602042053 | Klebsiella quasipneumoniae NFIX12 | Isolate | Rhizoplane |
| 420 | 2602042103 | Klebsiella quasipneumoniae NFIX29 | Isolate | Rhizoplane |
| 421 | 2602042104 | Klebsiella quasipneumoniae NFIX26 | Isolate | Rhizoplane |
| 422 | 2602042105 | Klebsiella quasipneumoniae NFIX25 | Isolate | Rhizoplane |
| 423 | 2602042106 | Klebsiella quasipneumoniae NFIX13 | Isolate | Rhizoplane |
| 424 | 2602042109 | Klebsiella aerogenes NFIX39 | Isolate | Rhizoplane |
| 425 | 2602042110 | Klebsiella quasipneumoniae NFIX40 | Isolate | Rhizoplane |
| 426 | 2602042111 | Klebsiella quasipneumoniae NFIX20 | Isolate | Rhizoplane |
| 427 | 2603880178 | Klebsiella quasipneumoniae NFIX34 | Isolate | Rhizoplane |
| 428 | 2603880184 | Klebsiella quasipneumoniae NFIX27 | Isolate | Rhizoplane |
| 429 | 2603880202 | Klebsiella quasipneumoniae NFIX38 | Isolate | Rhizoplane |
| 430 | 2603880211 | Klebsiella quasipneumoniae NFIX24 | Isolate | Rhizoplane |
| 431 | 2636415599 | Klebsiella variicola DX120E | Isolate | Unclassified |
| 432 | 2643221569 | Achromobacter sp. Root565 | Isolate | Unclassified |
| 433 | 2643221644 | Rhizobacter sp. Root1221 | Isolate | Unclassified |
| 434 | 2643221654 | Rhizobacter sp. Root404 | Isolate | Unclassified |
| 435 | 2667528173 | Rahnella sp. NFIX50 | Isolate | Rhizoplane |
| 436 | 2675903046 | Klebsiella quasipneumoniae NFIX52 | Isolate | Rhizoplane |
| 437 | 2775507074 | Klebsiella sp. D5A | Isolate | Unclassified |
| 438 | 2831864461 | Roseateles noduli HZ7 | Isolate | Nodule |
| 439 | 2852103415 | Edaphovirga cremea DSM 105170 | Isolate | Rhizosphere |
| 440 | 2881927736 | Candidimonas sp. SYP-B2681 | Isolate | Rhizosphere |
| 441 | 2886848708 | Mitsuaria sp. TWR114 | Isolate | Rhizosphere |
| 442 | 2887375801 | Parapusillimonas sp. SGNA-6 | Isolate | Rhizosphere |
| 443 | 2904474040 | Rahnella aquatilis 4485 | Isolate | Rhizosphere |
| 444 | 2904513164 | Klebsiella variicola 1431 | Isolate | Rhizosphere |
| 445 | 2919150387 | Rahnella aceris 1817 | Isolate | Unclassified |
| 446 | 2927143783 | Rahnella sp. 2050 | Isolate | Unclassified |
| 447 | 2969079654 | Klebsiella variicola E57-7 | Isolate | Unclassified |
| 448 | 2984559226 | Klebsiella variicola SORGH_AS834 | Isolate | Aerial Root |
| 449 | 2984595703 | Klebsiella variicola SORGH_AS1070 | Isolate | Aerial Root |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 93.61 |
| Metatranscriptomes | 0 |
| Isolates | 6.39 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.22 |
| Bulb | 0 |
| Endosphere | 16.76 |
| Nodule | 0.77 |
| Rhizoplane | 7.61 |
| Rhizosphere | 67.48 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.33 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070671_100008975 | 3300005355 | Bacteria | 8023 |
| 2 | SwRhRL2b_contig_2942750 | 2162886007 | Bacteria | 6398 |
| 3 | JGI24034J26672_10007511 | 3300002239 | Bacteria | 1583 |
| 4 | JGI25155J39150_1000123 | 3300002704 | Bacteria | 37730 |
| 5 | JGI25156J39149_1000052 | 3300002705 | Bacteria | 89046 |
| 6 | JGI25162J39368_1000029 | 3300002737 | Bacteria | 220066 |
| 7 | JGI25154J39366_1000081 | 3300002738 | Bacteria | 89046 |
| 8 | JGI25157J39369_1000006 | 3300002741 | Bacteria | 226861 |
| 9 | JGI25163J39215_1000037 | 3300002771 | Bacteria | 61773 |
| 10 | JGI25164J39214_1000008 | 3300002772 | Bacteria | 311285 |
| 11 | JGI25159J45721_1000667 | 3300002987 | Bacteria | 15168 |
| 12 | JGI25159J45721_1001832 | 3300002987 | Bacteria | 8506 |
| 13 | JGI25151J46595_10021834 | 3300003187 | Bacteria | 2670 |
| 14 | JGI25151J46595_10022048 | 3300003187 | Bacteria | 2651 |
| 15 | rootH2_10034882 | 3300003320 | Bacteria | 1644 |
| 16 | rootL2_10000270 | 3300003322 | Bacteria | 83376 |
| 17 | rootL2_10066204 | 3300003322 | Bacteria | 1233 |
| 18 | rootH1_10010855 | 3300003316 | Bacteria | 76739 |
| 19 | rootH1_10010855 | 3300003323 | Bacteria | 16450 |
| 20 | rootH1_10090419 | 3300003323 | Bacteria | 2447 |
| 21 | JGI25160J50197_1000071 | 3300003354 | Bacteria | 108301 |
| 22 | JGI25161J50226_1000030 | 3300003374 | Bacteria | 142870 |
| 23 | Ga0055538_1000014 | 3300003751 | Bacteria | 311285 |
| 24 | Ga0055539_1000020 | 3300003752 | Bacteria | 311285 |
| 25 | Ga0055533_1000027 | 3300003756 | Bacteria | 311285 |
| 26 | Ga0055525_1000032 | 3300003759 | Bacteria | 311285 |
| 27 | Ga0055526_1000165 | 3300003771 | Bacteria | 58505 |
| 28 | Ga0055526_1004597 | 3300003771 | Bacteria | 8231 |
| 29 | Ga0055526_1004630 | 3300003771 | Bacteria | 8194 |
| 30 | Ga0055526_1005641 | 3300003771 | Bacteria | 7122 |
| 31 | Ga0055526_1031764 | 3300003771 | Bacteria | 1505 |
| 32 | Ga0055537_1000689 | 3300003773 | Bacteria | 17610 |
| 33 | Ga0055524_1000006 | 3300003775 | Bacteria | 324702 |
| 34 | Ga0055524_1000033 | 3300003775 | Bacteria | 180833 |
| 35 | Ga0055524_1000459 | 3300003775 | Bacteria | 33313 |
| 36 | Ga0055524_1000535 | 3300003775 | Bacteria | 28905 |
| 37 | Ga0055536_1002314 | 3300003781 | Bacteria | 10788 |
| 38 | Ga0055534_1000905 | 3300003784 | Bacteria | 13364 |
| 39 | Ga0055528_1000432 | 3300003790 | Bacteria | 33611 |
| 40 | Ga0055530_10001786 | 3300003791 | Bacteria | 14953 |
| 41 | Ga0055530_10002584 | 3300003791 | Bacteria | 11480 |
| 42 | Ga0055540_1000005 | 3300003792 | Bacteria | 378126 |
| 43 | Ga0055540_1000007 | 3300003792 | Bacteria | 318178 |
| 44 | Ga0055540_1045874 | 3300003792 | Bacteria | 921 |
| 45 | Ga0055531_10001534 | 3300003794 | Bacteria | 16915 |
| 46 | Ga0055531_10001878 | 3300003794 | Bacteria | 14723 |
| 47 | Ga0055531_10002603 | 3300003794 | Bacteria | 11953 |
| 48 | Ga0055531_10004316 | 3300003794 | Bacteria | 8709 |
| 49 | Ga0055541_1000014 | 3300003841 | Bacteria | 311285 |
| 50 | JGI25405J52794_10000287 | 3300003911 | Bacteria | 6886 |
| 51 | Ga0055543_1000162 | 3300004625 | Bacteria | 55480 |
| 52 | Ga0055543_1005134 | 3300004625 | Bacteria | 3401 |
| 53 | Ga0055543_1010893 | 3300004625 | Bacteria | 1886 |
| 54 | Ga0065165_1000248 | 3300005262 | Bacteria | 93216 |
| 55 | Ga0065165_1000457 | 3300005262 | Bacteria | 63927 |
| 56 | Ga0065165_1014815 | 3300005262 | Bacteria | 3006 |
| 57 | Ga0065165_1014830 | 3300005262 | Bacteria | 3004 |
| 58 | Ga0065704_10000430 | 3300005289 | Bacteria | 53955 |
| 59 | Ga0065715_10015471 | 3300005293 | Bacteria | 1998 |
| 60 | Ga0065715_10154527 | 3300005293 | Bacteria | 1692 |
| 61 | Ga0070658_10056756 | 3300005327 | Bacteria | 3183 |
| 62 | Ga0070658_10068527 | 3300005327 | Bacteria | 2901 |
| 63 | Ga0070658_10626740 | 3300005327 | Bacteria | 933 |
| 64 | Ga0070676_10006055 | 3300005328 | Bacteria | 6456 |
| 65 | Ga0070676_10023546 | 3300005328 | Bacteria | 3462 |
| 66 | Ga0070676_10064971 | 3300005328 | Bacteria | 2177 |
| 67 | Ga0070676_10334443 | 3300005328 | Bacteria | 1037 |
| 68 | Ga0070683_100006244 | 3300005329 | Bacteria | 9995 |
| 69 | Ga0070683_100122375 | 3300005329 | Bacteria | 2458 |
| 70 | Ga0070683_100406453 | 3300005329 | Bacteria | 1299 |
| 71 | Ga0070670_100003877 | 3300005331 | Bacteria | 12476 |
| 72 | Ga0070670_100006300 | 3300005331 | Bacteria | 10047 |
| 73 | Ga0070670_100064726 | 3300005331 | Bacteria | 3137 |
| 74 | Ga0070670_100078154 | 3300005331 | Bacteria | 2842 |
| 75 | Ga0070670_100318387 | 3300005331 | Bacteria | 1362 |
| 76 | Ga0070677_10005147 | 3300005333 | Bacteria | 4298 |
| 77 | Ga0070677_10041929 | 3300005333 | Bacteria | 1809 |
| 78 | Ga0070677_10084456 | 3300005333 | Bacteria | 1367 |
| 79 | Ga0068869_100004685 | 3300005334 | Bacteria | 8537 |
| 80 | Ga0068869_100008711 | 3300005334 | Bacteria | 6551 |
| 81 | Ga0068869_100165058 | 3300005334 | Bacteria | 1726 |
| 82 | Ga0070666_10183457 | 3300005335 | Bacteria | 1468 |
| 83 | Ga0070680_100015257 | 3300005336 | Bacteria | 6020 |
| 84 | Ga0068868_100000930 | 3300005338 | Bacteria | 19942 |
| 85 | Ga0068868_100004465 | 3300005338 | Bacteria | 9815 |
| 86 | Ga0068868_100075354 | 3300005338 | Bacteria | 2696 |
| 87 | Ga0070660_100027188 | 3300005339 | Bacteria | 4267 |
| 88 | Ga0070660_100236026 | 3300005339 | Bacteria | 1488 |
| 89 | Ga0070660_100248610 | 3300005339 | Bacteria | 1450 |
| 90 | Ga0070660_100263554 | 3300005339 | Bacteria | 1407 |
| 91 | Ga0070660_100619034 | 3300005339 | Bacteria | 906 |
| 92 | Ga0070689_100501588 | 3300005340 | Bacteria | 1040 |
| 93 | Ga0070687_100009172 | 3300005343 | Bacteria | 4228 |
| 94 | Ga0070661_100000421 | 3300005344 | Bacteria | 32488 |
| 95 | Ga0070661_100025029 | 3300005344 | Bacteria | 4286 |
| 96 | Ga0070661_100147589 | 3300005344 | Bacteria | 1776 |
| 97 | Ga0070661_100448340 | 3300005344 | Bacteria | 1026 |
| 98 | Ga0070668_100279053 | 3300005347 | Bacteria | 1395 |
| 99 | Ga0070669_100006777 | 3300005353 | Bacteria | 8243 |
| 100 | Ga0070669_100230169 | 3300005353 | Bacteria | 1469 |
| 101 | Ga0070669_100347952 | 3300005353 | Bacteria | 1202 |
| 102 | Ga0070669_100398041 | 3300005353 | Bacteria | 1126 |
| 103 | Ga0070675_100000926 | 3300005354 | Bacteria | 20887 |
| 104 | Ga0070675_100023645 | 3300005354 | Bacteria | 4915 |
| 105 | Ga0070675_100033735 | 3300005354 | Bacteria | 4151 |
| 106 | Ga0070675_100052584 | 3300005354 | Bacteria | 3349 |
| 107 | Ga0070675_100129602 | 3300005354 | Bacteria | 2148 |
| 108 | Ga0070675_100138103 | 3300005354 | Bacteria | 2081 |
| 109 | Ga0070671_100006545 | 3300005355 | Bacteria | 9314 |
| 110 | Ga0070671_100006549 | 3300005355 | Bacteria | 9310 |
| 111 | Ga0070671_100115583 | 3300005355 | Bacteria | 2256 |
| 112 | Ga0070671_100269640 | 3300005355 | Bacteria | 1447 |
| 113 | Ga0070671_100309010 | 3300005355 | Bacteria | 1346 |
| 114 | Ga0070671_100528168 | 3300005355 | Bacteria | 1016 |
| 115 | Ga0070674_100003100 | 3300005356 | Bacteria | 9251 |
| 116 | Ga0070674_100107885 | 3300005356 | Bacteria | 2039 |
| 117 | Ga0070673_100002705 | 3300005364 | Bacteria | 10866 |
| 118 | Ga0070673_100010900 | 3300005364 | Bacteria | 6179 |
| 119 | Ga0070673_100049438 | 3300005364 | Bacteria | 3283 |
| 120 | Ga0070673_100080581 | 3300005364 | Bacteria | 2638 |
| 121 | Ga0070673_100106065 | 3300005364 | Bacteria | 2322 |
| 122 | Ga0070673_100195048 | 3300005364 | Bacteria | 1741 |
| 123 | Ga0070673_100442914 | 3300005364 | Bacteria | 1167 |
| 124 | Ga0070688_100052577 | 3300005365 | Bacteria | 2545 |
| 125 | Ga0070659_100001131 | 3300005366 | Bacteria | 19448 |
| 126 | Ga0070659_100015214 | 3300005366 | Bacteria | 5758 |
| 127 | Ga0070659_100069504 | 3300005366 | Bacteria | 2795 |
| 128 | Ga0070659_100315241 | 3300005366 | Bacteria | 1306 |
| 129 | Ga0070659_100350263 | 3300005366 | Bacteria | 1239 |
| 130 | Ga0070667_100028982 | 3300005367 | Bacteria | 4610 |
| 131 | Ga0070667_100046762 | 3300005367 | Bacteria | 3641 |
| 132 | Ga0070667_100049020 | 3300005367 | Bacteria | 3556 |
| 133 | Ga0070667_100050041 | 3300005367 | Bacteria | 3520 |
| 134 | Ga0070667_100075499 | 3300005367 | Bacteria | 2878 |
| 135 | Ga0070667_100106923 | 3300005367 | Bacteria | 2422 |
| 136 | Ga0070667_100202999 | 3300005367 | Bacteria | 1759 |
| 137 | Ga0070667_100261822 | 3300005367 | Bacteria | 1549 |
| 138 | Ga0070714_100003484 | 3300005435 | Bacteria | 11747 |
| 139 | Ga0070710_10045240 | 3300005437 | Bacteria | 2446 |
| 140 | Ga0070711_100328282 | 3300005439 | Bacteria | 1224 |
| 141 | Ga0070700_100040386 | 3300005441 | Bacteria | 2855 |
| 142 | Ga0070663_100135643 | 3300005455 | Bacteria | 1873 |
| 143 | Ga0070663_100171450 | 3300005455 | Bacteria | 1678 |
| 144 | Ga0070663_100178439 | 3300005455 | Bacteria | 1646 |
| 145 | Ga0070663_100480344 | 3300005455 | Bacteria | 1029 |
| 146 | Ga0070678_100012306 | 3300005456 | Bacteria | 5313 |
| 147 | Ga0070678_100069389 | 3300005456 | Bacteria | 2632 |
| 148 | Ga0070678_100344094 | 3300005456 | Bacteria | 1280 |
| 149 | Ga0070678_100353293 | 3300005456 | Bacteria | 1264 |
| 150 | Ga0070678_100534928 | 3300005456 | Bacteria | 1038 |
| 151 | Ga0070678_100566858 | 3300005456 | Bacteria | 1010 |
| 152 | Ga0070662_100001118 | 3300005457 | Bacteria | 16376 |
| 153 | Ga0070662_100062411 | 3300005457 | Bacteria | 2723 |
| 154 | Ga0070662_100150276 | 3300005457 | Bacteria | 1812 |
| 155 | Ga0070662_100317556 | 3300005457 | Bacteria | 1269 |
| 156 | Ga0070681_10163217 | 3300005458 | Bacteria | 2152 |
| 157 | Ga0068867_100004608 | 3300005459 | Bacteria | 9701 |
| 158 | Ga0068867_100007763 | 3300005459 | Bacteria | 7585 |
| 159 | Ga0068867_100037531 | 3300005459 | Bacteria | 3522 |
| 160 | Ga0068867_100137285 | 3300005459 | Bacteria | 1908 |
| 161 | Ga0070685_10026991 | 3300005466 | Bacteria | 3170 |
| 162 | Ga0070685_10038031 | 3300005466 | Bacteria | 2728 |
| 163 | Ga0070706_100002704 | 3300005467 | Bacteria | 17739 |
| 164 | Ga0070699_100329360 | 3300005518 | Unclassified | 1373 |
| 165 | Ga0070679_100133211 | 3300005530 | Bacteria | 2466 |
| 166 | Ga0070684_100004660 | 3300005535 | Bacteria | 10467 |
| 167 | Ga0070684_100112888 | 3300005535 | Bacteria | 2438 |
| 168 | Ga0070684_100260750 | 3300005535 | Bacteria | 1585 |
| 169 | Ga0070684_100402283 | 3300005535 | Bacteria | 1262 |
| 170 | Ga0068853_100008854 | 3300005539 | Bacteria | 8098 |
| 171 | Ga0068853_100079991 | 3300005539 | Bacteria | 2859 |
| 172 | Ga0068853_100121432 | 3300005539 | Bacteria | 2331 |
| 173 | Ga0068853_100289949 | 3300005539 | Bacteria | 1511 |
| 174 | Ga0070672_100004999 | 3300005543 | Bacteria | 8736 |
| 175 | Ga0070672_100082916 | 3300005543 | Bacteria | 2573 |
| 176 | Ga0070672_100196755 | 3300005543 | Bacteria | 1684 |
| 177 | Ga0070686_100010080 | 3300005544 | Bacteria | 5317 |
| 178 | Ga0070695_100066338 | 3300005545 | Bacteria | 2352 |
| 179 | Ga0070665_100195344 | 3300005548 | Bacteria | 2024 |
| 180 | Ga0070665_100290114 | 3300005548 | Bacteria | 1638 |
| 181 | Ga0070665_100551833 | 3300005548 | Bacteria | 1164 |
| 182 | Ga0070664_100001426 | 3300005564 | Bacteria | 19072 |
| 183 | Ga0070664_100032656 | 3300005564 | Bacteria | 4354 |
| 184 | Ga0070664_100043662 | 3300005564 | Bacteria | 3783 |
| 185 | Ga0070664_100080697 | 3300005564 | Bacteria | 2802 |
| 186 | Ga0070664_100283693 | 3300005564 | Bacteria | 1494 |
| 187 | Ga0070664_100318624 | 3300005564 | Bacteria | 1408 |
| 188 | Ga0068857_100005334 | 3300005577 | Bacteria | 10951 |
| 189 | Ga0068857_100056463 | 3300005577 | Bacteria | 3484 |
| 190 | Ga0068857_100066636 | 3300005577 | Bacteria | 3204 |
| 191 | Ga0068854_100023715 | 3300005578 | Bacteria | 4193 |
| 192 | Ga0068854_100031730 | 3300005578 | Bacteria | 3672 |
| 193 | Ga0068854_100109567 | 3300005578 | Bacteria | 2081 |
| 194 | Ga0068854_100359268 | 3300005578 | Bacteria | 1194 |
| 195 | Ga0068854_100570405 | 3300005578 | Bacteria | 962 |
| 196 | Ga0068856_100008227 | 3300005614 | Bacteria | 10167 |
| 197 | Ga0068852_100011321 | 3300005616 | Bacteria | 6711 |
| 198 | Ga0068852_100030483 | 3300005616 | Bacteria | 4440 |
| 199 | Ga0068852_100031117 | 3300005616 | Bacteria | 4399 |
| 200 | Ga0068852_100038260 | 3300005616 | Bacteria | 4030 |
| 201 | Ga0068852_100090150 | 3300005616 | Bacteria | 2742 |
| 202 | Ga0068852_100129524 | 3300005616 | Bacteria | 2322 |
| 203 | Ga0068852_100243046 | 3300005616 | Bacteria | 1721 |
| 204 | Ga0068852_100262259 | 3300005616 | Bacteria | 1659 |
| 205 | Ga0068859_100100470 | 3300005617 | Bacteria | 2948 |
| 206 | Ga0068859_100413048 | 3300005617 | Bacteria | 1446 |
| 207 | Ga0068864_100001420 | 3300005618 | Bacteria | 19796 |
| 208 | Ga0068864_100005635 | 3300005618 | Bacteria | 10265 |
| 209 | Ga0068864_100018785 | 3300005618 | Bacteria | 5778 |
| 210 | Ga0068864_100049209 | 3300005618 | Bacteria | 3626 |
| 211 | Ga0068864_100051910 | 3300005618 | Bacteria | 3534 |
| 212 | Ga0068866_10033691 | 3300005718 | Bacteria | 2487 |
| 213 | Ga0068861_100006180 | 3300005719 | Bacteria | 8149 |
| 214 | Ga0068861_100018413 | 3300005719 | Bacteria | 4976 |
| 215 | Ga0068861_100050276 | 3300005719 | Bacteria | 3160 |
| 216 | Ga0068851_10007383 | 3300005834 | Bacteria | 5045 |
| 217 | Ga0068851_10015841 | 3300005834 | Bacteria | 3599 |
| 218 | Ga0068870_10050666 | 3300005840 | Bacteria | 2195 |
| 219 | Ga0068870_10288925 | 3300005840 | Bacteria | 1031 |
| 220 | Ga0068863_100031141 | 3300005841 | Bacteria | 5093 |
| 221 | Ga0068863_100077677 | 3300005841 | Bacteria | 3142 |
| 222 | Ga0068863_100085537 | 3300005841 | Bacteria | 2988 |
| 223 | Ga0068863_100200095 | 3300005841 | Bacteria | 1921 |
| 224 | Ga0068863_100442513 | 3300005841 | Bacteria | 1275 |
| 225 | Ga0068858_100001292 | 3300005842 | Bacteria | 25859 |
| 226 | Ga0068858_100103295 | 3300005842 | Bacteria | 2658 |
| 227 | Ga0068860_100076886 | 3300005843 | Bacteria | 3174 |
| 228 | Ga0068862_100114461 | 3300005844 | Bacteria | 2371 |
| 229 | Ga0081455_10001479 | 3300005937 | Bacteria | 29079 |
| 230 | Ga0075364_10071666 | 3300006051 | Bacteria | 2283 |
| 231 | Ga0075364_10241316 | 3300006051 | Bacteria | 1227 |
| 232 | Ga0075432_10042041 | 3300006058 | Bacteria | 1598 |
| 233 | Ga0075362_10040059 | 3300006177 | Bacteria | 2061 |
| 234 | Ga0075367_10013603 | 3300006178 | Bacteria | 4380 |
| 235 | Ga0075367_10053393 | 3300006178 | Bacteria | 2394 |
| 236 | Ga0075367_10086550 | 3300006178 | Bacteria | 1902 |
| 237 | Ga0075366_10003855 | 3300006195 | Bacteria | 7988 |
| 238 | Ga0075366_10072018 | 3300006195 | Bacteria | 2059 |
| 239 | Ga0097621_100004797 | 3300006237 | Bacteria | 9464 |
| 240 | Ga0097621_100010187 | 3300006237 | Bacteria | 6863 |
| 241 | Ga0097621_100047062 | 3300006237 | Bacteria | 3493 |
| 242 | Ga0097621_100114312 | 3300006237 | Bacteria | 2283 |
| 243 | Ga0097621_100127976 | 3300006237 | Bacteria | 2158 |
| 244 | Ga0097621_100459828 | 3300006237 | Bacteria | 1148 |
| 245 | Ga0075370_10000414 | 3300006353 | Bacteria | 15762 |
| 246 | Ga0075370_10002136 | 3300006353 | Bacteria | 9035 |
| 247 | Ga0075370_10003303 | 3300006353 | Bacteria | 7653 |
| 248 | Ga0075370_10013634 | 3300006353 | Bacteria | 4326 |
| 249 | Ga0075370_10058441 | 3300006353 | Bacteria | 2193 |
| 250 | Ga0068871_100008334 | 3300006358 | Bacteria | 7452 |
| 251 | Ga0068871_100037449 | 3300006358 | Bacteria | 3868 |
| 252 | Ga0068871_100163445 | 3300006358 | Bacteria | 1905 |
| 253 | Ga0068865_100018910 | 3300006881 | Bacteria | 4452 |
| 254 | Ga0068865_100036499 | 3300006881 | Bacteria | 3314 |
| 255 | Ga0068865_100359016 | 3300006881 | Bacteria | 1182 |
| 256 | Ga0097620_100100481 | 3300006931 | Bacteria | 2948 |
| 257 | Ga0097620_100413090 | 3300006931 | Bacteria | 1446 |
| 258 | Ga0099823_1000049 | 3300006944 | Bacteria | 58213 |
| 259 | Ga0079104_1000009 | 3300006946 | Bacteria | 367015 |
| 260 | Ga0079104_1009160 | 3300006946 | Bacteria | 3377 |
| 261 | Ga0105244_10002360 | 3300009036 | Bacteria | 14334 |
| 262 | Ga0105250_10000818 | 3300009092 | Bacteria | 18529 |
| 263 | Ga0105240_10020343 | 3300009093 | Bacteria | 8857 |
| 264 | Ga0105240_10106425 | 3300009093 | Bacteria | 3402 |
| 265 | Ga0105240_10635941 | 3300009093 | Bacteria | 1171 |
| 266 | Ga0111539_10042281 | 3300009094 | Bacteria | 5475 |
| 267 | Ga0105245_10031804 | 3300009098 | Bacteria | 4672 |
| 268 | Ga0105245_10032610 | 3300009098 | Bacteria | 4611 |
| 269 | Ga0105245_10336331 | 3300009098 | Bacteria | 1492 |
| 270 | Ga0105245_10377138 | 3300009098 | Bacteria | 1412 |
| 271 | Ga0105247_10114825 | 3300009101 | Bacteria | 1737 |
| 272 | Ga0105247_10190353 | 3300009101 | Bacteria | 1373 |
| 273 | Ga0105247_10507529 | 3300009101 | Bacteria | 880 |
| 274 | Ga0114129_10002772 | 3300009147 | Bacteria | 24406 |
| 275 | Ga0105243_10169335 | 3300009148 | Bacteria | 1890 |
| 276 | Ga0105241_10090970 | 3300009174 | Bacteria | 2407 |
| 277 | Ga0105241_10091854 | 3300009174 | Bacteria | 2396 |
| 278 | Ga0105241_10392820 | 3300009174 | Bacteria | 1215 |
| 279 | Ga0105241_10562218 | 3300009174 | Bacteria | 1025 |
| 280 | Ga0105248_10038301 | 3300009177 | Bacteria | 5365 |
| 281 | Ga0105248_10147480 | 3300009177 | Bacteria | 2655 |
| 282 | Ga0105248_10583002 | 3300009177 | Bacteria | 1262 |
| 283 | Ga0105237_10074652 | 3300009545 | Bacteria | 3383 |
| 284 | Ga0105237_10092510 | 3300009545 | Bacteria | 3013 |
| 285 | Ga0105237_10455002 | 3300009545 | Bacteria | 1286 |
| 286 | Ga0105237_10612628 | 3300009545 | Bacteria | 1096 |
| 287 | Ga0105238_10016359 | 3300009551 | Bacteria | 7507 |
| 288 | Ga0105238_10054522 | 3300009551 | Bacteria | 4015 |
| 289 | Ga0105249_10054314 | 3300009553 | Bacteria | 3663 |
| 290 | Ga0105249_10075802 | 3300009553 | Bacteria | 3115 |
| 291 | Ga0105249_10274650 | 3300009553 | Bacteria | 1680 |
| 292 | Ga0105239_10015037 | 3300010375 | Bacteria | 8580 |
| 293 | Ga0105239_10030363 | 3300010375 | Bacteria | 5942 |
| 294 | Ga0105239_10211136 | 3300010375 | Bacteria | 2176 |
| 295 | Ga0105246_10088951 | 3300011119 | Bacteria | 2220 |
| 296 | Ga0157319_1000003 | 3300012497 | Bacteria | 397199 |
| 297 | Ga0157371_10000067 | 3300013102 | Bacteria | 168242 |
| 298 | Ga0157371_10019163 | 3300013102 | Bacteria | 5050 |
| 299 | Ga0157371_10263183 | 3300013102 | Bacteria | 1243 |
| 300 | Ga0157369_10525144 | 3300013105 | Bacteria | 1224 |
| 301 | Ga0157374_10041624 | 3300013296 | Bacteria | 4235 |
| 302 | Ga0157374_10068630 | 3300013296 | Bacteria | 3336 |
| 303 | Ga0157374_10135152 | 3300013296 | Bacteria | 2390 |
| 304 | Ga0157374_10158942 | 3300013296 | Bacteria | 2201 |
| 305 | Ga0157374_10219075 | 3300013296 | Bacteria | 1867 |
| 306 | Ga0157374_10480593 | 3300013296 | Bacteria | 1246 |
| 307 | Ga0157378_10056311 | 3300013297 | Bacteria | 3503 |
| 308 | Ga0157378_10280982 | 3300013297 | Bacteria | 1604 |
| 309 | Ga0157378_10414925 | 3300013297 | Bacteria | 1329 |
| 310 | Ga0163162_10031762 | 3300013306 | Bacteria | 5239 |
| 311 | Ga0163162_10241428 | 3300013306 | Bacteria | 1938 |
| 312 | Ga0163162_10302369 | 3300013306 | Bacteria | 1732 |
| 313 | Ga0163162_10585641 | 3300013306 | Bacteria | 1242 |
| 314 | Ga0157372_10006296 | 3300013307 | Bacteria | 12620 |
| 315 | Ga0157372_10294769 | 3300013307 | Bacteria | 1886 |
| 316 | Ga0157375_10020576 | 3300013308 | Bacteria | 6031 |
| 317 | Ga0157375_10065317 | 3300013308 | Bacteria | 3627 |
| 318 | Ga0157375_10159014 | 3300013308 | Bacteria | 2400 |
| 319 | Ga0157375_10161133 | 3300013308 | Bacteria | 2385 |
| 320 | Ga0157375_10173806 | 3300013308 | Bacteria | 2303 |
| 321 | Ga0163163_10002538 | 3300014325 | Bacteria | 15454 |
| 322 | Ga0182008_10165321 | 3300014497 | Bacteria | 1115 |
| 323 | Ga0157377_10002927 | 3300014745 | Bacteria | 7632 |
| 324 | Ga0157379_10007434 | 3300014968 | Bacteria | 9481 |
| 325 | Ga0157379_10015457 | 3300014968 | Bacteria | 6698 |
| 326 | Ga0157379_10039615 | 3300014968 | Bacteria | 4204 |
| 327 | Ga0157376_10014590 | 3300014969 | Bacteria | 5903 |
| 328 | Ga0157376_10024312 | 3300014969 | Bacteria | 4753 |
| 329 | Ga0157376_10296245 | 3300014969 | Bacteria | 1529 |
| 330 | Ga0163161_10004707 | 3300017792 | Bacteria | 9491 |
| 331 | Ga0163161_10053829 | 3300017792 | Bacteria | 2919 |
| 332 | Ga0209435_100001 | 3300025206 | Bacteria | 1424171 |
| 333 | Ga0209760_100256 | 3300025207 | Bacteria | 21361 |
| 334 | Ga0209436_105701 | 3300025208 | Bacteria | 2821 |
| 335 | Ga0209784_100030 | 3300025224 | Bacteria | 327457 |
| 336 | Ga0209566_100034 | 3300025225 | Bacteria | 327457 |
| 337 | Ga0209674_100052 | 3300025226 | Bacteria | 327457 |
| 338 | Ga0209563_100054 | 3300025230 | Bacteria | 327457 |
| 339 | Ga0207427_100035 | 3300025231 | Bacteria | 311526 |
| 340 | Ga0209437_100068 | 3300025233 | Bacteria | 311526 |
| 341 | Ga0207425_1003404 | 3300025245 | Bacteria | 5105 |
| 342 | Ga0209646_1000001 | 3300025246 | Bacteria | 3092932 |
| 343 | Ga0209026_1000003 | 3300025250 | Bacteria | 1060571 |
| 344 | Ga0209677_100032 | 3300025253 | Bacteria | 327457 |
| 345 | Ga0209759_1000001 | 3300025256 | Bacteria | 2799452 |
| 346 | Ga0209233_1001319 | 3300025261 | Bacteria | 9905 |
| 347 | Ga0209565_1000124 | 3300025263 | Bacteria | 110789 |
| 348 | Ga0209673_1000043 | 3300025273 | Bacteria | 291503 |
| 349 | Ga0209673_1010760 | 3300025273 | Bacteria | 3830 |
| 350 | Ga0209673_1015800 | 3300025273 | Bacteria | 2849 |
| 351 | Ga0209673_1017436 | 3300025273 | Bacteria | 2647 |
| 352 | Ga0209130_1000060 | 3300025284 | Bacteria | 201501 |
| 353 | Ga0209130_1000114 | 3300025284 | Bacteria | 130381 |
| 354 | Ga0209675_1000269 | 3300025291 | Bacteria | 49713 |
| 355 | Ga0209675_1002791 | 3300025291 | Bacteria | 8712 |
| 356 | Ga0209675_1023335 | 3300025291 | Bacteria | 1604 |
| 357 | Ga0209676_1000007 | 3300025292 | Bacteria | 1029371 |
| 358 | Ga0209676_1004596 | 3300025292 | Bacteria | 7619 |
| 359 | Ga0209676_1006553 | 3300025292 | Bacteria | 5714 |
| 360 | Ga0209025_1000822 | 3300025294 | Bacteria | 49588 |
| 361 | Ga0209025_1002740 | 3300025294 | Bacteria | 17842 |
| 362 | Ga0209025_1004701 | 3300025294 | Bacteria | 11654 |
| 363 | Ga0209025_1005559 | 3300025294 | Bacteria | 10214 |
| 364 | Ga0209564_1000019 | 3300025295 | Bacteria | 573686 |
| 365 | Ga0209564_1000051 | 3300025295 | Bacteria | 357748 |
| 366 | Ga0209564_1000268 | 3300025295 | Bacteria | 109101 |
| 367 | Ga0209564_1002616 | 3300025295 | Bacteria | 13766 |
| 368 | Ga0209564_1007637 | 3300025295 | Bacteria | 5531 |
| 369 | Ga0209758_1049975 | 3300025297 | Bacteria | 1471 |
| 370 | Ga0209758_1059472 | 3300025297 | Bacteria | 1271 |
| 371 | Ga0209050_1000003 | 3300025298 | Bacteria | 1609245 |
| 372 | Ga0209050_1000243 | 3300025298 | Bacteria | 117715 |
| 373 | Ga0209050_1002122 | 3300025298 | Bacteria | 18066 |
| 374 | Ga0209050_1002216 | 3300025298 | Bacteria | 17437 |
| 375 | Ga0209050_1002982 | 3300025298 | Bacteria | 13188 |
| 376 | Ga0209050_1005795 | 3300025298 | Bacteria | 7597 |
| 377 | Ga0209256_1000001 | 3300025299 | Bacteria | 2166974 |
| 378 | Ga0209256_1000019 | 3300025299 | Bacteria | 558627 |
| 379 | Ga0209256_1000242 | 3300025299 | Bacteria | 96789 |
| 380 | Ga0209256_1000512 | 3300025299 | Bacteria | 56957 |
| 381 | Ga0207426_1000308 | 3300025302 | Bacteria | 96061 |
| 382 | Ga0207426_1002574 | 3300025302 | Bacteria | 11305 |
| 383 | Ga0209051_1000003 | 3300025303 | Bacteria | 1609245 |
| 384 | Ga0209051_1000004 | 3300025303 | Bacteria | 1155596 |
| 385 | Ga0209051_1000577 | 3300025303 | Bacteria | 44159 |
| 386 | Ga0209051_1009165 | 3300025303 | Bacteria | 5133 |
| 387 | Ga0209257_1000020 | 3300025304 | Bacteria | 773356 |
| 388 | Ga0209257_1000038 | 3300025304 | Bacteria | 609032 |
| 389 | Ga0209257_1000044 | 3300025304 | Bacteria | 486709 |
| 390 | Ga0209257_1003863 | 3300025304 | Bacteria | 12246 |
| 391 | Ga0209257_1004264 | 3300025304 | Bacteria | 11282 |
| 392 | Ga0209257_1005946 | 3300025304 | Bacteria | 8197 |
| 393 | Ga0209257_1013536 | 3300025304 | Bacteria | 3613 |
| 394 | Ga0207697_10002323 | 3300025315 | Bacteria | 9905 |
| 395 | Ga0207697_10040005 | 3300025315 | Bacteria | 1924 |
| 396 | Ga0207656_10038928 | 3300025321 | Bacteria | 2008 |
| 397 | Ga0207656_10081504 | 3300025321 | Bacteria | 1455 |
| 398 | Ga0207656_10092387 | 3300025321 | Bacteria | 1375 |
| 399 | Ga0207696_1000173 | 3300025711 | Bacteria | 102240 |
| 400 | Ga0207655_1000198 | 3300025728 | Bacteria | 106261 |
| 401 | Ga0207682_10000706 | 3300025893 | Bacteria | 15485 |
| 402 | Ga0207682_10002760 | 3300025893 | Bacteria | 7780 |
| 403 | Ga0207682_10003004 | 3300025893 | Bacteria | 7400 |
| 404 | Ga0207682_10109217 | 3300025893 | Bacteria | 1216 |
| 405 | Ga0207692_10042920 | 3300025898 | Bacteria | 2247 |
| 406 | Ga0207688_10019000 | 3300025901 | Bacteria | 3739 |
| 407 | Ga0207680_10022089 | 3300025903 | Bacteria | 3455 |
| 408 | Ga0207647_10066050 | 3300025904 | Bacteria | 2194 |
| 409 | Ga0207699_10015220 | 3300025906 | Bacteria | 3991 |
| 410 | Ga0207645_10002087 | 3300025907 | Bacteria | 15984 |
| 411 | Ga0207645_10008182 | 3300025907 | Bacteria | 7324 |
| 412 | Ga0207645_10008366 | 3300025907 | Bacteria | 7220 |
| 413 | Ga0207645_10081673 | 3300025907 | Bacteria | 2072 |
| 414 | Ga0207645_10247954 | 3300025907 | Bacteria | 1178 |
| 415 | Ga0207645_10294339 | 3300025907 | Bacteria | 1080 |
| 416 | Ga0207643_10010973 | 3300025908 | Bacteria | 4887 |
| 417 | Ga0207643_10020852 | 3300025908 | Bacteria | 3597 |
| 418 | Ga0207643_10024104 | 3300025908 | Bacteria | 3358 |
| 419 | Ga0207643_10332143 | 3300025908 | Bacteria | 951 |
| 420 | Ga0207705_10175602 | 3300025909 | Bacteria | 1614 |
| 421 | Ga0207705_10289179 | 3300025909 | Bacteria | 1255 |
| 422 | Ga0207684_10006839 | 3300025910 | Bacteria | 10329 |
| 423 | Ga0207695_10052245 | 3300025913 | Bacteria | 4282 |
| 424 | Ga0207695_10053879 | 3300025913 | Bacteria | 4204 |
| 425 | Ga0207671_10005913 | 3300025914 | Bacteria | 11096 |
| 426 | Ga0207671_10019025 | 3300025914 | Bacteria | 5261 |
| 427 | Ga0207660_10003934 | 3300025917 | Bacteria | 9676 |
| 428 | Ga0207662_10023052 | 3300025918 | Bacteria | 3574 |
| 429 | Ga0207662_10098852 | 3300025918 | Bacteria | 1806 |
| 430 | Ga0207657_10024018 | 3300025919 | Bacteria | 5660 |
| 431 | Ga0207657_10024969 | 3300025919 | Bacteria | 5522 |
| 432 | Ga0207657_10229771 | 3300025919 | Bacteria | 1484 |
| 433 | Ga0207657_10233367 | 3300025919 | Bacteria | 1471 |
| 434 | Ga0207649_10000751 | 3300025920 | Bacteria | 21186 |
| 435 | Ga0207649_10014142 | 3300025920 | Bacteria | 4467 |
| 436 | Ga0207649_10187455 | 3300025920 | Bacteria | 1452 |
| 437 | Ga0207652_10017987 | 3300025921 | Bacteria | 5791 |
| 438 | Ga0207681_10027388 | 3300025923 | Bacteria | 3684 |
| 439 | Ga0207681_10238468 | 3300025923 | Bacteria | 1414 |
| 440 | Ga0207681_10397865 | 3300025923 | Bacteria | 1112 |
| 441 | Ga0207694_10015611 | 3300025924 | Bacteria | 5728 |
| 442 | Ga0207694_10037588 | 3300025924 | Bacteria | 3719 |
| 443 | Ga0207650_10002189 | 3300025925 | Bacteria | 13657 |
| 444 | Ga0207650_10002736 | 3300025925 | Bacteria | 12176 |
| 445 | Ga0207650_10002868 | 3300025925 | Bacteria | 11906 |
| 446 | Ga0207650_10043334 | 3300025925 | Bacteria | 3303 |
| 447 | Ga0207650_10087938 | 3300025925 | Bacteria | 2368 |
| 448 | Ga0207650_10296595 | 3300025925 | Bacteria | 1319 |
| 449 | Ga0207659_10005319 | 3300025926 | Bacteria | 7802 |
| 450 | Ga0207659_10015146 | 3300025926 | Bacteria | 4989 |
| 451 | Ga0207659_10040763 | 3300025926 | Bacteria | 3249 |
| 452 | Ga0207659_10090473 | 3300025926 | Bacteria | 2284 |
| 453 | Ga0207687_10009547 | 3300025927 | Bacteria | 6345 |
| 454 | Ga0207687_10046793 | 3300025927 | Bacteria | 2996 |
| 455 | Ga0207687_10270714 | 3300025927 | Bacteria | 1358 |
| 456 | Ga0207664_10001434 | 3300025929 | Bacteria | 15680 |
| 457 | Ga0207644_10015628 | 3300025931 | Bacteria | 5099 |
| 458 | Ga0207644_10048009 | 3300025931 | Bacteria | 3049 |
| 459 | Ga0207644_10062080 | 3300025931 | Bacteria | 2708 |
| 460 | Ga0207644_10126507 | 3300025931 | Bacteria | 1951 |
| 461 | Ga0207644_10146813 | 3300025931 | Bacteria | 1821 |
| 462 | Ga0207644_10358759 | 3300025931 | Bacteria | 1185 |
| 463 | Ga0207644_10474772 | 3300025931 | Bacteria | 1029 |
| 464 | Ga0207690_10000481 | 3300025932 | Bacteria | 25729 |
| 465 | Ga0207690_10104153 | 3300025932 | Bacteria | 2032 |
| 466 | Ga0207690_10154325 | 3300025932 | Bacteria | 1705 |
| 467 | Ga0207690_10200626 | 3300025932 | Bacteria | 1515 |
| 468 | Ga0207690_10263354 | 3300025932 | Bacteria | 1336 |
| 469 | Ga0207690_10291124 | 3300025932 | Bacteria | 1275 |
| 470 | Ga0207706_10004920 | 3300025933 | Bacteria | 12493 |
| 471 | Ga0207706_10064686 | 3300025933 | Bacteria | 3220 |
| 472 | Ga0207706_10079814 | 3300025933 | Bacteria | 2877 |
| 473 | Ga0207706_10142662 | 3300025933 | Bacteria | 2107 |
| 474 | Ga0207686_10404781 | 3300025934 | Bacteria | 1040 |
| 475 | Ga0207670_10012105 | 3300025936 | Bacteria | 5034 |
| 476 | Ga0207669_10018975 | 3300025937 | Bacteria | 3570 |
| 477 | Ga0207704_10064613 | 3300025938 | Bacteria | 2287 |
| 478 | Ga0207704_10122444 | 3300025938 | Bacteria | 1783 |
| 479 | Ga0207704_10220779 | 3300025938 | Bacteria | 1402 |
| 480 | Ga0207704_10333441 | 3300025938 | Bacteria | 1175 |
| 481 | Ga0207665_10092418 | 3300025939 | Bacteria | 2099 |
| 482 | Ga0207691_10000318 | 3300025940 | Bacteria | 47853 |
| 483 | Ga0207691_10014394 | 3300025940 | Bacteria | 7542 |
| 484 | Ga0207691_10042654 | 3300025940 | Bacteria | 4181 |
| 485 | Ga0207691_10083172 | 3300025940 | Bacteria | 2874 |
| 486 | Ga0207691_10111431 | 3300025940 | Bacteria | 2433 |
| 487 | Ga0207691_10717155 | 3300025940 | Unclassified | 843 |
| 488 | Ga0207711_10024699 | 3300025941 | Bacteria | 5039 |
| 489 | Ga0207711_10139505 | 3300025941 | Bacteria | 2180 |
| 490 | Ga0207711_10377432 | 3300025941 | Bacteria | 1315 |
| 491 | Ga0207711_10416288 | 3300025941 | Bacteria | 1249 |
| 492 | Ga0207689_10001904 | 3300025942 | Bacteria | 19724 |
| 493 | Ga0207689_10013816 | 3300025942 | Bacteria | 6881 |
| 494 | Ga0207689_10126735 | 3300025942 | Bacteria | 2100 |
| 495 | Ga0207689_10441783 | 3300025942 | Bacteria | 1087 |
| 496 | Ga0207661_10092738 | 3300025944 | Bacteria | 2518 |
| 497 | Ga0207661_10556995 | 3300025944 | Bacteria | 1050 |
| 498 | Ga0207679_10000501 | 3300025945 | Bacteria | 26940 |
| 499 | Ga0207679_10005264 | 3300025945 | Bacteria | 8109 |
| 500 | Ga0207679_10036386 | 3300025945 | Bacteria | 3491 |
| 501 | Ga0207679_10079550 | 3300025945 | Bacteria | 2500 |
| 502 | Ga0207651_10000364 | 3300025960 | Bacteria | 19183 |
| 503 | Ga0207651_10006026 | 3300025960 | Bacteria | 6292 |
| 504 | Ga0207651_10044839 | 3300025960 | Bacteria | 2962 |
| 505 | Ga0207668_10012084 | 3300025972 | Bacteria | 5273 |
| 506 | Ga0207640_10012872 | 3300025981 | Bacteria | 4779 |
| 507 | Ga0207640_10042903 | 3300025981 | Bacteria | 2887 |
| 508 | Ga0207640_10060571 | 3300025981 | Bacteria | 2503 |
| 509 | Ga0207640_10320555 | 3300025981 | Bacteria | 1234 |
| 510 | Ga0207640_10512070 | 3300025981 | Bacteria | 1001 |
| 511 | Ga0207658_10002924 | 3300025986 | Bacteria | 12231 |
| 512 | Ga0207658_10004551 | 3300025986 | Bacteria | 9620 |
| 513 | Ga0207658_10034339 | 3300025986 | Bacteria | 3625 |
| 514 | Ga0207658_10156564 | 3300025986 | Bacteria | 1862 |
| 515 | Ga0207658_10260453 | 3300025986 | Bacteria | 1478 |
| 516 | Ga0207658_10283314 | 3300025986 | Bacteria | 1421 |
| 517 | Ga0207677_10004631 | 3300026023 | Bacteria | 7401 |
| 518 | Ga0207677_10011733 | 3300026023 | Bacteria | 5006 |
| 519 | Ga0207677_10082694 | 3300026023 | Bacteria | 2308 |
| 520 | Ga0207677_10142955 | 3300026023 | Bacteria | 1835 |
| 521 | Ga0207677_10251608 | 3300026023 | Bacteria | 1435 |
| 522 | Ga0207703_10001647 | 3300026035 | Bacteria | 20096 |
| 523 | Ga0207703_10031109 | 3300026035 | Bacteria | 4218 |
| 524 | Ga0207639_10007604 | 3300026041 | Bacteria | 7391 |
| 525 | Ga0207639_10048854 | 3300026041 | Bacteria | 3204 |
| 526 | Ga0207639_10055759 | 3300026041 | Bacteria | 3026 |
| 527 | Ga0207639_10210448 | 3300026041 | Bacteria | 1673 |
| 528 | Ga0207639_10297179 | 3300026041 | Bacteria | 1426 |
| 529 | Ga0207678_10011143 | 3300026067 | Bacteria | 7897 |
| 530 | Ga0207678_10013097 | 3300026067 | Bacteria | 7275 |
| 531 | Ga0207678_10037317 | 3300026067 | Bacteria | 4226 |
| 532 | Ga0207678_10088611 | 3300026067 | Bacteria | 2645 |
| 533 | Ga0207678_10147103 | 3300026067 | Bacteria | 2011 |
| 534 | Ga0207708_10006073 | 3300026075 | Bacteria | 8958 |
| 535 | Ga0207708_10310031 | 3300026075 | Bacteria | 1285 |
| 536 | Ga0207702_10079153 | 3300026078 | Bacteria | 2848 |
| 537 | Ga0207702_10273146 | 3300026078 | Bacteria | 1595 |
| 538 | Ga0207702_10348808 | 3300026078 | Bacteria | 1416 |
| 539 | Ga0207702_10986600 | 3300026078 | Bacteria | 835 |
| 540 | Ga0207641_10002593 | 3300026088 | Bacteria | 16611 |
| 541 | Ga0207641_10038275 | 3300026088 | Bacteria | 4009 |
| 542 | Ga0207641_10215708 | 3300026088 | Bacteria | 1777 |
| 543 | Ga0207641_10334452 | 3300026088 | Bacteria | 1439 |
| 544 | Ga0207641_10641741 | 3300026088 | Bacteria | 1042 |
| 545 | Ga0207648_10006568 | 3300026089 | Bacteria | 11552 |
| 546 | Ga0207648_10014727 | 3300026089 | Bacteria | 7217 |
| 547 | Ga0207648_10043325 | 3300026089 | Bacteria | 3951 |
| 548 | Ga0207648_10459498 | 3300026089 | Bacteria | 1160 |
| 549 | Ga0207676_10001498 | 3300026095 | Bacteria | 17239 |
| 550 | Ga0207676_10017299 | 3300026095 | Bacteria | 5226 |
| 551 | Ga0207676_10089900 | 3300026095 | Bacteria | 2518 |
| 552 | Ga0207676_10111989 | 3300026095 | Bacteria | 2285 |
| 553 | Ga0207674_10008817 | 3300026116 | Bacteria | 11607 |
| 554 | Ga0207674_10031394 | 3300026116 | Bacteria | 5582 |
| 555 | Ga0207674_10042732 | 3300026116 | Bacteria | 4678 |
| 556 | Ga0207674_10313852 | 3300026116 | Bacteria | 1517 |
| 557 | Ga0207674_10484958 | 3300026116 | Bacteria | 1195 |
| 558 | Ga0207675_100000660 | 3300026118 | Bacteria | 33957 |
| 559 | Ga0207675_100001398 | 3300026118 | Bacteria | 24128 |
| 560 | Ga0207675_100238802 | 3300026118 | Bacteria | 1756 |
| 561 | Ga0207675_100445847 | 3300026118 | Bacteria | 1282 |
| 562 | Ga0207683_10010653 | 3300026121 | Bacteria | 7837 |
| 563 | Ga0207683_10024630 | 3300026121 | Bacteria | 5185 |
| 564 | Ga0207683_10045467 | 3300026121 | Bacteria | 3840 |
| 565 | Ga0207683_10088633 | 3300026121 | Bacteria | 2753 |
| 566 | Ga0207683_10092786 | 3300026121 | Bacteria | 2690 |
| 567 | Ga0207683_10142966 | 3300026121 | Bacteria | 2156 |
| 568 | Ga0207683_10209322 | 3300026121 | Bacteria | 1774 |
| 569 | Ga0207683_10375733 | 3300026121 | Bacteria | 1306 |
| 570 | Ga0207698_10018703 | 3300026142 | Bacteria | 4728 |
| 571 | Ga0207698_10078188 | 3300026142 | Bacteria | 2655 |
| 572 | Ga0207698_10131871 | 3300026142 | Bacteria | 2137 |
| 573 | Ga0207698_10156103 | 3300026142 | Bacteria | 1988 |
| 574 | Ga0207698_10207283 | 3300026142 | Bacteria | 1761 |
| 575 | Ga0209281_1000023 | 3300027111 | Bacteria | 519955 |
| 576 | Ga0209281_1009027 | 3300027111 | Bacteria | 2368 |
| 577 | Ga0209389_1025093 | 3300027296 | Bacteria | 5202 |
| 578 | Ga0209371_1000701 | 3300027312 | Bacteria | 28374 |
| 579 | Ga0209371_1013976 | 3300027312 | Bacteria | 2223 |
| 580 | Ga0207428_10190334 | 3300027907 | Bacteria | 1547 |
| 581 | Ga0268266_10179297 | 3300028379 | Bacteria | 1928 |
| 582 | Ga0268265_10139537 | 3300028380 | Bacteria | 2027 |
| 583 | Ga0268264_10079618 | 3300028381 | Bacteria | 2796 |
| 584 | Ga0268264_10309352 | 3300028381 | Bacteria | 1490 |
| 585 | Ga0307517_10000228 | 3300028786 | Bacteria | 94852 |
| 586 | Ga0307515_10007466 | 3300028794 | Bacteria | 21602 |
| 587 | Ga0307515_10034913 | 3300028794 | Bacteria | 8205 |
| 588 | Ga0307515_10090606 | 3300028794 | Bacteria | 3833 |
| 589 | Ga0265338_10009227 | 3300028800 | Bacteria | 11807 |
| 590 | Ga0268256_1000945 | 3300030500 | Bacteria | 19893 |
| 591 | Ga0268256_1015987 | 3300030500 | Bacteria | 2166 |
| 592 | Ga0307512_10023453 | 3300030522 | Bacteria | 5512 |
| 593 | Ga0307513_10000006 | 3300031456 | Bacteria | 470848 |
| 594 | Ga0307513_10000094 | 3300031456 | Bacteria | 127685 |
| 595 | Ga0307513_10015048 | 3300031456 | Bacteria | 9390 |
| 596 | Ga0307513_10030687 | 3300031456 | Bacteria | 6102 |
| 597 | Ga0307513_10309731 | 3300031456 | Bacteria | 1342 |
| 598 | Ga0307509_10000426 | 3300031507 | Bacteria | 70899 |
| 599 | Ga0307509_10014271 | 3300031507 | Bacteria | 9350 |
| 600 | Ga0307509_10016014 | 3300031507 | Bacteria | 8703 |
| 601 | Ga0307509_10124219 | 3300031507 | Bacteria | 2551 |
| 602 | Ga0307509_10262741 | 3300031507 | Bacteria | 1500 |
| 603 | Ga0307408_100006878 | 3300031548 | Bacteria | 7538 |
| 604 | Ga0307408_100012190 | 3300031548 | Bacteria | 5689 |
| 605 | Ga0307508_10003969 | 3300031616 | Bacteria | 14667 |
| 606 | Ga0307508_10110368 | 3300031616 | Bacteria | 2350 |
| 607 | Ga0307508_10204922 | 3300031616 | Bacteria | 1573 |
| 608 | Ga0307514_10033315 | 3300031649 | Bacteria | 4112 |
| 609 | Ga0307514_10072799 | 3300031649 | Bacteria | 2572 |
| 610 | Ga0307516_10132284 | 3300031730 | Bacteria | 2272 |
| 611 | Ga0307516_10198561 | 3300031730 | Bacteria | 1727 |
| 612 | Ga0307405_10032048 | 3300031731 | Bacteria | 3102 |
| 613 | Ga0307405_10188626 | 3300031731 | Bacteria | 1487 |
| 614 | Ga0307413_10023007 | 3300031824 | Bacteria | 3370 |
| 615 | Ga0307413_10085557 | 3300031824 | Bacteria | 2036 |
| 616 | Ga0307413_10098758 | 3300031824 | Bacteria | 1923 |
| 617 | Ga0307413_10223240 | 3300031824 | Bacteria | 1378 |
| 618 | Ga0307410_10013135 | 3300031852 | Bacteria | 4819 |
| 619 | Ga0307410_10140913 | 3300031852 | Bacteria | 1784 |
| 620 | Ga0307410_10226142 | 3300031852 | Bacteria | 1442 |
| 621 | Ga0307406_10016595 | 3300031901 | Bacteria | 4283 |
| 622 | Ga0307406_10094301 | 3300031901 | Bacteria | 2023 |
| 623 | Ga0307406_10129970 | 3300031901 | Bacteria | 1766 |
| 624 | Ga0307406_10478188 | 3300031901 | Bacteria | 1005 |
| 625 | Ga0307407_10054608 | 3300031903 | Bacteria | 2305 |
| 626 | Ga0307412_10003825 | 3300031911 | Bacteria | 8370 |
| 627 | Ga0307409_100018633 | 3300031995 | Bacteria | 4674 |
| 628 | Ga0307409_100030943 | 3300031995 | Bacteria | 3854 |
| 629 | Ga0307409_100050461 | 3300031995 | Bacteria | 3178 |
| 630 | Ga0307416_100001391 | 3300032002 | Bacteria | 13103 |
| 631 | Ga0307414_10466066 | 3300032004 | Bacteria | 1111 |
| 632 | Ga0307411_10057250 | 3300032005 | Bacteria | 2574 |
| 633 | Ga0307415_100000538 | 3300032126 | Bacteria | 16532 |
| 634 | Ga0307507_10183074 | 3300033179 | Bacteria | 1492 |
| 635 | Ga0307510_10000109 | 3300033180 | Bacteria | 65353 |
| 636 | Ga0307510_10003495 | 3300033180 | Bacteria | 18312 |
| 637 | Ga0307510_10007864 | 3300033180 | Bacteria | 12703 |
| 638 | Ga0373928_0039003 | 3300035084 | Bacteria | 1083 |
| 639 | Ga0373929_0028890 | 3300035085 | Bacteria | 1174 |
| 640 | Ga0373944_0012864 | 3300035089 | Bacteria | 2313 |
| 641 | Ga0373923_0081516 | 3300035111 | Bacteria | 1404 |
| 642 | Ga0373939_0020182 | 3300035114 | Bacteria | 1807 |
| 643 | Ga0373945_0008660 | 3300035116 | Bacteria | 3318 |
| 644 | Ga0373945_0096489 | 3300035116 | Bacteria | 1152 |
| 645 | Ga0373954_0235440 | 3300035118 | Unclassified | 901 |
| 646 | Ga0373956_0157678 | 3300035119 | Bacteria | 1069 |
| 647 | Ga0373943_0002106 | 3300035170 | Bacteria | 9038 |
| 648 | Ga0373946_0046180 | 3300035171 | Bacteria | 1804 |
| 649 | Ga0373955_0098276 | 3300035172 | Bacteria | 1677 |
| 650 | Ga0373924_0039178 | 3300035410 | Bacteria | 1936 |
| 651 | Ga0373931_0000491 | 3300035691 | Bacteria | 16121 |
| 652 | Ga0373931_0006164 | 3300035691 | Bacteria | 5591 |
| 653 | Ga0373935_0002582 | 3300035692 | Bacteria | 10400 |
| 654 | Ga0373927_0081556 | 3300035695 | Bacteria | 2096 |
| 655 | Ga0373927_0274012 | 3300035695 | Bacteria | 1110 |
| 656 | Ga0373927_0276567 | 3300035695 | Bacteria | 1104 |
| 657 | Ga0373933_0069365 | 3300035724 | Bacteria | 2143 |
| 658 | Ga0373947_0006791 | 3300035725 | Bacteria | 6634 |
| 659 | Ga0373937_0076146 | 3300036401 | Bacteria | 3099 |
| 660 | Ga0373937_0128242 | 3300036401 | Bacteria | 2368 |
| 661 | Ga0373937_0410850 | 3300036401 | Bacteria | 1284 |
| 662 | Ga0373925_0004170 | 3300037068 | Bacteria | 10968 |
| 663 | Ga0373925_0045282 | 3300037068 | Bacteria | 3268 |
| 664 | Ga0373925_0062007 | 3300037068 | Bacteria | 2811 |
| 665 | Ga0373925_0096138 | 3300037068 | Bacteria | 2270 |
| 666 | Ga0373925_0191460 | 3300037068 | Bacteria | 1623 |
| 667 | Ga0436365_1236244 | 3300039437 | Bacteria | 3292 |
| 668 | Ga0436363_0456608 | 3300039450 | Bacteria | 1920 |
| 669 | Ga0451793_0582550 | 3300041452 | Bacteria | 2054 |
| 670 | Ga0451795_0193179 | 3300041456 | Bacteria | 966 |
| 671 | Ga0451853_1100378 | 3300041512 | Bacteria | 2403 |
| 672 | Ga0439454_001207 | 3300042011 | Bacteria | 2405 |
| 673 | Ga0450919_001438 | 3300042121 | Bacteria | 3108 |
| 674 | Ga0450920_004372 | 3300042122 | Bacteria | 2480 |
| 675 | Ga0439444_0009863 | 3300042437 | Bacteria | 1514 |
| 676 | Ga0439460_0006330 | 3300042461 | Bacteria | 2933 |
| 677 | Ga0450918_000096 | 3300042531 | Bacteria | 18894 |
| 678 | Ga0451577_0018162 | 3300042876 | Bacteria | 6481 |
| 679 | Ga0466963_0207307 | 3300044694 | Bacteria | 1371 |
| 680 | Ga0453684_0201131 | 3300044712 | Bacteria | 2322 |
| 681 | Ga0451576_0191060 | 3300045051 | Bacteria | 2139 |
| 682 | Ga0451576_0487563 | 3300045051 | Bacteria | 1295 |
| 683 | Ga0495592_0000160 | 3300046454 | Bacteria | 59404 |
| 684 | Ga0495592_0033983 | 3300046454 | Bacteria | 3846 |
| 685 | Ga0495592_0121318 | 3300046454 | Bacteria | 1839 |
| 686 | Ga0495590_0033866 | 3300046457 | Bacteria | 1785 |
| 687 | Ga0495629_0001363 | 3300046459 | Bacteria | 19254 |
| 688 | Ga0495629_0114734 | 3300046459 | Bacteria | 1877 |
| 689 | Ga0495629_0348614 | 3300046459 | Bacteria | 1010 |
| 690 | Ga0495638_0103634 | 3300046460 | Bacteria | 1698 |
| 691 | Ga0495638_0282548 | 3300046460 | Bacteria | 901 |
| 692 | Ga0495641_0039621 | 3300046461 | Bacteria | 2196 |
| 693 | Ga0495651_0018483 | 3300046462 | Bacteria | 5399 |
| 694 | Ga0495651_0341012 | 3300046462 | Bacteria | 993 |
| 695 | Ga0495650_0000120 | 3300046471 | Bacteria | 184191 |
| 696 | Ga0495580_0006785 | 3300046472 | Bacteria | 9280 |
| 697 | Ga0495580_0030291 | 3300046472 | Bacteria | 3919 |
| 698 | Ga0495582_0003867 | 3300046473 | Bacteria | 8432 |
| 699 | Ga0495639_0004857 | 3300046475 | Bacteria | 5767 |
| 700 | Ga0495662_0000639 | 3300046476 | Bacteria | 16368 |
| 701 | Ga0495664_0049556 | 3300046477 | Bacteria | 2493 |
| 702 | Ga0495594_0009847 | 3300046499 | Bacteria | 4952 |
| 703 | Ga0495608_0047219 | 3300046511 | Bacteria | 2863 |
| 704 | Ga0495618_0001442 | 3300046514 | Bacteria | 15955 |
| 705 | Ga0495618_0209786 | 3300046514 | Bacteria | 1231 |
| 706 | Ga0495620_0074303 | 3300046515 | Bacteria | 1385 |
| 707 | Ga0495628_0079954 | 3300046516 | Bacteria | 2542 |
| 708 | Ga0495628_0347813 | 3300046516 | Bacteria | 1090 |
| 709 | Ga0495630_0001164 | 3300046517 | Bacteria | 18173 |
| 710 | Ga0495630_0187107 | 3300046517 | Bacteria | 1580 |
| 711 | Ga0495632_0107898 | 3300046519 | Bacteria | 1309 |
| 712 | Ga0495632_0151213 | 3300046519 | Bacteria | 1073 |
| 713 | Ga0495643_0202425 | 3300046522 | Bacteria | 952 |
| 714 | Ga0495666_0037062 | 3300046526 | Bacteria | 2373 |
| 715 | Ga0495666_0058819 | 3300046526 | Bacteria | 1838 |
| 716 | Ga0495652_0027292 | 3300046529 | Bacteria | 5032 |
| 717 | Ga0495665_0007522 | 3300046531 | Bacteria | 5896 |
| 718 | Ga0495640_0001826 | 3300046533 | Bacteria | 16892 |
| 719 | Ga0495587_0176802 | 3300046536 | Bacteria | 1211 |
| 720 | Ga0495597_0025872 | 3300046542 | Bacteria | 2699 |
| 721 | Ga0495645_0024687 | 3300046543 | Bacteria | 4362 |
| 722 | Ga0495645_0036129 | 3300046543 | Bacteria | 3602 |
| 723 | Ga0495622_0104509 | 3300046557 | Bacteria | 1297 |
| 724 | Ga0495668_0062278 | 3300046616 | Bacteria | 2056 |
| 725 | Ga0495634_0006487 | 3300046642 | Bacteria | 8886 |
| 726 | Ga0495625_0022218 | 3300046660 | Bacteria | 4868 |
| 727 | Ga0495635_0002326 | 3300046663 | Bacteria | 12918 |
| 728 | Ga0495588_0001246 | 3300046674 | Bacteria | 10938 |
| 729 | Ga0495657_0326041 | 3300046675 | Bacteria | 912 |
| 730 | Ga0495646_0027416 | 3300046680 | Bacteria | 3575 |
| 731 | Ga0495647_0001034 | 3300046681 | Bacteria | 8469 |
| 732 | Ga0495647_0143463 | 3300046681 | Bacteria | 1020 |
| 733 | Ga0495658_0001010 | 3300046683 | Bacteria | 14871 |
| 734 | Ga0495658_0105997 | 3300046683 | Bacteria | 1684 |
| 735 | Ga0495613_0005480 | 3300046689 | Bacteria | 9534 |
| 736 | Ga0495613_0045220 | 3300046689 | Bacteria | 3257 |
| 737 | Ga0495624_0004928 | 3300046690 | Bacteria | 9681 |
| 738 | Ga0495670_0140752 | 3300046691 | Bacteria | 1261 |
| 739 | Ga0495600_0001933 | 3300046809 | Bacteria | 11640 |
| 740 | Ga0495600_0148290 | 3300046809 | Bacteria | 1520 |
| 741 | Ga0495660_0000063 | 3300046810 | Bacteria | 129364 |
| 742 | Ga0495581_0001615 | 3300047315 | Bacteria | 12567 |
| 743 | Ga0495636_0003809 | 3300047318 | Bacteria | 5877 |
| 744 | Ga0495674_0011580 | 3300047319 | Bacteria | 8320 |
| 745 | Ga0495676_0008905 | 3300047321 | Bacteria | 9166 |
| 746 | Ga0495676_0066853 | 3300047321 | Bacteria | 2783 |
| 747 | Ga0495680_0001462 | 3300047322 | Bacteria | 25495 |
| 748 | Ga0495680_0100026 | 3300047322 | Bacteria | 2161 |
| 749 | Ga0495687_000330 | 3300047443 | Bacteria | 60838 |
| 750 | Ga0495687_010458 | 3300047443 | Bacteria | 5088 |
| 751 | Ga0495687_015164 | 3300047443 | Bacteria | 3930 |
| 752 | Ga0495681_0015098 | 3300047470 | Bacteria | 4385 |
| 753 | Ga0495684_0001528 | 3300047471 | Bacteria | 18538 |
| 754 | Ga0495684_0053681 | 3300047471 | Bacteria | 3075 |
| 755 | Ga0495684_0075862 | 3300047471 | Bacteria | 2554 |
| 756 | Ga0495593_0004976 | 3300047673 | Bacteria | 7872 |
| 757 | Ga0495614_0050180 | 3300048089 | Bacteria | 1788 |
| 758 | Ga0495626_0107016 | 3300048091 | Bacteria | 1214 |
| 759 | Ga0496100_0012406 | 3300048903 | Bacteria | 4885 |
| 760 | Ga0496101_0044204 | 3300048904 | Bacteria | 3187 |
| 761 | Ga0496102_0088578 | 3300048905 | Bacteria | 2862 |
| 762 | Ga0496104_0005589 | 3300048907 | Bacteria | 11007 |
| 763 | Ga0496104_0009568 | 3300048907 | Bacteria | 8628 |
| 764 | Ga0496104_0157042 | 3300048907 | Bacteria | 2183 |
| 765 | Ga0496105_0024505 | 3300048908 | Bacteria | 4903 |
| 766 | Ga0496106_0002439 | 3300048909 | Bacteria | 13854 |
| 767 | Ga0496106_0065841 | 3300048909 | Bacteria | 2759 |
| 768 | Ga0496106_0263540 | 3300048909 | Bacteria | 1379 |
| 769 | Ga0496107_0024352 | 3300048910 | Bacteria | 4283 |
| 770 | Ga0496108_0020132 | 3300048911 | Bacteria | 5483 |
| 771 | Ga0496108_0031269 | 3300048911 | Bacteria | 4416 |
| 772 | Ga0496108_0162658 | 3300048911 | Bacteria | 1930 |
| 773 | Ga0496108_0259753 | 3300048911 | Bacteria | 1511 |
| 774 | Ga0496108_0279838 | 3300048911 | Bacteria | 1452 |
| 775 | Ga0496109_0016343 | 3300048912 | Bacteria | 6485 |
| 776 | Ga0496109_0053756 | 3300048912 | Bacteria | 3674 |
| 777 | Ga0496109_0333486 | 3300048912 | Bacteria | 1432 |
| 778 | Ga0496109_0367734 | 3300048912 | Bacteria | 1358 |
| 779 | Ga0496110_0111615 | 3300048913 | Bacteria | 2458 |
| 780 | Ga0496110_0170691 | 3300048913 | Bacteria | 1973 |
| 781 | Ga0496110_0600876 | 3300048913 | Bacteria | 998 |
| 782 | Ga0496111_0040158 | 3300048914 | Bacteria | 3356 |
| 783 | Ga0496111_0103417 | 3300048914 | Bacteria | 2095 |
| 784 | Ga0496112_0137197 | 3300048915 | Bacteria | 2416 |
| 785 | Ga0496114_0001104 | 3300048917 | Bacteria | 20372 |
| 786 | Ga0496114_0098393 | 3300048917 | Bacteria | 2494 |
| 787 | Ga0496115_0114022 | 3300048918 | Bacteria | 2221 |
| 788 | Ga0496116_0000096 | 3300048919 | Bacteria | 202230 |
| 789 | Ga0496117_0000267 | 3300048920 | Bacteria | 98737 |
| 790 | Ga0496117_0016545 | 3300048920 | Bacteria | 6218 |
| 791 | Ga0496117_0130113 | 3300048920 | Bacteria | 1527 |
| 792 | Ga0496118_0000238 | 3300048921 | Bacteria | 96987 |
| 793 | Ga0496118_0005162 | 3300048921 | Bacteria | 14965 |
| 794 | Ga0496118_0064235 | 3300048921 | Bacteria | 2694 |
| 795 | Ga0496119_0007846 | 3300048922 | Bacteria | 9510 |
| 796 | Ga0496120_0001781 | 3300048923 | Bacteria | 24242 |
| 797 | Ga0496122_0000213 | 3300048925 | Bacteria | 129218 |
| 798 | Ga0496123_0000177 | 3300048926 | Bacteria | 129218 |
| 799 | Ga0496124_0000026 | 3300048927 | Bacteria | 385387 |
| 800 | Ga0496124_0023697 | 3300048927 | Bacteria | 5598 |
| 801 | Ga0496125_0000226 | 3300048928 | Bacteria | 115358 |
| 802 | Ga0496126_0000632 | 3300048929 | Bacteria | 65657 |
| 803 | Ga0501043_0064170 | 3300049579 | Bacteria | 2884 |
| 804 | Ga0501035_0580560 | 3300049822 | Bacteria | 915 |
| 805 | nmdc:mga03683_56607_c1 | 3300050489 | Bacteria | 1648 |
| 806 | nmdc:mga03683_7061_c1 | 3300050489 | Bacteria | 3878 |
| 807 | nmdc:mga0yw44_178587_c1 | 3300050492 | Bacteria | 1396 |
| 808 | nmdc:mga0k408_1110_c1 | 3300050493 | Bacteria | 14744 |
| 809 | nmdc:mga0k408_1324_c1 | 3300050493 | Bacteria | 13382 |
| 810 | nmdc:mga0k408_78543_c1 | 3300050493 | Bacteria | 1931 |
| 811 | nmdc:mga06z11_3260_c1 | 3300050494 | Bacteria | 6273 |
| 812 | nmdc:mga06z11_41344_c1 | 3300050494 | Bacteria | 2307 |
| 813 | nmdc:mga04h51_2183_c1 | 3300050495 | Bacteria | 4591 |
| 814 | nmdc:mga07m45_13675_c1 | 3300050496 | Bacteria | 4311 |
| 815 | nmdc:mga07m45_139430_c1 | 3300050496 | Bacteria | 1404 |
| 816 | nmdc:mga07m45_1430_c1 | 3300050496 | Bacteria | 10947 |
| 817 | nmdc:mga07m45_144687_c1 | 3300050496 | Bacteria | 1378 |
| 818 | nmdc:mga07m45_630_c1 | 3300050496 | Bacteria | 14978 |
| 819 | nmdc:mga07m45_65058_c1 | 3300050496 | Bacteria | 2070 |
| 820 | nmdc:mga07m45_7700_c1 | 3300050496 | Bacteria | 5513 |
| 821 | nmdc:mga07m45_92398_c1 | 3300050496 | Bacteria | 1734 |
| 822 | nmdc:mga08y16_645297_c1 | 3300050511 | Bacteria | 1063 |
| 823 | nmdc:mga0rr50_315743_c1 | 3300050513 | Bacteria | 1309 |
| 824 | nmdc:mga0rr50_84829_c1 | 3300050513 | Bacteria | 2453 |
| 825 | Ga0495601_0000745 | 3300053077 | Bacteria | 17500 |
| 826 | Ga0495612_0000694 | 3300053078 | Bacteria | 13603 |
| 827 | Ga0495595_0000392 | 3300053084 | Bacteria | 16663 |
| 828 | Ga0495619_0001107 | 3300053085 | Bacteria | 17705 |
| 829 | Ga0495619_0044288 | 3300053085 | Bacteria | 2921 |
| 830 | Ga0500578_0166327 | 3300053086 | Bacteria | 1366 |
| 831 | Ga0500644_0002178 | 3300053088 | Bacteria | 4956 |
| 832 | Ga0500651_0044723 | 3300053093 | Bacteria | 2787 |
| 833 | Ga0500651_0055428 | 3300053093 | Bacteria | 2483 |
| 834 | Ga0500555_066251 | 3300053103 | Bacteria | 961 |
| 835 | Ga0500593_001340 | 3300053117 | Bacteria | 8873 |
| 836 | Ga0500594_0039051 | 3300053118 | Bacteria | 1289 |
| 837 | Ga0500621_051100 | 3300053126 | Bacteria | 1673 |
| 838 | Ga0500628_010101 | 3300053129 | Bacteria | 1681 |
| 839 | Ga0500652_028153 | 3300053131 | Bacteria | 2180 |
| 840 | Ga0500658_0012270 | 3300053134 | Bacteria | 3159 |
| 841 | Ga0500559_0001509 | 3300053136 | Bacteria | 13100 |
| 842 | Ga0500568_0023974 | 3300053139 | Bacteria | 2588 |
| 843 | Ga0500568_0087137 | 3300053139 | Bacteria | 1180 |
| 844 | Ga0500604_0023188 | 3300053151 | Bacteria | 1769 |
| 845 | Ga0500616_0135097 | 3300053153 | Bacteria | 1160 |
| 846 | Ga0500636_0094671 | 3300053177 | Bacteria | 1706 |
| 847 | Ga0500645_001182 | 3300053730 | Bacteria | 13909 |
| 848 | Ga0500645_004523 | 3300053730 | Bacteria | 5306 |
| 849 | Ga0500645_009944 | 3300053730 | Bacteria | 3171 |
| 850 | Ga0500661_008225 | 3300055283 | Bacteria | 1917 |
| 851 | 2511244819 | 2511231002 | Bacteria | 5042903 |
| 852 | 2585826049 | 2585427591 | Bacteria | 5482980 |
| 853 | 2585831833 | 2585427592 | Bacteria | 5370892 |
| 854 | 2599410245 | 2599185169 | Bacteria | 5441380 |
| 855 | 2599904884 | 2599185292 | Bacteria | 6290804 |
| 856 | 2601523457 | 2600255254 | Bacteria | 5281859 |
| 857 | 2601528616 | 2600255255 | Bacteria | 5282785 |
| 858 | 2601615449 | 2600255280 | Bacteria | 5292309 |
| 859 | 2601619625 | 2600255281 | Bacteria | 5288753 |
| 860 | 2601643960 | 2600255287 | Bacteria | 5210468 |
| 861 | 2601648030 | 2600255288 | Bacteria | 5282738 |
| 862 | 2601653501 | 2600255289 | Bacteria | 5281907 |
| 863 | 2601658378 | 2600255290 | Bacteria | 5282218 |
| 864 | 2601663785 | 2600255291 | Bacteria | 5217298 |
| 865 | 2601696334 | 2600255298 | Bacteria | 5215185 |
| 866 | 2601701417 | 2600255299 | Bacteria | 5218662 |
| 867 | 2601706156 | 2600255300 | Bacteria | 5287774 |
| 868 | 2601711741 | 2600255301 | Bacteria | 5280532 |
| 869 | 2601716759 | 2600255302 | Bacteria | 5288235 |
| 870 | 2601721358 | 2600255303 | Bacteria | 5219315 |
| 871 | 2601727165 | 2600255304 | Bacteria | 5283973 |
| 872 | 2601731705 | 2600255305 | Bacteria | 5282329 |
| 873 | 2601736717 | 2600255306 | Bacteria | 5281613 |
| 874 | 2601740317 | 2600255307 | Bacteria | 5439064 |
| 875 | 2601751254 | 2600255309 | Bacteria | 5431045 |
| 876 | 2602018886 | 2600255392 | Bacteria | 5437392 |
| 877 | 2603661173 | 2602042052 | Bacteria | 5215873 |
| 878 | 2603666448 | 2602042053 | Bacteria | 5214361 |
| 879 | 2603839102 | 2602042103 | Bacteria | 5284714 |
| 880 | 2603843638 | 2602042104 | Bacteria | 5281639 |
| 881 | 2603849259 | 2602042105 | Bacteria | 5282303 |
| 882 | 2603854329 | 2602042106 | Bacteria | 5282744 |
| 883 | 2603865658 | 2602042109 | Bacteria | 5152801 |
| 884 | 2603872384 | 2602042110 | Bacteria | 5283285 |
| 885 | 2603877260 | 2602042111 | Bacteria | 5212080 |
| 886 | 2606049565 | 2603880178 | Bacteria | 5283018 |
| 887 | 2606070880 | 2603880184 | Bacteria | 5217896 |
| 888 | 2606147249 | 2603880202 | Bacteria | 5284684 |
| 889 | 2606176974 | 2603880211 | Bacteria | 5284226 |
| 890 | 2637223207 | 2636415599 | Bacteria | 5718434 |
| 891 | 2643860481 | 2643221569 | Bacteria | 6064337 |
| 892 | 2644245230 | 2643221644 | Bacteria | 6865017 |
| 893 | 2644305760 | 2643221654 | Bacteria | 5273570 |
| 894 | 2671109609 | 2667528173 | Bacteria | 5375747 |
| 895 | 2676408616 | 2675903046 | Bacteria | 5451247 |
| 896 | 2777019517 | 2775507074 | Bacteria | 5532402 |
| 897 | 2831866003 | 2831864461 | Bacteria | 6502356 |
| 898 | 2852106325 | 2852103415 | Bacteria | 5193810 |
| 899 | 2881930407 | 2881927736 | Bacteria | 3993927 |
| 900 | 2886851931 | 2886848708 | Bacteria | 5632523 |
| 901 | 2887377380 | 2887375801 | Bacteria | 5334027 |
| 902 | 2904478031 | 2904474040 | Bacteria | 5504324 |
| 903 | 2904517108 | 2904513164 | Bacteria | 5476410 |
| 904 | 2919154005 | 2919150387 | Bacteria | 5500879 |
| 905 | 2927147542 | 2927143783 | Bacteria | 5504251 |
| 906 | 2969080225 | 2969079654 | Bacteria | 5439582 |
| 907 | 2984562681 | 2984559226 | Bacteria | 5683096 |
| 908 | 2984600741 | 2984595703 | Bacteria | 5682994 |
| 909 | Ga0070671_100008975 | |||
| 910 | SwRhRL2b_contig_2942750 | |||
| 911 | JGI24034J26672_10007511 | |||
| 912 | JGI25155J39150_1000123 | |||
| 913 | JGI25156J39149_1000052 | |||
| 914 | JGI25162J39368_1000029 | |||
| 915 | JGI25154J39366_1000081 | |||
| 916 | JGI25157J39369_1000006 | |||
| 917 | JGI25163J39215_1000037 | |||
| 918 | JGI25164J39214_1000008 | |||
| 919 | JGI25159J45721_1000667 | |||
| 920 | JGI25159J45721_1001832 | |||
| 921 | JGI25151J46595_10021834 | |||
| 922 | JGI25151J46595_10022048 | |||
| 923 | rootH2_10034882 | |||
| 924 | rootL2_10000270 | |||
| 925 | rootL2_10066204 | |||
| 926 | rootH1_10010855 | |||
| 927 | rootH1_10090419 | |||
| 928 | JGI25160J50197_1000071 | |||
| 929 | JGI25161J50226_1000030 | |||
| 930 | Ga0055538_1000014 | |||
| 931 | Ga0055539_1000020 | |||
| 932 | Ga0055533_1000027 | |||
| 933 | Ga0055525_1000032 | |||
| 934 | Ga0055526_1000165 | |||
| 935 | Ga0055526_1004597 | |||
| 936 | Ga0055526_1004630 | |||
| 937 | Ga0055526_1005641 | |||
| 938 | Ga0055526_1031764 | |||
| 939 | Ga0055537_1000689 | |||
| 940 | Ga0055524_1000006 | |||
| 941 | Ga0055524_1000033 | |||
| 942 | Ga0055524_1000459 | |||
| 943 | Ga0055524_1000535 | |||
| 944 | Ga0055536_1002314 | |||
| 945 | Ga0055534_1000905 | |||
| 946 | Ga0055528_1000432 | |||
| 947 | Ga0055530_10001786 | |||
| 948 | Ga0055530_10002584 | |||
| 949 | Ga0055540_1000005 | |||
| 950 | Ga0055540_1000007 | |||
| 951 | Ga0055540_1045874 | |||
| 952 | Ga0055531_10001534 | |||
| 953 | Ga0055531_10001878 | |||
| 954 | Ga0055531_10002603 | |||
| 955 | Ga0055531_10004316 | |||
| 956 | Ga0055541_1000014 | |||
| 957 | JGI25405J52794_10000287 | |||
| 958 | Ga0055543_1000162 | |||
| 959 | Ga0055543_1005134 | |||
| 960 | Ga0055543_1010893 | |||
| 961 | Ga0065165_1000248 | |||
| 962 | Ga0065165_1000457 | |||
| 963 | Ga0065165_1014815 | |||
| 964 | Ga0065165_1014830 | |||
| 965 | Ga0065704_10000430 | |||
| 966 | Ga0065715_10015471 | |||
| 967 | Ga0065715_10154527 | |||
| 968 | Ga0070658_10056756 | |||
| 969 | Ga0070658_10068527 | |||
| 970 | Ga0070658_10626740 | |||
| 971 | Ga0070676_10006055 | |||
| 972 | Ga0070676_10023546 | |||
| 973 | Ga0070676_10064971 | |||
| 974 | Ga0070676_10334443 | |||
| 975 | Ga0070683_100006244 | |||
| 976 | Ga0070683_100122375 | |||
| 977 | Ga0070683_100406453 | |||
| 978 | Ga0070670_100003877 | |||
| 979 | Ga0070670_100006300 | |||
| 980 | Ga0070670_100064726 | |||
| 981 | Ga0070670_100078154 | |||
| 982 | Ga0070670_100318387 | |||
| 983 | Ga0070677_10005147 | |||
| 984 | Ga0070677_10041929 | |||
| 985 | Ga0070677_10084456 | |||
| 986 | Ga0068869_100004685 | |||
| 987 | Ga0068869_100008711 | |||
| 988 | Ga0068869_100165058 | |||
| 989 | Ga0070666_10183457 | |||
| 990 | Ga0070680_100015257 | |||
| 991 | Ga0068868_100000930 | |||
| 992 | Ga0068868_100004465 | |||
| 993 | Ga0068868_100075354 | |||
| 994 | Ga0070660_100027188 | |||
| 995 | Ga0070660_100236026 | |||
| 996 | Ga0070660_100248610 | |||
| 997 | Ga0070660_100263554 | |||
| 998 | Ga0070660_100619034 | |||
| 999 | Ga0070689_100501588 | |||
| 1000 | Ga0070687_100009172 | |||
| 1001 | Ga0070661_100000421 | |||
| 1002 | Ga0070661_100025029 | |||
| 1003 | Ga0070661_100147589 | |||
| 1004 | Ga0070661_100448340 | |||
| 1005 | Ga0070668_100279053 | |||
| 1006 | Ga0070669_100006777 | |||
| 1007 | Ga0070669_100230169 | |||
| 1008 | Ga0070669_100347952 | |||
| 1009 | Ga0070669_100398041 | |||
| 1010 | Ga0070675_100000926 | |||
| 1011 | Ga0070675_100023645 | |||
| 1012 | Ga0070675_100033735 | |||
| 1013 | Ga0070675_100052584 | |||
| 1014 | Ga0070675_100129602 | |||
| 1015 | Ga0070675_100138103 | |||
| 1016 | Ga0070671_100006545 | |||
| 1017 | Ga0070671_100006549 | |||
| 1018 | Ga0070671_100115583 | |||
| 1019 | Ga0070671_100269640 | |||
| 1020 | Ga0070671_100309010 | |||
| 1021 | Ga0070671_100528168 | |||
| 1022 | Ga0070674_100003100 | |||
| 1023 | Ga0070674_100107885 | |||
| 1024 | Ga0070673_100002705 | |||
| 1025 | Ga0070673_100010900 | |||
| 1026 | Ga0070673_100049438 | |||
| 1027 | Ga0070673_100080581 | |||
| 1028 | Ga0070673_100106065 | |||
| 1029 | Ga0070673_100195048 | |||
| 1030 | Ga0070673_100442914 | |||
| 1031 | Ga0070688_100052577 | |||
| 1032 | Ga0070659_100001131 | |||
| 1033 | Ga0070659_100015214 | |||
| 1034 | Ga0070659_100069504 | |||
| 1035 | Ga0070659_100315241 | |||
| 1036 | Ga0070659_100350263 | |||
| 1037 | Ga0070667_100028982 | |||
| 1038 | Ga0070667_100046762 | |||
| 1039 | Ga0070667_100049020 | |||
| 1040 | Ga0070667_100050041 | |||
| 1041 | Ga0070667_100075499 | |||
| 1042 | Ga0070667_100106923 | |||
| 1043 | Ga0070667_100202999 | |||
| 1044 | Ga0070667_100261822 | |||
| 1045 | Ga0070714_100003484 | |||
| 1046 | Ga0070710_10045240 | |||
| 1047 | Ga0070711_100328282 | |||
| 1048 | Ga0070700_100040386 | |||
| 1049 | Ga0070663_100135643 | |||
| 1050 | Ga0070663_100171450 | |||
| 1051 | Ga0070663_100178439 | |||
| 1052 | Ga0070663_100480344 | |||
| 1053 | Ga0070678_100012306 | |||
| 1054 | Ga0070678_100069389 | |||
| 1055 | Ga0070678_100344094 | |||
| 1056 | Ga0070678_100353293 | |||
| 1057 | Ga0070678_100534928 | |||
| 1058 | Ga0070678_100566858 | |||
| 1059 | Ga0070662_100001118 | |||
| 1060 | Ga0070662_100062411 | |||
| 1061 | Ga0070662_100150276 | |||
| 1062 | Ga0070662_100317556 | |||
| 1063 | Ga0070681_10163217 | |||
| 1064 | Ga0068867_100004608 | |||
| 1065 | Ga0068867_100007763 | |||
| 1066 | Ga0068867_100037531 | |||
| 1067 | Ga0068867_100137285 | |||
| 1068 | Ga0070685_10026991 | |||
| 1069 | Ga0070685_10038031 | |||
| 1070 | Ga0070706_100002704 | |||
| 1071 | Ga0070699_100329360 | |||
| 1072 | Ga0070679_100133211 | |||
| 1073 | Ga0070684_100004660 | |||
| 1074 | Ga0070684_100112888 | |||
| 1075 | Ga0070684_100260750 | |||
| 1076 | Ga0070684_100402283 | |||
| 1077 | Ga0068853_100008854 | |||
| 1078 | Ga0068853_100079991 | |||
| 1079 | Ga0068853_100121432 | |||
| 1080 | Ga0068853_100289949 | |||
| 1081 | Ga0070672_100004999 | |||
| 1082 | Ga0070672_100082916 | |||
| 1083 | Ga0070672_100196755 | |||
| 1084 | Ga0070686_100010080 | |||
| 1085 | Ga0070695_100066338 | |||
| 1086 | Ga0070665_100195344 | |||
| 1087 | Ga0070665_100290114 | |||
| 1088 | Ga0070665_100551833 | |||
| 1089 | Ga0070664_100001426 | |||
| 1090 | Ga0070664_100032656 | |||
| 1091 | Ga0070664_100043662 | |||
| 1092 | Ga0070664_100080697 | |||
| 1093 | Ga0070664_100283693 | |||
| 1094 | Ga0070664_100318624 | |||
| 1095 | Ga0068857_100005334 | |||
| 1096 | Ga0068857_100056463 | |||
| 1097 | Ga0068857_100066636 | |||
| 1098 | Ga0068854_100023715 | |||
| 1099 | Ga0068854_100031730 | |||
| 1100 | Ga0068854_100109567 | |||
| 1101 | Ga0068854_100359268 | |||
| 1102 | Ga0068854_100570405 | |||
| 1103 | Ga0068856_100008227 | |||
| 1104 | Ga0068852_100011321 | |||
| 1105 | Ga0068852_100030483 | |||
| 1106 | Ga0068852_100031117 | |||
| 1107 | Ga0068852_100038260 | |||
| 1108 | Ga0068852_100090150 | |||
| 1109 | Ga0068852_100129524 | |||
| 1110 | Ga0068852_100243046 | |||
| 1111 | Ga0068852_100262259 | |||
| 1112 | Ga0068859_100100470 | |||
| 1113 | Ga0068859_100413048 | |||
| 1114 | Ga0068864_100001420 | |||
| 1115 | Ga0068864_100005635 | |||
| 1116 | Ga0068864_100018785 | |||
| 1117 | Ga0068864_100049209 | |||
| 1118 | Ga0068864_100051910 | |||
| 1119 | Ga0068866_10033691 | |||
| 1120 | Ga0068861_100006180 | |||
| 1121 | Ga0068861_100018413 | |||
| 1122 | Ga0068861_100050276 | |||
| 1123 | Ga0068851_10007383 | |||
| 1124 | Ga0068851_10015841 | |||
| 1125 | Ga0068870_10050666 | |||
| 1126 | Ga0068870_10288925 | |||
| 1127 | Ga0068863_100031141 | |||
| 1128 | Ga0068863_100077677 | |||
| 1129 | Ga0068863_100085537 | |||
| 1130 | Ga0068863_100200095 | |||
| 1131 | Ga0068863_100442513 | |||
| 1132 | Ga0068858_100001292 | |||
| 1133 | Ga0068858_100103295 | |||
| 1134 | Ga0068860_100076886 | |||
| 1135 | Ga0068862_100114461 | |||
| 1136 | Ga0081455_10001479 | |||
| 1137 | Ga0075364_10071666 | |||
| 1138 | Ga0075364_10241316 | |||
| 1139 | Ga0075432_10042041 | |||
| 1140 | Ga0075362_10040059 | |||
| 1141 | Ga0075367_10013603 | |||
| 1142 | Ga0075367_10053393 | |||
| 1143 | Ga0075367_10086550 | |||
| 1144 | Ga0075366_10003855 | |||
| 1145 | Ga0075366_10072018 | |||
| 1146 | Ga0097621_100004797 | |||
| 1147 | Ga0097621_100010187 | |||
| 1148 | Ga0097621_100047062 | |||
| 1149 | Ga0097621_100114312 | |||
| 1150 | Ga0097621_100127976 | |||
| 1151 | Ga0097621_100459828 | |||
| 1152 | Ga0075370_10000414 | |||
| 1153 | Ga0075370_10002136 | |||
| 1154 | Ga0075370_10003303 | |||
| 1155 | Ga0075370_10013634 | |||
| 1156 | Ga0075370_10058441 | |||
| 1157 | Ga0068871_100008334 | |||
| 1158 | Ga0068871_100037449 | |||
| 1159 | Ga0068871_100163445 | |||
| 1160 | Ga0068865_100018910 | |||
| 1161 | Ga0068865_100036499 | |||
| 1162 | Ga0068865_100359016 | |||
| 1163 | Ga0097620_100100481 | |||
| 1164 | Ga0097620_100413090 | |||
| 1165 | Ga0099823_1000049 | |||
| 1166 | Ga0079104_1000009 | |||
| 1167 | Ga0079104_1009160 | |||
| 1168 | Ga0105244_10002360 | |||
| 1169 | Ga0105250_10000818 | |||
| 1170 | Ga0105240_10020343 | |||
| 1171 | Ga0105240_10106425 | |||
| 1172 | Ga0105240_10635941 | |||
| 1173 | Ga0111539_10042281 | |||
| 1174 | Ga0105245_10031804 | |||
| 1175 | Ga0105245_10032610 | |||
| 1176 | Ga0105245_10336331 | |||
| 1177 | Ga0105245_10377138 | |||
| 1178 | Ga0105247_10114825 | |||
| 1179 | Ga0105247_10190353 | |||
| 1180 | Ga0105247_10507529 | |||
| 1181 | Ga0114129_10002772 | |||
| 1182 | Ga0105243_10169335 | |||
| 1183 | Ga0105241_10090970 | |||
| 1184 | Ga0105241_10091854 | |||
| 1185 | Ga0105241_10392820 | |||
| 1186 | Ga0105241_10562218 | |||
| 1187 | Ga0105248_10038301 | |||
| 1188 | Ga0105248_10147480 | |||
| 1189 | Ga0105248_10583002 | |||
| 1190 | Ga0105237_10074652 | |||
| 1191 | Ga0105237_10092510 | |||
| 1192 | Ga0105237_10455002 | |||
| 1193 | Ga0105237_10612628 | |||
| 1194 | Ga0105238_10016359 | |||
| 1195 | Ga0105238_10054522 | |||
| 1196 | Ga0105249_10054314 | |||
| 1197 | Ga0105249_10075802 | |||
| 1198 | Ga0105249_10274650 | |||
| 1199 | Ga0105239_10015037 | |||
| 1200 | Ga0105239_10030363 | |||
| 1201 | Ga0105239_10211136 | |||
| 1202 | Ga0105246_10088951 | |||
| 1203 | Ga0157319_1000003 | |||
| 1204 | Ga0157371_10000067 | |||
| 1205 | Ga0157371_10019163 | |||
| 1206 | Ga0157371_10263183 | |||
| 1207 | Ga0157369_10525144 | |||
| 1208 | Ga0157374_10041624 | |||
| 1209 | Ga0157374_10068630 | |||
| 1210 | Ga0157374_10135152 | |||
| 1211 | Ga0157374_10158942 | |||
| 1212 | Ga0157374_10219075 | |||
| 1213 | Ga0157374_10480593 | |||
| 1214 | Ga0157378_10056311 | |||
| 1215 | Ga0157378_10280982 | |||
| 1216 | Ga0157378_10414925 | |||
| 1217 | Ga0163162_10031762 | |||
| 1218 | Ga0163162_10241428 | |||
| 1219 | Ga0163162_10302369 | |||
| 1220 | Ga0163162_10585641 | |||
| 1221 | Ga0157372_10006296 | |||
| 1222 | Ga0157372_10294769 | |||
| 1223 | Ga0157375_10020576 | |||
| 1224 | Ga0157375_10065317 | |||
| 1225 | Ga0157375_10159014 | |||
| 1226 | Ga0157375_10161133 | |||
| 1227 | Ga0157375_10173806 | |||
| 1228 | Ga0163163_10002538 | |||
| 1229 | Ga0182008_10165321 | |||
| 1230 | Ga0157377_10002927 | |||
| 1231 | Ga0157379_10007434 | |||
| 1232 | Ga0157379_10015457 | |||
| 1233 | Ga0157379_10039615 | |||
| 1234 | Ga0157376_10014590 | |||
| 1235 | Ga0157376_10024312 | |||
| 1236 | Ga0157376_10296245 | |||
| 1237 | Ga0163161_10004707 | |||
| 1238 | Ga0163161_10053829 | |||
| 1239 | Ga0209435_100001 | |||
| 1240 | Ga0209760_100256 | |||
| 1241 | Ga0209436_105701 | |||
| 1242 | Ga0209784_100030 | |||
| 1243 | Ga0209566_100034 | |||
| 1244 | Ga0209674_100052 | |||
| 1245 | Ga0209563_100054 | |||
| 1246 | Ga0207427_100035 | |||
| 1247 | Ga0209437_100068 | |||
| 1248 | Ga0207425_1003404 | |||
| 1249 | Ga0209646_1000001 | |||
| 1250 | Ga0209026_1000003 | |||
| 1251 | Ga0209677_100032 | |||
| 1252 | Ga0209759_1000001 | |||
| 1253 | Ga0209233_1001319 | |||
| 1254 | Ga0209565_1000124 | |||
| 1255 | Ga0209673_1000043 | |||
| 1256 | Ga0209673_1010760 | |||
| 1257 | Ga0209673_1015800 | |||
| 1258 | Ga0209673_1017436 | |||
| 1259 | Ga0209130_1000060 | |||
| 1260 | Ga0209130_1000114 | |||
| 1261 | Ga0209675_1000269 | |||
| 1262 | Ga0209675_1002791 | |||
| 1263 | Ga0209675_1023335 | |||
| 1264 | Ga0209676_1000007 | |||
| 1265 | Ga0209676_1004596 | |||
| 1266 | Ga0209676_1006553 | |||
| 1267 | Ga0209025_1000822 | |||
| 1268 | Ga0209025_1002740 | |||
| 1269 | Ga0209025_1004701 | |||
| 1270 | Ga0209025_1005559 | |||
| 1271 | Ga0209564_1000019 | |||
| 1272 | Ga0209564_1000051 | |||
| 1273 | Ga0209564_1000268 | |||
| 1274 | Ga0209564_1002616 | |||
| 1275 | Ga0209564_1007637 | |||
| 1276 | Ga0209758_1049975 | |||
| 1277 | Ga0209758_1059472 | |||
| 1278 | Ga0209050_1000003 | |||
| 1279 | Ga0209050_1000243 | |||
| 1280 | Ga0209050_1002122 | |||
| 1281 | Ga0209050_1002216 | |||
| 1282 | Ga0209050_1002982 | |||
| 1283 | Ga0209050_1005795 | |||
| 1284 | Ga0209256_1000001 | |||
| 1285 | Ga0209256_1000019 | |||
| 1286 | Ga0209256_1000242 | |||
| 1287 | Ga0209256_1000512 | |||
| 1288 | Ga0207426_1000308 | |||
| 1289 | Ga0207426_1002574 | |||
| 1290 | Ga0209051_1000003 | |||
| 1291 | Ga0209051_1000004 | |||
| 1292 | Ga0209051_1000577 | |||
| 1293 | Ga0209051_1009165 | |||
| 1294 | Ga0209257_1000020 | |||
| 1295 | Ga0209257_1000038 | |||
| 1296 | Ga0209257_1000044 | |||
| 1297 | Ga0209257_1003863 | |||
| 1298 | Ga0209257_1004264 | |||
| 1299 | Ga0209257_1005946 | |||
| 1300 | Ga0209257_1013536 | |||
| 1301 | Ga0207697_10002323 | |||
| 1302 | Ga0207697_10040005 | |||
| 1303 | Ga0207656_10038928 | |||
| 1304 | Ga0207656_10081504 | |||
| 1305 | Ga0207656_10092387 | |||
| 1306 | Ga0207696_1000173 | |||
| 1307 | Ga0207655_1000198 | |||
| 1308 | Ga0207682_10000706 | |||
| 1309 | Ga0207682_10002760 | |||
| 1310 | Ga0207682_10003004 | |||
| 1311 | Ga0207682_10109217 | |||
| 1312 | Ga0207692_10042920 | |||
| 1313 | Ga0207688_10019000 | |||
| 1314 | Ga0207680_10022089 | |||
| 1315 | Ga0207647_10066050 | |||
| 1316 | Ga0207699_10015220 | |||
| 1317 | Ga0207645_10002087 | |||
| 1318 | Ga0207645_10008182 | |||
| 1319 | Ga0207645_10008366 | |||
| 1320 | Ga0207645_10081673 | |||
| 1321 | Ga0207645_10247954 | |||
| 1322 | Ga0207645_10294339 | |||
| 1323 | Ga0207643_10010973 | |||
| 1324 | Ga0207643_10020852 | |||
| 1325 | Ga0207643_10024104 | |||
| 1326 | Ga0207643_10332143 | |||
| 1327 | Ga0207705_10175602 | |||
| 1328 | Ga0207705_10289179 | |||
| 1329 | Ga0207684_10006839 | |||
| 1330 | Ga0207695_10052245 | |||
| 1331 | Ga0207695_10053879 | |||
| 1332 | Ga0207671_10005913 | |||
| 1333 | Ga0207671_10019025 | |||
| 1334 | Ga0207660_10003934 | |||
| 1335 | Ga0207662_10023052 | |||
| 1336 | Ga0207662_10098852 | |||
| 1337 | Ga0207657_10024018 | |||
| 1338 | Ga0207657_10024969 | |||
| 1339 | Ga0207657_10229771 | |||
| 1340 | Ga0207657_10233367 | |||
| 1341 | Ga0207649_10000751 | |||
| 1342 | Ga0207649_10014142 | |||
| 1343 | Ga0207649_10187455 | |||
| 1344 | Ga0207652_10017987 | |||
| 1345 | Ga0207681_10027388 | |||
| 1346 | Ga0207681_10238468 | |||
| 1347 | Ga0207681_10397865 | |||
| 1348 | Ga0207694_10015611 | |||
| 1349 | Ga0207694_10037588 | |||
| 1350 | Ga0207650_10002189 | |||
| 1351 | Ga0207650_10002736 | |||
| 1352 | Ga0207650_10002868 | |||
| 1353 | Ga0207650_10043334 | |||
| 1354 | Ga0207650_10087938 | |||
| 1355 | Ga0207650_10296595 | |||
| 1356 | Ga0207659_10005319 | |||
| 1357 | Ga0207659_10015146 | |||
| 1358 | Ga0207659_10040763 | |||
| 1359 | Ga0207659_10090473 | |||
| 1360 | Ga0207687_10009547 | |||
| 1361 | Ga0207687_10046793 | |||
| 1362 | Ga0207687_10270714 | |||
| 1363 | Ga0207664_10001434 | |||
| 1364 | Ga0207644_10015628 | |||
| 1365 | Ga0207644_10048009 | |||
| 1366 | Ga0207644_10062080 | |||
| 1367 | Ga0207644_10126507 | |||
| 1368 | Ga0207644_10146813 | |||
| 1369 | Ga0207644_10358759 | |||
| 1370 | Ga0207644_10474772 | |||
| 1371 | Ga0207690_10000481 | |||
| 1372 | Ga0207690_10104153 | |||
| 1373 | Ga0207690_10154325 | |||
| 1374 | Ga0207690_10200626 | |||
| 1375 | Ga0207690_10263354 | |||
| 1376 | Ga0207690_10291124 | |||
| 1377 | Ga0207706_10004920 | |||
| 1378 | Ga0207706_10064686 | |||
| 1379 | Ga0207706_10079814 | |||
| 1380 | Ga0207706_10142662 | |||
| 1381 | Ga0207686_10404781 | |||
| 1382 | Ga0207670_10012105 | |||
| 1383 | Ga0207669_10018975 | |||
| 1384 | Ga0207704_10064613 | |||
| 1385 | Ga0207704_10122444 | |||
| 1386 | Ga0207704_10220779 | |||
| 1387 | Ga0207704_10333441 | |||
| 1388 | Ga0207665_10092418 | |||
| 1389 | Ga0207691_10000318 | |||
| 1390 | Ga0207691_10014394 | |||
| 1391 | Ga0207691_10042654 | |||
| 1392 | Ga0207691_10083172 | |||
| 1393 | Ga0207691_10111431 | |||
| 1394 | Ga0207691_10717155 | |||
| 1395 | Ga0207711_10024699 | |||
| 1396 | Ga0207711_10139505 | |||
| 1397 | Ga0207711_10377432 | |||
| 1398 | Ga0207711_10416288 | |||
| 1399 | Ga0207689_10001904 | |||
| 1400 | Ga0207689_10013816 | |||
| 1401 | Ga0207689_10126735 | |||
| 1402 | Ga0207689_10441783 | |||
| 1403 | Ga0207661_10092738 | |||
| 1404 | Ga0207661_10556995 | |||
| 1405 | Ga0207679_10000501 | |||
| 1406 | Ga0207679_10005264 | |||
| 1407 | Ga0207679_10036386 | |||
| 1408 | Ga0207679_10079550 | |||
| 1409 | Ga0207651_10000364 | |||
| 1410 | Ga0207651_10006026 | |||
| 1411 | Ga0207651_10044839 | |||
| 1412 | Ga0207668_10012084 | |||
| 1413 | Ga0207640_10012872 | |||
| 1414 | Ga0207640_10042903 | |||
| 1415 | Ga0207640_10060571 | |||
| 1416 | Ga0207640_10320555 | |||
| 1417 | Ga0207640_10512070 | |||
| 1418 | Ga0207658_10002924 | |||
| 1419 | Ga0207658_10004551 | |||
| 1420 | Ga0207658_10034339 | |||
| 1421 | Ga0207658_10156564 | |||
| 1422 | Ga0207658_10260453 | |||
| 1423 | Ga0207658_10283314 | |||
| 1424 | Ga0207677_10004631 | |||
| 1425 | Ga0207677_10011733 | |||
| 1426 | Ga0207677_10082694 | |||
| 1427 | Ga0207677_10142955 | |||
| 1428 | Ga0207677_10251608 | |||
| 1429 | Ga0207703_10001647 | |||
| 1430 | Ga0207703_10031109 | |||
| 1431 | Ga0207639_10007604 | |||
| 1432 | Ga0207639_10048854 | |||
| 1433 | Ga0207639_10055759 | |||
| 1434 | Ga0207639_10210448 | |||
| 1435 | Ga0207639_10297179 | |||
| 1436 | Ga0207678_10011143 | |||
| 1437 | Ga0207678_10013097 | |||
| 1438 | Ga0207678_10037317 | |||
| 1439 | Ga0207678_10088611 | |||
| 1440 | Ga0207678_10147103 | |||
| 1441 | Ga0207708_10006073 | |||
| 1442 | Ga0207708_10310031 | |||
| 1443 | Ga0207702_10079153 | |||
| 1444 | Ga0207702_10273146 | |||
| 1445 | Ga0207702_10348808 | |||
| 1446 | Ga0207702_10986600 | |||
| 1447 | Ga0207641_10002593 | |||
| 1448 | Ga0207641_10038275 | |||
| 1449 | Ga0207641_10215708 | |||
| 1450 | Ga0207641_10334452 | |||
| 1451 | Ga0207641_10641741 | |||
| 1452 | Ga0207648_10006568 | |||
| 1453 | Ga0207648_10014727 | |||
| 1454 | Ga0207648_10043325 | |||
| 1455 | Ga0207648_10459498 | |||
| 1456 | Ga0207676_10001498 | |||
| 1457 | Ga0207676_10017299 | |||
| 1458 | Ga0207676_10089900 | |||
| 1459 | Ga0207676_10111989 | |||
| 1460 | Ga0207674_10008817 | |||
| 1461 | Ga0207674_10031394 | |||
| 1462 | Ga0207674_10042732 | |||
| 1463 | Ga0207674_10313852 | |||
| 1464 | Ga0207674_10484958 | |||
| 1465 | Ga0207675_100000660 | |||
| 1466 | Ga0207675_100001398 | |||
| 1467 | Ga0207675_100238802 | |||
| 1468 | Ga0207675_100445847 | |||
| 1469 | Ga0207683_10010653 | |||
| 1470 | Ga0207683_10024630 | |||
| 1471 | Ga0207683_10045467 | |||
| 1472 | Ga0207683_10088633 | |||
| 1473 | Ga0207683_10092786 | |||
| 1474 | Ga0207683_10142966 | |||
| 1475 | Ga0207683_10209322 | |||
| 1476 | Ga0207683_10375733 | |||
| 1477 | Ga0207698_10018703 | |||
| 1478 | Ga0207698_10078188 | |||
| 1479 | Ga0207698_10131871 | |||
| 1480 | Ga0207698_10156103 | |||
| 1481 | Ga0207698_10207283 | |||
| 1482 | Ga0209281_1000023 | |||
| 1483 | Ga0209281_1009027 | |||
| 1484 | Ga0209389_1025093 | |||
| 1485 | Ga0209371_1000701 | |||
| 1486 | Ga0209371_1013976 | |||
| 1487 | Ga0207428_10190334 | |||
| 1488 | Ga0268266_10179297 | |||
| 1489 | Ga0268265_10139537 | |||
| 1490 | Ga0268264_10079618 | |||
| 1491 | Ga0268264_10309352 | |||
| 1492 | Ga0307517_10000228 | |||
| 1493 | Ga0307515_10007466 | |||
| 1494 | Ga0307515_10034913 | |||
| 1495 | Ga0307515_10090606 | |||
| 1496 | Ga0265338_10009227 | |||
| 1497 | Ga0268256_1000945 | |||
| 1498 | Ga0268256_1015987 | |||
| 1499 | Ga0307512_10023453 | |||
| 1500 | Ga0307513_10000006 | |||
| 1501 | Ga0307513_10000094 | |||
| 1502 | Ga0307513_10015048 | |||
| 1503 | Ga0307513_10030687 | |||
| 1504 | Ga0307513_10309731 | |||
| 1505 | Ga0307509_10000426 | |||
| 1506 | Ga0307509_10014271 | |||
| 1507 | Ga0307509_10016014 | |||
| 1508 | Ga0307509_10124219 | |||
| 1509 | Ga0307509_10262741 | |||
| 1510 | Ga0307408_100006878 | |||
| 1511 | Ga0307408_100012190 | |||
| 1512 | Ga0307508_10003969 | |||
| 1513 | Ga0307508_10110368 | |||
| 1514 | Ga0307508_10204922 | |||
| 1515 | Ga0307514_10033315 | |||
| 1516 | Ga0307514_10072799 | |||
| 1517 | Ga0307516_10132284 | |||
| 1518 | Ga0307516_10198561 | |||
| 1519 | Ga0307405_10032048 | |||
| 1520 | Ga0307405_10188626 | |||
| 1521 | Ga0307413_10023007 | |||
| 1522 | Ga0307413_10085557 | |||
| 1523 | Ga0307413_10098758 | |||
| 1524 | Ga0307413_10223240 | |||
| 1525 | Ga0307410_10013135 | |||
| 1526 | Ga0307410_10140913 | |||
| 1527 | Ga0307410_10226142 | |||
| 1528 | Ga0307406_10016595 | |||
| 1529 | Ga0307406_10094301 | |||
| 1530 | Ga0307406_10129970 | |||
| 1531 | Ga0307406_10478188 | |||
| 1532 | Ga0307407_10054608 | |||
| 1533 | Ga0307412_10003825 | |||
| 1534 | Ga0307409_100018633 | |||
| 1535 | Ga0307409_100030943 | |||
| 1536 | Ga0307409_100050461 | |||
| 1537 | Ga0307416_100001391 | |||
| 1538 | Ga0307414_10466066 | |||
| 1539 | Ga0307411_10057250 | |||
| 1540 | Ga0307415_100000538 | |||
| 1541 | Ga0307507_10183074 | |||
| 1542 | Ga0307510_10000109 | |||
| 1543 | Ga0307510_10003495 | |||
| 1544 | Ga0307510_10007864 | |||
| 1545 | Ga0373928_0039003 | |||
| 1546 | Ga0373929_0028890 | |||
| 1547 | Ga0373944_0012864 | |||
| 1548 | Ga0373923_0081516 | |||
| 1549 | Ga0373939_0020182 | |||
| 1550 | Ga0373945_0008660 | |||
| 1551 | Ga0373945_0096489 | |||
| 1552 | Ga0373954_0235440 | |||
| 1553 | Ga0373956_0157678 | |||
| 1554 | Ga0373943_0002106 | |||
| 1555 | Ga0373946_0046180 | |||
| 1556 | Ga0373955_0098276 | |||
| 1557 | Ga0373924_0039178 | |||
| 1558 | Ga0373931_0000491 | |||
| 1559 | Ga0373931_0006164 | |||
| 1560 | Ga0373935_0002582 | |||
| 1561 | Ga0373927_0081556 | |||
| 1562 | Ga0373927_0274012 | |||
| 1563 | Ga0373927_0276567 | |||
| 1564 | Ga0373933_0069365 | |||
| 1565 | Ga0373947_0006791 | |||
| 1566 | Ga0373937_0076146 | |||
| 1567 | Ga0373937_0128242 | |||
| 1568 | Ga0373937_0410850 | |||
| 1569 | Ga0373925_0004170 | |||
| 1570 | Ga0373925_0045282 | |||
| 1571 | Ga0373925_0062007 | |||
| 1572 | Ga0373925_0096138 | |||
| 1573 | Ga0373925_0191460 | |||
| 1574 | Ga0436365_1236244 | |||
| 1575 | Ga0436363_0456608 | |||
| 1576 | Ga0451793_0582550 | |||
| 1577 | Ga0451795_0193179 | |||
| 1578 | Ga0451853_1100378 | |||
| 1579 | Ga0439454_001207 | |||
| 1580 | Ga0450919_001438 | |||
| 1581 | Ga0450920_004372 | |||
| 1582 | Ga0439444_0009863 | |||
| 1583 | Ga0439460_0006330 | |||
| 1584 | Ga0450918_000096 | |||
| 1585 | Ga0451577_0018162 | |||
| 1586 | Ga0466963_0207307 | |||
| 1587 | Ga0453684_0201131 | |||
| 1588 | Ga0451576_0191060 | |||
| 1589 | Ga0451576_0487563 | |||
| 1590 | Ga0495592_0000160 | |||
| 1591 | Ga0495592_0033983 | |||
| 1592 | Ga0495592_0121318 | |||
| 1593 | Ga0495590_0033866 | |||
| 1594 | Ga0495629_0001363 | |||
| 1595 | Ga0495629_0114734 | |||
| 1596 | Ga0495629_0348614 | |||
| 1597 | Ga0495638_0103634 | |||
| 1598 | Ga0495638_0282548 | |||
| 1599 | Ga0495641_0039621 | |||
| 1600 | Ga0495651_0018483 | |||
| 1601 | Ga0495651_0341012 | |||
| 1602 | Ga0495650_0000120 | |||
| 1603 | Ga0495580_0006785 | |||
| 1604 | Ga0495580_0030291 | |||
| 1605 | Ga0495582_0003867 | |||
| 1606 | Ga0495639_0004857 | |||
| 1607 | Ga0495662_0000639 | |||
| 1608 | Ga0495664_0049556 | |||
| 1609 | Ga0495594_0009847 | |||
| 1610 | Ga0495608_0047219 | |||
| 1611 | Ga0495618_0001442 | |||
| 1612 | Ga0495618_0209786 | |||
| 1613 | Ga0495620_0074303 | |||
| 1614 | Ga0495628_0079954 | |||
| 1615 | Ga0495628_0347813 | |||
| 1616 | Ga0495630_0001164 | |||
| 1617 | Ga0495630_0187107 | |||
| 1618 | Ga0495632_0107898 | |||
| 1619 | Ga0495632_0151213 | |||
| 1620 | Ga0495643_0202425 | |||
| 1621 | Ga0495666_0037062 | |||
| 1622 | Ga0495666_0058819 | |||
| 1623 | Ga0495652_0027292 | |||
| 1624 | Ga0495665_0007522 | |||
| 1625 | Ga0495640_0001826 | |||
| 1626 | Ga0495587_0176802 | |||
| 1627 | Ga0495597_0025872 | |||
| 1628 | Ga0495645_0024687 | |||
| 1629 | Ga0495645_0036129 | |||
| 1630 | Ga0495622_0104509 | |||
| 1631 | Ga0495668_0062278 | |||
| 1632 | Ga0495634_0006487 | |||
| 1633 | Ga0495625_0022218 | |||
| 1634 | Ga0495635_0002326 | |||
| 1635 | Ga0495588_0001246 | |||
| 1636 | Ga0495657_0326041 | |||
| 1637 | Ga0495646_0027416 | |||
| 1638 | Ga0495647_0001034 | |||
| 1639 | Ga0495647_0143463 | |||
| 1640 | Ga0495658_0001010 | |||
| 1641 | Ga0495658_0105997 | |||
| 1642 | Ga0495613_0005480 | |||
| 1643 | Ga0495613_0045220 | |||
| 1644 | Ga0495624_0004928 | |||
| 1645 | Ga0495670_0140752 | |||
| 1646 | Ga0495600_0001933 | |||
| 1647 | Ga0495600_0148290 | |||
| 1648 | Ga0495660_0000063 | |||
| 1649 | Ga0495581_0001615 | |||
| 1650 | Ga0495636_0003809 | |||
| 1651 | Ga0495674_0011580 | |||
| 1652 | Ga0495676_0008905 | |||
| 1653 | Ga0495676_0066853 | |||
| 1654 | Ga0495680_0001462 | |||
| 1655 | Ga0495680_0100026 | |||
| 1656 | Ga0495687_000330 | |||
| 1657 | Ga0495687_010458 | |||
| 1658 | Ga0495687_015164 | |||
| 1659 | Ga0495681_0015098 | |||
| 1660 | Ga0495684_0001528 | |||
| 1661 | Ga0495684_0053681 | |||
| 1662 | Ga0495684_0075862 | |||
| 1663 | Ga0495593_0004976 | |||
| 1664 | Ga0495614_0050180 | |||
| 1665 | Ga0495626_0107016 | |||
| 1666 | Ga0496100_0012406 | |||
| 1667 | Ga0496101_0044204 | |||
| 1668 | Ga0496102_0088578 | |||
| 1669 | Ga0496104_0005589 | |||
| 1670 | Ga0496104_0009568 | |||
| 1671 | Ga0496104_0157042 | |||
| 1672 | Ga0496105_0024505 | |||
| 1673 | Ga0496106_0002439 | |||
| 1674 | Ga0496106_0065841 | |||
| 1675 | Ga0496106_0263540 | |||
| 1676 | Ga0496107_0024352 | |||
| 1677 | Ga0496108_0020132 | |||
| 1678 | Ga0496108_0031269 | |||
| 1679 | Ga0496108_0162658 | |||
| 1680 | Ga0496108_0259753 | |||
| 1681 | Ga0496108_0279838 | |||
| 1682 | Ga0496109_0016343 | |||
| 1683 | Ga0496109_0053756 | |||
| 1684 | Ga0496109_0333486 | |||
| 1685 | Ga0496109_0367734 | |||
| 1686 | Ga0496110_0111615 | |||
| 1687 | Ga0496110_0170691 | |||
| 1688 | Ga0496110_0600876 | |||
| 1689 | Ga0496111_0040158 | |||
| 1690 | Ga0496111_0103417 | |||
| 1691 | Ga0496112_0137197 | |||
| 1692 | Ga0496114_0001104 | |||
| 1693 | Ga0496114_0098393 | |||
| 1694 | Ga0496115_0114022 | |||
| 1695 | Ga0496116_0000096 | |||
| 1696 | Ga0496117_0000267 | |||
| 1697 | Ga0496117_0016545 | |||
| 1698 | Ga0496117_0130113 | |||
| 1699 | Ga0496118_0000238 | |||
| 1700 | Ga0496118_0005162 | |||
| 1701 | Ga0496118_0064235 | |||
| 1702 | Ga0496119_0007846 | |||
| 1703 | Ga0496120_0001781 | |||
| 1704 | Ga0496122_0000213 | |||
| 1705 | Ga0496123_0000177 | |||
| 1706 | Ga0496124_0000026 | |||
| 1707 | Ga0496124_0023697 | |||
| 1708 | Ga0496125_0000226 | |||
| 1709 | Ga0496126_0000632 | |||
| 1710 | Ga0501043_0064170 | |||
| 1711 | Ga0501035_0580560 | |||
| 1712 | nmdc:mga03683_56607_c1 | |||
| 1713 | nmdc:mga03683_7061_c1 | |||
| 1714 | nmdc:mga0yw44_178587_c1 | |||
| 1715 | nmdc:mga0k408_1110_c1 | |||
| 1716 | nmdc:mga0k408_1324_c1 | |||
| 1717 | nmdc:mga0k408_78543_c1 | |||
| 1718 | nmdc:mga06z11_3260_c1 | |||
| 1719 | nmdc:mga06z11_41344_c1 | |||
| 1720 | nmdc:mga04h51_2183_c1 | |||
| 1721 | nmdc:mga07m45_13675_c1 | |||
| 1722 | nmdc:mga07m45_139430_c1 | |||
| 1723 | nmdc:mga07m45_1430_c1 | |||
| 1724 | nmdc:mga07m45_144687_c1 | |||
| 1725 | nmdc:mga07m45_630_c1 | |||
| 1726 | nmdc:mga07m45_65058_c1 | |||
| 1727 | nmdc:mga07m45_7700_c1 | |||
| 1728 | nmdc:mga07m45_92398_c1 | |||
| 1729 | nmdc:mga08y16_645297_c1 | |||
| 1730 | nmdc:mga0rr50_315743_c1 | |||
| 1731 | nmdc:mga0rr50_84829_c1 | |||
| 1732 | Ga0495601_0000745 | |||
| 1733 | Ga0495612_0000694 | |||
| 1734 | Ga0495595_0000392 | |||
| 1735 | Ga0495619_0001107 | |||
| 1736 | Ga0495619_0044288 | |||
| 1737 | Ga0500578_0166327 | |||
| 1738 | Ga0500644_0002178 | |||
| 1739 | Ga0500651_0044723 | |||
| 1740 | Ga0500651_0055428 | |||
| 1741 | Ga0500555_066251 | |||
| 1742 | Ga0500593_001340 | |||
| 1743 | Ga0500594_0039051 | |||
| 1744 | Ga0500621_051100 | |||
| 1745 | Ga0500628_010101 | |||
| 1746 | Ga0500652_028153 | |||
| 1747 | Ga0500658_0012270 | |||
| 1748 | Ga0500559_0001509 | |||
| 1749 | Ga0500568_0023974 | |||
| 1750 | Ga0500568_0087137 | |||
| 1751 | Ga0500604_0023188 | |||
| 1752 | Ga0500616_0135097 | |||
| 1753 | Ga0500636_0094671 | |||
| 1754 | Ga0500645_001182 | |||
| 1755 | Ga0500645_004523 | |||
| 1756 | Ga0500645_009944 | |||
| 1757 | Ga0500661_008225 | |||
| 1758 | 2511244819 | |||
| 1759 | 2585826049 | |||
| 1760 | 2585831833 | |||
| 1761 | 2599410245 | |||
| 1762 | 2599904884 | |||
| 1763 | 2601523457 | |||
| 1764 | 2601528616 | |||
| 1765 | 2601615449 | |||
| 1766 | 2601619625 | |||
| 1767 | 2601643960 | |||
| 1768 | 2601648030 | |||
| 1769 | 2601653501 | |||
| 1770 | 2601658378 | |||
| 1771 | 2601663785 | |||
| 1772 | 2601696334 | |||
| 1773 | 2601701417 | |||
| 1774 | 2601706156 | |||
| 1775 | 2601711741 | |||
| 1776 | 2601716759 | |||
| 1777 | 2601721358 | |||
| 1778 | 2601727165 | |||
| 1779 | 2601731705 | |||
| 1780 | 2601736717 | |||
| 1781 | 2601740317 | |||
| 1782 | 2601751254 | |||
| 1783 | 2602018886 | |||
| 1784 | 2603661173 | |||
| 1785 | 2603666448 | |||
| 1786 | 2603839102 | |||
| 1787 | 2603843638 | |||
| 1788 | 2603849259 | |||
| 1789 | 2603854329 | |||
| 1790 | 2603865658 | |||
| 1791 | 2603872384 | |||
| 1792 | 2603877260 | |||
| 1793 | 2606049565 | |||
| 1794 | 2606070880 | |||
| 1795 | 2606147249 | |||
| 1796 | 2606176974 | |||
| 1797 | 2637223207 | |||
| 1798 | 2643860481 | |||
| 1799 | 2644245230 | |||
| 1800 | 2644305760 | |||
| 1801 | 2671109609 | |||
| 1802 | 2676408616 | |||
| 1803 | 2777019517 | |||
| 1804 | 2831866003 | |||
| 1805 | 2852106325 | |||
| 1806 | 2881930407 | |||
| 1807 | 2886851931 | |||
| 1808 | 2887377380 | |||
| 1809 | 2904478031 | |||
| 1810 | 2904517108 | |||
| 1811 | 2919154005 | |||
| 1812 | 2927147542 | |||
| 1813 | 2969080225 | |||
| 1814 | 2984562681 | |||
| 1815 | 2984600741 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1dxe-assembly1.cif.gz_A | 2-dehydro-3-deoxy-galactarate aldolase from escherichia coli | 0.9676 | 6 | 243 |
| 4b5w-assembly1.cif.gz_C | crystal structures of divalent metal dependent pyruvate aldolase r70a mutant, hpai, in complex with pyruvate | 0.9658 | 8 | 243 |
| 7v8t-assembly1.cif.gz_F | crystal structure of class ii pyruvate aldolase from pseudomonas aeruginosa. | 0.9606 | 8 | 241 |
| 7et9-assembly1.cif.gz_A | crystal structure of abhpai-zn-pyruvate complex, class ii aldolase, hpai from acinetobacter baumannii | 0.9584 | 10 | 241 |
| 2v5j-assembly1.cif.gz_B | apo class ii aldolase hpch | 0.9577 | 8 | 243 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1dxfA00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Phosphoenolpyruvate-binding domains | 0.9616 | 6 | 243 | 3.20.20.60 |
| af_P76469_1_267_3.20.20.60 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Phosphoenolpyruvate-binding domains | 0.9423 | 8 | 242 | 3.20.20.60 |
| 1dxfA00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Phosphoenolpyruvate-binding domains | 0.9385 | 6 | 243 | 3.20.20.60 |
| 4mf4F00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Phosphoenolpyruvate-binding domains | 0.936 | 8 | 239 | 3.20.20.60 |
| 6r62A00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Phosphoenolpyruvate-binding domains | 0.9149 | 8 | 243 | 3.20.20.60 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-C4AZ63-F1-model_v4 | deleted | 0.9747 | 8 | 126 |
|
| AF-C1DMY2-F1-model_v4 | 2,4-dihydroxyhept-2-ene-1,7-dioic acid aldolase | 0.9672 | 8 | 241 |
GO:0005737
GO:0016832 |
| AF-A0A315FTA1-F1-model_v4 | 4-hydroxy-2-oxo-heptane-1,7-dioate aldolase | 0.965 | 8 | 240 |
GO:0005737
GO:0016832 |
| AF-A0A5S9N7C9-F1-model_v4 | 5-keto-4-deoxy-D-glucarate aldolase (EC 4.1.2.20) | 0.9649 | 8 | 243 |
GO:0005737
GO:0008672 |
| AF-A0A420WW90-F1-model_v4 | 2,4-dihydroxyhept-2-enedioate aldolase | 0.9647 | 8 | 243 |
GO:0005737
GO:0016832 |