F485348

General Info

Members Datasets Scaffolds Average Seq Length
907 449 1815 258

Family's Representative Sequence

Representative Sequence 3300005355|Ga0070671_100008975|Ga0070671_1000089756
Length 278
Sequence MNESVRIDSDHTMTTPTTTPAEPYCAFPNSFKRRLIAHEPLIGCWCSLANPITTEVLGVAGFDWILLDGEHSPNDVISFIPQLMALKDSVSAPIVRPSWNNPVELKRLLDGGFYNFLIPFIESADEAARAVAATRYPPQGFRGVSVSQRSNKFGSVKDYFTGINDQICVMVQIESRKGVAAAAEIAKVDGIDGIFVGPSDLAAGFGHLGNASHPEVQAAMAEVIAAAKAAGKPIGILAPVEADARRYMAQGVTFVAVGSDLGVFRSGTQALRDRYLAA

Samples

Sample ID Description Type Environment
1 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
4 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
5 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
6 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
7 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
8 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
9 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
10 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
11 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
12 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
13 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
14 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
15 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
16 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
17 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
18 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
19 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
20 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
21 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
22 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
23 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
24 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
25 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
26 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
27 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
28 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
29 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
30 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
31 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
32 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
33 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
34 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
35 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
36 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
37 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
38 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
39 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
40 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
41 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
42 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
43 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
44 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
45 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
46 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
47 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
48 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
49 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
50 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
51 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
52 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
53 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
54 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
55 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
56 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
57 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
58 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
59 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
60 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
61 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
62 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
63 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
64 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
65 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
66 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
67 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
68 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
69 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
70 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
71 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
72 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
73 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
74 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
75 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
76 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
77 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
78 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
79 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
80 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
81 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
82 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
83 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
84 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
85 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
86 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
87 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
88 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
89 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
90 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
91 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
92 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
93 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
94 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
95 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
96 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
97 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
98 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
99 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
100 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
101 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
102 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
103 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
104 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
105 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
106 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
107 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
108 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
109 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
110 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
111 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
112 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
113 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
114 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
115 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
116 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
117 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
118 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
119 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
120 3300012497 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 Metagenome Rhizosphere
121 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
122 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
123 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
124 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
125 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
126 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
127 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
128 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
129 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
130 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
131 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
132 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
133 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
134 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
135 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
136 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
137 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
138 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
139 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
140 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
141 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
142 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
143 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
144 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
145 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
146 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
147 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
148 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
149 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
150 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
151 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
152 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
153 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
154 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
155 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
156 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
157 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
158 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
159 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
160 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
161 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
162 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
212 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
213 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
214 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
215 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
216 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
217 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
219 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
220 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
221 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
222 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
223 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
224 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
225 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
226 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
227 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
228 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
229 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
230 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
231 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
232 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
233 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
234 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
235 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
236 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
237 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
238 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
239 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
240 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
241 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
242 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
243 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
244 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
245 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
246 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
247 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
248 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
249 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
250 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
251 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
252 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
253 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
254 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
255 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
256 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
257 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
258 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
259 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
260 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
261 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
262 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
263 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
264 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
265 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
266 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
267 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
268 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
269 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
270 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
271 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
272 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
273 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
274 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
275 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
276 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
277 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
278 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
279 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
280 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
281 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
282 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
283 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
284 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
285 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
286 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
287 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
288 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
289 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
290 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
291 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
292 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
293 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
294 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
295 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
296 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
297 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
298 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
299 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
300 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
301 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
302 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
303 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
304 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
305 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
306 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
307 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
308 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
309 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
310 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
311 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
312 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
313 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
314 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
315 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
316 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
317 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
318 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
319 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
320 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
321 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
322 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
323 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
324 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
325 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
326 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
327 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
328 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
329 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
330 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
331 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
332 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
333 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
334 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
335 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
336 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
337 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
338 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
339 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
340 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
341 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
342 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
343 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
344 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
345 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
346 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
347 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
348 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
349 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
350 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
351 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
352 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
353 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
354 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
355 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
356 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
357 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
358 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
359 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
360 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
361 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
362 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
363 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
364 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
365 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
366 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
367 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
368 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
369 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
370 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
371 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
372 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
373 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
374 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
375 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
376 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
377 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
378 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
379 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
380 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
381 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
382 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
383 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
384 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
385 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
386 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
387 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
388 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
389 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
390 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
391 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
392 2511231002 Polaromonas sp. CF318 Isolate Rhizosphere
393 2585427591 Rahnella aquatilis OV744 Isolate Rhizosphere
394 2585427592 Rahnella aquatilis OV588 Isolate Rhizosphere
395 2599185169 Klebsiella quasipneumoniae NFPP35 Isolate Rhizoplane
396 2599185292 Achromobacter sp. NFACC18-2 Isolate Rhizoplane
397 2600255254 Klebsiella quasipneumoniae NFIX15 Isolate Rhizoplane
398 2600255255 Klebsiella quasipneumoniae NFIX23 Isolate Rhizoplane
399 2600255280 Klebsiella quasipneumoniae NFIX42 Isolate Rhizoplane
400 2600255281 Klebsiella quasipneumoniae NFIX43 Isolate Rhizoplane
401 2600255287 Klebsiella quasipneumoniae NFIX11 Isolate Rhizoplane
402 2600255288 Klebsiella quasipneumoniae NFIX14 Isolate Rhizoplane
403 2600255289 Klebsiella quasipneumoniae NFIX16 Isolate Rhizoplane
404 2600255290 Klebsiella quasipneumoniae NFIX17 Isolate Rhizoplane
405 2600255291 Klebsiella quasipneumoniae NFIX19 Isolate Rhizoplane
406 2600255298 Klebsiella quasipneumoniae NFIX21 Isolate Rhizoplane
407 2600255299 Klebsiella quasipneumoniae NFIX22 Isolate Rhizoplane
408 2600255300 Klebsiella quasipneumoniae NFIX30 Isolate Rhizoplane
409 2600255301 Klebsiella quasipneumoniae NFIX33 Isolate Rhizoplane
410 2600255302 Klebsiella quasipneumoniae NFIX35 Isolate Rhizoplane
411 2600255303 Klebsiella quasipneumoniae NFIX36 Isolate Rhizoplane
412 2600255304 Klebsiella quasipneumoniae NFIX37 Isolate Rhizoplane
413 2600255305 Klebsiella quasipneumoniae NFIX41 Isolate Rhizoplane
414 2600255306 Klebsiella quasipneumoniae NFIX44 Isolate Rhizoplane
415 2600255307 Klebsiella quasipneumoniae NFIX56 Isolate Rhizoplane
416 2600255309 Klebsiella sp. NFIX53 Isolate Rhizoplane
417 2600255392 Klebsiella quasipneumoniae NFIX54 Isolate Rhizoplane
418 2602042052 Klebsiella quasipneumoniae NFIX18 Isolate Rhizoplane
419 2602042053 Klebsiella quasipneumoniae NFIX12 Isolate Rhizoplane
420 2602042103 Klebsiella quasipneumoniae NFIX29 Isolate Rhizoplane
421 2602042104 Klebsiella quasipneumoniae NFIX26 Isolate Rhizoplane
422 2602042105 Klebsiella quasipneumoniae NFIX25 Isolate Rhizoplane
423 2602042106 Klebsiella quasipneumoniae NFIX13 Isolate Rhizoplane
424 2602042109 Klebsiella aerogenes NFIX39 Isolate Rhizoplane
425 2602042110 Klebsiella quasipneumoniae NFIX40 Isolate Rhizoplane
426 2602042111 Klebsiella quasipneumoniae NFIX20 Isolate Rhizoplane
427 2603880178 Klebsiella quasipneumoniae NFIX34 Isolate Rhizoplane
428 2603880184 Klebsiella quasipneumoniae NFIX27 Isolate Rhizoplane
429 2603880202 Klebsiella quasipneumoniae NFIX38 Isolate Rhizoplane
430 2603880211 Klebsiella quasipneumoniae NFIX24 Isolate Rhizoplane
431 2636415599 Klebsiella variicola DX120E Isolate Unclassified
432 2643221569 Achromobacter sp. Root565 Isolate Unclassified
433 2643221644 Rhizobacter sp. Root1221 Isolate Unclassified
434 2643221654 Rhizobacter sp. Root404 Isolate Unclassified
435 2667528173 Rahnella sp. NFIX50 Isolate Rhizoplane
436 2675903046 Klebsiella quasipneumoniae NFIX52 Isolate Rhizoplane
437 2775507074 Klebsiella sp. D5A Isolate Unclassified
438 2831864461 Roseateles noduli HZ7 Isolate Nodule
439 2852103415 Edaphovirga cremea DSM 105170 Isolate Rhizosphere
440 2881927736 Candidimonas sp. SYP-B2681 Isolate Rhizosphere
441 2886848708 Mitsuaria sp. TWR114 Isolate Rhizosphere
442 2887375801 Parapusillimonas sp. SGNA-6 Isolate Rhizosphere
443 2904474040 Rahnella aquatilis 4485 Isolate Rhizosphere
444 2904513164 Klebsiella variicola 1431 Isolate Rhizosphere
445 2919150387 Rahnella aceris 1817 Isolate Unclassified
446 2927143783 Rahnella sp. 2050 Isolate Unclassified
447 2969079654 Klebsiella variicola E57-7 Isolate Unclassified
448 2984559226 Klebsiella variicola SORGH_AS834 Isolate Aerial Root
449 2984595703 Klebsiella variicola SORGH_AS1070 Isolate Aerial Root

Type Distribution

Type Percentage (%)
Metagenomes 93.61
Metatranscriptomes 0
Isolates 6.39

Biome Distribution

Category Percentage (%)
Aerial Root 0.22
Bulb 0
Endosphere 16.76
Nodule 0.77
Rhizoplane 7.61
Rhizosphere 67.48
Stem 0
Stem Tuber 0
Unclassified 0.33

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070671_100008975 3300005355 Bacteria 8023
2 SwRhRL2b_contig_2942750 2162886007 Bacteria 6398
3 JGI24034J26672_10007511 3300002239 Bacteria 1583
4 JGI25155J39150_1000123 3300002704 Bacteria 37730
5 JGI25156J39149_1000052 3300002705 Bacteria 89046
6 JGI25162J39368_1000029 3300002737 Bacteria 220066
7 JGI25154J39366_1000081 3300002738 Bacteria 89046
8 JGI25157J39369_1000006 3300002741 Bacteria 226861
9 JGI25163J39215_1000037 3300002771 Bacteria 61773
10 JGI25164J39214_1000008 3300002772 Bacteria 311285
11 JGI25159J45721_1000667 3300002987 Bacteria 15168
12 JGI25159J45721_1001832 3300002987 Bacteria 8506
13 JGI25151J46595_10021834 3300003187 Bacteria 2670
14 JGI25151J46595_10022048 3300003187 Bacteria 2651
15 rootH2_10034882 3300003320 Bacteria 1644
16 rootL2_10000270 3300003322 Bacteria 83376
17 rootL2_10066204 3300003322 Bacteria 1233
18 rootH1_10010855 3300003316 Bacteria 76739
19 rootH1_10010855 3300003323 Bacteria 16450
20 rootH1_10090419 3300003323 Bacteria 2447
21 JGI25160J50197_1000071 3300003354 Bacteria 108301
22 JGI25161J50226_1000030 3300003374 Bacteria 142870
23 Ga0055538_1000014 3300003751 Bacteria 311285
24 Ga0055539_1000020 3300003752 Bacteria 311285
25 Ga0055533_1000027 3300003756 Bacteria 311285
26 Ga0055525_1000032 3300003759 Bacteria 311285
27 Ga0055526_1000165 3300003771 Bacteria 58505
28 Ga0055526_1004597 3300003771 Bacteria 8231
29 Ga0055526_1004630 3300003771 Bacteria 8194
30 Ga0055526_1005641 3300003771 Bacteria 7122
31 Ga0055526_1031764 3300003771 Bacteria 1505
32 Ga0055537_1000689 3300003773 Bacteria 17610
33 Ga0055524_1000006 3300003775 Bacteria 324702
34 Ga0055524_1000033 3300003775 Bacteria 180833
35 Ga0055524_1000459 3300003775 Bacteria 33313
36 Ga0055524_1000535 3300003775 Bacteria 28905
37 Ga0055536_1002314 3300003781 Bacteria 10788
38 Ga0055534_1000905 3300003784 Bacteria 13364
39 Ga0055528_1000432 3300003790 Bacteria 33611
40 Ga0055530_10001786 3300003791 Bacteria 14953
41 Ga0055530_10002584 3300003791 Bacteria 11480
42 Ga0055540_1000005 3300003792 Bacteria 378126
43 Ga0055540_1000007 3300003792 Bacteria 318178
44 Ga0055540_1045874 3300003792 Bacteria 921
45 Ga0055531_10001534 3300003794 Bacteria 16915
46 Ga0055531_10001878 3300003794 Bacteria 14723
47 Ga0055531_10002603 3300003794 Bacteria 11953
48 Ga0055531_10004316 3300003794 Bacteria 8709
49 Ga0055541_1000014 3300003841 Bacteria 311285
50 JGI25405J52794_10000287 3300003911 Bacteria 6886
51 Ga0055543_1000162 3300004625 Bacteria 55480
52 Ga0055543_1005134 3300004625 Bacteria 3401
53 Ga0055543_1010893 3300004625 Bacteria 1886
54 Ga0065165_1000248 3300005262 Bacteria 93216
55 Ga0065165_1000457 3300005262 Bacteria 63927
56 Ga0065165_1014815 3300005262 Bacteria 3006
57 Ga0065165_1014830 3300005262 Bacteria 3004
58 Ga0065704_10000430 3300005289 Bacteria 53955
59 Ga0065715_10015471 3300005293 Bacteria 1998
60 Ga0065715_10154527 3300005293 Bacteria 1692
61 Ga0070658_10056756 3300005327 Bacteria 3183
62 Ga0070658_10068527 3300005327 Bacteria 2901
63 Ga0070658_10626740 3300005327 Bacteria 933
64 Ga0070676_10006055 3300005328 Bacteria 6456
65 Ga0070676_10023546 3300005328 Bacteria 3462
66 Ga0070676_10064971 3300005328 Bacteria 2177
67 Ga0070676_10334443 3300005328 Bacteria 1037
68 Ga0070683_100006244 3300005329 Bacteria 9995
69 Ga0070683_100122375 3300005329 Bacteria 2458
70 Ga0070683_100406453 3300005329 Bacteria 1299
71 Ga0070670_100003877 3300005331 Bacteria 12476
72 Ga0070670_100006300 3300005331 Bacteria 10047
73 Ga0070670_100064726 3300005331 Bacteria 3137
74 Ga0070670_100078154 3300005331 Bacteria 2842
75 Ga0070670_100318387 3300005331 Bacteria 1362
76 Ga0070677_10005147 3300005333 Bacteria 4298
77 Ga0070677_10041929 3300005333 Bacteria 1809
78 Ga0070677_10084456 3300005333 Bacteria 1367
79 Ga0068869_100004685 3300005334 Bacteria 8537
80 Ga0068869_100008711 3300005334 Bacteria 6551
81 Ga0068869_100165058 3300005334 Bacteria 1726
82 Ga0070666_10183457 3300005335 Bacteria 1468
83 Ga0070680_100015257 3300005336 Bacteria 6020
84 Ga0068868_100000930 3300005338 Bacteria 19942
85 Ga0068868_100004465 3300005338 Bacteria 9815
86 Ga0068868_100075354 3300005338 Bacteria 2696
87 Ga0070660_100027188 3300005339 Bacteria 4267
88 Ga0070660_100236026 3300005339 Bacteria 1488
89 Ga0070660_100248610 3300005339 Bacteria 1450
90 Ga0070660_100263554 3300005339 Bacteria 1407
91 Ga0070660_100619034 3300005339 Bacteria 906
92 Ga0070689_100501588 3300005340 Bacteria 1040
93 Ga0070687_100009172 3300005343 Bacteria 4228
94 Ga0070661_100000421 3300005344 Bacteria 32488
95 Ga0070661_100025029 3300005344 Bacteria 4286
96 Ga0070661_100147589 3300005344 Bacteria 1776
97 Ga0070661_100448340 3300005344 Bacteria 1026
98 Ga0070668_100279053 3300005347 Bacteria 1395
99 Ga0070669_100006777 3300005353 Bacteria 8243
100 Ga0070669_100230169 3300005353 Bacteria 1469
101 Ga0070669_100347952 3300005353 Bacteria 1202
102 Ga0070669_100398041 3300005353 Bacteria 1126
103 Ga0070675_100000926 3300005354 Bacteria 20887
104 Ga0070675_100023645 3300005354 Bacteria 4915
105 Ga0070675_100033735 3300005354 Bacteria 4151
106 Ga0070675_100052584 3300005354 Bacteria 3349
107 Ga0070675_100129602 3300005354 Bacteria 2148
108 Ga0070675_100138103 3300005354 Bacteria 2081
109 Ga0070671_100006545 3300005355 Bacteria 9314
110 Ga0070671_100006549 3300005355 Bacteria 9310
111 Ga0070671_100115583 3300005355 Bacteria 2256
112 Ga0070671_100269640 3300005355 Bacteria 1447
113 Ga0070671_100309010 3300005355 Bacteria 1346
114 Ga0070671_100528168 3300005355 Bacteria 1016
115 Ga0070674_100003100 3300005356 Bacteria 9251
116 Ga0070674_100107885 3300005356 Bacteria 2039
117 Ga0070673_100002705 3300005364 Bacteria 10866
118 Ga0070673_100010900 3300005364 Bacteria 6179
119 Ga0070673_100049438 3300005364 Bacteria 3283
120 Ga0070673_100080581 3300005364 Bacteria 2638
121 Ga0070673_100106065 3300005364 Bacteria 2322
122 Ga0070673_100195048 3300005364 Bacteria 1741
123 Ga0070673_100442914 3300005364 Bacteria 1167
124 Ga0070688_100052577 3300005365 Bacteria 2545
125 Ga0070659_100001131 3300005366 Bacteria 19448
126 Ga0070659_100015214 3300005366 Bacteria 5758
127 Ga0070659_100069504 3300005366 Bacteria 2795
128 Ga0070659_100315241 3300005366 Bacteria 1306
129 Ga0070659_100350263 3300005366 Bacteria 1239
130 Ga0070667_100028982 3300005367 Bacteria 4610
131 Ga0070667_100046762 3300005367 Bacteria 3641
132 Ga0070667_100049020 3300005367 Bacteria 3556
133 Ga0070667_100050041 3300005367 Bacteria 3520
134 Ga0070667_100075499 3300005367 Bacteria 2878
135 Ga0070667_100106923 3300005367 Bacteria 2422
136 Ga0070667_100202999 3300005367 Bacteria 1759
137 Ga0070667_100261822 3300005367 Bacteria 1549
138 Ga0070714_100003484 3300005435 Bacteria 11747
139 Ga0070710_10045240 3300005437 Bacteria 2446
140 Ga0070711_100328282 3300005439 Bacteria 1224
141 Ga0070700_100040386 3300005441 Bacteria 2855
142 Ga0070663_100135643 3300005455 Bacteria 1873
143 Ga0070663_100171450 3300005455 Bacteria 1678
144 Ga0070663_100178439 3300005455 Bacteria 1646
145 Ga0070663_100480344 3300005455 Bacteria 1029
146 Ga0070678_100012306 3300005456 Bacteria 5313
147 Ga0070678_100069389 3300005456 Bacteria 2632
148 Ga0070678_100344094 3300005456 Bacteria 1280
149 Ga0070678_100353293 3300005456 Bacteria 1264
150 Ga0070678_100534928 3300005456 Bacteria 1038
151 Ga0070678_100566858 3300005456 Bacteria 1010
152 Ga0070662_100001118 3300005457 Bacteria 16376
153 Ga0070662_100062411 3300005457 Bacteria 2723
154 Ga0070662_100150276 3300005457 Bacteria 1812
155 Ga0070662_100317556 3300005457 Bacteria 1269
156 Ga0070681_10163217 3300005458 Bacteria 2152
157 Ga0068867_100004608 3300005459 Bacteria 9701
158 Ga0068867_100007763 3300005459 Bacteria 7585
159 Ga0068867_100037531 3300005459 Bacteria 3522
160 Ga0068867_100137285 3300005459 Bacteria 1908
161 Ga0070685_10026991 3300005466 Bacteria 3170
162 Ga0070685_10038031 3300005466 Bacteria 2728
163 Ga0070706_100002704 3300005467 Bacteria 17739
164 Ga0070699_100329360 3300005518 Unclassified 1373
165 Ga0070679_100133211 3300005530 Bacteria 2466
166 Ga0070684_100004660 3300005535 Bacteria 10467
167 Ga0070684_100112888 3300005535 Bacteria 2438
168 Ga0070684_100260750 3300005535 Bacteria 1585
169 Ga0070684_100402283 3300005535 Bacteria 1262
170 Ga0068853_100008854 3300005539 Bacteria 8098
171 Ga0068853_100079991 3300005539 Bacteria 2859
172 Ga0068853_100121432 3300005539 Bacteria 2331
173 Ga0068853_100289949 3300005539 Bacteria 1511
174 Ga0070672_100004999 3300005543 Bacteria 8736
175 Ga0070672_100082916 3300005543 Bacteria 2573
176 Ga0070672_100196755 3300005543 Bacteria 1684
177 Ga0070686_100010080 3300005544 Bacteria 5317
178 Ga0070695_100066338 3300005545 Bacteria 2352
179 Ga0070665_100195344 3300005548 Bacteria 2024
180 Ga0070665_100290114 3300005548 Bacteria 1638
181 Ga0070665_100551833 3300005548 Bacteria 1164
182 Ga0070664_100001426 3300005564 Bacteria 19072
183 Ga0070664_100032656 3300005564 Bacteria 4354
184 Ga0070664_100043662 3300005564 Bacteria 3783
185 Ga0070664_100080697 3300005564 Bacteria 2802
186 Ga0070664_100283693 3300005564 Bacteria 1494
187 Ga0070664_100318624 3300005564 Bacteria 1408
188 Ga0068857_100005334 3300005577 Bacteria 10951
189 Ga0068857_100056463 3300005577 Bacteria 3484
190 Ga0068857_100066636 3300005577 Bacteria 3204
191 Ga0068854_100023715 3300005578 Bacteria 4193
192 Ga0068854_100031730 3300005578 Bacteria 3672
193 Ga0068854_100109567 3300005578 Bacteria 2081
194 Ga0068854_100359268 3300005578 Bacteria 1194
195 Ga0068854_100570405 3300005578 Bacteria 962
196 Ga0068856_100008227 3300005614 Bacteria 10167
197 Ga0068852_100011321 3300005616 Bacteria 6711
198 Ga0068852_100030483 3300005616 Bacteria 4440
199 Ga0068852_100031117 3300005616 Bacteria 4399
200 Ga0068852_100038260 3300005616 Bacteria 4030
201 Ga0068852_100090150 3300005616 Bacteria 2742
202 Ga0068852_100129524 3300005616 Bacteria 2322
203 Ga0068852_100243046 3300005616 Bacteria 1721
204 Ga0068852_100262259 3300005616 Bacteria 1659
205 Ga0068859_100100470 3300005617 Bacteria 2948
206 Ga0068859_100413048 3300005617 Bacteria 1446
207 Ga0068864_100001420 3300005618 Bacteria 19796
208 Ga0068864_100005635 3300005618 Bacteria 10265
209 Ga0068864_100018785 3300005618 Bacteria 5778
210 Ga0068864_100049209 3300005618 Bacteria 3626
211 Ga0068864_100051910 3300005618 Bacteria 3534
212 Ga0068866_10033691 3300005718 Bacteria 2487
213 Ga0068861_100006180 3300005719 Bacteria 8149
214 Ga0068861_100018413 3300005719 Bacteria 4976
215 Ga0068861_100050276 3300005719 Bacteria 3160
216 Ga0068851_10007383 3300005834 Bacteria 5045
217 Ga0068851_10015841 3300005834 Bacteria 3599
218 Ga0068870_10050666 3300005840 Bacteria 2195
219 Ga0068870_10288925 3300005840 Bacteria 1031
220 Ga0068863_100031141 3300005841 Bacteria 5093
221 Ga0068863_100077677 3300005841 Bacteria 3142
222 Ga0068863_100085537 3300005841 Bacteria 2988
223 Ga0068863_100200095 3300005841 Bacteria 1921
224 Ga0068863_100442513 3300005841 Bacteria 1275
225 Ga0068858_100001292 3300005842 Bacteria 25859
226 Ga0068858_100103295 3300005842 Bacteria 2658
227 Ga0068860_100076886 3300005843 Bacteria 3174
228 Ga0068862_100114461 3300005844 Bacteria 2371
229 Ga0081455_10001479 3300005937 Bacteria 29079
230 Ga0075364_10071666 3300006051 Bacteria 2283
231 Ga0075364_10241316 3300006051 Bacteria 1227
232 Ga0075432_10042041 3300006058 Bacteria 1598
233 Ga0075362_10040059 3300006177 Bacteria 2061
234 Ga0075367_10013603 3300006178 Bacteria 4380
235 Ga0075367_10053393 3300006178 Bacteria 2394
236 Ga0075367_10086550 3300006178 Bacteria 1902
237 Ga0075366_10003855 3300006195 Bacteria 7988
238 Ga0075366_10072018 3300006195 Bacteria 2059
239 Ga0097621_100004797 3300006237 Bacteria 9464
240 Ga0097621_100010187 3300006237 Bacteria 6863
241 Ga0097621_100047062 3300006237 Bacteria 3493
242 Ga0097621_100114312 3300006237 Bacteria 2283
243 Ga0097621_100127976 3300006237 Bacteria 2158
244 Ga0097621_100459828 3300006237 Bacteria 1148
245 Ga0075370_10000414 3300006353 Bacteria 15762
246 Ga0075370_10002136 3300006353 Bacteria 9035
247 Ga0075370_10003303 3300006353 Bacteria 7653
248 Ga0075370_10013634 3300006353 Bacteria 4326
249 Ga0075370_10058441 3300006353 Bacteria 2193
250 Ga0068871_100008334 3300006358 Bacteria 7452
251 Ga0068871_100037449 3300006358 Bacteria 3868
252 Ga0068871_100163445 3300006358 Bacteria 1905
253 Ga0068865_100018910 3300006881 Bacteria 4452
254 Ga0068865_100036499 3300006881 Bacteria 3314
255 Ga0068865_100359016 3300006881 Bacteria 1182
256 Ga0097620_100100481 3300006931 Bacteria 2948
257 Ga0097620_100413090 3300006931 Bacteria 1446
258 Ga0099823_1000049 3300006944 Bacteria 58213
259 Ga0079104_1000009 3300006946 Bacteria 367015
260 Ga0079104_1009160 3300006946 Bacteria 3377
261 Ga0105244_10002360 3300009036 Bacteria 14334
262 Ga0105250_10000818 3300009092 Bacteria 18529
263 Ga0105240_10020343 3300009093 Bacteria 8857
264 Ga0105240_10106425 3300009093 Bacteria 3402
265 Ga0105240_10635941 3300009093 Bacteria 1171
266 Ga0111539_10042281 3300009094 Bacteria 5475
267 Ga0105245_10031804 3300009098 Bacteria 4672
268 Ga0105245_10032610 3300009098 Bacteria 4611
269 Ga0105245_10336331 3300009098 Bacteria 1492
270 Ga0105245_10377138 3300009098 Bacteria 1412
271 Ga0105247_10114825 3300009101 Bacteria 1737
272 Ga0105247_10190353 3300009101 Bacteria 1373
273 Ga0105247_10507529 3300009101 Bacteria 880
274 Ga0114129_10002772 3300009147 Bacteria 24406
275 Ga0105243_10169335 3300009148 Bacteria 1890
276 Ga0105241_10090970 3300009174 Bacteria 2407
277 Ga0105241_10091854 3300009174 Bacteria 2396
278 Ga0105241_10392820 3300009174 Bacteria 1215
279 Ga0105241_10562218 3300009174 Bacteria 1025
280 Ga0105248_10038301 3300009177 Bacteria 5365
281 Ga0105248_10147480 3300009177 Bacteria 2655
282 Ga0105248_10583002 3300009177 Bacteria 1262
283 Ga0105237_10074652 3300009545 Bacteria 3383
284 Ga0105237_10092510 3300009545 Bacteria 3013
285 Ga0105237_10455002 3300009545 Bacteria 1286
286 Ga0105237_10612628 3300009545 Bacteria 1096
287 Ga0105238_10016359 3300009551 Bacteria 7507
288 Ga0105238_10054522 3300009551 Bacteria 4015
289 Ga0105249_10054314 3300009553 Bacteria 3663
290 Ga0105249_10075802 3300009553 Bacteria 3115
291 Ga0105249_10274650 3300009553 Bacteria 1680
292 Ga0105239_10015037 3300010375 Bacteria 8580
293 Ga0105239_10030363 3300010375 Bacteria 5942
294 Ga0105239_10211136 3300010375 Bacteria 2176
295 Ga0105246_10088951 3300011119 Bacteria 2220
296 Ga0157319_1000003 3300012497 Bacteria 397199
297 Ga0157371_10000067 3300013102 Bacteria 168242
298 Ga0157371_10019163 3300013102 Bacteria 5050
299 Ga0157371_10263183 3300013102 Bacteria 1243
300 Ga0157369_10525144 3300013105 Bacteria 1224
301 Ga0157374_10041624 3300013296 Bacteria 4235
302 Ga0157374_10068630 3300013296 Bacteria 3336
303 Ga0157374_10135152 3300013296 Bacteria 2390
304 Ga0157374_10158942 3300013296 Bacteria 2201
305 Ga0157374_10219075 3300013296 Bacteria 1867
306 Ga0157374_10480593 3300013296 Bacteria 1246
307 Ga0157378_10056311 3300013297 Bacteria 3503
308 Ga0157378_10280982 3300013297 Bacteria 1604
309 Ga0157378_10414925 3300013297 Bacteria 1329
310 Ga0163162_10031762 3300013306 Bacteria 5239
311 Ga0163162_10241428 3300013306 Bacteria 1938
312 Ga0163162_10302369 3300013306 Bacteria 1732
313 Ga0163162_10585641 3300013306 Bacteria 1242
314 Ga0157372_10006296 3300013307 Bacteria 12620
315 Ga0157372_10294769 3300013307 Bacteria 1886
316 Ga0157375_10020576 3300013308 Bacteria 6031
317 Ga0157375_10065317 3300013308 Bacteria 3627
318 Ga0157375_10159014 3300013308 Bacteria 2400
319 Ga0157375_10161133 3300013308 Bacteria 2385
320 Ga0157375_10173806 3300013308 Bacteria 2303
321 Ga0163163_10002538 3300014325 Bacteria 15454
322 Ga0182008_10165321 3300014497 Bacteria 1115
323 Ga0157377_10002927 3300014745 Bacteria 7632
324 Ga0157379_10007434 3300014968 Bacteria 9481
325 Ga0157379_10015457 3300014968 Bacteria 6698
326 Ga0157379_10039615 3300014968 Bacteria 4204
327 Ga0157376_10014590 3300014969 Bacteria 5903
328 Ga0157376_10024312 3300014969 Bacteria 4753
329 Ga0157376_10296245 3300014969 Bacteria 1529
330 Ga0163161_10004707 3300017792 Bacteria 9491
331 Ga0163161_10053829 3300017792 Bacteria 2919
332 Ga0209435_100001 3300025206 Bacteria 1424171
333 Ga0209760_100256 3300025207 Bacteria 21361
334 Ga0209436_105701 3300025208 Bacteria 2821
335 Ga0209784_100030 3300025224 Bacteria 327457
336 Ga0209566_100034 3300025225 Bacteria 327457
337 Ga0209674_100052 3300025226 Bacteria 327457
338 Ga0209563_100054 3300025230 Bacteria 327457
339 Ga0207427_100035 3300025231 Bacteria 311526
340 Ga0209437_100068 3300025233 Bacteria 311526
341 Ga0207425_1003404 3300025245 Bacteria 5105
342 Ga0209646_1000001 3300025246 Bacteria 3092932
343 Ga0209026_1000003 3300025250 Bacteria 1060571
344 Ga0209677_100032 3300025253 Bacteria 327457
345 Ga0209759_1000001 3300025256 Bacteria 2799452
346 Ga0209233_1001319 3300025261 Bacteria 9905
347 Ga0209565_1000124 3300025263 Bacteria 110789
348 Ga0209673_1000043 3300025273 Bacteria 291503
349 Ga0209673_1010760 3300025273 Bacteria 3830
350 Ga0209673_1015800 3300025273 Bacteria 2849
351 Ga0209673_1017436 3300025273 Bacteria 2647
352 Ga0209130_1000060 3300025284 Bacteria 201501
353 Ga0209130_1000114 3300025284 Bacteria 130381
354 Ga0209675_1000269 3300025291 Bacteria 49713
355 Ga0209675_1002791 3300025291 Bacteria 8712
356 Ga0209675_1023335 3300025291 Bacteria 1604
357 Ga0209676_1000007 3300025292 Bacteria 1029371
358 Ga0209676_1004596 3300025292 Bacteria 7619
359 Ga0209676_1006553 3300025292 Bacteria 5714
360 Ga0209025_1000822 3300025294 Bacteria 49588
361 Ga0209025_1002740 3300025294 Bacteria 17842
362 Ga0209025_1004701 3300025294 Bacteria 11654
363 Ga0209025_1005559 3300025294 Bacteria 10214
364 Ga0209564_1000019 3300025295 Bacteria 573686
365 Ga0209564_1000051 3300025295 Bacteria 357748
366 Ga0209564_1000268 3300025295 Bacteria 109101
367 Ga0209564_1002616 3300025295 Bacteria 13766
368 Ga0209564_1007637 3300025295 Bacteria 5531
369 Ga0209758_1049975 3300025297 Bacteria 1471
370 Ga0209758_1059472 3300025297 Bacteria 1271
371 Ga0209050_1000003 3300025298 Bacteria 1609245
372 Ga0209050_1000243 3300025298 Bacteria 117715
373 Ga0209050_1002122 3300025298 Bacteria 18066
374 Ga0209050_1002216 3300025298 Bacteria 17437
375 Ga0209050_1002982 3300025298 Bacteria 13188
376 Ga0209050_1005795 3300025298 Bacteria 7597
377 Ga0209256_1000001 3300025299 Bacteria 2166974
378 Ga0209256_1000019 3300025299 Bacteria 558627
379 Ga0209256_1000242 3300025299 Bacteria 96789
380 Ga0209256_1000512 3300025299 Bacteria 56957
381 Ga0207426_1000308 3300025302 Bacteria 96061
382 Ga0207426_1002574 3300025302 Bacteria 11305
383 Ga0209051_1000003 3300025303 Bacteria 1609245
384 Ga0209051_1000004 3300025303 Bacteria 1155596
385 Ga0209051_1000577 3300025303 Bacteria 44159
386 Ga0209051_1009165 3300025303 Bacteria 5133
387 Ga0209257_1000020 3300025304 Bacteria 773356
388 Ga0209257_1000038 3300025304 Bacteria 609032
389 Ga0209257_1000044 3300025304 Bacteria 486709
390 Ga0209257_1003863 3300025304 Bacteria 12246
391 Ga0209257_1004264 3300025304 Bacteria 11282
392 Ga0209257_1005946 3300025304 Bacteria 8197
393 Ga0209257_1013536 3300025304 Bacteria 3613
394 Ga0207697_10002323 3300025315 Bacteria 9905
395 Ga0207697_10040005 3300025315 Bacteria 1924
396 Ga0207656_10038928 3300025321 Bacteria 2008
397 Ga0207656_10081504 3300025321 Bacteria 1455
398 Ga0207656_10092387 3300025321 Bacteria 1375
399 Ga0207696_1000173 3300025711 Bacteria 102240
400 Ga0207655_1000198 3300025728 Bacteria 106261
401 Ga0207682_10000706 3300025893 Bacteria 15485
402 Ga0207682_10002760 3300025893 Bacteria 7780
403 Ga0207682_10003004 3300025893 Bacteria 7400
404 Ga0207682_10109217 3300025893 Bacteria 1216
405 Ga0207692_10042920 3300025898 Bacteria 2247
406 Ga0207688_10019000 3300025901 Bacteria 3739
407 Ga0207680_10022089 3300025903 Bacteria 3455
408 Ga0207647_10066050 3300025904 Bacteria 2194
409 Ga0207699_10015220 3300025906 Bacteria 3991
410 Ga0207645_10002087 3300025907 Bacteria 15984
411 Ga0207645_10008182 3300025907 Bacteria 7324
412 Ga0207645_10008366 3300025907 Bacteria 7220
413 Ga0207645_10081673 3300025907 Bacteria 2072
414 Ga0207645_10247954 3300025907 Bacteria 1178
415 Ga0207645_10294339 3300025907 Bacteria 1080
416 Ga0207643_10010973 3300025908 Bacteria 4887
417 Ga0207643_10020852 3300025908 Bacteria 3597
418 Ga0207643_10024104 3300025908 Bacteria 3358
419 Ga0207643_10332143 3300025908 Bacteria 951
420 Ga0207705_10175602 3300025909 Bacteria 1614
421 Ga0207705_10289179 3300025909 Bacteria 1255
422 Ga0207684_10006839 3300025910 Bacteria 10329
423 Ga0207695_10052245 3300025913 Bacteria 4282
424 Ga0207695_10053879 3300025913 Bacteria 4204
425 Ga0207671_10005913 3300025914 Bacteria 11096
426 Ga0207671_10019025 3300025914 Bacteria 5261
427 Ga0207660_10003934 3300025917 Bacteria 9676
428 Ga0207662_10023052 3300025918 Bacteria 3574
429 Ga0207662_10098852 3300025918 Bacteria 1806
430 Ga0207657_10024018 3300025919 Bacteria 5660
431 Ga0207657_10024969 3300025919 Bacteria 5522
432 Ga0207657_10229771 3300025919 Bacteria 1484
433 Ga0207657_10233367 3300025919 Bacteria 1471
434 Ga0207649_10000751 3300025920 Bacteria 21186
435 Ga0207649_10014142 3300025920 Bacteria 4467
436 Ga0207649_10187455 3300025920 Bacteria 1452
437 Ga0207652_10017987 3300025921 Bacteria 5791
438 Ga0207681_10027388 3300025923 Bacteria 3684
439 Ga0207681_10238468 3300025923 Bacteria 1414
440 Ga0207681_10397865 3300025923 Bacteria 1112
441 Ga0207694_10015611 3300025924 Bacteria 5728
442 Ga0207694_10037588 3300025924 Bacteria 3719
443 Ga0207650_10002189 3300025925 Bacteria 13657
444 Ga0207650_10002736 3300025925 Bacteria 12176
445 Ga0207650_10002868 3300025925 Bacteria 11906
446 Ga0207650_10043334 3300025925 Bacteria 3303
447 Ga0207650_10087938 3300025925 Bacteria 2368
448 Ga0207650_10296595 3300025925 Bacteria 1319
449 Ga0207659_10005319 3300025926 Bacteria 7802
450 Ga0207659_10015146 3300025926 Bacteria 4989
451 Ga0207659_10040763 3300025926 Bacteria 3249
452 Ga0207659_10090473 3300025926 Bacteria 2284
453 Ga0207687_10009547 3300025927 Bacteria 6345
454 Ga0207687_10046793 3300025927 Bacteria 2996
455 Ga0207687_10270714 3300025927 Bacteria 1358
456 Ga0207664_10001434 3300025929 Bacteria 15680
457 Ga0207644_10015628 3300025931 Bacteria 5099
458 Ga0207644_10048009 3300025931 Bacteria 3049
459 Ga0207644_10062080 3300025931 Bacteria 2708
460 Ga0207644_10126507 3300025931 Bacteria 1951
461 Ga0207644_10146813 3300025931 Bacteria 1821
462 Ga0207644_10358759 3300025931 Bacteria 1185
463 Ga0207644_10474772 3300025931 Bacteria 1029
464 Ga0207690_10000481 3300025932 Bacteria 25729
465 Ga0207690_10104153 3300025932 Bacteria 2032
466 Ga0207690_10154325 3300025932 Bacteria 1705
467 Ga0207690_10200626 3300025932 Bacteria 1515
468 Ga0207690_10263354 3300025932 Bacteria 1336
469 Ga0207690_10291124 3300025932 Bacteria 1275
470 Ga0207706_10004920 3300025933 Bacteria 12493
471 Ga0207706_10064686 3300025933 Bacteria 3220
472 Ga0207706_10079814 3300025933 Bacteria 2877
473 Ga0207706_10142662 3300025933 Bacteria 2107
474 Ga0207686_10404781 3300025934 Bacteria 1040
475 Ga0207670_10012105 3300025936 Bacteria 5034
476 Ga0207669_10018975 3300025937 Bacteria 3570
477 Ga0207704_10064613 3300025938 Bacteria 2287
478 Ga0207704_10122444 3300025938 Bacteria 1783
479 Ga0207704_10220779 3300025938 Bacteria 1402
480 Ga0207704_10333441 3300025938 Bacteria 1175
481 Ga0207665_10092418 3300025939 Bacteria 2099
482 Ga0207691_10000318 3300025940 Bacteria 47853
483 Ga0207691_10014394 3300025940 Bacteria 7542
484 Ga0207691_10042654 3300025940 Bacteria 4181
485 Ga0207691_10083172 3300025940 Bacteria 2874
486 Ga0207691_10111431 3300025940 Bacteria 2433
487 Ga0207691_10717155 3300025940 Unclassified 843
488 Ga0207711_10024699 3300025941 Bacteria 5039
489 Ga0207711_10139505 3300025941 Bacteria 2180
490 Ga0207711_10377432 3300025941 Bacteria 1315
491 Ga0207711_10416288 3300025941 Bacteria 1249
492 Ga0207689_10001904 3300025942 Bacteria 19724
493 Ga0207689_10013816 3300025942 Bacteria 6881
494 Ga0207689_10126735 3300025942 Bacteria 2100
495 Ga0207689_10441783 3300025942 Bacteria 1087
496 Ga0207661_10092738 3300025944 Bacteria 2518
497 Ga0207661_10556995 3300025944 Bacteria 1050
498 Ga0207679_10000501 3300025945 Bacteria 26940
499 Ga0207679_10005264 3300025945 Bacteria 8109
500 Ga0207679_10036386 3300025945 Bacteria 3491
501 Ga0207679_10079550 3300025945 Bacteria 2500
502 Ga0207651_10000364 3300025960 Bacteria 19183
503 Ga0207651_10006026 3300025960 Bacteria 6292
504 Ga0207651_10044839 3300025960 Bacteria 2962
505 Ga0207668_10012084 3300025972 Bacteria 5273
506 Ga0207640_10012872 3300025981 Bacteria 4779
507 Ga0207640_10042903 3300025981 Bacteria 2887
508 Ga0207640_10060571 3300025981 Bacteria 2503
509 Ga0207640_10320555 3300025981 Bacteria 1234
510 Ga0207640_10512070 3300025981 Bacteria 1001
511 Ga0207658_10002924 3300025986 Bacteria 12231
512 Ga0207658_10004551 3300025986 Bacteria 9620
513 Ga0207658_10034339 3300025986 Bacteria 3625
514 Ga0207658_10156564 3300025986 Bacteria 1862
515 Ga0207658_10260453 3300025986 Bacteria 1478
516 Ga0207658_10283314 3300025986 Bacteria 1421
517 Ga0207677_10004631 3300026023 Bacteria 7401
518 Ga0207677_10011733 3300026023 Bacteria 5006
519 Ga0207677_10082694 3300026023 Bacteria 2308
520 Ga0207677_10142955 3300026023 Bacteria 1835
521 Ga0207677_10251608 3300026023 Bacteria 1435
522 Ga0207703_10001647 3300026035 Bacteria 20096
523 Ga0207703_10031109 3300026035 Bacteria 4218
524 Ga0207639_10007604 3300026041 Bacteria 7391
525 Ga0207639_10048854 3300026041 Bacteria 3204
526 Ga0207639_10055759 3300026041 Bacteria 3026
527 Ga0207639_10210448 3300026041 Bacteria 1673
528 Ga0207639_10297179 3300026041 Bacteria 1426
529 Ga0207678_10011143 3300026067 Bacteria 7897
530 Ga0207678_10013097 3300026067 Bacteria 7275
531 Ga0207678_10037317 3300026067 Bacteria 4226
532 Ga0207678_10088611 3300026067 Bacteria 2645
533 Ga0207678_10147103 3300026067 Bacteria 2011
534 Ga0207708_10006073 3300026075 Bacteria 8958
535 Ga0207708_10310031 3300026075 Bacteria 1285
536 Ga0207702_10079153 3300026078 Bacteria 2848
537 Ga0207702_10273146 3300026078 Bacteria 1595
538 Ga0207702_10348808 3300026078 Bacteria 1416
539 Ga0207702_10986600 3300026078 Bacteria 835
540 Ga0207641_10002593 3300026088 Bacteria 16611
541 Ga0207641_10038275 3300026088 Bacteria 4009
542 Ga0207641_10215708 3300026088 Bacteria 1777
543 Ga0207641_10334452 3300026088 Bacteria 1439
544 Ga0207641_10641741 3300026088 Bacteria 1042
545 Ga0207648_10006568 3300026089 Bacteria 11552
546 Ga0207648_10014727 3300026089 Bacteria 7217
547 Ga0207648_10043325 3300026089 Bacteria 3951
548 Ga0207648_10459498 3300026089 Bacteria 1160
549 Ga0207676_10001498 3300026095 Bacteria 17239
550 Ga0207676_10017299 3300026095 Bacteria 5226
551 Ga0207676_10089900 3300026095 Bacteria 2518
552 Ga0207676_10111989 3300026095 Bacteria 2285
553 Ga0207674_10008817 3300026116 Bacteria 11607
554 Ga0207674_10031394 3300026116 Bacteria 5582
555 Ga0207674_10042732 3300026116 Bacteria 4678
556 Ga0207674_10313852 3300026116 Bacteria 1517
557 Ga0207674_10484958 3300026116 Bacteria 1195
558 Ga0207675_100000660 3300026118 Bacteria 33957
559 Ga0207675_100001398 3300026118 Bacteria 24128
560 Ga0207675_100238802 3300026118 Bacteria 1756
561 Ga0207675_100445847 3300026118 Bacteria 1282
562 Ga0207683_10010653 3300026121 Bacteria 7837
563 Ga0207683_10024630 3300026121 Bacteria 5185
564 Ga0207683_10045467 3300026121 Bacteria 3840
565 Ga0207683_10088633 3300026121 Bacteria 2753
566 Ga0207683_10092786 3300026121 Bacteria 2690
567 Ga0207683_10142966 3300026121 Bacteria 2156
568 Ga0207683_10209322 3300026121 Bacteria 1774
569 Ga0207683_10375733 3300026121 Bacteria 1306
570 Ga0207698_10018703 3300026142 Bacteria 4728
571 Ga0207698_10078188 3300026142 Bacteria 2655
572 Ga0207698_10131871 3300026142 Bacteria 2137
573 Ga0207698_10156103 3300026142 Bacteria 1988
574 Ga0207698_10207283 3300026142 Bacteria 1761
575 Ga0209281_1000023 3300027111 Bacteria 519955
576 Ga0209281_1009027 3300027111 Bacteria 2368
577 Ga0209389_1025093 3300027296 Bacteria 5202
578 Ga0209371_1000701 3300027312 Bacteria 28374
579 Ga0209371_1013976 3300027312 Bacteria 2223
580 Ga0207428_10190334 3300027907 Bacteria 1547
581 Ga0268266_10179297 3300028379 Bacteria 1928
582 Ga0268265_10139537 3300028380 Bacteria 2027
583 Ga0268264_10079618 3300028381 Bacteria 2796
584 Ga0268264_10309352 3300028381 Bacteria 1490
585 Ga0307517_10000228 3300028786 Bacteria 94852
586 Ga0307515_10007466 3300028794 Bacteria 21602
587 Ga0307515_10034913 3300028794 Bacteria 8205
588 Ga0307515_10090606 3300028794 Bacteria 3833
589 Ga0265338_10009227 3300028800 Bacteria 11807
590 Ga0268256_1000945 3300030500 Bacteria 19893
591 Ga0268256_1015987 3300030500 Bacteria 2166
592 Ga0307512_10023453 3300030522 Bacteria 5512
593 Ga0307513_10000006 3300031456 Bacteria 470848
594 Ga0307513_10000094 3300031456 Bacteria 127685
595 Ga0307513_10015048 3300031456 Bacteria 9390
596 Ga0307513_10030687 3300031456 Bacteria 6102
597 Ga0307513_10309731 3300031456 Bacteria 1342
598 Ga0307509_10000426 3300031507 Bacteria 70899
599 Ga0307509_10014271 3300031507 Bacteria 9350
600 Ga0307509_10016014 3300031507 Bacteria 8703
601 Ga0307509_10124219 3300031507 Bacteria 2551
602 Ga0307509_10262741 3300031507 Bacteria 1500
603 Ga0307408_100006878 3300031548 Bacteria 7538
604 Ga0307408_100012190 3300031548 Bacteria 5689
605 Ga0307508_10003969 3300031616 Bacteria 14667
606 Ga0307508_10110368 3300031616 Bacteria 2350
607 Ga0307508_10204922 3300031616 Bacteria 1573
608 Ga0307514_10033315 3300031649 Bacteria 4112
609 Ga0307514_10072799 3300031649 Bacteria 2572
610 Ga0307516_10132284 3300031730 Bacteria 2272
611 Ga0307516_10198561 3300031730 Bacteria 1727
612 Ga0307405_10032048 3300031731 Bacteria 3102
613 Ga0307405_10188626 3300031731 Bacteria 1487
614 Ga0307413_10023007 3300031824 Bacteria 3370
615 Ga0307413_10085557 3300031824 Bacteria 2036
616 Ga0307413_10098758 3300031824 Bacteria 1923
617 Ga0307413_10223240 3300031824 Bacteria 1378
618 Ga0307410_10013135 3300031852 Bacteria 4819
619 Ga0307410_10140913 3300031852 Bacteria 1784
620 Ga0307410_10226142 3300031852 Bacteria 1442
621 Ga0307406_10016595 3300031901 Bacteria 4283
622 Ga0307406_10094301 3300031901 Bacteria 2023
623 Ga0307406_10129970 3300031901 Bacteria 1766
624 Ga0307406_10478188 3300031901 Bacteria 1005
625 Ga0307407_10054608 3300031903 Bacteria 2305
626 Ga0307412_10003825 3300031911 Bacteria 8370
627 Ga0307409_100018633 3300031995 Bacteria 4674
628 Ga0307409_100030943 3300031995 Bacteria 3854
629 Ga0307409_100050461 3300031995 Bacteria 3178
630 Ga0307416_100001391 3300032002 Bacteria 13103
631 Ga0307414_10466066 3300032004 Bacteria 1111
632 Ga0307411_10057250 3300032005 Bacteria 2574
633 Ga0307415_100000538 3300032126 Bacteria 16532
634 Ga0307507_10183074 3300033179 Bacteria 1492
635 Ga0307510_10000109 3300033180 Bacteria 65353
636 Ga0307510_10003495 3300033180 Bacteria 18312
637 Ga0307510_10007864 3300033180 Bacteria 12703
638 Ga0373928_0039003 3300035084 Bacteria 1083
639 Ga0373929_0028890 3300035085 Bacteria 1174
640 Ga0373944_0012864 3300035089 Bacteria 2313
641 Ga0373923_0081516 3300035111 Bacteria 1404
642 Ga0373939_0020182 3300035114 Bacteria 1807
643 Ga0373945_0008660 3300035116 Bacteria 3318
644 Ga0373945_0096489 3300035116 Bacteria 1152
645 Ga0373954_0235440 3300035118 Unclassified 901
646 Ga0373956_0157678 3300035119 Bacteria 1069
647 Ga0373943_0002106 3300035170 Bacteria 9038
648 Ga0373946_0046180 3300035171 Bacteria 1804
649 Ga0373955_0098276 3300035172 Bacteria 1677
650 Ga0373924_0039178 3300035410 Bacteria 1936
651 Ga0373931_0000491 3300035691 Bacteria 16121
652 Ga0373931_0006164 3300035691 Bacteria 5591
653 Ga0373935_0002582 3300035692 Bacteria 10400
654 Ga0373927_0081556 3300035695 Bacteria 2096
655 Ga0373927_0274012 3300035695 Bacteria 1110
656 Ga0373927_0276567 3300035695 Bacteria 1104
657 Ga0373933_0069365 3300035724 Bacteria 2143
658 Ga0373947_0006791 3300035725 Bacteria 6634
659 Ga0373937_0076146 3300036401 Bacteria 3099
660 Ga0373937_0128242 3300036401 Bacteria 2368
661 Ga0373937_0410850 3300036401 Bacteria 1284
662 Ga0373925_0004170 3300037068 Bacteria 10968
663 Ga0373925_0045282 3300037068 Bacteria 3268
664 Ga0373925_0062007 3300037068 Bacteria 2811
665 Ga0373925_0096138 3300037068 Bacteria 2270
666 Ga0373925_0191460 3300037068 Bacteria 1623
667 Ga0436365_1236244 3300039437 Bacteria 3292
668 Ga0436363_0456608 3300039450 Bacteria 1920
669 Ga0451793_0582550 3300041452 Bacteria 2054
670 Ga0451795_0193179 3300041456 Bacteria 966
671 Ga0451853_1100378 3300041512 Bacteria 2403
672 Ga0439454_001207 3300042011 Bacteria 2405
673 Ga0450919_001438 3300042121 Bacteria 3108
674 Ga0450920_004372 3300042122 Bacteria 2480
675 Ga0439444_0009863 3300042437 Bacteria 1514
676 Ga0439460_0006330 3300042461 Bacteria 2933
677 Ga0450918_000096 3300042531 Bacteria 18894
678 Ga0451577_0018162 3300042876 Bacteria 6481
679 Ga0466963_0207307 3300044694 Bacteria 1371
680 Ga0453684_0201131 3300044712 Bacteria 2322
681 Ga0451576_0191060 3300045051 Bacteria 2139
682 Ga0451576_0487563 3300045051 Bacteria 1295
683 Ga0495592_0000160 3300046454 Bacteria 59404
684 Ga0495592_0033983 3300046454 Bacteria 3846
685 Ga0495592_0121318 3300046454 Bacteria 1839
686 Ga0495590_0033866 3300046457 Bacteria 1785
687 Ga0495629_0001363 3300046459 Bacteria 19254
688 Ga0495629_0114734 3300046459 Bacteria 1877
689 Ga0495629_0348614 3300046459 Bacteria 1010
690 Ga0495638_0103634 3300046460 Bacteria 1698
691 Ga0495638_0282548 3300046460 Bacteria 901
692 Ga0495641_0039621 3300046461 Bacteria 2196
693 Ga0495651_0018483 3300046462 Bacteria 5399
694 Ga0495651_0341012 3300046462 Bacteria 993
695 Ga0495650_0000120 3300046471 Bacteria 184191
696 Ga0495580_0006785 3300046472 Bacteria 9280
697 Ga0495580_0030291 3300046472 Bacteria 3919
698 Ga0495582_0003867 3300046473 Bacteria 8432
699 Ga0495639_0004857 3300046475 Bacteria 5767
700 Ga0495662_0000639 3300046476 Bacteria 16368
701 Ga0495664_0049556 3300046477 Bacteria 2493
702 Ga0495594_0009847 3300046499 Bacteria 4952
703 Ga0495608_0047219 3300046511 Bacteria 2863
704 Ga0495618_0001442 3300046514 Bacteria 15955
705 Ga0495618_0209786 3300046514 Bacteria 1231
706 Ga0495620_0074303 3300046515 Bacteria 1385
707 Ga0495628_0079954 3300046516 Bacteria 2542
708 Ga0495628_0347813 3300046516 Bacteria 1090
709 Ga0495630_0001164 3300046517 Bacteria 18173
710 Ga0495630_0187107 3300046517 Bacteria 1580
711 Ga0495632_0107898 3300046519 Bacteria 1309
712 Ga0495632_0151213 3300046519 Bacteria 1073
713 Ga0495643_0202425 3300046522 Bacteria 952
714 Ga0495666_0037062 3300046526 Bacteria 2373
715 Ga0495666_0058819 3300046526 Bacteria 1838
716 Ga0495652_0027292 3300046529 Bacteria 5032
717 Ga0495665_0007522 3300046531 Bacteria 5896
718 Ga0495640_0001826 3300046533 Bacteria 16892
719 Ga0495587_0176802 3300046536 Bacteria 1211
720 Ga0495597_0025872 3300046542 Bacteria 2699
721 Ga0495645_0024687 3300046543 Bacteria 4362
722 Ga0495645_0036129 3300046543 Bacteria 3602
723 Ga0495622_0104509 3300046557 Bacteria 1297
724 Ga0495668_0062278 3300046616 Bacteria 2056
725 Ga0495634_0006487 3300046642 Bacteria 8886
726 Ga0495625_0022218 3300046660 Bacteria 4868
727 Ga0495635_0002326 3300046663 Bacteria 12918
728 Ga0495588_0001246 3300046674 Bacteria 10938
729 Ga0495657_0326041 3300046675 Bacteria 912
730 Ga0495646_0027416 3300046680 Bacteria 3575
731 Ga0495647_0001034 3300046681 Bacteria 8469
732 Ga0495647_0143463 3300046681 Bacteria 1020
733 Ga0495658_0001010 3300046683 Bacteria 14871
734 Ga0495658_0105997 3300046683 Bacteria 1684
735 Ga0495613_0005480 3300046689 Bacteria 9534
736 Ga0495613_0045220 3300046689 Bacteria 3257
737 Ga0495624_0004928 3300046690 Bacteria 9681
738 Ga0495670_0140752 3300046691 Bacteria 1261
739 Ga0495600_0001933 3300046809 Bacteria 11640
740 Ga0495600_0148290 3300046809 Bacteria 1520
741 Ga0495660_0000063 3300046810 Bacteria 129364
742 Ga0495581_0001615 3300047315 Bacteria 12567
743 Ga0495636_0003809 3300047318 Bacteria 5877
744 Ga0495674_0011580 3300047319 Bacteria 8320
745 Ga0495676_0008905 3300047321 Bacteria 9166
746 Ga0495676_0066853 3300047321 Bacteria 2783
747 Ga0495680_0001462 3300047322 Bacteria 25495
748 Ga0495680_0100026 3300047322 Bacteria 2161
749 Ga0495687_000330 3300047443 Bacteria 60838
750 Ga0495687_010458 3300047443 Bacteria 5088
751 Ga0495687_015164 3300047443 Bacteria 3930
752 Ga0495681_0015098 3300047470 Bacteria 4385
753 Ga0495684_0001528 3300047471 Bacteria 18538
754 Ga0495684_0053681 3300047471 Bacteria 3075
755 Ga0495684_0075862 3300047471 Bacteria 2554
756 Ga0495593_0004976 3300047673 Bacteria 7872
757 Ga0495614_0050180 3300048089 Bacteria 1788
758 Ga0495626_0107016 3300048091 Bacteria 1214
759 Ga0496100_0012406 3300048903 Bacteria 4885
760 Ga0496101_0044204 3300048904 Bacteria 3187
761 Ga0496102_0088578 3300048905 Bacteria 2862
762 Ga0496104_0005589 3300048907 Bacteria 11007
763 Ga0496104_0009568 3300048907 Bacteria 8628
764 Ga0496104_0157042 3300048907 Bacteria 2183
765 Ga0496105_0024505 3300048908 Bacteria 4903
766 Ga0496106_0002439 3300048909 Bacteria 13854
767 Ga0496106_0065841 3300048909 Bacteria 2759
768 Ga0496106_0263540 3300048909 Bacteria 1379
769 Ga0496107_0024352 3300048910 Bacteria 4283
770 Ga0496108_0020132 3300048911 Bacteria 5483
771 Ga0496108_0031269 3300048911 Bacteria 4416
772 Ga0496108_0162658 3300048911 Bacteria 1930
773 Ga0496108_0259753 3300048911 Bacteria 1511
774 Ga0496108_0279838 3300048911 Bacteria 1452
775 Ga0496109_0016343 3300048912 Bacteria 6485
776 Ga0496109_0053756 3300048912 Bacteria 3674
777 Ga0496109_0333486 3300048912 Bacteria 1432
778 Ga0496109_0367734 3300048912 Bacteria 1358
779 Ga0496110_0111615 3300048913 Bacteria 2458
780 Ga0496110_0170691 3300048913 Bacteria 1973
781 Ga0496110_0600876 3300048913 Bacteria 998
782 Ga0496111_0040158 3300048914 Bacteria 3356
783 Ga0496111_0103417 3300048914 Bacteria 2095
784 Ga0496112_0137197 3300048915 Bacteria 2416
785 Ga0496114_0001104 3300048917 Bacteria 20372
786 Ga0496114_0098393 3300048917 Bacteria 2494
787 Ga0496115_0114022 3300048918 Bacteria 2221
788 Ga0496116_0000096 3300048919 Bacteria 202230
789 Ga0496117_0000267 3300048920 Bacteria 98737
790 Ga0496117_0016545 3300048920 Bacteria 6218
791 Ga0496117_0130113 3300048920 Bacteria 1527
792 Ga0496118_0000238 3300048921 Bacteria 96987
793 Ga0496118_0005162 3300048921 Bacteria 14965
794 Ga0496118_0064235 3300048921 Bacteria 2694
795 Ga0496119_0007846 3300048922 Bacteria 9510
796 Ga0496120_0001781 3300048923 Bacteria 24242
797 Ga0496122_0000213 3300048925 Bacteria 129218
798 Ga0496123_0000177 3300048926 Bacteria 129218
799 Ga0496124_0000026 3300048927 Bacteria 385387
800 Ga0496124_0023697 3300048927 Bacteria 5598
801 Ga0496125_0000226 3300048928 Bacteria 115358
802 Ga0496126_0000632 3300048929 Bacteria 65657
803 Ga0501043_0064170 3300049579 Bacteria 2884
804 Ga0501035_0580560 3300049822 Bacteria 915
805 nmdc:mga03683_56607_c1 3300050489 Bacteria 1648
806 nmdc:mga03683_7061_c1 3300050489 Bacteria 3878
807 nmdc:mga0yw44_178587_c1 3300050492 Bacteria 1396
808 nmdc:mga0k408_1110_c1 3300050493 Bacteria 14744
809 nmdc:mga0k408_1324_c1 3300050493 Bacteria 13382
810 nmdc:mga0k408_78543_c1 3300050493 Bacteria 1931
811 nmdc:mga06z11_3260_c1 3300050494 Bacteria 6273
812 nmdc:mga06z11_41344_c1 3300050494 Bacteria 2307
813 nmdc:mga04h51_2183_c1 3300050495 Bacteria 4591
814 nmdc:mga07m45_13675_c1 3300050496 Bacteria 4311
815 nmdc:mga07m45_139430_c1 3300050496 Bacteria 1404
816 nmdc:mga07m45_1430_c1 3300050496 Bacteria 10947
817 nmdc:mga07m45_144687_c1 3300050496 Bacteria 1378
818 nmdc:mga07m45_630_c1 3300050496 Bacteria 14978
819 nmdc:mga07m45_65058_c1 3300050496 Bacteria 2070
820 nmdc:mga07m45_7700_c1 3300050496 Bacteria 5513
821 nmdc:mga07m45_92398_c1 3300050496 Bacteria 1734
822 nmdc:mga08y16_645297_c1 3300050511 Bacteria 1063
823 nmdc:mga0rr50_315743_c1 3300050513 Bacteria 1309
824 nmdc:mga0rr50_84829_c1 3300050513 Bacteria 2453
825 Ga0495601_0000745 3300053077 Bacteria 17500
826 Ga0495612_0000694 3300053078 Bacteria 13603
827 Ga0495595_0000392 3300053084 Bacteria 16663
828 Ga0495619_0001107 3300053085 Bacteria 17705
829 Ga0495619_0044288 3300053085 Bacteria 2921
830 Ga0500578_0166327 3300053086 Bacteria 1366
831 Ga0500644_0002178 3300053088 Bacteria 4956
832 Ga0500651_0044723 3300053093 Bacteria 2787
833 Ga0500651_0055428 3300053093 Bacteria 2483
834 Ga0500555_066251 3300053103 Bacteria 961
835 Ga0500593_001340 3300053117 Bacteria 8873
836 Ga0500594_0039051 3300053118 Bacteria 1289
837 Ga0500621_051100 3300053126 Bacteria 1673
838 Ga0500628_010101 3300053129 Bacteria 1681
839 Ga0500652_028153 3300053131 Bacteria 2180
840 Ga0500658_0012270 3300053134 Bacteria 3159
841 Ga0500559_0001509 3300053136 Bacteria 13100
842 Ga0500568_0023974 3300053139 Bacteria 2588
843 Ga0500568_0087137 3300053139 Bacteria 1180
844 Ga0500604_0023188 3300053151 Bacteria 1769
845 Ga0500616_0135097 3300053153 Bacteria 1160
846 Ga0500636_0094671 3300053177 Bacteria 1706
847 Ga0500645_001182 3300053730 Bacteria 13909
848 Ga0500645_004523 3300053730 Bacteria 5306
849 Ga0500645_009944 3300053730 Bacteria 3171
850 Ga0500661_008225 3300055283 Bacteria 1917
851 2511244819 2511231002 Bacteria 5042903
852 2585826049 2585427591 Bacteria 5482980
853 2585831833 2585427592 Bacteria 5370892
854 2599410245 2599185169 Bacteria 5441380
855 2599904884 2599185292 Bacteria 6290804
856 2601523457 2600255254 Bacteria 5281859
857 2601528616 2600255255 Bacteria 5282785
858 2601615449 2600255280 Bacteria 5292309
859 2601619625 2600255281 Bacteria 5288753
860 2601643960 2600255287 Bacteria 5210468
861 2601648030 2600255288 Bacteria 5282738
862 2601653501 2600255289 Bacteria 5281907
863 2601658378 2600255290 Bacteria 5282218
864 2601663785 2600255291 Bacteria 5217298
865 2601696334 2600255298 Bacteria 5215185
866 2601701417 2600255299 Bacteria 5218662
867 2601706156 2600255300 Bacteria 5287774
868 2601711741 2600255301 Bacteria 5280532
869 2601716759 2600255302 Bacteria 5288235
870 2601721358 2600255303 Bacteria 5219315
871 2601727165 2600255304 Bacteria 5283973
872 2601731705 2600255305 Bacteria 5282329
873 2601736717 2600255306 Bacteria 5281613
874 2601740317 2600255307 Bacteria 5439064
875 2601751254 2600255309 Bacteria 5431045
876 2602018886 2600255392 Bacteria 5437392
877 2603661173 2602042052 Bacteria 5215873
878 2603666448 2602042053 Bacteria 5214361
879 2603839102 2602042103 Bacteria 5284714
880 2603843638 2602042104 Bacteria 5281639
881 2603849259 2602042105 Bacteria 5282303
882 2603854329 2602042106 Bacteria 5282744
883 2603865658 2602042109 Bacteria 5152801
884 2603872384 2602042110 Bacteria 5283285
885 2603877260 2602042111 Bacteria 5212080
886 2606049565 2603880178 Bacteria 5283018
887 2606070880 2603880184 Bacteria 5217896
888 2606147249 2603880202 Bacteria 5284684
889 2606176974 2603880211 Bacteria 5284226
890 2637223207 2636415599 Bacteria 5718434
891 2643860481 2643221569 Bacteria 6064337
892 2644245230 2643221644 Bacteria 6865017
893 2644305760 2643221654 Bacteria 5273570
894 2671109609 2667528173 Bacteria 5375747
895 2676408616 2675903046 Bacteria 5451247
896 2777019517 2775507074 Bacteria 5532402
897 2831866003 2831864461 Bacteria 6502356
898 2852106325 2852103415 Bacteria 5193810
899 2881930407 2881927736 Bacteria 3993927
900 2886851931 2886848708 Bacteria 5632523
901 2887377380 2887375801 Bacteria 5334027
902 2904478031 2904474040 Bacteria 5504324
903 2904517108 2904513164 Bacteria 5476410
904 2919154005 2919150387 Bacteria 5500879
905 2927147542 2927143783 Bacteria 5504251
906 2969080225 2969079654 Bacteria 5439582
907 2984562681 2984559226 Bacteria 5683096
908 2984600741 2984595703 Bacteria 5682994
909 Ga0070671_100008975
910 SwRhRL2b_contig_2942750
911 JGI24034J26672_10007511
912 JGI25155J39150_1000123
913 JGI25156J39149_1000052
914 JGI25162J39368_1000029
915 JGI25154J39366_1000081
916 JGI25157J39369_1000006
917 JGI25163J39215_1000037
918 JGI25164J39214_1000008
919 JGI25159J45721_1000667
920 JGI25159J45721_1001832
921 JGI25151J46595_10021834
922 JGI25151J46595_10022048
923 rootH2_10034882
924 rootL2_10000270
925 rootL2_10066204
926 rootH1_10010855
927 rootH1_10090419
928 JGI25160J50197_1000071
929 JGI25161J50226_1000030
930 Ga0055538_1000014
931 Ga0055539_1000020
932 Ga0055533_1000027
933 Ga0055525_1000032
934 Ga0055526_1000165
935 Ga0055526_1004597
936 Ga0055526_1004630
937 Ga0055526_1005641
938 Ga0055526_1031764
939 Ga0055537_1000689
940 Ga0055524_1000006
941 Ga0055524_1000033
942 Ga0055524_1000459
943 Ga0055524_1000535
944 Ga0055536_1002314
945 Ga0055534_1000905
946 Ga0055528_1000432
947 Ga0055530_10001786
948 Ga0055530_10002584
949 Ga0055540_1000005
950 Ga0055540_1000007
951 Ga0055540_1045874
952 Ga0055531_10001534
953 Ga0055531_10001878
954 Ga0055531_10002603
955 Ga0055531_10004316
956 Ga0055541_1000014
957 JGI25405J52794_10000287
958 Ga0055543_1000162
959 Ga0055543_1005134
960 Ga0055543_1010893
961 Ga0065165_1000248
962 Ga0065165_1000457
963 Ga0065165_1014815
964 Ga0065165_1014830
965 Ga0065704_10000430
966 Ga0065715_10015471
967 Ga0065715_10154527
968 Ga0070658_10056756
969 Ga0070658_10068527
970 Ga0070658_10626740
971 Ga0070676_10006055
972 Ga0070676_10023546
973 Ga0070676_10064971
974 Ga0070676_10334443
975 Ga0070683_100006244
976 Ga0070683_100122375
977 Ga0070683_100406453
978 Ga0070670_100003877
979 Ga0070670_100006300
980 Ga0070670_100064726
981 Ga0070670_100078154
982 Ga0070670_100318387
983 Ga0070677_10005147
984 Ga0070677_10041929
985 Ga0070677_10084456
986 Ga0068869_100004685
987 Ga0068869_100008711
988 Ga0068869_100165058
989 Ga0070666_10183457
990 Ga0070680_100015257
991 Ga0068868_100000930
992 Ga0068868_100004465
993 Ga0068868_100075354
994 Ga0070660_100027188
995 Ga0070660_100236026
996 Ga0070660_100248610
997 Ga0070660_100263554
998 Ga0070660_100619034
999 Ga0070689_100501588
1000 Ga0070687_100009172
1001 Ga0070661_100000421
1002 Ga0070661_100025029
1003 Ga0070661_100147589
1004 Ga0070661_100448340
1005 Ga0070668_100279053
1006 Ga0070669_100006777
1007 Ga0070669_100230169
1008 Ga0070669_100347952
1009 Ga0070669_100398041
1010 Ga0070675_100000926
1011 Ga0070675_100023645
1012 Ga0070675_100033735
1013 Ga0070675_100052584
1014 Ga0070675_100129602
1015 Ga0070675_100138103
1016 Ga0070671_100006545
1017 Ga0070671_100006549
1018 Ga0070671_100115583
1019 Ga0070671_100269640
1020 Ga0070671_100309010
1021 Ga0070671_100528168
1022 Ga0070674_100003100
1023 Ga0070674_100107885
1024 Ga0070673_100002705
1025 Ga0070673_100010900
1026 Ga0070673_100049438
1027 Ga0070673_100080581
1028 Ga0070673_100106065
1029 Ga0070673_100195048
1030 Ga0070673_100442914
1031 Ga0070688_100052577
1032 Ga0070659_100001131
1033 Ga0070659_100015214
1034 Ga0070659_100069504
1035 Ga0070659_100315241
1036 Ga0070659_100350263
1037 Ga0070667_100028982
1038 Ga0070667_100046762
1039 Ga0070667_100049020
1040 Ga0070667_100050041
1041 Ga0070667_100075499
1042 Ga0070667_100106923
1043 Ga0070667_100202999
1044 Ga0070667_100261822
1045 Ga0070714_100003484
1046 Ga0070710_10045240
1047 Ga0070711_100328282
1048 Ga0070700_100040386
1049 Ga0070663_100135643
1050 Ga0070663_100171450
1051 Ga0070663_100178439
1052 Ga0070663_100480344
1053 Ga0070678_100012306
1054 Ga0070678_100069389
1055 Ga0070678_100344094
1056 Ga0070678_100353293
1057 Ga0070678_100534928
1058 Ga0070678_100566858
1059 Ga0070662_100001118
1060 Ga0070662_100062411
1061 Ga0070662_100150276
1062 Ga0070662_100317556
1063 Ga0070681_10163217
1064 Ga0068867_100004608
1065 Ga0068867_100007763
1066 Ga0068867_100037531
1067 Ga0068867_100137285
1068 Ga0070685_10026991
1069 Ga0070685_10038031
1070 Ga0070706_100002704
1071 Ga0070699_100329360
1072 Ga0070679_100133211
1073 Ga0070684_100004660
1074 Ga0070684_100112888
1075 Ga0070684_100260750
1076 Ga0070684_100402283
1077 Ga0068853_100008854
1078 Ga0068853_100079991
1079 Ga0068853_100121432
1080 Ga0068853_100289949
1081 Ga0070672_100004999
1082 Ga0070672_100082916
1083 Ga0070672_100196755
1084 Ga0070686_100010080
1085 Ga0070695_100066338
1086 Ga0070665_100195344
1087 Ga0070665_100290114
1088 Ga0070665_100551833
1089 Ga0070664_100001426
1090 Ga0070664_100032656
1091 Ga0070664_100043662
1092 Ga0070664_100080697
1093 Ga0070664_100283693
1094 Ga0070664_100318624
1095 Ga0068857_100005334
1096 Ga0068857_100056463
1097 Ga0068857_100066636
1098 Ga0068854_100023715
1099 Ga0068854_100031730
1100 Ga0068854_100109567
1101 Ga0068854_100359268
1102 Ga0068854_100570405
1103 Ga0068856_100008227
1104 Ga0068852_100011321
1105 Ga0068852_100030483
1106 Ga0068852_100031117
1107 Ga0068852_100038260
1108 Ga0068852_100090150
1109 Ga0068852_100129524
1110 Ga0068852_100243046
1111 Ga0068852_100262259
1112 Ga0068859_100100470
1113 Ga0068859_100413048
1114 Ga0068864_100001420
1115 Ga0068864_100005635
1116 Ga0068864_100018785
1117 Ga0068864_100049209
1118 Ga0068864_100051910
1119 Ga0068866_10033691
1120 Ga0068861_100006180
1121 Ga0068861_100018413
1122 Ga0068861_100050276
1123 Ga0068851_10007383
1124 Ga0068851_10015841
1125 Ga0068870_10050666
1126 Ga0068870_10288925
1127 Ga0068863_100031141
1128 Ga0068863_100077677
1129 Ga0068863_100085537
1130 Ga0068863_100200095
1131 Ga0068863_100442513
1132 Ga0068858_100001292
1133 Ga0068858_100103295
1134 Ga0068860_100076886
1135 Ga0068862_100114461
1136 Ga0081455_10001479
1137 Ga0075364_10071666
1138 Ga0075364_10241316
1139 Ga0075432_10042041
1140 Ga0075362_10040059
1141 Ga0075367_10013603
1142 Ga0075367_10053393
1143 Ga0075367_10086550
1144 Ga0075366_10003855
1145 Ga0075366_10072018
1146 Ga0097621_100004797
1147 Ga0097621_100010187
1148 Ga0097621_100047062
1149 Ga0097621_100114312
1150 Ga0097621_100127976
1151 Ga0097621_100459828
1152 Ga0075370_10000414
1153 Ga0075370_10002136
1154 Ga0075370_10003303
1155 Ga0075370_10013634
1156 Ga0075370_10058441
1157 Ga0068871_100008334
1158 Ga0068871_100037449
1159 Ga0068871_100163445
1160 Ga0068865_100018910
1161 Ga0068865_100036499
1162 Ga0068865_100359016
1163 Ga0097620_100100481
1164 Ga0097620_100413090
1165 Ga0099823_1000049
1166 Ga0079104_1000009
1167 Ga0079104_1009160
1168 Ga0105244_10002360
1169 Ga0105250_10000818
1170 Ga0105240_10020343
1171 Ga0105240_10106425
1172 Ga0105240_10635941
1173 Ga0111539_10042281
1174 Ga0105245_10031804
1175 Ga0105245_10032610
1176 Ga0105245_10336331
1177 Ga0105245_10377138
1178 Ga0105247_10114825
1179 Ga0105247_10190353
1180 Ga0105247_10507529
1181 Ga0114129_10002772
1182 Ga0105243_10169335
1183 Ga0105241_10090970
1184 Ga0105241_10091854
1185 Ga0105241_10392820
1186 Ga0105241_10562218
1187 Ga0105248_10038301
1188 Ga0105248_10147480
1189 Ga0105248_10583002
1190 Ga0105237_10074652
1191 Ga0105237_10092510
1192 Ga0105237_10455002
1193 Ga0105237_10612628
1194 Ga0105238_10016359
1195 Ga0105238_10054522
1196 Ga0105249_10054314
1197 Ga0105249_10075802
1198 Ga0105249_10274650
1199 Ga0105239_10015037
1200 Ga0105239_10030363
1201 Ga0105239_10211136
1202 Ga0105246_10088951
1203 Ga0157319_1000003
1204 Ga0157371_10000067
1205 Ga0157371_10019163
1206 Ga0157371_10263183
1207 Ga0157369_10525144
1208 Ga0157374_10041624
1209 Ga0157374_10068630
1210 Ga0157374_10135152
1211 Ga0157374_10158942
1212 Ga0157374_10219075
1213 Ga0157374_10480593
1214 Ga0157378_10056311
1215 Ga0157378_10280982
1216 Ga0157378_10414925
1217 Ga0163162_10031762
1218 Ga0163162_10241428
1219 Ga0163162_10302369
1220 Ga0163162_10585641
1221 Ga0157372_10006296
1222 Ga0157372_10294769
1223 Ga0157375_10020576
1224 Ga0157375_10065317
1225 Ga0157375_10159014
1226 Ga0157375_10161133
1227 Ga0157375_10173806
1228 Ga0163163_10002538
1229 Ga0182008_10165321
1230 Ga0157377_10002927
1231 Ga0157379_10007434
1232 Ga0157379_10015457
1233 Ga0157379_10039615
1234 Ga0157376_10014590
1235 Ga0157376_10024312
1236 Ga0157376_10296245
1237 Ga0163161_10004707
1238 Ga0163161_10053829
1239 Ga0209435_100001
1240 Ga0209760_100256
1241 Ga0209436_105701
1242 Ga0209784_100030
1243 Ga0209566_100034
1244 Ga0209674_100052
1245 Ga0209563_100054
1246 Ga0207427_100035
1247 Ga0209437_100068
1248 Ga0207425_1003404
1249 Ga0209646_1000001
1250 Ga0209026_1000003
1251 Ga0209677_100032
1252 Ga0209759_1000001
1253 Ga0209233_1001319
1254 Ga0209565_1000124
1255 Ga0209673_1000043
1256 Ga0209673_1010760
1257 Ga0209673_1015800
1258 Ga0209673_1017436
1259 Ga0209130_1000060
1260 Ga0209130_1000114
1261 Ga0209675_1000269
1262 Ga0209675_1002791
1263 Ga0209675_1023335
1264 Ga0209676_1000007
1265 Ga0209676_1004596
1266 Ga0209676_1006553
1267 Ga0209025_1000822
1268 Ga0209025_1002740
1269 Ga0209025_1004701
1270 Ga0209025_1005559
1271 Ga0209564_1000019
1272 Ga0209564_1000051
1273 Ga0209564_1000268
1274 Ga0209564_1002616
1275 Ga0209564_1007637
1276 Ga0209758_1049975
1277 Ga0209758_1059472
1278 Ga0209050_1000003
1279 Ga0209050_1000243
1280 Ga0209050_1002122
1281 Ga0209050_1002216
1282 Ga0209050_1002982
1283 Ga0209050_1005795
1284 Ga0209256_1000001
1285 Ga0209256_1000019
1286 Ga0209256_1000242
1287 Ga0209256_1000512
1288 Ga0207426_1000308
1289 Ga0207426_1002574
1290 Ga0209051_1000003
1291 Ga0209051_1000004
1292 Ga0209051_1000577
1293 Ga0209051_1009165
1294 Ga0209257_1000020
1295 Ga0209257_1000038
1296 Ga0209257_1000044
1297 Ga0209257_1003863
1298 Ga0209257_1004264
1299 Ga0209257_1005946
1300 Ga0209257_1013536
1301 Ga0207697_10002323
1302 Ga0207697_10040005
1303 Ga0207656_10038928
1304 Ga0207656_10081504
1305 Ga0207656_10092387
1306 Ga0207696_1000173
1307 Ga0207655_1000198
1308 Ga0207682_10000706
1309 Ga0207682_10002760
1310 Ga0207682_10003004
1311 Ga0207682_10109217
1312 Ga0207692_10042920
1313 Ga0207688_10019000
1314 Ga0207680_10022089
1315 Ga0207647_10066050
1316 Ga0207699_10015220
1317 Ga0207645_10002087
1318 Ga0207645_10008182
1319 Ga0207645_10008366
1320 Ga0207645_10081673
1321 Ga0207645_10247954
1322 Ga0207645_10294339
1323 Ga0207643_10010973
1324 Ga0207643_10020852
1325 Ga0207643_10024104
1326 Ga0207643_10332143
1327 Ga0207705_10175602
1328 Ga0207705_10289179
1329 Ga0207684_10006839
1330 Ga0207695_10052245
1331 Ga0207695_10053879
1332 Ga0207671_10005913
1333 Ga0207671_10019025
1334 Ga0207660_10003934
1335 Ga0207662_10023052
1336 Ga0207662_10098852
1337 Ga0207657_10024018
1338 Ga0207657_10024969
1339 Ga0207657_10229771
1340 Ga0207657_10233367
1341 Ga0207649_10000751
1342 Ga0207649_10014142
1343 Ga0207649_10187455
1344 Ga0207652_10017987
1345 Ga0207681_10027388
1346 Ga0207681_10238468
1347 Ga0207681_10397865
1348 Ga0207694_10015611
1349 Ga0207694_10037588
1350 Ga0207650_10002189
1351 Ga0207650_10002736
1352 Ga0207650_10002868
1353 Ga0207650_10043334
1354 Ga0207650_10087938
1355 Ga0207650_10296595
1356 Ga0207659_10005319
1357 Ga0207659_10015146
1358 Ga0207659_10040763
1359 Ga0207659_10090473
1360 Ga0207687_10009547
1361 Ga0207687_10046793
1362 Ga0207687_10270714
1363 Ga0207664_10001434
1364 Ga0207644_10015628
1365 Ga0207644_10048009
1366 Ga0207644_10062080
1367 Ga0207644_10126507
1368 Ga0207644_10146813
1369 Ga0207644_10358759
1370 Ga0207644_10474772
1371 Ga0207690_10000481
1372 Ga0207690_10104153
1373 Ga0207690_10154325
1374 Ga0207690_10200626
1375 Ga0207690_10263354
1376 Ga0207690_10291124
1377 Ga0207706_10004920
1378 Ga0207706_10064686
1379 Ga0207706_10079814
1380 Ga0207706_10142662
1381 Ga0207686_10404781
1382 Ga0207670_10012105
1383 Ga0207669_10018975
1384 Ga0207704_10064613
1385 Ga0207704_10122444
1386 Ga0207704_10220779
1387 Ga0207704_10333441
1388 Ga0207665_10092418
1389 Ga0207691_10000318
1390 Ga0207691_10014394
1391 Ga0207691_10042654
1392 Ga0207691_10083172
1393 Ga0207691_10111431
1394 Ga0207691_10717155
1395 Ga0207711_10024699
1396 Ga0207711_10139505
1397 Ga0207711_10377432
1398 Ga0207711_10416288
1399 Ga0207689_10001904
1400 Ga0207689_10013816
1401 Ga0207689_10126735
1402 Ga0207689_10441783
1403 Ga0207661_10092738
1404 Ga0207661_10556995
1405 Ga0207679_10000501
1406 Ga0207679_10005264
1407 Ga0207679_10036386
1408 Ga0207679_10079550
1409 Ga0207651_10000364
1410 Ga0207651_10006026
1411 Ga0207651_10044839
1412 Ga0207668_10012084
1413 Ga0207640_10012872
1414 Ga0207640_10042903
1415 Ga0207640_10060571
1416 Ga0207640_10320555
1417 Ga0207640_10512070
1418 Ga0207658_10002924
1419 Ga0207658_10004551
1420 Ga0207658_10034339
1421 Ga0207658_10156564
1422 Ga0207658_10260453
1423 Ga0207658_10283314
1424 Ga0207677_10004631
1425 Ga0207677_10011733
1426 Ga0207677_10082694
1427 Ga0207677_10142955
1428 Ga0207677_10251608
1429 Ga0207703_10001647
1430 Ga0207703_10031109
1431 Ga0207639_10007604
1432 Ga0207639_10048854
1433 Ga0207639_10055759
1434 Ga0207639_10210448
1435 Ga0207639_10297179
1436 Ga0207678_10011143
1437 Ga0207678_10013097
1438 Ga0207678_10037317
1439 Ga0207678_10088611
1440 Ga0207678_10147103
1441 Ga0207708_10006073
1442 Ga0207708_10310031
1443 Ga0207702_10079153
1444 Ga0207702_10273146
1445 Ga0207702_10348808
1446 Ga0207702_10986600
1447 Ga0207641_10002593
1448 Ga0207641_10038275
1449 Ga0207641_10215708
1450 Ga0207641_10334452
1451 Ga0207641_10641741
1452 Ga0207648_10006568
1453 Ga0207648_10014727
1454 Ga0207648_10043325
1455 Ga0207648_10459498
1456 Ga0207676_10001498
1457 Ga0207676_10017299
1458 Ga0207676_10089900
1459 Ga0207676_10111989
1460 Ga0207674_10008817
1461 Ga0207674_10031394
1462 Ga0207674_10042732
1463 Ga0207674_10313852
1464 Ga0207674_10484958
1465 Ga0207675_100000660
1466 Ga0207675_100001398
1467 Ga0207675_100238802
1468 Ga0207675_100445847
1469 Ga0207683_10010653
1470 Ga0207683_10024630
1471 Ga0207683_10045467
1472 Ga0207683_10088633
1473 Ga0207683_10092786
1474 Ga0207683_10142966
1475 Ga0207683_10209322
1476 Ga0207683_10375733
1477 Ga0207698_10018703
1478 Ga0207698_10078188
1479 Ga0207698_10131871
1480 Ga0207698_10156103
1481 Ga0207698_10207283
1482 Ga0209281_1000023
1483 Ga0209281_1009027
1484 Ga0209389_1025093
1485 Ga0209371_1000701
1486 Ga0209371_1013976
1487 Ga0207428_10190334
1488 Ga0268266_10179297
1489 Ga0268265_10139537
1490 Ga0268264_10079618
1491 Ga0268264_10309352
1492 Ga0307517_10000228
1493 Ga0307515_10007466
1494 Ga0307515_10034913
1495 Ga0307515_10090606
1496 Ga0265338_10009227
1497 Ga0268256_1000945
1498 Ga0268256_1015987
1499 Ga0307512_10023453
1500 Ga0307513_10000006
1501 Ga0307513_10000094
1502 Ga0307513_10015048
1503 Ga0307513_10030687
1504 Ga0307513_10309731
1505 Ga0307509_10000426
1506 Ga0307509_10014271
1507 Ga0307509_10016014
1508 Ga0307509_10124219
1509 Ga0307509_10262741
1510 Ga0307408_100006878
1511 Ga0307408_100012190
1512 Ga0307508_10003969
1513 Ga0307508_10110368
1514 Ga0307508_10204922
1515 Ga0307514_10033315
1516 Ga0307514_10072799
1517 Ga0307516_10132284
1518 Ga0307516_10198561
1519 Ga0307405_10032048
1520 Ga0307405_10188626
1521 Ga0307413_10023007
1522 Ga0307413_10085557
1523 Ga0307413_10098758
1524 Ga0307413_10223240
1525 Ga0307410_10013135
1526 Ga0307410_10140913
1527 Ga0307410_10226142
1528 Ga0307406_10016595
1529 Ga0307406_10094301
1530 Ga0307406_10129970
1531 Ga0307406_10478188
1532 Ga0307407_10054608
1533 Ga0307412_10003825
1534 Ga0307409_100018633
1535 Ga0307409_100030943
1536 Ga0307409_100050461
1537 Ga0307416_100001391
1538 Ga0307414_10466066
1539 Ga0307411_10057250
1540 Ga0307415_100000538
1541 Ga0307507_10183074
1542 Ga0307510_10000109
1543 Ga0307510_10003495
1544 Ga0307510_10007864
1545 Ga0373928_0039003
1546 Ga0373929_0028890
1547 Ga0373944_0012864
1548 Ga0373923_0081516
1549 Ga0373939_0020182
1550 Ga0373945_0008660
1551 Ga0373945_0096489
1552 Ga0373954_0235440
1553 Ga0373956_0157678
1554 Ga0373943_0002106
1555 Ga0373946_0046180
1556 Ga0373955_0098276
1557 Ga0373924_0039178
1558 Ga0373931_0000491
1559 Ga0373931_0006164
1560 Ga0373935_0002582
1561 Ga0373927_0081556
1562 Ga0373927_0274012
1563 Ga0373927_0276567
1564 Ga0373933_0069365
1565 Ga0373947_0006791
1566 Ga0373937_0076146
1567 Ga0373937_0128242
1568 Ga0373937_0410850
1569 Ga0373925_0004170
1570 Ga0373925_0045282
1571 Ga0373925_0062007
1572 Ga0373925_0096138
1573 Ga0373925_0191460
1574 Ga0436365_1236244
1575 Ga0436363_0456608
1576 Ga0451793_0582550
1577 Ga0451795_0193179
1578 Ga0451853_1100378
1579 Ga0439454_001207
1580 Ga0450919_001438
1581 Ga0450920_004372
1582 Ga0439444_0009863
1583 Ga0439460_0006330
1584 Ga0450918_000096
1585 Ga0451577_0018162
1586 Ga0466963_0207307
1587 Ga0453684_0201131
1588 Ga0451576_0191060
1589 Ga0451576_0487563
1590 Ga0495592_0000160
1591 Ga0495592_0033983
1592 Ga0495592_0121318
1593 Ga0495590_0033866
1594 Ga0495629_0001363
1595 Ga0495629_0114734
1596 Ga0495629_0348614
1597 Ga0495638_0103634
1598 Ga0495638_0282548
1599 Ga0495641_0039621
1600 Ga0495651_0018483
1601 Ga0495651_0341012
1602 Ga0495650_0000120
1603 Ga0495580_0006785
1604 Ga0495580_0030291
1605 Ga0495582_0003867
1606 Ga0495639_0004857
1607 Ga0495662_0000639
1608 Ga0495664_0049556
1609 Ga0495594_0009847
1610 Ga0495608_0047219
1611 Ga0495618_0001442
1612 Ga0495618_0209786
1613 Ga0495620_0074303
1614 Ga0495628_0079954
1615 Ga0495628_0347813
1616 Ga0495630_0001164
1617 Ga0495630_0187107
1618 Ga0495632_0107898
1619 Ga0495632_0151213
1620 Ga0495643_0202425
1621 Ga0495666_0037062
1622 Ga0495666_0058819
1623 Ga0495652_0027292
1624 Ga0495665_0007522
1625 Ga0495640_0001826
1626 Ga0495587_0176802
1627 Ga0495597_0025872
1628 Ga0495645_0024687
1629 Ga0495645_0036129
1630 Ga0495622_0104509
1631 Ga0495668_0062278
1632 Ga0495634_0006487
1633 Ga0495625_0022218
1634 Ga0495635_0002326
1635 Ga0495588_0001246
1636 Ga0495657_0326041
1637 Ga0495646_0027416
1638 Ga0495647_0001034
1639 Ga0495647_0143463
1640 Ga0495658_0001010
1641 Ga0495658_0105997
1642 Ga0495613_0005480
1643 Ga0495613_0045220
1644 Ga0495624_0004928
1645 Ga0495670_0140752
1646 Ga0495600_0001933
1647 Ga0495600_0148290
1648 Ga0495660_0000063
1649 Ga0495581_0001615
1650 Ga0495636_0003809
1651 Ga0495674_0011580
1652 Ga0495676_0008905
1653 Ga0495676_0066853
1654 Ga0495680_0001462
1655 Ga0495680_0100026
1656 Ga0495687_000330
1657 Ga0495687_010458
1658 Ga0495687_015164
1659 Ga0495681_0015098
1660 Ga0495684_0001528
1661 Ga0495684_0053681
1662 Ga0495684_0075862
1663 Ga0495593_0004976
1664 Ga0495614_0050180
1665 Ga0495626_0107016
1666 Ga0496100_0012406
1667 Ga0496101_0044204
1668 Ga0496102_0088578
1669 Ga0496104_0005589
1670 Ga0496104_0009568
1671 Ga0496104_0157042
1672 Ga0496105_0024505
1673 Ga0496106_0002439
1674 Ga0496106_0065841
1675 Ga0496106_0263540
1676 Ga0496107_0024352
1677 Ga0496108_0020132
1678 Ga0496108_0031269
1679 Ga0496108_0162658
1680 Ga0496108_0259753
1681 Ga0496108_0279838
1682 Ga0496109_0016343
1683 Ga0496109_0053756
1684 Ga0496109_0333486
1685 Ga0496109_0367734
1686 Ga0496110_0111615
1687 Ga0496110_0170691
1688 Ga0496110_0600876
1689 Ga0496111_0040158
1690 Ga0496111_0103417
1691 Ga0496112_0137197
1692 Ga0496114_0001104
1693 Ga0496114_0098393
1694 Ga0496115_0114022
1695 Ga0496116_0000096
1696 Ga0496117_0000267
1697 Ga0496117_0016545
1698 Ga0496117_0130113
1699 Ga0496118_0000238
1700 Ga0496118_0005162
1701 Ga0496118_0064235
1702 Ga0496119_0007846
1703 Ga0496120_0001781
1704 Ga0496122_0000213
1705 Ga0496123_0000177
1706 Ga0496124_0000026
1707 Ga0496124_0023697
1708 Ga0496125_0000226
1709 Ga0496126_0000632
1710 Ga0501043_0064170
1711 Ga0501035_0580560
1712 nmdc:mga03683_56607_c1
1713 nmdc:mga03683_7061_c1
1714 nmdc:mga0yw44_178587_c1
1715 nmdc:mga0k408_1110_c1
1716 nmdc:mga0k408_1324_c1
1717 nmdc:mga0k408_78543_c1
1718 nmdc:mga06z11_3260_c1
1719 nmdc:mga06z11_41344_c1
1720 nmdc:mga04h51_2183_c1
1721 nmdc:mga07m45_13675_c1
1722 nmdc:mga07m45_139430_c1
1723 nmdc:mga07m45_1430_c1
1724 nmdc:mga07m45_144687_c1
1725 nmdc:mga07m45_630_c1
1726 nmdc:mga07m45_65058_c1
1727 nmdc:mga07m45_7700_c1
1728 nmdc:mga07m45_92398_c1
1729 nmdc:mga08y16_645297_c1
1730 nmdc:mga0rr50_315743_c1
1731 nmdc:mga0rr50_84829_c1
1732 Ga0495601_0000745
1733 Ga0495612_0000694
1734 Ga0495595_0000392
1735 Ga0495619_0001107
1736 Ga0495619_0044288
1737 Ga0500578_0166327
1738 Ga0500644_0002178
1739 Ga0500651_0044723
1740 Ga0500651_0055428
1741 Ga0500555_066251
1742 Ga0500593_001340
1743 Ga0500594_0039051
1744 Ga0500621_051100
1745 Ga0500628_010101
1746 Ga0500652_028153
1747 Ga0500658_0012270
1748 Ga0500559_0001509
1749 Ga0500568_0023974
1750 Ga0500568_0087137
1751 Ga0500604_0023188
1752 Ga0500616_0135097
1753 Ga0500636_0094671
1754 Ga0500645_001182
1755 Ga0500645_004523
1756 Ga0500645_009944
1757 Ga0500661_008225
1758 2511244819
1759 2585826049
1760 2585831833
1761 2599410245
1762 2599904884
1763 2601523457
1764 2601528616
1765 2601615449
1766 2601619625
1767 2601643960
1768 2601648030
1769 2601653501
1770 2601658378
1771 2601663785
1772 2601696334
1773 2601701417
1774 2601706156
1775 2601711741
1776 2601716759
1777 2601721358
1778 2601727165
1779 2601731705
1780 2601736717
1781 2601740317
1782 2601751254
1783 2602018886
1784 2603661173
1785 2603666448
1786 2603839102
1787 2603843638
1788 2603849259
1789 2603854329
1790 2603865658
1791 2603872384
1792 2603877260
1793 2606049565
1794 2606070880
1795 2606147249
1796 2606176974
1797 2637223207
1798 2643860481
1799 2644245230
1800 2644305760
1801 2671109609
1802 2676408616
1803 2777019517
1804 2831866003
1805 2852106325
1806 2881930407
1807 2886851931
1808 2887377380
1809 2904478031
1810 2904517108
1811 2919154005
1812 2927147542
1813 2969080225
1814 2984562681
1815 2984600741

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03328

HpcH_HpaI

HpcH/HpaI aldolase/citrate lyase family

41

267

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
1dxe-assembly1.cif.gz_A 2-dehydro-3-deoxy-galactarate aldolase from escherichia coli 0.9676 6 243
4b5w-assembly1.cif.gz_C crystal structures of divalent metal dependent pyruvate aldolase r70a mutant, hpai, in complex with pyruvate 0.9658 8 243
7v8t-assembly1.cif.gz_F crystal structure of class ii pyruvate aldolase from pseudomonas aeruginosa. 0.9606 8 241
7et9-assembly1.cif.gz_A crystal structure of abhpai-zn-pyruvate complex, class ii aldolase, hpai from acinetobacter baumannii 0.9584 10 241
2v5j-assembly1.cif.gz_B apo class ii aldolase hpch 0.9577 8 243
ID Description Score Start End Superfamily
1dxfA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Phosphoenolpyruvate-binding domains 0.9616 6 243 3.20.20.60
af_P76469_1_267_3.20.20.60 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Phosphoenolpyruvate-binding domains 0.9423 8 242 3.20.20.60
1dxfA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Phosphoenolpyruvate-binding domains 0.9385 6 243 3.20.20.60
4mf4F00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Phosphoenolpyruvate-binding domains 0.936 8 239 3.20.20.60
6r62A00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Phosphoenolpyruvate-binding domains 0.9149 8 243 3.20.20.60
ID Description Score Start End GO Terms
AF-C4AZ63-F1-model_v4 deleted 0.9747 8 126
AF-C1DMY2-F1-model_v4 2,4-dihydroxyhept-2-ene-1,7-dioic acid aldolase 0.9672 8 241 GO:0005737
GO:0016832
AF-A0A315FTA1-F1-model_v4 4-hydroxy-2-oxo-heptane-1,7-dioate aldolase 0.965 8 240 GO:0005737
GO:0016832
AF-A0A5S9N7C9-F1-model_v4 5-keto-4-deoxy-D-glucarate aldolase (EC 4.1.2.20) 0.9649 8 243 GO:0005737
GO:0008672
AF-A0A420WW90-F1-model_v4 2,4-dihydroxyhept-2-enedioate aldolase 0.9647 8 243 GO:0005737
GO:0016832

Map