F485349
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 907 | 303 | 907 | 195 |
Family's Representative Sequence
| Representative Sequence | 3300005614|Ga0068856_100704331|Ga0068856_1007043312 |
| Length | 218 |
| Sequence | MSGGCAKAIELRSYLRLIESIIMPTRSSSPFASGSRVYLRPPRPSDEAAFLRAARASRSLHGRWAKAPSTRTEFASFAKRFGGAAPTHIGFLVFRNADDALCGVFNFSEIVRNAFNSAYLGYYAFAPHAGGGLMTEGFALALDLAFRRLALHRIEVNVQPTNRRSLALVARLHFFCEGYSRRYVKIAGRWRDHVRFAMLAEDWSRLRSVVLTQISRRG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300001976 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 | Metagenome | Rhizosphere |
| 2 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 3 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 4 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 5 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 6 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 7 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 8 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 11 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 12 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 15 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 17 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 18 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 19 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 21 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 22 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 23 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 25 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 32 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 35 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 41 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 42 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 47 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 48 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 49 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 50 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 51 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 53 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 54 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 55 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 56 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 58 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 59 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 63 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 65 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 66 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 67 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 69 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 70 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 71 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 72 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 73 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 74 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 75 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 76 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 77 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 78 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 79 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 80 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 81 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 82 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 83 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 84 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 86 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 87 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 88 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 89 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 90 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 91 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 93 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 122 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 123 | 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 197 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 198 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 199 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 200 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 201 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 202 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 203 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 204 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 205 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 206 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 207 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 208 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 209 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 210 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 211 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 212 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 213 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 214 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 215 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 216 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 217 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 218 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 219 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 220 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 221 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 222 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 223 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 224 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 225 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 226 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 227 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 228 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 229 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 230 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 231 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 232 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 233 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 234 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 235 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 236 | 3300042129 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 | Metagenome | Rhizosphere |
| 237 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 238 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 239 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 240 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 241 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 242 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 269 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 270 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 271 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 272 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 273 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 274 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 275 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 276 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 277 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 278 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 279 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 280 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 281 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 282 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 283 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 284 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 285 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 286 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 287 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 288 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 289 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 290 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 291 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 292 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 293 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 294 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 295 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 296 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 297 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 298 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 299 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 300 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.78 |
| Metatranscriptomes | 0.22 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 3.53 |
| Rhizosphere | 96.36 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.11 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24752J21851_1009839 | 3300001976 | Bacteria | 1248 |
| 2 | JGI24743J22301_10011735 | 3300001991 | Unclassified | 1584 |
| 3 | JGI24748J21848_1021889 | 3300002074 | Bacteria | 773 |
| 4 | JGI24034J26672_10008291 | 3300002239 | Bacteria | 1517 |
| 5 | JGI24751J29686_10034862 | 3300002459 | Bacteria | 1043 |
| 6 | JGI25406J46586_10120319 | 3300003203 | Bacteria | 773 |
| 7 | Ga0065712_10131233 | 3300005290 | Bacteria | 1547 |
| 8 | Ga0070658_10010289 | 3300005327 | Bacteria | 7503 |
| 9 | Ga0070658_10632055 | 3300005327 | Bacteria | 928 |
| 10 | Ga0070676_10001800 | 3300005328 | Bacteria | 10898 |
| 11 | Ga0070676_10014144 | 3300005328 | Bacteria | 4382 |
| 12 | Ga0070676_10312965 | 3300005328 | Bacteria | 1068 |
| 13 | Ga0070683_100009470 | 3300005329 | Bacteria | 8331 |
| 14 | Ga0070683_100136766 | 3300005329 | Unclassified | 2320 |
| 15 | Ga0070683_100162470 | 3300005329 | Bacteria | 2119 |
| 16 | Ga0070683_100316383 | 3300005329 | Bacteria | 1485 |
| 17 | Ga0070690_100011226 | 3300005330 | Bacteria | 5236 |
| 18 | Ga0070690_100016580 | 3300005330 | Bacteria | 4417 |
| 19 | Ga0070690_100038809 | 3300005330 | Bacteria | 3007 |
| 20 | Ga0070690_100069917 | 3300005330 | Bacteria | 2279 |
| 21 | Ga0070690_100354294 | 3300005330 | Bacteria | 1066 |
| 22 | Ga0070670_100029212 | 3300005331 | Bacteria | 4744 |
| 23 | Ga0070670_100067874 | 3300005331 | Bacteria | 3060 |
| 24 | Ga0070670_100082378 | 3300005331 | Unclassified | 2764 |
| 25 | Ga0070670_100111627 | 3300005331 | Bacteria | 2356 |
| 26 | Ga0070670_100234414 | 3300005331 | Bacteria | 1597 |
| 27 | Ga0070670_100830440 | 3300005331 | Bacteria | 835 |
| 28 | Ga0070677_10002166 | 3300005333 | Bacteria | 6280 |
| 29 | Ga0070677_10027843 | 3300005333 | Bacteria | 2131 |
| 30 | Ga0070677_10164128 | 3300005333 | Unclassified | 1045 |
| 31 | Ga0068869_100002048 | 3300005334 | Bacteria | 12109 |
| 32 | Ga0068869_100023950 | 3300005334 | Bacteria | 4224 |
| 33 | Ga0068869_100097166 | 3300005334 | Bacteria | 2224 |
| 34 | Ga0068869_100233465 | 3300005334 | Bacteria | 1462 |
| 35 | Ga0070666_10003156 | 3300005335 | Bacteria | 10011 |
| 36 | Ga0070666_10006568 | 3300005335 | Bacteria | 7146 |
| 37 | Ga0070666_10066112 | 3300005335 | Unclassified | 2453 |
| 38 | Ga0070666_10151823 | 3300005335 | Bacteria | 1616 |
| 39 | Ga0070666_10212146 | 3300005335 | Bacteria | 1364 |
| 40 | Ga0070666_10223167 | 3300005335 | Bacteria | 1329 |
| 41 | Ga0070680_100029569 | 3300005336 | Bacteria | 4400 |
| 42 | Ga0070680_100041080 | 3300005336 | Bacteria | 3749 |
| 43 | Ga0070680_100111261 | 3300005336 | Bacteria | 2280 |
| 44 | Ga0070680_100226029 | 3300005336 | Bacteria | 1580 |
| 45 | Ga0070682_100018828 | 3300005337 | Bacteria | 4043 |
| 46 | Ga0070682_100034586 | 3300005337 | Bacteria | 3078 |
| 47 | Ga0070682_100091487 | 3300005337 | Unclassified | 1991 |
| 48 | Ga0070682_100309519 | 3300005337 | Bacteria | 1162 |
| 49 | Ga0068868_100000774 | 3300005338 | Bacteria | 21630 |
| 50 | Ga0068868_100015861 | 3300005338 | Bacteria | 5583 |
| 51 | Ga0068868_100016776 | 3300005338 | Bacteria | 5446 |
| 52 | Ga0068868_100090864 | 3300005338 | Bacteria | 2459 |
| 53 | Ga0068868_100165407 | 3300005338 | Unclassified | 1829 |
| 54 | Ga0068868_100500833 | 3300005338 | Bacteria | 1064 |
| 55 | Ga0070660_100007823 | 3300005339 | Bacteria | 7454 |
| 56 | Ga0070660_100028916 | 3300005339 | Bacteria | 4150 |
| 57 | Ga0070660_100037521 | 3300005339 | Bacteria | 3673 |
| 58 | Ga0070660_100041143 | 3300005339 | Bacteria | 3522 |
| 59 | Ga0070660_100064656 | 3300005339 | Bacteria | 2846 |
| 60 | Ga0070689_100012106 | 3300005340 | Bacteria | 6203 |
| 61 | Ga0070689_100047874 | 3300005340 | Bacteria | 3296 |
| 62 | Ga0070689_100224826 | 3300005340 | Bacteria | 1541 |
| 63 | Ga0070689_100953704 | 3300005340 | Bacteria | 761 |
| 64 | Ga0070691_10077539 | 3300005341 | Bacteria | 1622 |
| 65 | Ga0070687_100001561 | 3300005343 | Bacteria | 8134 |
| 66 | Ga0070687_100160803 | 3300005343 | Unclassified | 1327 |
| 67 | Ga0070661_100004591 | 3300005344 | Bacteria | 9497 |
| 68 | Ga0070661_100019359 | 3300005344 | Bacteria | 4852 |
| 69 | Ga0070661_100045024 | 3300005344 | Unclassified | 3225 |
| 70 | Ga0070661_100070871 | 3300005344 | Bacteria | 2564 |
| 71 | Ga0070661_100172627 | 3300005344 | Bacteria | 1642 |
| 72 | Ga0070692_10013193 | 3300005345 | Bacteria | 3847 |
| 73 | Ga0070692_10056178 | 3300005345 | Bacteria | 2061 |
| 74 | Ga0070668_100003095 | 3300005347 | Bacteria | 12292 |
| 75 | Ga0070668_100017531 | 3300005347 | Bacteria | 5371 |
| 76 | Ga0070668_100023123 | 3300005347 | Bacteria | 4698 |
| 77 | Ga0070668_100030960 | 3300005347 | Bacteria | 4071 |
| 78 | Ga0070668_100053853 | 3300005347 | Bacteria | 3102 |
| 79 | Ga0070668_100125054 | 3300005347 | Bacteria | 2059 |
| 80 | Ga0070669_100001056 | 3300005353 | Bacteria | 20146 |
| 81 | Ga0070669_100013619 | 3300005353 | Bacteria | 5780 |
| 82 | Ga0070669_100064961 | 3300005353 | Bacteria | 2688 |
| 83 | Ga0070669_100080175 | 3300005353 | Unclassified | 2429 |
| 84 | Ga0070669_100110702 | 3300005353 | Unclassified | 2084 |
| 85 | Ga0070669_100157476 | 3300005353 | Unclassified | 1762 |
| 86 | Ga0070669_100761884 | 3300005353 | Bacteria | 821 |
| 87 | Ga0070675_100003008 | 3300005354 | Bacteria | 12724 |
| 88 | Ga0070675_100405076 | 3300005354 | Bacteria | 1217 |
| 89 | Ga0070675_100580005 | 3300005354 | Bacteria | 1016 |
| 90 | Ga0070671_100010164 | 3300005355 | Bacteria | 7553 |
| 91 | Ga0070671_100014026 | 3300005355 | Bacteria | 6471 |
| 92 | Ga0070671_100048480 | 3300005355 | Bacteria | 3532 |
| 93 | Ga0070671_100647353 | 3300005355 | Bacteria | 915 |
| 94 | Ga0070674_100002939 | 3300005356 | Bacteria | 9447 |
| 95 | Ga0070674_100022959 | 3300005356 | Bacteria | 4028 |
| 96 | Ga0070674_100061392 | 3300005356 | Bacteria | 2623 |
| 97 | Ga0070673_100002518 | 3300005364 | Bacteria | 11189 |
| 98 | Ga0070673_100024244 | 3300005364 | Bacteria | 4446 |
| 99 | Ga0070673_100042195 | 3300005364 | Bacteria | 3515 |
| 100 | Ga0070673_100180112 | 3300005364 | Bacteria | 1809 |
| 101 | Ga0070673_100328514 | 3300005364 | Bacteria | 1352 |
| 102 | Ga0070688_100006442 | 3300005365 | Bacteria | 6276 |
| 103 | Ga0070688_100013781 | 3300005365 | Bacteria | 4569 |
| 104 | Ga0070688_100101811 | 3300005365 | Bacteria | 1895 |
| 105 | Ga0070659_100001467 | 3300005366 | Bacteria | 16988 |
| 106 | Ga0070659_100004493 | 3300005366 | Bacteria | 9963 |
| 107 | Ga0070659_100035551 | 3300005366 | Unclassified | 3879 |
| 108 | Ga0070659_100042607 | 3300005366 | Bacteria | 3549 |
| 109 | Ga0070659_100161228 | 3300005366 | Unclassified | 1834 |
| 110 | Ga0070659_100417198 | 3300005366 | Bacteria | 1135 |
| 111 | Ga0070659_100678171 | 3300005366 | Bacteria | 890 |
| 112 | Ga0070667_100004783 | 3300005367 | Bacteria | 11341 |
| 113 | Ga0070667_100032146 | 3300005367 | Bacteria | 4376 |
| 114 | Ga0070667_100032527 | 3300005367 | Bacteria | 4351 |
| 115 | Ga0070667_100032899 | 3300005367 | Bacteria | 4328 |
| 116 | Ga0070667_100058368 | 3300005367 | Bacteria | 3262 |
| 117 | Ga0070667_100123319 | 3300005367 | Bacteria | 2256 |
| 118 | Ga0070667_100415956 | 3300005367 | Bacteria | 1225 |
| 119 | Ga0070667_100439572 | 3300005367 | Bacteria | 1191 |
| 120 | Ga0070667_100442121 | 3300005367 | Unclassified | 1187 |
| 121 | Ga0070667_100753131 | 3300005367 | Unclassified | 903 |
| 122 | Ga0070709_10011638 | 3300005434 | Bacteria | 4909 |
| 123 | Ga0070709_10149690 | 3300005434 | Unclassified | 1612 |
| 124 | Ga0070709_10163314 | 3300005434 | Bacteria | 1550 |
| 125 | Ga0070709_10214450 | 3300005434 | Unclassified | 1370 |
| 126 | Ga0070714_100001561 | 3300005435 | Bacteria | 16680 |
| 127 | Ga0070714_100179355 | 3300005435 | Bacteria | 1926 |
| 128 | Ga0070713_100000035 | 3300005436 | Bacteria | 86284 |
| 129 | Ga0070713_100031713 | 3300005436 | Bacteria | 4212 |
| 130 | Ga0070713_100165937 | 3300005436 | Bacteria | 1974 |
| 131 | Ga0070710_10001992 | 3300005437 | Bacteria | 9678 |
| 132 | Ga0070710_10111654 | 3300005437 | Bacteria | 1643 |
| 133 | Ga0070711_100008712 | 3300005439 | Bacteria | 6224 |
| 134 | Ga0070711_100011788 | 3300005439 | Bacteria | 5439 |
| 135 | Ga0070711_100179840 | 3300005439 | Bacteria | 1619 |
| 136 | Ga0070705_100065933 | 3300005440 | Bacteria | 2169 |
| 137 | Ga0070705_100099438 | 3300005440 | Unclassified | 1833 |
| 138 | Ga0070700_100105515 | 3300005441 | Unclassified | 1863 |
| 139 | Ga0070694_100055128 | 3300005444 | Bacteria | 2695 |
| 140 | Ga0070708_100001563 | 3300005445 | Bacteria | 17553 |
| 141 | Ga0070708_100693996 | 3300005445 | Unclassified | 958 |
| 142 | Ga0070663_100003583 | 3300005455 | Bacteria | 8971 |
| 143 | Ga0070663_100016670 | 3300005455 | Bacteria | 4778 |
| 144 | Ga0070663_100064818 | 3300005455 | Unclassified | 2642 |
| 145 | Ga0070663_100723176 | 3300005455 | Unclassified | 848 |
| 146 | Ga0070678_100003520 | 3300005456 | Bacteria | 8735 |
| 147 | Ga0070678_100013450 | 3300005456 | Bacteria | 5132 |
| 148 | Ga0070678_100128334 | 3300005456 | Bacteria | 2011 |
| 149 | Ga0070678_100358216 | 3300005456 | Bacteria | 1256 |
| 150 | Ga0070662_100000514 | 3300005457 | Bacteria | 23259 |
| 151 | Ga0070662_100001751 | 3300005457 | Bacteria | 13369 |
| 152 | Ga0070662_100082979 | 3300005457 | Bacteria | 2391 |
| 153 | Ga0070662_100272617 | 3300005457 | Bacteria | 1367 |
| 154 | Ga0070681_10007078 | 3300005458 | Bacteria | 10921 |
| 155 | Ga0070681_10045765 | 3300005458 | Bacteria | 4377 |
| 156 | Ga0070681_10421880 | 3300005458 | Bacteria | 1246 |
| 157 | Ga0070681_10566782 | 3300005458 | Unclassified | 1049 |
| 158 | Ga0068867_100007386 | 3300005459 | Bacteria | 7774 |
| 159 | Ga0068867_100014417 | 3300005459 | Bacteria | 5601 |
| 160 | Ga0068867_100019395 | 3300005459 | Bacteria | 4846 |
| 161 | Ga0068867_100056617 | 3300005459 | Unclassified | 2901 |
| 162 | Ga0068867_100288194 | 3300005459 | Bacteria | 1349 |
| 163 | Ga0068867_100385747 | 3300005459 | Bacteria | 1178 |
| 164 | Ga0070685_10002325 | 3300005466 | Bacteria | 9797 |
| 165 | Ga0070685_10013823 | 3300005466 | Bacteria | 4267 |
| 166 | Ga0070685_10318383 | 3300005466 | Bacteria | 1053 |
| 167 | Ga0070706_100024696 | 3300005467 | Bacteria | 5533 |
| 168 | Ga0070707_100051744 | 3300005468 | Bacteria | 3937 |
| 169 | Ga0070707_100065852 | 3300005468 | Bacteria | 3481 |
| 170 | Ga0070699_100005607 | 3300005518 | Bacteria | 11008 |
| 171 | Ga0070679_100032998 | 3300005530 | Bacteria | 5124 |
| 172 | Ga0070679_100051349 | 3300005530 | Bacteria | 4107 |
| 173 | Ga0070679_100253794 | 3300005530 | Unclassified | 1714 |
| 174 | Ga0070679_100355836 | 3300005530 | Bacteria | 1412 |
| 175 | Ga0070679_100402222 | 3300005530 | Bacteria | 1315 |
| 176 | Ga0070679_100750751 | 3300005530 | Unclassified | 918 |
| 177 | Ga0070684_100003343 | 3300005535 | Bacteria | 12011 |
| 178 | Ga0070684_100061871 | 3300005535 | Bacteria | 3277 |
| 179 | Ga0070684_101240747 | 3300005535 | Bacteria | 701 |
| 180 | Ga0070697_100088588 | 3300005536 | Bacteria | 2556 |
| 181 | Ga0068853_100006454 | 3300005539 | Bacteria | 9326 |
| 182 | Ga0068853_100263299 | 3300005539 | Bacteria | 1586 |
| 183 | Ga0068853_100281420 | 3300005539 | Unclassified | 1533 |
| 184 | Ga0070672_100012616 | 3300005543 | Bacteria | 5942 |
| 185 | Ga0070672_100017957 | 3300005543 | Bacteria | 5103 |
| 186 | Ga0070672_100019414 | 3300005543 | Bacteria | 4933 |
| 187 | Ga0070672_100042097 | 3300005543 | Unclassified | 3515 |
| 188 | Ga0070672_100083055 | 3300005543 | Bacteria | 2570 |
| 189 | Ga0070672_100139150 | 3300005543 | Bacteria | 2001 |
| 190 | Ga0070686_100003848 | 3300005544 | Bacteria | 8258 |
| 191 | Ga0070695_100022414 | 3300005545 | Bacteria | 3873 |
| 192 | Ga0070696_100039595 | 3300005546 | Unclassified | 3254 |
| 193 | Ga0070696_100056482 | 3300005546 | Bacteria | 2738 |
| 194 | Ga0070696_100213044 | 3300005546 | Bacteria | 1447 |
| 195 | Ga0070693_100005461 | 3300005547 | Bacteria | 6112 |
| 196 | Ga0070693_100006452 | 3300005547 | Bacteria | 5689 |
| 197 | Ga0070693_100196895 | 3300005547 | Unclassified | 1306 |
| 198 | Ga0070693_100204273 | 3300005547 | Unclassified | 1285 |
| 199 | Ga0070665_100002901 | 3300005548 | Bacteria | 18520 |
| 200 | Ga0070665_100004716 | 3300005548 | Bacteria | 14204 |
| 201 | Ga0070665_100005543 | 3300005548 | Bacteria | 12980 |
| 202 | Ga0070665_100107353 | 3300005548 | Bacteria | 2794 |
| 203 | Ga0070665_100850069 | 3300005548 | Bacteria | 926 |
| 204 | Ga0068855_100003365 | 3300005563 | Bacteria | 19579 |
| 205 | Ga0068855_100004748 | 3300005563 | Bacteria | 16593 |
| 206 | Ga0068855_100142436 | 3300005563 | Bacteria | 2731 |
| 207 | Ga0068855_100155977 | 3300005563 | Bacteria | 2594 |
| 208 | Ga0068855_101009991 | 3300005563 | Bacteria | 873 |
| 209 | Ga0070664_100000603 | 3300005564 | Bacteria | 27498 |
| 210 | Ga0070664_100015292 | 3300005564 | Bacteria | 6274 |
| 211 | Ga0070664_100082272 | 3300005564 | Bacteria | 2776 |
| 212 | Ga0070664_100140797 | 3300005564 | Bacteria | 2124 |
| 213 | Ga0070664_100230370 | 3300005564 | Unclassified | 1660 |
| 214 | Ga0070664_100962318 | 3300005564 | Bacteria | 802 |
| 215 | Ga0070664_101057691 | 3300005564 | Bacteria | 764 |
| 216 | Ga0068857_100008941 | 3300005577 | Bacteria | 8678 |
| 217 | Ga0068857_100032329 | 3300005577 | Bacteria | 4626 |
| 218 | Ga0068857_100095377 | 3300005577 | Unclassified | 2665 |
| 219 | Ga0068857_100260336 | 3300005577 | Bacteria | 1592 |
| 220 | Ga0068857_100591178 | 3300005577 | Bacteria | 1048 |
| 221 | Ga0068854_100016392 | 3300005578 | Bacteria | 4939 |
| 222 | Ga0068854_100040073 | 3300005578 | Bacteria | 3303 |
| 223 | Ga0068854_100127237 | 3300005578 | Unclassified | 1941 |
| 224 | Ga0068854_100168046 | 3300005578 | Bacteria | 1704 |
| 225 | Ga0068854_100339589 | 3300005578 | Bacteria | 1226 |
| 226 | Ga0068856_100004285 | 3300005614 | Bacteria | 14234 |
| 227 | Ga0068856_100006811 | 3300005614 | Bacteria | 11183 |
| 228 | Ga0068856_100015427 | 3300005614 | Bacteria | 7383 |
| 229 | Ga0068856_100069088 | 3300005614 | Bacteria | 3493 |
| 230 | Ga0068856_100146518 | 3300005614 | Bacteria | 2369 |
| 231 | Ga0068856_100315113 | 3300005614 | Unclassified | 1582 |
| 232 | Ga0068856_100421830 | 3300005614 | Unclassified | 1354 |
| 233 | Ga0068856_100704331 | 3300005614 | Bacteria | 1030 |
| 234 | Ga0070702_100008097 | 3300005615 | Bacteria | 5077 |
| 235 | Ga0070702_100016023 | 3300005615 | Bacteria | 3839 |
| 236 | Ga0068852_100004904 | 3300005616 | Bacteria | 9502 |
| 237 | Ga0068852_100007597 | 3300005616 | Bacteria | 7927 |
| 238 | Ga0068852_100066353 | 3300005616 | Bacteria | 3151 |
| 239 | Ga0068852_100197212 | 3300005616 | Unclassified | 1903 |
| 240 | Ga0068852_100229474 | 3300005616 | Bacteria | 1769 |
| 241 | Ga0068852_100490942 | 3300005616 | Unclassified | 1221 |
| 242 | Ga0068852_100532235 | 3300005616 | Bacteria | 1173 |
| 243 | Ga0068859_100000538 | 3300005617 | Bacteria | 37506 |
| 244 | Ga0068859_100002241 | 3300005617 | Bacteria | 19618 |
| 245 | Ga0068859_100011797 | 3300005617 | Bacteria | 8780 |
| 246 | Ga0068859_100024952 | 3300005617 | Bacteria | 6000 |
| 247 | Ga0068859_100295047 | 3300005617 | Bacteria | 1714 |
| 248 | Ga0068859_100602005 | 3300005617 | Bacteria | 1192 |
| 249 | Ga0068859_100751572 | 3300005617 | Bacteria | 1064 |
| 250 | Ga0068864_100000566 | 3300005618 | Bacteria | 31533 |
| 251 | Ga0068864_100009639 | 3300005618 | Bacteria | 7967 |
| 252 | Ga0068864_100010761 | 3300005618 | Bacteria | 7560 |
| 253 | Ga0068864_100064811 | 3300005618 | Bacteria | 3169 |
| 254 | Ga0068864_100070071 | 3300005618 | Bacteria | 3050 |
| 255 | Ga0068864_100140941 | 3300005618 | Bacteria | 2175 |
| 256 | Ga0068864_100415537 | 3300005618 | Bacteria | 1281 |
| 257 | Ga0068866_10009303 | 3300005718 | Bacteria | 4167 |
| 258 | Ga0068866_10011749 | 3300005718 | Bacteria | 3798 |
| 259 | Ga0068861_100019043 | 3300005719 | Bacteria | 4899 |
| 260 | Ga0068861_100037669 | 3300005719 | Bacteria | 3595 |
| 261 | Ga0068861_100069168 | 3300005719 | Bacteria | 2730 |
| 262 | Ga0068861_100074449 | 3300005719 | Bacteria | 2641 |
| 263 | Ga0068861_100734009 | 3300005719 | Bacteria | 921 |
| 264 | Ga0068851_10000426 | 3300005834 | Bacteria | 18827 |
| 265 | Ga0068851_10011782 | 3300005834 | Bacteria | 4107 |
| 266 | Ga0068851_10056517 | 3300005834 | Unclassified | 2002 |
| 267 | Ga0068851_10130146 | 3300005834 | Bacteria | 1360 |
| 268 | Ga0068851_10261738 | 3300005834 | Bacteria | 984 |
| 269 | Ga0068851_10264288 | 3300005834 | Bacteria | 979 |
| 270 | Ga0068870_10008049 | 3300005840 | Bacteria | 4723 |
| 271 | Ga0068870_10036326 | 3300005840 | Bacteria | 2534 |
| 272 | Ga0068870_10119904 | 3300005840 | Unclassified | 1514 |
| 273 | Ga0068870_10210434 | 3300005840 | Unclassified | 1184 |
| 274 | Ga0068863_100001174 | 3300005841 | Bacteria | 26150 |
| 275 | Ga0068863_100001288 | 3300005841 | Bacteria | 25037 |
| 276 | Ga0068863_100009743 | 3300005841 | Bacteria | 9371 |
| 277 | Ga0068863_100022056 | 3300005841 | Bacteria | 6081 |
| 278 | Ga0068863_100103620 | 3300005841 | Bacteria | 2706 |
| 279 | Ga0068863_100237443 | 3300005841 | Bacteria | 1759 |
| 280 | Ga0068863_100355213 | 3300005841 | Bacteria | 1428 |
| 281 | Ga0068858_100001310 | 3300005842 | Bacteria | 25695 |
| 282 | Ga0068858_100004050 | 3300005842 | Bacteria | 14449 |
| 283 | Ga0068858_100013137 | 3300005842 | Bacteria | 7808 |
| 284 | Ga0068858_100052246 | 3300005842 | Bacteria | 3780 |
| 285 | Ga0068858_100347013 | 3300005842 | Bacteria | 1421 |
| 286 | Ga0068860_100001659 | 3300005843 | Bacteria | 23813 |
| 287 | Ga0068860_100002991 | 3300005843 | Bacteria | 17457 |
| 288 | Ga0068860_100008441 | 3300005843 | Bacteria | 10261 |
| 289 | Ga0068860_100036770 | 3300005843 | Bacteria | 4689 |
| 290 | Ga0068860_100115903 | 3300005843 | Bacteria | 2562 |
| 291 | Ga0068860_100136551 | 3300005843 | Bacteria | 2355 |
| 292 | Ga0068860_100270375 | 3300005843 | Bacteria | 1659 |
| 293 | Ga0068860_100358511 | 3300005843 | Bacteria | 1436 |
| 294 | Ga0068862_100030188 | 3300005844 | Bacteria | 4568 |
| 295 | Ga0068862_100058816 | 3300005844 | Bacteria | 3298 |
| 296 | Ga0068862_100184800 | 3300005844 | Unclassified | 1872 |
| 297 | Ga0081455_10450271 | 3300005937 | Unclassified | 879 |
| 298 | Ga0081539_10046006 | 3300005985 | Bacteria | 2504 |
| 299 | Ga0081539_10066694 | 3300005985 | Bacteria | 1949 |
| 300 | Ga0070715_10004661 | 3300006163 | Bacteria | 4522 |
| 301 | Ga0070716_100021241 | 3300006173 | Bacteria | 3418 |
| 302 | Ga0070712_100050075 | 3300006175 | Unclassified | 2904 |
| 303 | Ga0070712_100055613 | 3300006175 | Bacteria | 2772 |
| 304 | Ga0097621_100002601 | 3300006237 | Bacteria | 12371 |
| 305 | Ga0097621_100085550 | 3300006237 | Unclassified | 2630 |
| 306 | Ga0068871_100021424 | 3300006358 | Bacteria | 4967 |
| 307 | Ga0068871_100027967 | 3300006358 | Unclassified | 4416 |
| 308 | Ga0068871_100036725 | 3300006358 | Bacteria | 3902 |
| 309 | Ga0068871_100212526 | 3300006358 | Bacteria | 1673 |
| 310 | Ga0075428_100044002 | 3300006844 | Bacteria | 4908 |
| 311 | Ga0075428_100309644 | 3300006844 | Bacteria | 1697 |
| 312 | Ga0075433_10371263 | 3300006852 | Bacteria | 1263 |
| 313 | Ga0075434_100135392 | 3300006871 | Bacteria | 2483 |
| 314 | Ga0068865_100017550 | 3300006881 | Bacteria | 4605 |
| 315 | Ga0068865_100038653 | 3300006881 | Bacteria | 3232 |
| 316 | Ga0068865_100052527 | 3300006881 | Bacteria | 2825 |
| 317 | Ga0068865_100539139 | 3300006881 | Bacteria | 978 |
| 318 | Ga0075436_100079449 | 3300006914 | Bacteria | 2272 |
| 319 | Ga0097620_100000538 | 3300006931 | Bacteria | 37506 |
| 320 | Ga0097620_100002241 | 3300006931 | Bacteria | 19618 |
| 321 | Ga0097620_100011796 | 3300006931 | Bacteria | 8780 |
| 322 | Ga0097620_100024954 | 3300006931 | Bacteria | 6000 |
| 323 | Ga0097620_100295058 | 3300006931 | Bacteria | 1714 |
| 324 | Ga0097620_100602056 | 3300006931 | Bacteria | 1192 |
| 325 | Ga0097620_100751526 | 3300006931 | Bacteria | 1064 |
| 326 | Ga0075435_100737441 | 3300007076 | Unclassified | 857 |
| 327 | Ga0105240_10016388 | 3300009093 | Bacteria | 10034 |
| 328 | Ga0105240_10029251 | 3300009093 | Bacteria | 7184 |
| 329 | Ga0105240_10076475 | 3300009093 | Bacteria | 4126 |
| 330 | Ga0111539_10104443 | 3300009094 | Bacteria | 3324 |
| 331 | Ga0111539_10243953 | 3300009094 | Bacteria | 2092 |
| 332 | Ga0111539_10461455 | 3300009094 | Bacteria | 1479 |
| 333 | Ga0111539_10701658 | 3300009094 | Unclassified | 1178 |
| 334 | Ga0105245_10004136 | 3300009098 | Bacteria | 12888 |
| 335 | Ga0105245_10011558 | 3300009098 | Bacteria | 7689 |
| 336 | Ga0105245_10040547 | 3300009098 | Bacteria | 4149 |
| 337 | Ga0105245_10154086 | 3300009098 | Bacteria | 2175 |
| 338 | Ga0105245_11355215 | 3300009098 | Bacteria | 761 |
| 339 | Ga0105247_10005328 | 3300009101 | Bacteria | 8107 |
| 340 | Ga0105247_10257282 | 3300009101 | Bacteria | 1196 |
| 341 | Ga0105243_10237471 | 3300009148 | Unclassified | 1620 |
| 342 | Ga0105241_10122743 | 3300009174 | Bacteria | 2094 |
| 343 | Ga0105241_10179358 | 3300009174 | Bacteria | 1756 |
| 344 | Ga0105241_10192933 | 3300009174 | Bacteria | 1696 |
| 345 | Ga0105242_10024712 | 3300009176 | Bacteria | 4747 |
| 346 | Ga0105242_10083702 | 3300009176 | Bacteria | 2672 |
| 347 | Ga0105242_10098208 | 3300009176 | Bacteria | 2477 |
| 348 | Ga0105242_10365529 | 3300009176 | Unclassified | 1336 |
| 349 | Ga0105248_10001811 | 3300009177 | Bacteria | 23753 |
| 350 | Ga0105248_10017422 | 3300009177 | Bacteria | 7920 |
| 351 | Ga0105248_10042963 | 3300009177 | Bacteria | 5068 |
| 352 | Ga0105248_10044269 | 3300009177 | Bacteria | 4992 |
| 353 | Ga0105248_10392887 | 3300009177 | Bacteria | 1562 |
| 354 | Ga0105248_10562616 | 3300009177 | Bacteria | 1286 |
| 355 | Ga0105248_11625282 | 3300009177 | Unclassified | 732 |
| 356 | Ga0105248_12174003 | 3300009177 | Bacteria | 631 |
| 357 | Ga0105237_10133995 | 3300009545 | Bacteria | 2472 |
| 358 | Ga0105237_10141586 | 3300009545 | Bacteria | 2399 |
| 359 | Ga0105237_10414616 | 3300009545 | Bacteria | 1352 |
| 360 | Ga0105238_10207161 | 3300009551 | Bacteria | 1937 |
| 361 | Ga0105249_10253320 | 3300009553 | Bacteria | 1746 |
| 362 | Ga0105239_10005432 | 3300010375 | Bacteria | 14957 |
| 363 | Ga0105239_10104937 | 3300010375 | Bacteria | 3129 |
| 364 | Ga0105246_10016551 | 3300011119 | Bacteria | 4670 |
| 365 | Ga0105246_10029542 | 3300011119 | Bacteria | 3611 |
| 366 | Ga0105246_11024521 | 3300011119 | Unclassified | 749 |
| 367 | Ga0157373_10001627 | 3300013100 | Bacteria | 17144 |
| 368 | Ga0157373_10004575 | 3300013100 | Bacteria | 10405 |
| 369 | Ga0157373_10170280 | 3300013100 | Bacteria | 1532 |
| 370 | Ga0157371_10000614 | 3300013102 | Bacteria | 42414 |
| 371 | Ga0157371_10098999 | 3300013102 | Bacteria | 2067 |
| 372 | Ga0157370_10002272 | 3300013104 | Bacteria | 23306 |
| 373 | Ga0157370_10016162 | 3300013104 | Bacteria | 7565 |
| 374 | Ga0157370_10017667 | 3300013104 | Bacteria | 7190 |
| 375 | Ga0157370_10017934 | 3300013104 | Bacteria | 7129 |
| 376 | Ga0157370_10041269 | 3300013104 | Bacteria | 4453 |
| 377 | Ga0157370_10088675 | 3300013104 | Bacteria | 2905 |
| 378 | Ga0157370_10174463 | 3300013104 | Unclassified | 1998 |
| 379 | Ga0157370_10394901 | 3300013104 | Unclassified | 1273 |
| 380 | Ga0157369_10025834 | 3300013105 | Bacteria | 6515 |
| 381 | Ga0157369_10073906 | 3300013105 | Bacteria | 3656 |
| 382 | Ga0157369_10111900 | 3300013105 | Bacteria | 2901 |
| 383 | Ga0157369_10513243 | 3300013105 | Bacteria | 1240 |
| 384 | Ga0157374_10000346 | 3300013296 | Bacteria | 42858 |
| 385 | Ga0157374_10009463 | 3300013296 | Bacteria | 8365 |
| 386 | Ga0157374_10040506 | 3300013296 | Bacteria | 4291 |
| 387 | Ga0157374_10122413 | 3300013296 | Unclassified | 2512 |
| 388 | Ga0157378_10022161 | 3300013297 | Bacteria | 5590 |
| 389 | Ga0157378_10077834 | 3300013297 | Bacteria | 2990 |
| 390 | Ga0157378_10088666 | 3300013297 | Unclassified | 2808 |
| 391 | Ga0157378_10123824 | 3300013297 | Bacteria | 2386 |
| 392 | Ga0163162_10004891 | 3300013306 | Bacteria | 12917 |
| 393 | Ga0163162_10028327 | 3300013306 | Bacteria | 5541 |
| 394 | Ga0163162_10045691 | 3300013306 | Bacteria | 4387 |
| 395 | Ga0157372_10005628 | 3300013307 | Bacteria | 13321 |
| 396 | Ga0157372_10039506 | 3300013307 | Bacteria | 5209 |
| 397 | Ga0157372_10095006 | 3300013307 | Bacteria | 3396 |
| 398 | Ga0157372_10152472 | 3300013307 | Bacteria | 2668 |
| 399 | Ga0157372_10166276 | 3300013307 | Bacteria | 2551 |
| 400 | Ga0157372_10197651 | 3300013307 | Unclassified | 2329 |
| 401 | Ga0157372_10307335 | 3300013307 | Bacteria | 1845 |
| 402 | Ga0157372_10451955 | 3300013307 | Bacteria | 1497 |
| 403 | Ga0157372_11096720 | 3300013307 | Bacteria | 921 |
| 404 | Ga0157372_11787965 | 3300013307 | Bacteria | 707 |
| 405 | Ga0157375_10021582 | 3300013308 | Bacteria | 5908 |
| 406 | Ga0157375_10030471 | 3300013308 | Bacteria | 5087 |
| 407 | Ga0157375_10365791 | 3300013308 | Bacteria | 1608 |
| 408 | Ga0157375_10683039 | 3300013308 | Unclassified | 1181 |
| 409 | Ga0157375_10747611 | 3300013308 | Bacteria | 1129 |
| 410 | Ga0163163_10000834 | 3300014325 | Bacteria | 26217 |
| 411 | Ga0163163_10007776 | 3300014325 | Bacteria | 9473 |
| 412 | Ga0163163_10008499 | 3300014325 | Bacteria | 9125 |
| 413 | Ga0163163_10053997 | 3300014325 | Bacteria | 3968 |
| 414 | Ga0163163_10131417 | 3300014325 | Bacteria | 2544 |
| 415 | Ga0157380_10012389 | 3300014326 | Bacteria | 6186 |
| 416 | Ga0157380_10040189 | 3300014326 | Bacteria | 3641 |
| 417 | Ga0157380_10041417 | 3300014326 | Bacteria | 3594 |
| 418 | Ga0157380_10606100 | 3300014326 | Bacteria | 1084 |
| 419 | Ga0157377_10146791 | 3300014745 | Unclassified | 1455 |
| 420 | Ga0157377_10680455 | 3300014745 | Bacteria | 744 |
| 421 | Ga0157379_10000063 | 3300014968 | Bacteria | 68139 |
| 422 | Ga0157379_10001854 | 3300014968 | Bacteria | 17491 |
| 423 | Ga0157379_10004556 | 3300014968 | Bacteria | 11884 |
| 424 | Ga0157379_10006330 | 3300014968 | Bacteria | 10194 |
| 425 | Ga0157379_10016387 | 3300014968 | Bacteria | 6519 |
| 426 | Ga0157379_11341127 | 3300014968 | Unclassified | 692 |
| 427 | Ga0157376_10039073 | 3300014969 | Bacteria | 3867 |
| 428 | Ga0157376_10046821 | 3300014969 | Bacteria | 3569 |
| 429 | Ga0157376_10109207 | 3300014969 | Bacteria | 2431 |
| 430 | Ga0157376_10125191 | 3300014969 | Bacteria | 2284 |
| 431 | Ga0157376_10468579 | 3300014969 | Bacteria | 1232 |
| 432 | Ga0157376_10485995 | 3300014969 | Bacteria | 1211 |
| 433 | Ga0163161_10003668 | 3300017792 | Bacteria | 10770 |
| 434 | Ga0163161_10056159 | 3300017792 | Bacteria | 2859 |
| 435 | Ga0163161_10298053 | 3300017792 | Bacteria | 1269 |
| 436 | Ga0163161_10560441 | 3300017792 | Bacteria | 937 |
| 437 | Ga0206356_10703160 | 3300020070 | Bacteria | 1323 |
| 438 | Ga0206353_10151062 | 3300020082 | Bacteria | 3656 |
| 439 | Ga0207666_1006598 | 3300025271 | Bacteria | 1509 |
| 440 | Ga0207697_10000020 | 3300025315 | Bacteria | 55999 |
| 441 | Ga0207697_10036401 | 3300025315 | Bacteria | 2015 |
| 442 | Ga0207697_10114552 | 3300025315 | Bacteria | 1156 |
| 443 | Ga0207656_10019699 | 3300025321 | Bacteria | 2671 |
| 444 | Ga0207656_10037791 | 3300025321 | Unclassified | 2033 |
| 445 | Ga0207682_10000288 | 3300025893 | Bacteria | 22923 |
| 446 | Ga0207682_10002688 | 3300025893 | Bacteria | 7915 |
| 447 | Ga0207692_10006582 | 3300025898 | Bacteria | 4721 |
| 448 | Ga0207642_10243214 | 3300025899 | Bacteria | 1017 |
| 449 | Ga0207710_10102492 | 3300025900 | Bacteria | 1351 |
| 450 | Ga0207688_10001077 | 3300025901 | Bacteria | 13977 |
| 451 | Ga0207680_10011012 | 3300025903 | Bacteria | 4552 |
| 452 | Ga0207680_10023928 | 3300025903 | Bacteria | 3343 |
| 453 | Ga0207680_10098903 | 3300025903 | Bacteria | 1871 |
| 454 | Ga0207680_10128823 | 3300025903 | Unclassified | 1665 |
| 455 | Ga0207680_10274973 | 3300025903 | Bacteria | 1169 |
| 456 | Ga0207685_10003418 | 3300025905 | Bacteria | 3857 |
| 457 | Ga0207699_10015000 | 3300025906 | Bacteria | 4014 |
| 458 | Ga0207699_10076189 | 3300025906 | Bacteria | 2066 |
| 459 | Ga0207699_10279188 | 3300025906 | Bacteria | 1160 |
| 460 | Ga0207645_10000353 | 3300025907 | Bacteria | 38206 |
| 461 | Ga0207645_10000516 | 3300025907 | Bacteria | 32079 |
| 462 | Ga0207645_10063635 | 3300025907 | Bacteria | 2357 |
| 463 | Ga0207645_10280271 | 3300025907 | Bacteria | 1107 |
| 464 | Ga0207645_10298064 | 3300025907 | Bacteria | 1073 |
| 465 | Ga0207643_10000131 | 3300025908 | Bacteria | 50934 |
| 466 | Ga0207643_10002024 | 3300025908 | Bacteria | 11195 |
| 467 | Ga0207643_10004088 | 3300025908 | Bacteria | 7849 |
| 468 | Ga0207643_10025935 | 3300025908 | Bacteria | 3243 |
| 469 | Ga0207643_10357630 | 3300025908 | Bacteria | 917 |
| 470 | Ga0207705_10012689 | 3300025909 | Bacteria | 6080 |
| 471 | Ga0207705_10164774 | 3300025909 | Bacteria | 1666 |
| 472 | Ga0207705_10500603 | 3300025909 | Bacteria | 944 |
| 473 | Ga0207684_10101679 | 3300025910 | Bacteria | 2457 |
| 474 | Ga0207654_10006442 | 3300025911 | Bacteria | 5910 |
| 475 | Ga0207654_10138953 | 3300025911 | Bacteria | 1547 |
| 476 | Ga0207654_10155206 | 3300025911 | Bacteria | 1474 |
| 477 | Ga0207707_10012638 | 3300025912 | Bacteria | 7338 |
| 478 | Ga0207707_10042784 | 3300025912 | Bacteria | 3952 |
| 479 | Ga0207707_10309058 | 3300025912 | Bacteria | 1366 |
| 480 | Ga0207707_10659652 | 3300025912 | Bacteria | 881 |
| 481 | Ga0207695_10014173 | 3300025913 | Bacteria | 9460 |
| 482 | Ga0207695_10044252 | 3300025913 | Bacteria | 4736 |
| 483 | Ga0207695_10060626 | 3300025913 | Bacteria | 3915 |
| 484 | Ga0207695_10440028 | 3300025913 | Unclassified | 1187 |
| 485 | Ga0207671_10124032 | 3300025914 | Unclassified | 1977 |
| 486 | Ga0207671_10355524 | 3300025914 | Bacteria | 1162 |
| 487 | Ga0207693_10003162 | 3300025915 | Bacteria | 14146 |
| 488 | Ga0207693_10031128 | 3300025915 | Bacteria | 4215 |
| 489 | Ga0207693_10411464 | 3300025915 | Bacteria | 1057 |
| 490 | Ga0207663_10048994 | 3300025916 | Bacteria | 2618 |
| 491 | Ga0207663_10164514 | 3300025916 | Bacteria | 1570 |
| 492 | Ga0207663_10350726 | 3300025916 | Bacteria | 1117 |
| 493 | Ga0207660_10006657 | 3300025917 | Bacteria | 7494 |
| 494 | Ga0207660_10059370 | 3300025917 | Bacteria | 2746 |
| 495 | Ga0207660_10254586 | 3300025917 | Bacteria | 1386 |
| 496 | Ga0207662_10003213 | 3300025918 | Bacteria | 8366 |
| 497 | Ga0207662_10168223 | 3300025918 | Bacteria | 1404 |
| 498 | Ga0207662_10177995 | 3300025918 | Bacteria | 1367 |
| 499 | Ga0207657_10000838 | 3300025919 | Bacteria | 32510 |
| 500 | Ga0207657_10001142 | 3300025919 | Bacteria | 28211 |
| 501 | Ga0207657_10001514 | 3300025919 | Bacteria | 24886 |
| 502 | Ga0207657_10005375 | 3300025919 | Bacteria | 13408 |
| 503 | Ga0207657_10014488 | 3300025919 | Bacteria | 7694 |
| 504 | Ga0207657_10027603 | 3300025919 | Bacteria | 5197 |
| 505 | Ga0207649_10020195 | 3300025920 | Bacteria | 3817 |
| 506 | Ga0207649_10092390 | 3300025920 | Bacteria | 1984 |
| 507 | Ga0207649_10119325 | 3300025920 | Bacteria | 1776 |
| 508 | Ga0207649_10135513 | 3300025920 | Unclassified | 1678 |
| 509 | Ga0207649_10533631 | 3300025920 | Unclassified | 896 |
| 510 | Ga0207652_10216347 | 3300025921 | Bacteria | 1726 |
| 511 | Ga0207652_10222287 | 3300025921 | Bacteria | 1702 |
| 512 | Ga0207652_10264867 | 3300025921 | Unclassified | 1550 |
| 513 | Ga0207652_10328739 | 3300025921 | Bacteria | 1380 |
| 514 | Ga0207652_10348044 | 3300025921 | Bacteria | 1337 |
| 515 | Ga0207646_10048822 | 3300025922 | Bacteria | 3792 |
| 516 | Ga0207646_10150555 | 3300025922 | Bacteria | 2098 |
| 517 | Ga0207681_10001804 | 3300025923 | Bacteria | 13734 |
| 518 | Ga0207681_10004889 | 3300025923 | Bacteria | 8238 |
| 519 | Ga0207681_10035034 | 3300025923 | Bacteria | 3306 |
| 520 | Ga0207681_10051109 | 3300025923 | Bacteria | 2799 |
| 521 | Ga0207681_10117350 | 3300025923 | Bacteria | 1946 |
| 522 | Ga0207681_10210403 | 3300025923 | Bacteria | 1498 |
| 523 | Ga0207694_10077340 | 3300025924 | Bacteria | 2607 |
| 524 | Ga0207694_10846328 | 3300025924 | Unclassified | 773 |
| 525 | Ga0207650_10015720 | 3300025925 | Bacteria | 5276 |
| 526 | Ga0207650_10022736 | 3300025925 | Bacteria | 4442 |
| 527 | Ga0207650_10120693 | 3300025925 | Bacteria | 2040 |
| 528 | Ga0207659_10006674 | 3300025926 | Bacteria | 7091 |
| 529 | Ga0207659_10009505 | 3300025926 | Bacteria | 6080 |
| 530 | Ga0207687_10003789 | 3300025927 | Bacteria | 10161 |
| 531 | Ga0207687_10004961 | 3300025927 | Bacteria | 8830 |
| 532 | Ga0207687_10048784 | 3300025927 | Bacteria | 2942 |
| 533 | Ga0207687_10387516 | 3300025927 | Bacteria | 1146 |
| 534 | Ga0207700_10000023 | 3300025928 | Bacteria | 152285 |
| 535 | Ga0207700_10065175 | 3300025928 | Bacteria | 2778 |
| 536 | Ga0207700_10069862 | 3300025928 | Bacteria | 2697 |
| 537 | Ga0207700_10223950 | 3300025928 | Unclassified | 1596 |
| 538 | Ga0207700_10235075 | 3300025928 | Bacteria | 1560 |
| 539 | Ga0207664_10004963 | 3300025929 | Bacteria | 9050 |
| 540 | Ga0207664_10008325 | 3300025929 | Bacteria | 7226 |
| 541 | Ga0207664_10013621 | 3300025929 | Bacteria | 5845 |
| 542 | Ga0207664_10261193 | 3300025929 | Bacteria | 1514 |
| 543 | Ga0207664_11296998 | 3300025929 | Unclassified | 648 |
| 544 | Ga0207644_10006550 | 3300025931 | Bacteria | 7588 |
| 545 | Ga0207644_10014097 | 3300025931 | Bacteria | 5346 |
| 546 | Ga0207644_10058219 | 3300025931 | Bacteria | 2792 |
| 547 | Ga0207644_10130900 | 3300025931 | Bacteria | 1920 |
| 548 | Ga0207644_10219477 | 3300025931 | Bacteria | 1506 |
| 549 | Ga0207644_10343860 | 3300025931 | Unclassified | 1210 |
| 550 | Ga0207690_10000802 | 3300025932 | Bacteria | 20178 |
| 551 | Ga0207690_10019366 | 3300025932 | Unclassified | 4189 |
| 552 | Ga0207690_10183824 | 3300025932 | Bacteria | 1576 |
| 553 | Ga0207690_10409050 | 3300025932 | Unclassified | 1083 |
| 554 | Ga0207690_10653633 | 3300025932 | Bacteria | 862 |
| 555 | Ga0207706_10000052 | 3300025933 | Bacteria | 115553 |
| 556 | Ga0207706_10002570 | 3300025933 | Bacteria | 17702 |
| 557 | Ga0207706_10006651 | 3300025933 | Bacteria | 10690 |
| 558 | Ga0207706_10046988 | 3300025933 | Bacteria | 3821 |
| 559 | Ga0207706_10191791 | 3300025933 | Unclassified | 1793 |
| 560 | Ga0207706_10313699 | 3300025933 | Bacteria | 1365 |
| 561 | Ga0207686_10010171 | 3300025934 | Bacteria | 5114 |
| 562 | Ga0207686_10015584 | 3300025934 | Bacteria | 4252 |
| 563 | Ga0207686_10056328 | 3300025934 | Bacteria | 2470 |
| 564 | Ga0207686_10241590 | 3300025934 | Bacteria | 1314 |
| 565 | Ga0207709_10431743 | 3300025935 | Bacteria | 1014 |
| 566 | Ga0207670_10004757 | 3300025936 | Bacteria | 7364 |
| 567 | Ga0207670_10030209 | 3300025936 | Bacteria | 3460 |
| 568 | Ga0207670_10156813 | 3300025936 | Bacteria | 1695 |
| 569 | Ga0207670_10779584 | 3300025936 | Bacteria | 796 |
| 570 | Ga0207669_10003089 | 3300025937 | Bacteria | 7169 |
| 571 | Ga0207669_10006693 | 3300025937 | Bacteria | 5284 |
| 572 | Ga0207669_10007153 | 3300025937 | Bacteria | 5140 |
| 573 | Ga0207669_10070770 | 3300025937 | Bacteria | 2188 |
| 574 | Ga0207669_10263243 | 3300025937 | Bacteria | 1291 |
| 575 | Ga0207704_10088619 | 3300025938 | Bacteria | 2025 |
| 576 | Ga0207704_10109488 | 3300025938 | Bacteria | 1863 |
| 577 | Ga0207665_10012112 | 3300025939 | Bacteria | 5659 |
| 578 | Ga0207665_10025691 | 3300025939 | Bacteria | 3887 |
| 579 | Ga0207691_10000663 | 3300025940 | Bacteria | 33984 |
| 580 | Ga0207691_10031723 | 3300025940 | Bacteria | 4930 |
| 581 | Ga0207691_10038134 | 3300025940 | Bacteria | 4446 |
| 582 | Ga0207691_10042435 | 3300025940 | Unclassified | 4193 |
| 583 | Ga0207691_10054892 | 3300025940 | Bacteria | 3633 |
| 584 | Ga0207691_10084220 | 3300025940 | Bacteria | 2854 |
| 585 | Ga0207691_10156979 | 3300025940 | Bacteria | 1998 |
| 586 | Ga0207691_10230540 | 3300025940 | Unclassified | 1604 |
| 587 | Ga0207691_10679550 | 3300025940 | Unclassified | 869 |
| 588 | Ga0207711_10000741 | 3300025941 | Bacteria | 32019 |
| 589 | Ga0207711_10027614 | 3300025941 | Bacteria | 4768 |
| 590 | Ga0207711_10134208 | 3300025941 | Archaea | 2222 |
| 591 | Ga0207711_10229408 | 3300025941 | Bacteria | 1700 |
| 592 | Ga0207711_10396589 | 3300025941 | Unclassified | 1282 |
| 593 | Ga0207689_10000091 | 3300025942 | Bacteria | 73260 |
| 594 | Ga0207689_10002629 | 3300025942 | Bacteria | 16626 |
| 595 | Ga0207689_10005593 | 3300025942 | Bacteria | 11204 |
| 596 | Ga0207689_10021888 | 3300025942 | Bacteria | 5376 |
| 597 | Ga0207689_10027409 | 3300025942 | Unclassified | 4769 |
| 598 | Ga0207689_10081081 | 3300025942 | Bacteria | 2667 |
| 599 | Ga0207689_10239495 | 3300025942 | Bacteria | 1500 |
| 600 | Ga0207689_10242062 | 3300025942 | Bacteria | 1491 |
| 601 | Ga0207661_10033692 | 3300025944 | Bacteria | 3977 |
| 602 | Ga0207661_10182006 | 3300025944 | Unclassified | 1836 |
| 603 | Ga0207679_10009761 | 3300025945 | Bacteria | 6158 |
| 604 | Ga0207679_10025870 | 3300025945 | Bacteria | 4041 |
| 605 | Ga0207679_10034570 | 3300025945 | Bacteria | 3567 |
| 606 | Ga0207679_10138470 | 3300025945 | Bacteria | 1964 |
| 607 | Ga0207679_10143797 | 3300025945 | Bacteria | 1931 |
| 608 | Ga0207679_10202353 | 3300025945 | Unclassified | 1659 |
| 609 | Ga0207667_10002090 | 3300025949 | Bacteria | 25032 |
| 610 | Ga0207667_10004899 | 3300025949 | Bacteria | 16348 |
| 611 | Ga0207667_10016222 | 3300025949 | Bacteria | 8418 |
| 612 | Ga0207667_10089248 | 3300025949 | Bacteria | 3186 |
| 613 | Ga0207667_10126075 | 3300025949 | Bacteria | 2637 |
| 614 | Ga0207667_10129870 | 3300025949 | Bacteria | 2595 |
| 615 | Ga0207667_10161080 | 3300025949 | Bacteria | 2308 |
| 616 | Ga0207667_10810816 | 3300025949 | Unclassified | 932 |
| 617 | Ga0207651_10023051 | 3300025960 | Bacteria | 3821 |
| 618 | Ga0207651_10026254 | 3300025960 | Bacteria | 3634 |
| 619 | Ga0207651_10092840 | 3300025960 | Unclassified | 2214 |
| 620 | Ga0207651_10147366 | 3300025960 | Bacteria | 1827 |
| 621 | Ga0207712_10049868 | 3300025961 | Unclassified | 2920 |
| 622 | Ga0207712_10058143 | 3300025961 | Bacteria | 2731 |
| 623 | Ga0207712_10143346 | 3300025961 | Bacteria | 1836 |
| 624 | Ga0207668_10035134 | 3300025972 | Bacteria | 3334 |
| 625 | Ga0207668_10102684 | 3300025972 | Bacteria | 2128 |
| 626 | Ga0207668_10112473 | 3300025972 | Bacteria | 2045 |
| 627 | Ga0207668_10176614 | 3300025972 | Bacteria | 1680 |
| 628 | Ga0207668_11092287 | 3300025972 | Unclassified | 715 |
| 629 | Ga0207640_10004826 | 3300025981 | Bacteria | 7324 |
| 630 | Ga0207640_10037589 | 3300025981 | Bacteria | 3047 |
| 631 | Ga0207640_10091174 | 3300025981 | Unclassified | 2111 |
| 632 | Ga0207640_10119106 | 3300025981 | Bacteria | 1887 |
| 633 | Ga0207640_10249758 | 3300025981 | Unclassified | 1376 |
| 634 | Ga0207640_10283293 | 3300025981 | Bacteria | 1303 |
| 635 | Ga0207658_10002498 | 3300025986 | Bacteria | 13399 |
| 636 | Ga0207658_10022714 | 3300025986 | Bacteria | 4369 |
| 637 | Ga0207658_10024031 | 3300025986 | Bacteria | 4259 |
| 638 | Ga0207658_10074568 | 3300025986 | Bacteria | 2578 |
| 639 | Ga0207658_10090467 | 3300025986 | Bacteria | 2372 |
| 640 | Ga0207658_10113298 | 3300025986 | Unclassified | 2148 |
| 641 | Ga0207658_10138516 | 3300025986 | Bacteria | 1966 |
| 642 | Ga0207658_10240003 | 3300025986 | Bacteria | 1535 |
| 643 | Ga0207658_10348030 | 3300025986 | Bacteria | 1290 |
| 644 | Ga0207677_10000945 | 3300026023 | Bacteria | 16205 |
| 645 | Ga0207677_10007706 | 3300026023 | Bacteria | 5976 |
| 646 | Ga0207677_10026625 | 3300026023 | Bacteria | 3631 |
| 647 | Ga0207677_10130342 | 3300026023 | Unclassified | 1908 |
| 648 | Ga0207677_10175540 | 3300026023 | Bacteria | 1680 |
| 649 | Ga0207677_10314425 | 3300026023 | Bacteria | 1299 |
| 650 | Ga0207703_10003421 | 3300026035 | Bacteria | 13323 |
| 651 | Ga0207703_10003665 | 3300026035 | Bacteria | 12803 |
| 652 | Ga0207703_10006642 | 3300026035 | Bacteria | 9226 |
| 653 | Ga0207703_10009304 | 3300026035 | Bacteria | 7723 |
| 654 | Ga0207703_10397061 | 3300026035 | Bacteria | 1279 |
| 655 | Ga0207639_10099426 | 3300026041 | Bacteria | 2347 |
| 656 | Ga0207639_10175514 | 3300026041 | Bacteria | 1819 |
| 657 | Ga0207639_10197384 | 3300026041 | Unclassified | 1723 |
| 658 | Ga0207639_10296693 | 3300026041 | Bacteria | 1427 |
| 659 | Ga0207678_10000257 | 3300026067 | Bacteria | 48122 |
| 660 | Ga0207678_10011283 | 3300026067 | Bacteria | 7845 |
| 661 | Ga0207678_10021509 | 3300026067 | Bacteria | 5656 |
| 662 | Ga0207678_10120513 | 3300026067 | Bacteria | 2239 |
| 663 | Ga0207678_10315514 | 3300026067 | Bacteria | 1344 |
| 664 | Ga0207678_10399312 | 3300026067 | Bacteria | 1190 |
| 665 | Ga0207678_10441966 | 3300026067 | Unclassified | 1130 |
| 666 | Ga0207708_10003069 | 3300026075 | Bacteria | 12298 |
| 667 | Ga0207702_10001528 | 3300026078 | Bacteria | 22893 |
| 668 | Ga0207702_10020849 | 3300026078 | Bacteria | 5422 |
| 669 | Ga0207702_10022442 | 3300026078 | Bacteria | 5232 |
| 670 | Ga0207702_10029568 | 3300026078 | Bacteria | 4560 |
| 671 | Ga0207702_10047008 | 3300026078 | Bacteria | 3635 |
| 672 | Ga0207702_10856736 | 3300026078 | Bacteria | 900 |
| 673 | Ga0207641_10005302 | 3300026088 | Bacteria | 11014 |
| 674 | Ga0207641_10010744 | 3300026088 | Bacteria | 7506 |
| 675 | Ga0207641_10048832 | 3300026088 | Bacteria | 3574 |
| 676 | Ga0207641_10063530 | 3300026088 | Bacteria | 3154 |
| 677 | Ga0207641_10092827 | 3300026088 | Bacteria | 2644 |
| 678 | Ga0207641_10102994 | 3300026088 | Bacteria | 2518 |
| 679 | Ga0207641_10188814 | 3300026088 | Bacteria | 1892 |
| 680 | Ga0207641_10444051 | 3300026088 | Bacteria | 1253 |
| 681 | Ga0207648_10000306 | 3300026089 | Bacteria | 53612 |
| 682 | Ga0207648_10000415 | 3300026089 | Bacteria | 47449 |
| 683 | Ga0207648_10006931 | 3300026089 | Bacteria | 11223 |
| 684 | Ga0207648_10021907 | 3300026089 | Bacteria | 5740 |
| 685 | Ga0207648_10035512 | 3300026089 | Bacteria | 4391 |
| 686 | Ga0207648_10078366 | 3300026089 | Unclassified | 2882 |
| 687 | Ga0207648_10096508 | 3300026089 | Bacteria | 2587 |
| 688 | Ga0207676_10000576 | 3300026095 | Bacteria | 30160 |
| 689 | Ga0207676_10010947 | 3300026095 | Bacteria | 6474 |
| 690 | Ga0207676_10021336 | 3300026095 | Bacteria | 4751 |
| 691 | Ga0207676_10189304 | 3300026095 | Bacteria | 1809 |
| 692 | Ga0207676_10681372 | 3300026095 | Unclassified | 994 |
| 693 | Ga0207676_10777592 | 3300026095 | Unclassified | 933 |
| 694 | Ga0207674_10002203 | 3300026116 | Bacteria | 24677 |
| 695 | Ga0207674_10009218 | 3300026116 | Bacteria | 11314 |
| 696 | Ga0207674_10011259 | 3300026116 | Bacteria | 10055 |
| 697 | Ga0207674_10071748 | 3300026116 | Bacteria | 3479 |
| 698 | Ga0207674_10290503 | 3300026116 | Bacteria | 1583 |
| 699 | Ga0207675_100002299 | 3300026118 | Bacteria | 18975 |
| 700 | Ga0207675_100027539 | 3300026118 | Bacteria | 5293 |
| 701 | Ga0207675_100075541 | 3300026118 | Bacteria | 3154 |
| 702 | Ga0207675_100130544 | 3300026118 | Bacteria | 2382 |
| 703 | Ga0207675_100242021 | 3300026118 | Bacteria | 1744 |
| 704 | Ga0207675_100477586 | 3300026118 | Unclassified | 1238 |
| 705 | Ga0207675_101043099 | 3300026118 | Unclassified | 837 |
| 706 | Ga0207683_10001496 | 3300026121 | Bacteria | 21076 |
| 707 | Ga0207683_10004801 | 3300026121 | Bacteria | 11638 |
| 708 | Ga0207683_10008139 | 3300026121 | Bacteria | 8968 |
| 709 | Ga0207683_10010604 | 3300026121 | Bacteria | 7859 |
| 710 | Ga0207683_10641681 | 3300026121 | Unclassified | 983 |
| 711 | Ga0207698_10000659 | 3300026142 | Bacteria | 20017 |
| 712 | Ga0207698_10024376 | 3300026142 | Bacteria | 4246 |
| 713 | Ga0207698_10264090 | 3300026142 | Bacteria | 1583 |
| 714 | Ga0209983_1016566 | 3300027665 | Bacteria | 1523 |
| 715 | Ga0209983_1024795 | 3300027665 | Bacteria | 1264 |
| 716 | Ga0209971_1001936 | 3300027682 | Bacteria | 5058 |
| 717 | Ga0209966_1046711 | 3300027695 | Bacteria | 914 |
| 718 | Ga0268266_10011604 | 3300028379 | Bacteria | 7648 |
| 719 | Ga0268266_10085665 | 3300028379 | Bacteria | 2753 |
| 720 | Ga0268266_10502027 | 3300028379 | Bacteria | 1158 |
| 721 | Ga0268265_10029710 | 3300028380 | Bacteria | 3928 |
| 722 | Ga0268265_10044623 | 3300028380 | Bacteria | 3302 |
| 723 | Ga0268265_10048032 | 3300028380 | Bacteria | 3202 |
| 724 | Ga0268265_10128928 | 3300028380 | Bacteria | 2098 |
| 725 | Ga0268265_10259706 | 3300028380 | Bacteria | 1543 |
| 726 | Ga0268264_10000599 | 3300028381 | Bacteria | 43601 |
| 727 | Ga0268264_10006545 | 3300028381 | Bacteria | 9808 |
| 728 | Ga0268264_10008391 | 3300028381 | Bacteria | 8588 |
| 729 | Ga0268264_10046042 | 3300028381 | Bacteria | 3623 |
| 730 | Ga0268264_10110557 | 3300028381 | Bacteria | 2406 |
| 731 | Ga0268264_10121263 | 3300028381 | Bacteria | 2304 |
| 732 | Ga0268264_10172945 | 3300028381 | Bacteria | 1955 |
| 733 | Ga0268264_10601785 | 3300028381 | Bacteria | 1083 |
| 734 | Ga0268264_10633059 | 3300028381 | Archaea | 1057 |
| 735 | Ga0265332_10002051 | 3300031238 | Bacteria | 10534 |
| 736 | Ga0265325_10035231 | 3300031241 | Bacteria | 2659 |
| 737 | Ga0265329_10006644 | 3300031242 | Bacteria | 4567 |
| 738 | Ga0265331_10000485 | 3300031250 | Bacteria | 38062 |
| 739 | Ga0265327_10013562 | 3300031251 | Bacteria | 5405 |
| 740 | Ga0265316_10015334 | 3300031344 | Bacteria | 6704 |
| 741 | Ga0307408_100004014 | 3300031548 | Bacteria | 10035 |
| 742 | Ga0307408_100019001 | 3300031548 | Bacteria | 4622 |
| 743 | Ga0265314_10009143 | 3300031711 | Bacteria | 8409 |
| 744 | Ga0265342_10010277 | 3300031712 | Bacteria | 6514 |
| 745 | Ga0307405_10014503 | 3300031731 | Bacteria | 4239 |
| 746 | Ga0307405_10018794 | 3300031731 | Bacteria | 3821 |
| 747 | Ga0307413_10007331 | 3300031824 | Bacteria | 5114 |
| 748 | Ga0307413_10160338 | 3300031824 | Bacteria | 1579 |
| 749 | Ga0307410_10001025 | 3300031852 | Bacteria | 12119 |
| 750 | Ga0307410_10001357 | 3300031852 | Bacteria | 10985 |
| 751 | Ga0307406_10032793 | 3300031901 | Bacteria | 3173 |
| 752 | Ga0307406_10037070 | 3300031901 | Bacteria | 3008 |
| 753 | Ga0307407_10002673 | 3300031903 | Bacteria | 7063 |
| 754 | Ga0307407_10041821 | 3300031903 | Bacteria | 2565 |
| 755 | Ga0307412_10009818 | 3300031911 | Bacteria | 5497 |
| 756 | Ga0307412_10081877 | 3300031911 | Bacteria | 2233 |
| 757 | Ga0307409_100012473 | 3300031995 | Bacteria | 5417 |
| 758 | Ga0307409_100018388 | 3300031995 | Bacteria | 4697 |
| 759 | Ga0307416_100060819 | 3300032002 | Unclassified | 3078 |
| 760 | Ga0307416_100203594 | 3300032002 | Bacteria | 1880 |
| 761 | Ga0307414_10230346 | 3300032004 | Bacteria | 1527 |
| 762 | Ga0307411_10004698 | 3300032005 | Bacteria | 6592 |
| 763 | Ga0307411_10105760 | 3300032005 | Bacteria | 2001 |
| 764 | Ga0307415_100006430 | 3300032126 | Bacteria | 6335 |
| 765 | Ga0373934_0103572 | 3300035086 | Bacteria | 1151 |
| 766 | Ga0373934_0124891 | 3300035086 | Bacteria | 1048 |
| 767 | Ga0373944_0015297 | 3300035089 | Bacteria | 2152 |
| 768 | Ga0373945_0006448 | 3300035116 | Bacteria | 3785 |
| 769 | Ga0373945_0060435 | 3300035116 | Bacteria | 1413 |
| 770 | Ga0373945_0134193 | 3300035116 | Unclassified | 994 |
| 771 | Ga0373945_0147991 | 3300035116 | Unclassified | 950 |
| 772 | Ga0373945_0288796 | 3300035116 | Bacteria | 700 |
| 773 | Ga0373953_0008343 | 3300035117 | Bacteria | 3515 |
| 774 | Ga0373954_0002402 | 3300035118 | Bacteria | 7846 |
| 775 | Ga0373954_0229205 | 3300035118 | Bacteria | 914 |
| 776 | Ga0373954_0234894 | 3300035118 | Bacteria | 902 |
| 777 | Ga0373956_0042193 | 3300035119 | Bacteria | 2027 |
| 778 | Ga0373957_0006034 | 3300035120 | Bacteria | 3795 |
| 779 | Ga0373946_0064905 | 3300035171 | Unclassified | 1562 |
| 780 | Ga0373955_0084787 | 3300035172 | Unclassified | 1797 |
| 781 | Ga0373924_0207673 | 3300035410 | Bacteria | 864 |
| 782 | Ga0373931_0033564 | 3300035691 | Bacteria | 2660 |
| 783 | Ga0373931_0173261 | 3300035691 | Bacteria | 1273 |
| 784 | Ga0373931_0227715 | 3300035691 | Unclassified | 1125 |
| 785 | Ga0373935_0019078 | 3300035692 | Bacteria | 4182 |
| 786 | Ga0373935_0068211 | 3300035692 | Bacteria | 2288 |
| 787 | Ga0373935_0100658 | 3300035692 | Unclassified | 1905 |
| 788 | Ga0373927_0006664 | 3300035695 | Bacteria | 7858 |
| 789 | Ga0373927_0124947 | 3300035695 | Bacteria | 1679 |
| 790 | Ga0373927_0186264 | 3300035695 | Bacteria | 1362 |
| 791 | Ga0373933_0005336 | 3300035724 | Bacteria | 7005 |
| 792 | Ga0373933_0036393 | 3300035724 | Bacteria | 2881 |
| 793 | Ga0373933_0070172 | 3300035724 | Unclassified | 2131 |
| 794 | Ga0373947_0015338 | 3300035725 | Bacteria | 4398 |
| 795 | Ga0373947_0285839 | 3300035725 | Bacteria | 1097 |
| 796 | Ga0373937_0028859 | 3300036401 | Bacteria | 5023 |
| 797 | Ga0373937_0042165 | 3300036401 | Bacteria | 4164 |
| 798 | Ga0373937_0203914 | 3300036401 | Unclassified | 1859 |
| 799 | Ga0373937_0232966 | 3300036401 | Bacteria | 1734 |
| 800 | Ga0373937_0470532 | 3300036401 | Bacteria | 1194 |
| 801 | Ga0373937_0858090 | 3300036401 | Unclassified | 856 |
| 802 | Ga0373925_0163243 | 3300037068 | Bacteria | 1755 |
| 803 | Ga0373925_0183922 | 3300037068 | Bacteria | 1656 |
| 804 | Ga0373925_0209796 | 3300037068 | Bacteria | 1551 |
| 805 | Ga0373925_0237926 | 3300037068 | Unclassified | 1457 |
| 806 | Ga0373925_0511692 | 3300037068 | Unclassified | 986 |
| 807 | Ga0395905_0308615 | 3300037471 | Unclassified | 1470 |
| 808 | Ga0451853_2525184 | 3300041512 | Bacteria | 1535 |
| 809 | Ga0439448_0025256 | 3300042005 | Bacteria | 1863 |
| 810 | Ga0450891_023889 | 3300042129 | Bacteria | 611 |
| 811 | Ga0439458_0069788 | 3300042157 | Bacteria | 886 |
| 812 | Ga0439435_0029683 | 3300042436 | Unclassified | 1478 |
| 813 | Ga0451577_0080614 | 3300042876 | Bacteria | 2903 |
| 814 | Ga0451577_0280096 | 3300042876 | Unclassified | 1511 |
| 815 | Ga0451576_0377529 | 3300045051 | Unclassified | 1486 |
| 816 | Ga0466967_0379197 | 3300045976 | Bacteria | 1373 |
| 817 | Ga0495651_0191090 | 3300046462 | Bacteria | 1441 |
| 818 | Ga0495651_0250168 | 3300046462 | Unclassified | 1211 |
| 819 | Ga0495653_0130897 | 3300046463 | Bacteria | 1776 |
| 820 | Ga0495580_0010175 | 3300046472 | Bacteria | 7344 |
| 821 | Ga0495580_0077356 | 3300046472 | Bacteria | 2320 |
| 822 | Ga0495580_0299883 | 3300046472 | Bacteria | 1094 |
| 823 | Ga0495582_0009981 | 3300046473 | Bacteria | 5226 |
| 824 | Ga0495639_0005310 | 3300046475 | Bacteria | 5548 |
| 825 | Ga0495662_0085792 | 3300046476 | Unclassified | 1533 |
| 826 | Ga0495664_0030616 | 3300046477 | Bacteria | 3153 |
| 827 | Ga0495664_0540979 | 3300046477 | Bacteria | 694 |
| 828 | Ga0495594_0017270 | 3300046499 | Bacteria | 3810 |
| 829 | Ga0495628_0127544 | 3300046516 | Bacteria | 1948 |
| 830 | Ga0495630_0135258 | 3300046517 | Bacteria | 1873 |
| 831 | Ga0495666_0086173 | 3300046526 | Bacteria | 1484 |
| 832 | Ga0495665_0022338 | 3300046531 | Bacteria | 3400 |
| 833 | Ga0495586_0064780 | 3300046535 | Bacteria | 1992 |
| 834 | Ga0495621_0002673 | 3300046539 | Bacteria | 4826 |
| 835 | Ga0495645_0006508 | 3300046543 | Bacteria | 8112 |
| 836 | Ga0495645_0282285 | 3300046543 | Bacteria | 1091 |
| 837 | Ga0495635_0021390 | 3300046663 | Bacteria | 4507 |
| 838 | Ga0495635_0619942 | 3300046663 | Bacteria | 705 |
| 839 | Ga0495659_0011305 | 3300046664 | Bacteria | 2876 |
| 840 | Ga0495623_0070732 | 3300046679 | Bacteria | 2173 |
| 841 | Ga0495658_0046521 | 3300046683 | Bacteria | 2439 |
| 842 | Ga0495600_0029604 | 3300046809 | Bacteria | 3546 |
| 843 | Ga0495581_0008149 | 3300047315 | Bacteria | 6067 |
| 844 | Ga0495604_0179273 | 3300047317 | Bacteria | 1483 |
| 845 | Ga0495674_0157749 | 3300047319 | Bacteria | 1900 |
| 846 | Ga0495680_0075719 | 3300047322 | Bacteria | 2553 |
| 847 | Ga0495684_0003967 | 3300047471 | Bacteria | 11537 |
| 848 | Ga0495602_0073475 | 3300048088 | Bacteria | 2911 |
| 849 | Ga0496100_0141959 | 3300048903 | Bacteria | 1703 |
| 850 | Ga0496100_0146195 | 3300048903 | Bacteria | 1681 |
| 851 | Ga0496101_0120097 | 3300048904 | Unclassified | 1986 |
| 852 | Ga0496102_0028926 | 3300048905 | Bacteria | 4954 |
| 853 | Ga0496102_0039538 | 3300048905 | Bacteria | 4262 |
| 854 | Ga0496102_0039809 | 3300048905 | Unclassified | 4249 |
| 855 | Ga0496102_0422729 | 3300048905 | Bacteria | 1252 |
| 856 | Ga0496103_0216955 | 3300048906 | Unclassified | 1230 |
| 857 | Ga0496104_0071628 | 3300048907 | Bacteria | 3295 |
| 858 | Ga0496104_0101161 | 3300048907 | Bacteria | 2759 |
| 859 | Ga0496104_0380993 | 3300048907 | Bacteria | 1323 |
| 860 | Ga0496105_0022793 | 3300048908 | Bacteria | 5074 |
| 861 | Ga0496105_0206236 | 3300048908 | Bacteria | 1603 |
| 862 | Ga0496106_0015856 | 3300048909 | Bacteria | 5573 |
| 863 | Ga0496106_0217851 | 3300048909 | Unclassified | 1522 |
| 864 | Ga0496107_0007460 | 3300048910 | Bacteria | 7540 |
| 865 | Ga0496107_0037561 | 3300048910 | Bacteria | 3475 |
| 866 | Ga0496107_0151599 | 3300048910 | Bacteria | 1715 |
| 867 | Ga0496108_0003278 | 3300048911 | Bacteria | 13001 |
| 868 | Ga0496108_0147764 | 3300048911 | Bacteria | 2027 |
| 869 | Ga0496109_0004927 | 3300048912 | Bacteria | 11142 |
| 870 | Ga0496109_0040016 | 3300048912 | Bacteria | 4245 |
| 871 | Ga0496110_0003478 | 3300048913 | Bacteria | 12080 |
| 872 | Ga0496110_0198982 | 3300048913 | Bacteria | 1820 |
| 873 | Ga0496110_0213348 | 3300048913 | Unclassified | 1755 |
| 874 | Ga0496110_0461402 | 3300048913 | Unclassified | 1158 |
| 875 | Ga0496111_0106968 | 3300048914 | Unclassified | 2059 |
| 876 | Ga0496111_0319377 | 3300048914 | Bacteria | 1150 |
| 877 | Ga0496112_0001998 | 3300048915 | Bacteria | 16138 |
| 878 | Ga0496113_0280272 | 3300048916 | Bacteria | 1333 |
| 879 | Ga0496114_0038202 | 3300048917 | Bacteria | 3972 |
| 880 | Ga0496115_0369470 | 3300048918 | Bacteria | 1168 |
| 881 | Ga0501034_0009235 | 3300049571 | Bacteria | 10337 |
| 882 | Ga0501047_0011148 | 3300049581 | Bacteria | 8507 |
| 883 | Ga0501067_0191117 | 3300049583 | Bacteria | 1140 |
| 884 | Ga0501070_0001616 | 3300049586 | Bacteria | 19990 |
| 885 | Ga0501071_0361408 | 3300049587 | Bacteria | 1106 |
| 886 | Ga0501072_0093139 | 3300049588 | Bacteria | 2393 |
| 887 | Ga0501075_0451477 | 3300049591 | Unclassified | 980 |
| 888 | Ga0501076_0277016 | 3300049592 | Unclassified | 1374 |
| 889 | Ga0501080_0010533 | 3300049742 | Bacteria | 8468 |
| 890 | Ga0501083_0073067 | 3300049744 | Bacteria | 2279 |
| 891 | Ga0501083_0099826 | 3300049744 | Bacteria | 1914 |
| 892 | Ga0501045_0061866 | 3300049824 | Bacteria | 2747 |
| 893 | nmdc:mga08y16_1190169_c1 | 3300050511 | Bacteria | 733 |
| 894 | nmdc:mga08y16_91621_c1 | 3300050511 | Bacteria | 3168 |
| 895 | nmdc:mga0n895_341536_c1 | 3300050512 | Bacteria | 1516 |
| 896 | nmdc:mga0n895_735150_c1 | 3300050512 | Bacteria | 981 |
| 897 | nmdc:mga0rr50_572116_c1 | 3300050513 | Bacteria | 962 |
| 898 | nmdc:mga0rr50_850105_c1 | 3300050513 | Unclassified | 778 |
| 899 | nmdc:mga0rr50_928671_c1 | 3300050513 | Unclassified | 742 |
| 900 | nmdc:mga08x19_213965_c1 | 3300050514 | Bacteria | 1323 |
| 901 | nmdc:mga08x19_755365_c1 | 3300050514 | Unclassified | 690 |
| 902 | nmdc:mga0a205_281765_c1 | 3300050515 | Bacteria | 1537 |
| 903 | Ga0495601_0254616 | 3300053077 | Bacteria | 1146 |
| 904 | Ga0495601_0303835 | 3300053077 | Unclassified | 1039 |
| 905 | Ga0495612_0049642 | 3300053078 | Unclassified | 1722 |
| 906 | Ga0495619_0052673 | 3300053085 | Bacteria | 2690 |
| 907 | Ga0501082_0094150 | 3300060353 | Bacteria | 2588 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300049587 | Ga0501071_0361408 | Ga0501071_0361408_11_484 | 157 |
| 2 | 3300005843 | Ga0068860_100358511 | Ga0068860_1003585112 | 160 |
| 3 | 3300025927 | Ga0207687_10387516 | Ga0207687_103875161 | 160 |
| 4 | 3300026095 | Ga0207676_10189304 | Ga0207676_101893043 | 160 |
| 5 | 3300036401 | Ga0373937_0858090 | Ga0373937_0858090_104_619 | 167 |
| 6 | 3300027665 | Ga0209983_1024795 | Ga0209983_10247952 | 168 |
| 7 | 3300005455 | Ga0070663_100723176 | Ga0070663_1007231761 | 171 |
| 8 | 3300014968 | Ga0157379_11341127 | Ga0157379_113411271 | 174 |
| 9 | 3300025940 | Ga0207691_10230540 | Ga0207691_102305402 | 174 |
| 10 | 3300025986 | Ga0207658_10348030 | Ga0207658_103480302 | 174 |
| 11 | 3300028381 | Ga0268264_10172945 | Ga0268264_101729452 | 174 |
| 12 | 3300006871 | Ga0075434_100135392 | Ga0075434_1001353923 | 176 |
| 13 | 3300050512 | nmdc:mga0n895_735150_c1 | nmdc:mga0n895_735150_c1_322_873 | 176 |
| 14 | 3300005328 | Ga0070676_10001800 | Ga0070676_1000180010 | 178 |
| 15 | 3300005330 | Ga0070690_100038809 | Ga0070690_1000388093 | 178 |
| 16 | 3300005331 | Ga0070670_100111627 | Ga0070670_1001116271 | 178 |
| 17 | 3300005333 | Ga0070677_10027843 | Ga0070677_100278432 | 178 |
| 18 | 3300005334 | Ga0068869_100097166 | Ga0068869_1000971662 | 178 |
| 19 | 3300005334 | Ga0068869_100233465 | Ga0068869_1002334652 | 178 |
| 20 | 3300005335 | Ga0070666_10003156 | Ga0070666_100031568 | 178 |
| 21 | 3300005338 | Ga0068868_100000774 | Ga0068868_1000007746 | 178 |
| 22 | 3300005340 | Ga0070689_100224826 | Ga0070689_1002248262 | 178 |
| 23 | 3300005347 | Ga0070668_100023123 | Ga0070668_1000231232 | 178 |
| 24 | 3300005347 | Ga0070668_100125054 | Ga0070668_1001250542 | 178 |
| 25 | 3300005353 | Ga0070669_100001056 | Ga0070669_10000105616 | 178 |
| 26 | 3300005354 | Ga0070675_100003008 | Ga0070675_1000030089 | 178 |
| 27 | 3300005355 | Ga0070671_100014026 | Ga0070671_1000140264 | 178 |
| 28 | 3300005356 | Ga0070674_100061392 | Ga0070674_1000613922 | 178 |
| 29 | 3300005364 | Ga0070673_100002518 | Ga0070673_10000251810 | 178 |
| 30 | 3300005365 | Ga0070688_100101811 | Ga0070688_1001018112 | 178 |
| 31 | 3300005367 | Ga0070667_100004783 | Ga0070667_1000047837 | 178 |
| 32 | 3300005456 | Ga0070678_100003520 | Ga0070678_1000035205 | 178 |
| 33 | 3300005459 | Ga0068867_100019395 | Ga0068867_1000193954 | 178 |
| 34 | 3300005466 | Ga0070685_10318383 | Ga0070685_103183831 | 178 |
| 35 | 3300005543 | Ga0070672_100012616 | Ga0070672_1000126164 | 178 |
| 36 | 3300005548 | Ga0070665_100005543 | Ga0070665_1000055438 | 178 |
| 37 | 3300005617 | Ga0068859_100002241 | Ga0068859_10000224114 | 178 |
| 38 | 3300005617 | Ga0068859_100024952 | Ga0068859_1000249525 | 178 |
| 39 | 3300005618 | Ga0068864_100009639 | Ga0068864_1000096392 | 178 |
| 40 | 3300005719 | Ga0068861_100069168 | Ga0068861_1000691683 | 178 |
| 41 | 3300005834 | Ga0068851_10261738 | Ga0068851_102617382 | 178 |
| 42 | 3300005840 | Ga0068870_10008049 | Ga0068870_100080493 | 178 |
| 43 | 3300005841 | Ga0068863_100009743 | Ga0068863_1000097437 | 178 |
| 44 | 3300005841 | Ga0068863_100103620 | Ga0068863_1001036202 | 178 |
| 45 | 3300005842 | Ga0068858_100001310 | Ga0068858_10000131024 | 178 |
| 46 | 3300005843 | Ga0068860_100002991 | Ga0068860_1000029914 | 178 |
| 47 | 3300005844 | Ga0068862_100030188 | Ga0068862_1000301887 | 178 |
| 48 | 3300005844 | Ga0068862_100058816 | Ga0068862_1000588162 | 178 |
| 49 | 3300006237 | Ga0097621_100002601 | Ga0097621_1000026019 | 178 |
| 50 | 3300006358 | Ga0068871_100021424 | Ga0068871_1000214244 | 178 |
| 51 | 3300006844 | Ga0075428_100309644 | Ga0075428_1003096442 | 178 |
| 52 | 3300006881 | Ga0068865_100038653 | Ga0068865_1000386532 | 178 |
| 53 | 3300006931 | Ga0097620_100002241 | Ga0097620_10000224114 | 178 |
| 54 | 3300006931 | Ga0097620_100024954 | Ga0097620_1000249544 | 178 |
| 55 | 3300009098 | Ga0105245_11355215 | Ga0105245_113552152 | 178 |
| 56 | 3300009177 | Ga0105248_10001811 | Ga0105248_100018118 | 178 |
| 57 | 3300009177 | Ga0105248_10042963 | Ga0105248_100429634 | 178 |
| 58 | 3300013296 | Ga0157374_10000346 | Ga0157374_1000034636 | 178 |
| 59 | 3300013297 | Ga0157378_10022161 | Ga0157378_100221619 | 178 |
| 60 | 3300013306 | Ga0163162_10045691 | Ga0163162_100456912 | 178 |
| 61 | 3300013308 | Ga0157375_10021582 | Ga0157375_100215826 | 178 |
| 62 | 3300014325 | Ga0163163_10053997 | Ga0163163_100539972 | 178 |
| 63 | 3300014326 | Ga0157380_10040189 | Ga0157380_100401896 | 178 |
| 64 | 3300014968 | Ga0157379_10006330 | Ga0157379_1000633010 | 178 |
| 65 | 3300014969 | Ga0157376_10109207 | Ga0157376_101092072 | 178 |
| 66 | 3300017792 | Ga0163161_10003668 | Ga0163161_100036686 | 178 |
| 67 | 3300025893 | Ga0207682_10002688 | Ga0207682_100026884 | 178 |
| 68 | 3300025903 | Ga0207680_10011012 | Ga0207680_100110126 | 178 |
| 69 | 3300025907 | Ga0207645_10000353 | Ga0207645_1000035310 | 178 |
| 70 | 3300025908 | Ga0207643_10004088 | Ga0207643_100040883 | 178 |
| 71 | 3300025923 | Ga0207681_10001804 | Ga0207681_100018047 | 178 |
| 72 | 3300025923 | Ga0207681_10051109 | Ga0207681_100511093 | 178 |
| 73 | 3300025925 | Ga0207650_10022736 | Ga0207650_100227364 | 178 |
| 74 | 3300025926 | Ga0207659_10009505 | Ga0207659_100095054 | 178 |
| 75 | 3300025931 | Ga0207644_10014097 | Ga0207644_100140973 | 178 |
| 76 | 3300025933 | Ga0207706_10191791 | Ga0207706_101917912 | 178 |
| 77 | 3300025936 | Ga0207670_10156813 | Ga0207670_101568132 | 178 |
| 78 | 3300025937 | Ga0207669_10070770 | Ga0207669_100707702 | 178 |
| 79 | 3300025940 | Ga0207691_10000663 | Ga0207691_100006638 | 178 |
| 80 | 3300025940 | Ga0207691_10038134 | Ga0207691_100381345 | 178 |
| 81 | 3300025941 | Ga0207711_10027614 | Ga0207711_100276147 | 178 |
| 82 | 3300025942 | Ga0207689_10005593 | Ga0207689_100055937 | 178 |
| 83 | 3300025942 | Ga0207689_10239495 | Ga0207689_102394952 | 178 |
| 84 | 3300025961 | Ga0207712_10058143 | Ga0207712_100581433 | 178 |
| 85 | 3300025972 | Ga0207668_10102684 | Ga0207668_101026843 | 178 |
| 86 | 3300025986 | Ga0207658_10002498 | Ga0207658_100024988 | 178 |
| 87 | 3300025986 | Ga0207658_10138516 | Ga0207658_101385162 | 178 |
| 88 | 3300026023 | Ga0207677_10007706 | Ga0207677_100077066 | 178 |
| 89 | 3300026035 | Ga0207703_10009304 | Ga0207703_100093047 | 178 |
| 90 | 3300026067 | Ga0207678_10399312 | Ga0207678_103993122 | 178 |
| 91 | 3300026088 | Ga0207641_10005302 | Ga0207641_100053028 | 178 |
| 92 | 3300026088 | Ga0207641_10188814 | Ga0207641_101888142 | 178 |
| 93 | 3300026089 | Ga0207648_10000306 | Ga0207648_1000030626 | 178 |
| 94 | 3300026089 | Ga0207648_10021907 | Ga0207648_100219074 | 178 |
| 95 | 3300026095 | Ga0207676_10021336 | Ga0207676_100213364 | 178 |
| 96 | 3300026118 | Ga0207675_100027539 | Ga0207675_1000275395 | 178 |
| 97 | 3300026118 | Ga0207675_100242021 | Ga0207675_1002420212 | 178 |
| 98 | 3300026121 | Ga0207683_10010604 | Ga0207683_100106044 | 178 |
| 99 | 3300028380 | Ga0268265_10029710 | Ga0268265_100297104 | 178 |
| 100 | 3300028380 | Ga0268265_10128928 | Ga0268265_101289283 | 178 |
| 101 | 3300028381 | Ga0268264_10008391 | Ga0268264_100083917 | 178 |
| 102 | 3300035691 | Ga0373931_0173261 | Ga0373931_0173261_200_736 | 178 |
| 103 | 3300042129 | Ga0450891_023889 | Ga0450891_023889_55_600 | 178 |
| 104 | 3300048911 | Ga0496108_0147764 | Ga0496108_0147764_899_1435 | 178 |
| 105 | 3300048913 | Ga0496110_0198982 | Ga0496110_0198982_843_1379 | 178 |
| 106 | 3300049571 | Ga0501034_0009235 | Ga0501034_0009235_421_978 | 178 |
| 107 | 3300049581 | Ga0501047_0011148 | Ga0501047_0011148_4591_5148 | 178 |
| 108 | 3300049583 | Ga0501067_0191117 | Ga0501067_0191117_528_1085 | 178 |
| 109 | 3300049586 | Ga0501070_0001616 | Ga0501070_0001616_8532_9089 | 178 |
| 110 | 3300049588 | Ga0501072_0093139 | Ga0501072_0093139_1775_2332 | 178 |
| 111 | 3300049742 | Ga0501080_0010533 | Ga0501080_0010533_1578_2135 | 178 |
| 112 | 3300049744 | Ga0501083_0073067 | Ga0501083_0073067_936_1493 | 178 |
| 113 | 3300049744 | Ga0501083_0099826 | Ga0501083_0099826_566_1123 | 178 |
| 114 | 3300060353 | Ga0501082_0094150 | Ga0501082_0094150_864_1421 | 178 |
| 115 | 3300005436 | Ga0070713_100000035 | Ga0070713_10000003516 | 179 |
| 116 | 3300006175 | Ga0070712_100050075 | Ga0070712_1000500753 | 179 |
| 117 | 3300025928 | Ga0207700_10000023 | Ga0207700_10000023146 | 179 |
| 118 | 3300053077 | Ga0495601_0254616 | Ga0495601_0254616_304_906 | 179 |
| 119 | 3300009176 | Ga0105242_10098208 | Ga0105242_100982083 | 182 |
| 120 | 3300014326 | Ga0157380_10012389 | Ga0157380_100123892 | 182 |
| 121 | 3300025934 | Ga0207686_10010171 | Ga0207686_100101715 | 182 |
| 122 | 3300035086 | Ga0373934_0124891 | Ga0373934_0124891_388_972 | 183 |
| 123 | 3300035724 | Ga0373933_0070172 | Ga0373933_0070172_1424_2008 | 183 |
| 124 | 3300007076 | Ga0075435_100737441 | Ga0075435_1007374412 | 186 |
| 125 | 3300050513 | nmdc:mga0rr50_850105_c1 | nmdc:mga0rr50_850105_c1_125_730 | 186 |
| 126 | 3300002074 | JGI24748J21848_1021889 | JGI24748J21848_10218892 | 187 |
| 127 | 3300005328 | Ga0070676_10312965 | Ga0070676_103129652 | 187 |
| 128 | 3300005329 | Ga0070683_100136766 | Ga0070683_1001367662 | 187 |
| 129 | 3300005330 | Ga0070690_100016580 | Ga0070690_1000165806 | 187 |
| 130 | 3300005330 | Ga0070690_100354294 | Ga0070690_1003542941 | 187 |
| 131 | 3300005331 | Ga0070670_100029212 | Ga0070670_1000292123 | 187 |
| 132 | 3300005334 | Ga0068869_100023950 | Ga0068869_1000239503 | 187 |
| 133 | 3300005335 | Ga0070666_10006568 | Ga0070666_100065683 | 187 |
| 134 | 3300005336 | Ga0070680_100041080 | Ga0070680_1000410806 | 187 |
| 135 | 3300005337 | Ga0070682_100018828 | Ga0070682_1000188283 | 187 |
| 136 | 3300005338 | Ga0068868_100015861 | Ga0068868_1000158617 | 187 |
| 137 | 3300005340 | Ga0070689_100012106 | Ga0070689_1000121063 | 187 |
| 138 | 3300005345 | Ga0070692_10056178 | Ga0070692_100561783 | 187 |
| 139 | 3300005356 | Ga0070674_100022959 | Ga0070674_1000229592 | 187 |
| 140 | 3300005364 | Ga0070673_100042195 | Ga0070673_1000421953 | 187 |
| 141 | 3300005365 | Ga0070688_100013781 | Ga0070688_1000137814 | 187 |
| 142 | 3300005366 | Ga0070659_100042607 | Ga0070659_1000426074 | 187 |
| 143 | 3300005366 | Ga0070659_100417198 | Ga0070659_1004171982 | 187 |
| 144 | 3300005434 | Ga0070709_10163314 | Ga0070709_101633142 | 187 |
| 145 | 3300005436 | Ga0070713_100031713 | Ga0070713_1000317133 | 187 |
| 146 | 3300005437 | Ga0070710_10111654 | Ga0070710_101116542 | 187 |
| 147 | 3300005439 | Ga0070711_100008712 | Ga0070711_1000087128 | 187 |
| 148 | 3300005440 | Ga0070705_100065933 | Ga0070705_1000659332 | 187 |
| 149 | 3300005444 | Ga0070694_100055128 | Ga0070694_1000551283 | 187 |
| 150 | 3300005455 | Ga0070663_100064818 | Ga0070663_1000648184 | 187 |
| 151 | 3300005457 | Ga0070662_100001751 | Ga0070662_1000017519 | 187 |
| 152 | 3300005457 | Ga0070662_100272617 | Ga0070662_1002726173 | 187 |
| 153 | 3300005458 | Ga0070681_10566782 | Ga0070681_105667822 | 187 |
| 154 | 3300005459 | Ga0068867_100288194 | Ga0068867_1002881942 | 187 |
| 155 | 3300005466 | Ga0070685_10002325 | Ga0070685_100023252 | 187 |
| 156 | 3300005467 | Ga0070706_100024696 | Ga0070706_1000246966 | 187 |
| 157 | 3300005468 | Ga0070707_100051744 | Ga0070707_1000517444 | 187 |
| 158 | 3300005468 | Ga0070707_100065852 | Ga0070707_1000658523 | 187 |
| 159 | 3300005530 | Ga0070679_100750751 | Ga0070679_1007507511 | 187 |
| 160 | 3300005536 | Ga0070697_100088588 | Ga0070697_1000885883 | 187 |
| 161 | 3300005543 | Ga0070672_100139150 | Ga0070672_1001391502 | 187 |
| 162 | 3300005545 | Ga0070695_100022414 | Ga0070695_1000224143 | 187 |
| 163 | 3300005546 | Ga0070696_100039595 | Ga0070696_1000395954 | 187 |
| 164 | 3300005546 | Ga0070696_100056482 | Ga0070696_1000564824 | 187 |
| 165 | 3300005547 | Ga0070693_100006452 | Ga0070693_1000064523 | 187 |
| 166 | 3300005548 | Ga0070665_100004716 | Ga0070665_1000047162 | 187 |
| 167 | 3300005564 | Ga0070664_100140797 | Ga0070664_1001407972 | 187 |
| 168 | 3300005578 | Ga0068854_100016392 | Ga0068854_1000163926 | 187 |
| 169 | 3300005578 | Ga0068854_100040073 | Ga0068854_1000400733 | 187 |
| 170 | 3300005614 | Ga0068856_100015427 | Ga0068856_1000154274 | 187 |
| 171 | 3300005615 | Ga0070702_100008097 | Ga0070702_1000080976 | 187 |
| 172 | 3300005616 | Ga0068852_100197212 | Ga0068852_1001972121 | 187 |
| 173 | 3300005617 | Ga0068859_100011797 | Ga0068859_1000117974 | 187 |
| 174 | 3300005618 | Ga0068864_100070071 | Ga0068864_1000700713 | 187 |
| 175 | 3300005718 | Ga0068866_10011749 | Ga0068866_100117494 | 187 |
| 176 | 3300005719 | Ga0068861_100734009 | Ga0068861_1007340092 | 187 |
| 177 | 3300005840 | Ga0068870_10119904 | Ga0068870_101199042 | 187 |
| 178 | 3300005841 | Ga0068863_100001174 | Ga0068863_10000117424 | 187 |
| 179 | 3300005842 | Ga0068858_100052246 | Ga0068858_1000522463 | 187 |
| 180 | 3300005843 | Ga0068860_100008441 | Ga0068860_1000084413 | 187 |
| 181 | 3300006163 | Ga0070715_10004661 | Ga0070715_100046612 | 187 |
| 182 | 3300006173 | Ga0070716_100021241 | Ga0070716_1000212412 | 187 |
| 183 | 3300006175 | Ga0070712_100055613 | Ga0070712_1000556132 | 187 |
| 184 | 3300006358 | Ga0068871_100036725 | Ga0068871_1000367256 | 187 |
| 185 | 3300006881 | Ga0068865_100052527 | Ga0068865_1000525274 | 187 |
| 186 | 3300006914 | Ga0075436_100079449 | Ga0075436_1000794493 | 187 |
| 187 | 3300006931 | Ga0097620_100011796 | Ga0097620_1000117964 | 187 |
| 188 | 3300009093 | Ga0105240_10029251 | Ga0105240_100292516 | 187 |
| 189 | 3300009098 | Ga0105245_10004136 | Ga0105245_1000413615 | 187 |
| 190 | 3300009098 | Ga0105245_10011558 | Ga0105245_100115587 | 187 |
| 191 | 3300009098 | Ga0105245_10040547 | Ga0105245_100405476 | 187 |
| 192 | 3300009101 | Ga0105247_10005328 | Ga0105247_100053283 | 187 |
| 193 | 3300009174 | Ga0105241_10179358 | Ga0105241_101793582 | 187 |
| 194 | 3300009174 | Ga0105241_10192933 | Ga0105241_101929332 | 187 |
| 195 | 3300009176 | Ga0105242_10024712 | Ga0105242_100247123 | 187 |
| 196 | 3300009176 | Ga0105242_10083702 | Ga0105242_100837024 | 187 |
| 197 | 3300009177 | Ga0105248_10044269 | Ga0105248_100442694 | 187 |
| 198 | 3300009545 | Ga0105237_10141586 | Ga0105237_101415863 | 187 |
| 199 | 3300009551 | Ga0105238_10207161 | Ga0105238_102071612 | 187 |
| 200 | 3300010375 | Ga0105239_10104937 | Ga0105239_101049373 | 187 |
| 201 | 3300011119 | Ga0105246_10016551 | Ga0105246_100165513 | 187 |
| 202 | 3300013104 | Ga0157370_10017934 | Ga0157370_100179344 | 187 |
| 203 | 3300013105 | Ga0157369_10513243 | Ga0157369_105132432 | 187 |
| 204 | 3300013296 | Ga0157374_10040506 | Ga0157374_100405063 | 187 |
| 205 | 3300013297 | Ga0157378_10077834 | Ga0157378_100778342 | 187 |
| 206 | 3300013297 | Ga0157378_10123824 | Ga0157378_101238242 | 187 |
| 207 | 3300013306 | Ga0163162_10004891 | Ga0163162_1000489115 | 187 |
| 208 | 3300013306 | Ga0163162_10028327 | Ga0163162_100283278 | 187 |
| 209 | 3300013307 | Ga0157372_11787965 | Ga0157372_117879651 | 187 |
| 210 | 3300013308 | Ga0157375_10030471 | Ga0157375_100304713 | 187 |
| 211 | 3300014325 | Ga0163163_10000834 | Ga0163163_1000083424 | 187 |
| 212 | 3300014968 | Ga0157379_10004556 | Ga0157379_100045566 | 187 |
| 213 | 3300014969 | Ga0157376_10039073 | Ga0157376_100390732 | 187 |
| 214 | 3300014969 | Ga0157376_10046821 | Ga0157376_100468214 | 187 |
| 215 | 3300017792 | Ga0163161_10298053 | Ga0163161_102980532 | 187 |
| 216 | 3300025899 | Ga0207642_10243214 | Ga0207642_102432142 | 187 |
| 217 | 3300025900 | Ga0207710_10102492 | Ga0207710_101024922 | 187 |
| 218 | 3300025903 | Ga0207680_10098903 | Ga0207680_100989032 | 187 |
| 219 | 3300025905 | Ga0207685_10003418 | Ga0207685_100034182 | 187 |
| 220 | 3300025906 | Ga0207699_10076189 | Ga0207699_100761892 | 187 |
| 221 | 3300025907 | Ga0207645_10298064 | Ga0207645_102980642 | 187 |
| 222 | 3300025908 | Ga0207643_10025935 | Ga0207643_100259354 | 187 |
| 223 | 3300025910 | Ga0207684_10101679 | Ga0207684_101016791 | 187 |
| 224 | 3300025911 | Ga0207654_10138953 | Ga0207654_101389532 | 187 |
| 225 | 3300025911 | Ga0207654_10155206 | Ga0207654_101552062 | 187 |
| 226 | 3300025912 | Ga0207707_10309058 | Ga0207707_103090582 | 187 |
| 227 | 3300025913 | Ga0207695_10044252 | Ga0207695_100442522 | 187 |
| 228 | 3300025914 | Ga0207671_10124032 | Ga0207671_101240322 | 187 |
| 229 | 3300025915 | Ga0207693_10003162 | Ga0207693_100031623 | 187 |
| 230 | 3300025915 | Ga0207693_10031128 | Ga0207693_100311283 | 187 |
| 231 | 3300025916 | Ga0207663_10048994 | Ga0207663_100489942 | 187 |
| 232 | 3300025916 | Ga0207663_10350726 | Ga0207663_103507262 | 187 |
| 233 | 3300025917 | Ga0207660_10254586 | Ga0207660_102545862 | 187 |
| 234 | 3300025919 | Ga0207657_10005375 | Ga0207657_1000537512 | 187 |
| 235 | 3300025921 | Ga0207652_10328739 | Ga0207652_103287392 | 187 |
| 236 | 3300025922 | Ga0207646_10048822 | Ga0207646_100488223 | 187 |
| 237 | 3300025922 | Ga0207646_10150555 | Ga0207646_101505552 | 187 |
| 238 | 3300025924 | Ga0207694_10846328 | Ga0207694_108463281 | 187 |
| 239 | 3300025927 | Ga0207687_10003789 | Ga0207687_100037899 | 187 |
| 240 | 3300025927 | Ga0207687_10004961 | Ga0207687_100049612 | 187 |
| 241 | 3300025927 | Ga0207687_10048784 | Ga0207687_100487843 | 187 |
| 242 | 3300025928 | Ga0207700_10069862 | Ga0207700_100698622 | 187 |
| 243 | 3300025929 | Ga0207664_10013621 | Ga0207664_100136219 | 187 |
| 244 | 3300025929 | Ga0207664_11296998 | Ga0207664_112969981 | 187 |
| 245 | 3300025931 | Ga0207644_10006550 | Ga0207644_100065505 | 187 |
| 246 | 3300025931 | Ga0207644_10130900 | Ga0207644_101309003 | 187 |
| 247 | 3300025932 | Ga0207690_10409050 | Ga0207690_104090502 | 187 |
| 248 | 3300025933 | Ga0207706_10006651 | Ga0207706_100066513 | 187 |
| 249 | 3300025934 | Ga0207686_10015584 | Ga0207686_100155844 | 187 |
| 250 | 3300025934 | Ga0207686_10241590 | Ga0207686_102415902 | 187 |
| 251 | 3300025936 | Ga0207670_10004757 | Ga0207670_100047575 | 187 |
| 252 | 3300025937 | Ga0207669_10007153 | Ga0207669_100071533 | 187 |
| 253 | 3300025938 | Ga0207704_10109488 | Ga0207704_101094883 | 187 |
| 254 | 3300025939 | Ga0207665_10012112 | Ga0207665_100121123 | 187 |
| 255 | 3300025939 | Ga0207665_10025691 | Ga0207665_100256913 | 187 |
| 256 | 3300025940 | Ga0207691_10054892 | Ga0207691_100548922 | 187 |
| 257 | 3300025941 | Ga0207711_10000741 | Ga0207711_1000074115 | 187 |
| 258 | 3300025942 | Ga0207689_10021888 | Ga0207689_100218884 | 187 |
| 259 | 3300025942 | Ga0207689_10027409 | Ga0207689_100274097 | 187 |
| 260 | 3300025942 | Ga0207689_10081081 | Ga0207689_100810814 | 187 |
| 261 | 3300025945 | Ga0207679_10143797 | Ga0207679_101437973 | 187 |
| 262 | 3300025949 | Ga0207667_10810816 | Ga0207667_108108162 | 187 |
| 263 | 3300025960 | Ga0207651_10026254 | Ga0207651_100262544 | 187 |
| 264 | 3300025981 | Ga0207640_10037589 | Ga0207640_100375893 | 187 |
| 265 | 3300025986 | Ga0207658_10022714 | Ga0207658_100227143 | 187 |
| 266 | 3300026023 | Ga0207677_10000945 | Ga0207677_100009453 | 187 |
| 267 | 3300026023 | Ga0207677_10026625 | Ga0207677_100266252 | 187 |
| 268 | 3300026035 | Ga0207703_10003665 | Ga0207703_100036658 | 187 |
| 269 | 3300026041 | Ga0207639_10175514 | Ga0207639_101755142 | 187 |
| 270 | 3300026041 | Ga0207639_10296693 | Ga0207639_102966933 | 187 |
| 271 | 3300026067 | Ga0207678_10120513 | Ga0207678_101205132 | 187 |
| 272 | 3300026067 | Ga0207678_10315514 | Ga0207678_103155142 | 187 |
| 273 | 3300026078 | Ga0207702_10029568 | Ga0207702_100295682 | 187 |
| 274 | 3300026088 | Ga0207641_10010744 | Ga0207641_100107445 | 187 |
| 275 | 3300026089 | Ga0207648_10035512 | Ga0207648_100355124 | 187 |
| 276 | 3300026095 | Ga0207676_10000576 | Ga0207676_1000057621 | 187 |
| 277 | 3300026116 | Ga0207674_10009218 | Ga0207674_100092188 | 187 |
| 278 | 3300026121 | Ga0207683_10008139 | Ga0207683_100081394 | 187 |
| 279 | 3300026142 | Ga0207698_10264090 | Ga0207698_102640902 | 187 |
| 280 | 3300028381 | Ga0268264_10006545 | Ga0268264_1000654510 | 187 |
| 281 | 3300028381 | Ga0268264_10110557 | Ga0268264_101105572 | 187 |
| 282 | 3300035086 | Ga0373934_0103572 | Ga0373934_0103572_207_800 | 187 |
| 283 | 3300035089 | Ga0373944_0015297 | Ga0373944_0015297_246_830 | 187 |
| 284 | 3300035116 | Ga0373945_0006448 | Ga0373945_0006448_505_1089 | 187 |
| 285 | 3300035116 | Ga0373945_0060435 | Ga0373945_0060435_538_1131 | 187 |
| 286 | 3300035116 | Ga0373945_0134193 | Ga0373945_0134193_42_635 | 187 |
| 287 | 3300035116 | Ga0373945_0147991 | Ga0373945_0147991_93_686 | 187 |
| 288 | 3300035117 | Ga0373953_0008343 | Ga0373953_0008343_1510_2103 | 187 |
| 289 | 3300035118 | Ga0373954_0002402 | Ga0373954_0002402_6346_6939 | 187 |
| 290 | 3300035118 | Ga0373954_0234894 | Ga0373954_0234894_298_882 | 187 |
| 291 | 3300035119 | Ga0373956_0042193 | Ga0373956_0042193_1210_1803 | 187 |
| 292 | 3300035120 | Ga0373957_0006034 | Ga0373957_0006034_741_1334 | 187 |
| 293 | 3300035171 | Ga0373946_0064905 | Ga0373946_0064905_312_896 | 187 |
| 294 | 3300035172 | Ga0373955_0084787 | Ga0373955_0084787_419_1012 | 187 |
| 295 | 3300035410 | Ga0373924_0207673 | Ga0373924_0207673_184_777 | 187 |
| 296 | 3300035692 | Ga0373935_0019078 | Ga0373935_0019078_990_1583 | 187 |
| 297 | 3300035692 | Ga0373935_0068211 | Ga0373935_0068211_403_996 | 187 |
| 298 | 3300035695 | Ga0373927_0006664 | Ga0373927_0006664_5371_5955 | 187 |
| 299 | 3300035695 | Ga0373927_0124947 | Ga0373927_0124947_255_848 | 187 |
| 300 | 3300035724 | Ga0373933_0005336 | Ga0373933_0005336_5753_6346 | 187 |
| 301 | 3300035724 | Ga0373933_0036393 | Ga0373933_0036393_930_1523 | 187 |
| 302 | 3300035725 | Ga0373947_0015338 | Ga0373947_0015338_2602_3195 | 187 |
| 303 | 3300035725 | Ga0373947_0285839 | Ga0373947_0285839_17_610 | 187 |
| 304 | 3300036401 | Ga0373937_0028859 | Ga0373937_0028859_4153_4746 | 187 |
| 305 | 3300036401 | Ga0373937_0042165 | Ga0373937_0042165_3167_3751 | 187 |
| 306 | 3300036401 | Ga0373937_0232966 | Ga0373937_0232966_540_1124 | 187 |
| 307 | 3300037068 | Ga0373925_0163243 | Ga0373925_0163243_41_634 | 187 |
| 308 | 3300037068 | Ga0373925_0183922 | Ga0373925_0183922_555_1139 | 187 |
| 309 | 3300037068 | Ga0373925_0209796 | Ga0373925_0209796_392_976 | 187 |
| 310 | 3300037068 | Ga0373925_0237926 | Ga0373925_0237926_776_1369 | 187 |
| 311 | 3300041512 | Ga0451853_2525184 | Ga0451853_2525184_367_960 | 187 |
| 312 | 3300042005 | Ga0439448_0025256 | Ga0439448_0025256_1066_1659 | 187 |
| 313 | 3300046462 | Ga0495651_0191090 | Ga0495651_0191090_19_612 | 187 |
| 314 | 3300046462 | Ga0495651_0250168 | Ga0495651_0250168_152_745 | 187 |
| 315 | 3300046463 | Ga0495653_0130897 | Ga0495653_0130897_183_767 | 187 |
| 316 | 3300046472 | Ga0495580_0010175 | Ga0495580_0010175_104_688 | 187 |
| 317 | 3300046472 | Ga0495580_0077356 | Ga0495580_0077356_1490_2074 | 187 |
| 318 | 3300046472 | Ga0495580_0299883 | Ga0495580_0299883_54_647 | 187 |
| 319 | 3300046473 | Ga0495582_0009981 | Ga0495582_0009981_671_1255 | 187 |
| 320 | 3300046475 | Ga0495639_0005310 | Ga0495639_0005310_934_1518 | 187 |
| 321 | 3300046476 | Ga0495662_0085792 | Ga0495662_0085792_704_1288 | 187 |
| 322 | 3300046477 | Ga0495664_0030616 | Ga0495664_0030616_325_918 | 187 |
| 323 | 3300046477 | Ga0495664_0540979 | Ga0495664_0540979_90_683 | 187 |
| 324 | 3300046499 | Ga0495594_0017270 | Ga0495594_0017270_1763_2347 | 187 |
| 325 | 3300046516 | Ga0495628_0127544 | Ga0495628_0127544_1034_1627 | 187 |
| 326 | 3300046517 | Ga0495630_0135258 | Ga0495630_0135258_795_1388 | 187 |
| 327 | 3300046526 | Ga0495666_0086173 | Ga0495666_0086173_733_1317 | 187 |
| 328 | 3300046531 | Ga0495665_0022338 | Ga0495665_0022338_1468_2052 | 187 |
| 329 | 3300046535 | Ga0495586_0064780 | Ga0495586_0064780_1210_1803 | 187 |
| 330 | 3300046539 | Ga0495621_0002673 | Ga0495621_0002673_2011_2604 | 187 |
| 331 | 3300046543 | Ga0495645_0006508 | Ga0495645_0006508_5245_5838 | 187 |
| 332 | 3300046543 | Ga0495645_0282285 | Ga0495645_0282285_293_886 | 187 |
| 333 | 3300046663 | Ga0495635_0021390 | Ga0495635_0021390_3574_4158 | 187 |
| 334 | 3300046663 | Ga0495635_0619942 | Ga0495635_0619942_67_660 | 187 |
| 335 | 3300046664 | Ga0495659_0011305 | Ga0495659_0011305_1358_1951 | 187 |
| 336 | 3300046679 | Ga0495623_0070732 | Ga0495623_0070732_660_1253 | 187 |
| 337 | 3300046683 | Ga0495658_0046521 | Ga0495658_0046521_1799_2392 | 187 |
| 338 | 3300046809 | Ga0495600_0029604 | Ga0495600_0029604_1789_2373 | 187 |
| 339 | 3300047315 | Ga0495581_0008149 | Ga0495581_0008149_5375_5959 | 187 |
| 340 | 3300047317 | Ga0495604_0179273 | Ga0495604_0179273_423_1016 | 187 |
| 341 | 3300047319 | Ga0495674_0157749 | Ga0495674_0157749_813_1406 | 187 |
| 342 | 3300047322 | Ga0495680_0075719 | Ga0495680_0075719_495_1079 | 187 |
| 343 | 3300047471 | Ga0495684_0003967 | Ga0495684_0003967_6455_7039 | 187 |
| 344 | 3300048088 | Ga0495602_0073475 | Ga0495602_0073475_2307_2891 | 187 |
| 345 | 3300048905 | Ga0496102_0039809 | Ga0496102_0039809_561_1145 | 187 |
| 346 | 3300048907 | Ga0496104_0101161 | Ga0496104_0101161_352_945 | 187 |
| 347 | 3300048908 | Ga0496105_0022793 | Ga0496105_0022793_3237_3830 | 187 |
| 348 | 3300048910 | Ga0496107_0151599 | Ga0496107_0151599_696_1289 | 187 |
| 349 | 3300048912 | Ga0496109_0040016 | Ga0496109_0040016_1661_2254 | 187 |
| 350 | 3300048914 | Ga0496111_0106968 | Ga0496111_0106968_249_842 | 187 |
| 351 | 3300048915 | Ga0496112_0001998 | Ga0496112_0001998_3850_4443 | 187 |
| 352 | 3300048917 | Ga0496114_0038202 | Ga0496114_0038202_1793_2386 | 187 |
| 353 | 3300053077 | Ga0495601_0303835 | Ga0495601_0303835_246_839 | 187 |
| 354 | 3300053078 | Ga0495612_0049642 | Ga0495612_0049642_655_1248 | 187 |
| 355 | 3300053085 | Ga0495619_0052673 | Ga0495619_0052673_1320_1904 | 187 |
| 356 | 3300003203 | JGI25406J46586_10120319 | JGI25406J46586_101203191 | 188 |
| 357 | 3300005985 | Ga0081539_10066694 | Ga0081539_100666942 | 188 |
| 358 | 3300026118 | Ga0207675_101043099 | Ga0207675_1010430992 | 188 |
| 359 | 3300031238 | Ga0265332_10002051 | Ga0265332_1000205114 | 188 |
| 360 | 3300031241 | Ga0265325_10035231 | Ga0265325_100352313 | 188 |
| 361 | 3300031242 | Ga0265329_10006644 | Ga0265329_100066444 | 188 |
| 362 | 3300031250 | Ga0265331_10000485 | Ga0265331_1000048527 | 188 |
| 363 | 3300031251 | Ga0265327_10013562 | Ga0265327_100135624 | 188 |
| 364 | 3300031344 | Ga0265316_10015334 | Ga0265316_100153343 | 188 |
| 365 | 3300031711 | Ga0265314_10009143 | Ga0265314_100091434 | 188 |
| 366 | 3300031712 | Ga0265342_10010277 | Ga0265342_100102772 | 188 |
| 367 | 3300005543 | Ga0070672_100083055 | Ga0070672_1000830553 | 189 |
| 368 | 3300005563 | Ga0068855_100003365 | Ga0068855_10000336519 | 189 |
| 369 | 3300005564 | Ga0070664_100000603 | Ga0070664_10000060320 | 189 |
| 370 | 3300005614 | Ga0068856_100006811 | Ga0068856_1000068112 | 189 |
| 371 | 3300005616 | Ga0068852_100007597 | Ga0068852_1000075975 | 189 |
| 372 | 3300005617 | Ga0068859_100602005 | Ga0068859_1006020052 | 189 |
| 373 | 3300005834 | Ga0068851_10130146 | Ga0068851_101301462 | 189 |
| 374 | 3300006931 | Ga0097620_100602056 | Ga0097620_1006020562 | 189 |
| 375 | 3300014969 | Ga0157376_10468579 | Ga0157376_104685792 | 189 |
| 376 | 3300025907 | Ga0207645_10280271 | Ga0207645_102802712 | 189 |
| 377 | 3300025919 | Ga0207657_10000838 | Ga0207657_1000083810 | 189 |
| 378 | 3300025923 | Ga0207681_10117350 | Ga0207681_101173503 | 189 |
| 379 | 3300025932 | Ga0207690_10000802 | Ga0207690_1000080213 | 189 |
| 380 | 3300025933 | Ga0207706_10000052 | Ga0207706_1000005274 | 189 |
| 381 | 3300025940 | Ga0207691_10084220 | Ga0207691_100842203 | 189 |
| 382 | 3300025945 | Ga0207679_10034570 | Ga0207679_100345704 | 189 |
| 383 | 3300025949 | Ga0207667_10004899 | Ga0207667_100048993 | 189 |
| 384 | 3300025960 | Ga0207651_10023051 | Ga0207651_100230513 | 189 |
| 385 | 3300025981 | Ga0207640_10091174 | Ga0207640_100911744 | 189 |
| 386 | 3300025986 | Ga0207658_10024031 | Ga0207658_100240313 | 189 |
| 387 | 3300026023 | Ga0207677_10130342 | Ga0207677_101303423 | 189 |
| 388 | 3300026067 | Ga0207678_10021509 | Ga0207678_100215095 | 189 |
| 389 | 3300026078 | Ga0207702_10001528 | Ga0207702_1000152819 | 189 |
| 390 | 3300026142 | Ga0207698_10024376 | Ga0207698_100243763 | 189 |
| 391 | 3300036401 | Ga0373937_0470532 | Ga0373937_0470532_558_1160 | 189 |
| 392 | 3300006844 | Ga0075428_100044002 | Ga0075428_1000440022 | 190 |
| 393 | 3300014326 | Ga0157380_10606100 | Ga0157380_106061002 | 190 |
| 394 | 3300025972 | Ga0207668_10035134 | Ga0207668_100351343 | 190 |
| 395 | 3300025972 | Ga0207668_11092287 | Ga0207668_110922872 | 190 |
| 396 | 3300027665 | Ga0209983_1016566 | Ga0209983_10165662 | 190 |
| 397 | 3300027695 | Ga0209966_1046711 | Ga0209966_10467112 | 190 |
| 398 | 3300005366 | Ga0070659_100035551 | Ga0070659_1000355512 | 191 |
| 399 | 3300009177 | Ga0105248_11625282 | Ga0105248_116252821 | 191 |
| 400 | 3300025928 | Ga0207700_10235075 | Ga0207700_102350751 | 191 |
| 401 | 3300025941 | Ga0207711_10134208 | Ga0207711_101342081 | 191 |
| 402 | 3300025942 | Ga0207689_10242062 | Ga0207689_102420622 | 191 |
| 403 | 3300005329 | Ga0070683_100162470 | Ga0070683_1001624702 | 192 |
| 404 | 3300005331 | Ga0070670_100082378 | Ga0070670_1000823783 | 192 |
| 405 | 3300005333 | Ga0070677_10164128 | Ga0070677_101641282 | 192 |
| 406 | 3300005335 | Ga0070666_10066112 | Ga0070666_100661123 | 192 |
| 407 | 3300005338 | Ga0068868_100016776 | Ga0068868_1000167763 | 192 |
| 408 | 3300005338 | Ga0068868_100500833 | Ga0068868_1005008332 | 192 |
| 409 | 3300005344 | Ga0070661_100045024 | Ga0070661_1000450243 | 192 |
| 410 | 3300005356 | Ga0070674_100002939 | Ga0070674_1000029396 | 192 |
| 411 | 3300005456 | Ga0070678_100013450 | Ga0070678_1000134503 | 192 |
| 412 | 3300005459 | Ga0068867_100014417 | Ga0068867_1000144174 | 192 |
| 413 | 3300005543 | Ga0070672_100042097 | Ga0070672_1000420974 | 192 |
| 414 | 3300005548 | Ga0070665_100002901 | Ga0070665_1000029012 | 192 |
| 415 | 3300005564 | Ga0070664_100082272 | Ga0070664_1000822723 | 192 |
| 416 | 3300005616 | Ga0068852_100004904 | Ga0068852_10000490411 | 192 |
| 417 | 3300005834 | Ga0068851_10011782 | Ga0068851_100117823 | 192 |
| 418 | 3300006237 | Ga0097621_100085550 | Ga0097621_1000855502 | 192 |
| 419 | 3300006358 | Ga0068871_100027967 | Ga0068871_1000279673 | 192 |
| 420 | 3300006881 | Ga0068865_100539139 | Ga0068865_1005391392 | 192 |
| 421 | 3300009177 | Ga0105248_10562616 | Ga0105248_105626163 | 192 |
| 422 | 3300013296 | Ga0157374_10122413 | Ga0157374_101224133 | 192 |
| 423 | 3300013308 | Ga0157375_10747611 | Ga0157375_107476112 | 192 |
| 424 | 3300025903 | Ga0207680_10128823 | Ga0207680_101288232 | 192 |
| 425 | 3300025925 | Ga0207650_10120693 | Ga0207650_101206933 | 192 |
| 426 | 3300025937 | Ga0207669_10003089 | Ga0207669_100030895 | 192 |
| 427 | 3300025940 | Ga0207691_10042435 | Ga0207691_100424354 | 192 |
| 428 | 3300025941 | Ga0207711_10396589 | Ga0207711_103965892 | 192 |
| 429 | 3300026089 | Ga0207648_10078366 | Ga0207648_100783664 | 192 |
| 430 | 3300026095 | Ga0207676_10777592 | Ga0207676_107775922 | 192 |
| 431 | 3300026121 | Ga0207683_10001496 | Ga0207683_100014966 | 192 |
| 432 | 3300028379 | Ga0268266_10011604 | Ga0268266_100116043 | 192 |
| 433 | 3300035691 | Ga0373931_0033564 | Ga0373931_0033564_540_1121 | 192 |
| 434 | 3300005439 | Ga0070711_100179840 | Ga0070711_1001798402 | 193 |
| 435 | 3300025916 | Ga0207663_10164514 | Ga0207663_101645143 | 193 |
| 436 | 3300005367 | Ga0070667_100415956 | Ga0070667_1004159561 | 194 |
| 437 | 3300005614 | Ga0068856_100704331 | Ga0068856_1007043312 | 194 |
| 438 | 3300042436 | Ga0439435_0029683 | Ga0439435_0029683_263_853 | 194 |
| 439 | 3300049591 | Ga0501075_0451477 | Ga0501075_0451477_253_843 | 194 |
| 440 | 3300049592 | Ga0501076_0277016 | Ga0501076_0277016_485_1075 | 194 |
| 441 | 3300049824 | Ga0501045_0061866 | Ga0501045_0061866_1851_2441 | 194 |
| 442 | 3300005347 | Ga0070668_100030960 | Ga0070668_1000309604 | 195 |
| 443 | 3300005353 | Ga0070669_100110702 | Ga0070669_1001107023 | 195 |
| 444 | 3300005564 | Ga0070664_100015292 | Ga0070664_1000152925 | 195 |
| 445 | 3300005614 | Ga0068856_100146518 | Ga0068856_1001465182 | 195 |
| 446 | 3300005614 | Ga0068856_100421830 | Ga0068856_1004218302 | 195 |
| 447 | 3300005618 | Ga0068864_100064811 | Ga0068864_1000648111 | 195 |
| 448 | 3300005618 | Ga0068864_100415537 | Ga0068864_1004155372 | 195 |
| 449 | 3300005719 | Ga0068861_100074449 | Ga0068861_1000744492 | 195 |
| 450 | 3300005841 | Ga0068863_100237443 | Ga0068863_1002374431 | 195 |
| 451 | 3300005843 | Ga0068860_100036770 | Ga0068860_1000367703 | 195 |
| 452 | 3300005843 | Ga0068860_100136551 | Ga0068860_1001365514 | 195 |
| 453 | 3300009094 | Ga0111539_10461455 | Ga0111539_104614553 | 195 |
| 454 | 3300011119 | Ga0105246_11024521 | Ga0105246_110245211 | 195 |
| 455 | 3300013307 | Ga0157372_10152472 | Ga0157372_101524722 | 195 |
| 456 | 3300013308 | Ga0157375_10365791 | Ga0157375_103657912 | 195 |
| 457 | 3300014969 | Ga0157376_10485995 | Ga0157376_104859951 | 195 |
| 458 | 3300025945 | Ga0207679_10009761 | Ga0207679_100097615 | 195 |
| 459 | 3300026035 | Ga0207703_10397061 | Ga0207703_103970612 | 195 |
| 460 | 3300026088 | Ga0207641_10048832 | Ga0207641_100488321 | 195 |
| 461 | 3300026088 | Ga0207641_10444051 | Ga0207641_104440511 | 195 |
| 462 | 3300026095 | Ga0207676_10681372 | Ga0207676_106813722 | 195 |
| 463 | 3300026118 | Ga0207675_100477586 | Ga0207675_1004775862 | 195 |
| 464 | 3300028380 | Ga0268265_10044623 | Ga0268265_100446233 | 195 |
| 465 | 3300028381 | Ga0268264_10121263 | Ga0268264_101212632 | 195 |
| 466 | 3300042876 | Ga0451577_0080614 | Ga0451577_0080614_2180_2773 | 195 |
| 467 | 3300042876 | Ga0451577_0280096 | Ga0451577_0280096_240_842 | 195 |
| 468 | 3300045051 | Ga0451576_0377529 | Ga0451576_0377529_857_1459 | 195 |
| 469 | 3300048907 | Ga0496104_0380993 | Ga0496104_0380993_452_1045 | 195 |
| 470 | 3300048909 | Ga0496106_0217851 | Ga0496106_0217851_398_991 | 195 |
| 471 | 3300050513 | nmdc:mga0rr50_928671_c1 | nmdc:mga0rr50_928671_c1_71_673 | 195 |
| 472 | 3300050514 | nmdc:mga08x19_755365_c1 | nmdc:mga08x19_755365_c1_38_661 | 195 |
| 473 | 3300005330 | Ga0070690_100069917 | Ga0070690_1000699173 | 196 |
| 474 | 3300005331 | Ga0070670_100067874 | Ga0070670_1000678743 | 196 |
| 475 | 3300005334 | Ga0068869_100002048 | Ga0068869_10000204811 | 196 |
| 476 | 3300005335 | Ga0070666_10151823 | Ga0070666_101518232 | 196 |
| 477 | 3300005339 | Ga0070660_100028916 | Ga0070660_1000289163 | 196 |
| 478 | 3300005340 | Ga0070689_100953704 | Ga0070689_1009537041 | 196 |
| 479 | 3300005343 | Ga0070687_100160803 | Ga0070687_1001608032 | 196 |
| 480 | 3300005344 | Ga0070661_100172627 | Ga0070661_1001726273 | 196 |
| 481 | 3300005347 | Ga0070668_100003095 | Ga0070668_1000030953 | 196 |
| 482 | 3300005347 | Ga0070668_100017531 | Ga0070668_1000175314 | 196 |
| 483 | 3300005353 | Ga0070669_100013619 | Ga0070669_1000136196 | 196 |
| 484 | 3300005353 | Ga0070669_100064961 | Ga0070669_1000649614 | 196 |
| 485 | 3300005354 | Ga0070675_100580005 | Ga0070675_1005800051 | 196 |
| 486 | 3300005355 | Ga0070671_100048480 | Ga0070671_1000484803 | 196 |
| 487 | 3300005364 | Ga0070673_100180112 | Ga0070673_1001801123 | 196 |
| 488 | 3300005367 | Ga0070667_100032146 | Ga0070667_1000321466 | 196 |
| 489 | 3300005367 | Ga0070667_100032899 | Ga0070667_1000328994 | 196 |
| 490 | 3300005367 | Ga0070667_100058368 | Ga0070667_1000583684 | 196 |
| 491 | 3300005367 | Ga0070667_100123319 | Ga0070667_1001233193 | 196 |
| 492 | 3300005367 | Ga0070667_100753131 | Ga0070667_1007531312 | 196 |
| 493 | 3300005445 | Ga0070708_100001563 | Ga0070708_1000015635 | 196 |
| 494 | 3300005445 | Ga0070708_100693996 | Ga0070708_1006939962 | 196 |
| 495 | 3300005456 | Ga0070678_100358216 | Ga0070678_1003582163 | 196 |
| 496 | 3300005457 | Ga0070662_100082979 | Ga0070662_1000829792 | 196 |
| 497 | 3300005459 | Ga0068867_100007386 | Ga0068867_1000073869 | 196 |
| 498 | 3300005530 | Ga0070679_100402222 | Ga0070679_1004022222 | 196 |
| 499 | 3300005539 | Ga0068853_100263299 | Ga0068853_1002632992 | 196 |
| 500 | 3300005543 | Ga0070672_100017957 | Ga0070672_1000179576 | 196 |
| 501 | 3300005543 | Ga0070672_100019414 | Ga0070672_1000194146 | 196 |
| 502 | 3300005546 | Ga0070696_100213044 | Ga0070696_1002130442 | 196 |
| 503 | 3300005547 | Ga0070693_100196895 | Ga0070693_1001968952 | 196 |
| 504 | 3300005548 | Ga0070665_100107353 | Ga0070665_1001073534 | 196 |
| 505 | 3300005563 | Ga0068855_100004748 | Ga0068855_10000474818 | 196 |
| 506 | 3300005563 | Ga0068855_100142436 | Ga0068855_1001424364 | 196 |
| 507 | 3300005577 | Ga0068857_100008941 | Ga0068857_1000089418 | 196 |
| 508 | 3300005578 | Ga0068854_100168046 | Ga0068854_1001680463 | 196 |
| 509 | 3300005578 | Ga0068854_100339589 | Ga0068854_1003395892 | 196 |
| 510 | 3300005614 | Ga0068856_100315113 | Ga0068856_1003151132 | 196 |
| 511 | 3300005616 | Ga0068852_100229474 | Ga0068852_1002294742 | 196 |
| 512 | 3300005617 | Ga0068859_100000538 | Ga0068859_10000053829 | 196 |
| 513 | 3300005617 | Ga0068859_100751572 | Ga0068859_1007515722 | 196 |
| 514 | 3300005618 | Ga0068864_100000566 | Ga0068864_10000056612 | 196 |
| 515 | 3300005719 | Ga0068861_100037669 | Ga0068861_1000376693 | 196 |
| 516 | 3300005840 | Ga0068870_10210434 | Ga0068870_102104342 | 196 |
| 517 | 3300005841 | Ga0068863_100001288 | Ga0068863_10000128816 | 196 |
| 518 | 3300005841 | Ga0068863_100022056 | Ga0068863_1000220565 | 196 |
| 519 | 3300005842 | Ga0068858_100004050 | Ga0068858_10000405017 | 196 |
| 520 | 3300005842 | Ga0068858_100013137 | Ga0068858_1000131373 | 196 |
| 521 | 3300005843 | Ga0068860_100001659 | Ga0068860_10000165916 | 196 |
| 522 | 3300005843 | Ga0068860_100270375 | Ga0068860_1002703753 | 196 |
| 523 | 3300005937 | Ga0081455_10450271 | Ga0081455_104502712 | 196 |
| 524 | 3300005985 | Ga0081539_10046006 | Ga0081539_100460062 | 196 |
| 525 | 3300006852 | Ga0075433_10371263 | Ga0075433_103712632 | 196 |
| 526 | 3300006931 | Ga0097620_100000538 | Ga0097620_10000053816 | 196 |
| 527 | 3300006931 | Ga0097620_100751526 | Ga0097620_1007515262 | 196 |
| 528 | 3300009094 | Ga0111539_10243953 | Ga0111539_102439532 | 196 |
| 529 | 3300009098 | Ga0105245_10154086 | Ga0105245_101540862 | 196 |
| 530 | 3300009101 | Ga0105247_10257282 | Ga0105247_102572822 | 196 |
| 531 | 3300009177 | Ga0105248_10017422 | Ga0105248_100174228 | 196 |
| 532 | 3300009177 | Ga0105248_10392887 | Ga0105248_103928873 | 196 |
| 533 | 3300009177 | Ga0105248_12174003 | Ga0105248_121740031 | 196 |
| 534 | 3300009553 | Ga0105249_10253320 | Ga0105249_102533203 | 196 |
| 535 | 3300013104 | Ga0157370_10002272 | Ga0157370_1000227216 | 196 |
| 536 | 3300013104 | Ga0157370_10016162 | Ga0157370_100161625 | 196 |
| 537 | 3300013307 | Ga0157372_11096720 | Ga0157372_110967202 | 196 |
| 538 | 3300013308 | Ga0157375_10683039 | Ga0157375_106830391 | 196 |
| 539 | 3300014325 | Ga0163163_10007776 | Ga0163163_100077764 | 196 |
| 540 | 3300014325 | Ga0163163_10131417 | Ga0163163_101314171 | 196 |
| 541 | 3300014968 | Ga0157379_10000063 | Ga0157379_1000006311 | 196 |
| 542 | 3300014968 | Ga0157379_10001854 | Ga0157379_1000185414 | 196 |
| 543 | 3300025315 | Ga0207697_10036401 | Ga0207697_100364012 | 196 |
| 544 | 3300025315 | Ga0207697_10114552 | Ga0207697_101145522 | 196 |
| 545 | 3300025903 | Ga0207680_10274973 | Ga0207680_102749732 | 196 |
| 546 | 3300025907 | Ga0207645_10063635 | Ga0207645_100636354 | 196 |
| 547 | 3300025908 | Ga0207643_10002024 | Ga0207643_100020246 | 196 |
| 548 | 3300025908 | Ga0207643_10357630 | Ga0207643_103576301 | 196 |
| 549 | 3300025918 | Ga0207662_10177995 | Ga0207662_101779952 | 196 |
| 550 | 3300025919 | Ga0207657_10001142 | Ga0207657_100011425 | 196 |
| 551 | 3300025920 | Ga0207649_10092390 | Ga0207649_100923902 | 196 |
| 552 | 3300025923 | Ga0207681_10004889 | Ga0207681_100048896 | 196 |
| 553 | 3300025923 | Ga0207681_10035034 | Ga0207681_100350342 | 196 |
| 554 | 3300025931 | Ga0207644_10058219 | Ga0207644_100582194 | 196 |
| 555 | 3300025932 | Ga0207690_10019366 | Ga0207690_100193664 | 196 |
| 556 | 3300025933 | Ga0207706_10046988 | Ga0207706_100469883 | 196 |
| 557 | 3300025936 | Ga0207670_10779584 | Ga0207670_107795841 | 196 |
| 558 | 3300025940 | Ga0207691_10031723 | Ga0207691_100317236 | 196 |
| 559 | 3300025940 | Ga0207691_10679550 | Ga0207691_106795501 | 196 |
| 560 | 3300025941 | Ga0207711_10229408 | Ga0207711_102294083 | 196 |
| 561 | 3300025942 | Ga0207689_10002629 | Ga0207689_100026298 | 196 |
| 562 | 3300025945 | Ga0207679_10138470 | Ga0207679_101384702 | 196 |
| 563 | 3300025949 | Ga0207667_10016222 | Ga0207667_100162223 | 196 |
| 564 | 3300025949 | Ga0207667_10126075 | Ga0207667_101260753 | 196 |
| 565 | 3300025949 | Ga0207667_10161080 | Ga0207667_101610802 | 196 |
| 566 | 3300025960 | Ga0207651_10147366 | Ga0207651_101473662 | 196 |
| 567 | 3300025961 | Ga0207712_10143346 | Ga0207712_101433462 | 196 |
| 568 | 3300025972 | Ga0207668_10176614 | Ga0207668_101766142 | 196 |
| 569 | 3300025981 | Ga0207640_10249758 | Ga0207640_102497582 | 196 |
| 570 | 3300025986 | Ga0207658_10074568 | Ga0207658_100745684 | 196 |
| 571 | 3300025986 | Ga0207658_10090467 | Ga0207658_100904672 | 196 |
| 572 | 3300025986 | Ga0207658_10240003 | Ga0207658_102400033 | 196 |
| 573 | 3300026023 | Ga0207677_10175540 | Ga0207677_101755402 | 196 |
| 574 | 3300026023 | Ga0207677_10314425 | Ga0207677_103144252 | 196 |
| 575 | 3300026035 | Ga0207703_10003421 | Ga0207703_1000342113 | 196 |
| 576 | 3300026035 | Ga0207703_10006642 | Ga0207703_100066429 | 196 |
| 577 | 3300026067 | Ga0207678_10441966 | Ga0207678_104419662 | 196 |
| 578 | 3300026088 | Ga0207641_10063530 | Ga0207641_100635302 | 196 |
| 579 | 3300026089 | Ga0207648_10006931 | Ga0207648_100069318 | 196 |
| 580 | 3300026095 | Ga0207676_10010947 | Ga0207676_100109476 | 196 |
| 581 | 3300026116 | Ga0207674_10011259 | Ga0207674_100112596 | 196 |
| 582 | 3300026116 | Ga0207674_10071748 | Ga0207674_100717484 | 196 |
| 583 | 3300026118 | Ga0207675_100075541 | Ga0207675_1000755414 | 196 |
| 584 | 3300026121 | Ga0207683_10641681 | Ga0207683_106416812 | 196 |
| 585 | 3300028379 | Ga0268266_10085665 | Ga0268266_100856654 | 196 |
| 586 | 3300028380 | Ga0268265_10048032 | Ga0268265_100480323 | 196 |
| 587 | 3300028381 | Ga0268264_10000599 | Ga0268264_1000059917 | 196 |
| 588 | 3300028381 | Ga0268264_10046042 | Ga0268264_100460425 | 196 |
| 589 | 3300028381 | Ga0268264_10633059 | Ga0268264_106330592 | 196 |
| 590 | 3300031548 | Ga0307408_100019001 | Ga0307408_1000190013 | 196 |
| 591 | 3300031731 | Ga0307405_10014503 | Ga0307405_100145035 | 196 |
| 592 | 3300031824 | Ga0307413_10160338 | Ga0307413_101603383 | 196 |
| 593 | 3300031852 | Ga0307410_10001357 | Ga0307410_100013575 | 196 |
| 594 | 3300031901 | Ga0307406_10037070 | Ga0307406_100370704 | 196 |
| 595 | 3300031903 | Ga0307407_10041821 | Ga0307407_100418214 | 196 |
| 596 | 3300031911 | Ga0307412_10081877 | Ga0307412_100818773 | 196 |
| 597 | 3300031995 | Ga0307409_100012473 | Ga0307409_1000124737 | 196 |
| 598 | 3300032002 | Ga0307416_100203594 | Ga0307416_1002035942 | 196 |
| 599 | 3300032004 | Ga0307414_10230346 | Ga0307414_102303462 | 196 |
| 600 | 3300032005 | Ga0307411_10105760 | Ga0307411_101057603 | 196 |
| 601 | 3300032126 | Ga0307415_100006430 | Ga0307415_1000064302 | 196 |
| 602 | 3300035692 | Ga0373935_0100658 | Ga0373935_0100658_925_1515 | 196 |
| 603 | 3300035695 | Ga0373927_0186264 | Ga0373927_0186264_573_1163 | 196 |
| 604 | 3300037068 | Ga0373925_0511692 | Ga0373925_0511692_235_825 | 196 |
| 605 | 3300048913 | Ga0496110_0461402 | Ga0496110_0461402_151_747 | 196 |
| 606 | 3300050511 | nmdc:mga08y16_1190169_c1 | nmdc:mga08y16_1190169_c1_85_681 | 196 |
| 607 | 3300050512 | nmdc:mga0n895_341536_c1 | nmdc:mga0n895_341536_c1_325_921 | 196 |
| 608 | 3300050513 | nmdc:mga0rr50_572116_c1 | nmdc:mga0rr50_572116_c1_307_921 | 196 |
| 609 | 3300050515 | nmdc:mga0a205_281765_c1 | nmdc:mga0a205_281765_c1_486_1082 | 196 |
| 610 | 3300005327 | Ga0070658_10010289 | Ga0070658_100102896 | 197 |
| 611 | 3300005328 | Ga0070676_10014144 | Ga0070676_100141443 | 197 |
| 612 | 3300005329 | Ga0070683_100316383 | Ga0070683_1003163832 | 197 |
| 613 | 3300005331 | Ga0070670_100234414 | Ga0070670_1002344142 | 197 |
| 614 | 3300005335 | Ga0070666_10212146 | Ga0070666_102121462 | 197 |
| 615 | 3300005336 | Ga0070680_100029569 | Ga0070680_1000295694 | 197 |
| 616 | 3300005336 | Ga0070680_100111261 | Ga0070680_1001112613 | 197 |
| 617 | 3300005337 | Ga0070682_100034586 | Ga0070682_1000345861 | 197 |
| 618 | 3300005337 | Ga0070682_100309519 | Ga0070682_1003095192 | 197 |
| 619 | 3300005338 | Ga0068868_100090864 | Ga0068868_1000908643 | 197 |
| 620 | 3300005338 | Ga0068868_100165407 | Ga0068868_1001654072 | 197 |
| 621 | 3300005339 | Ga0070660_100037521 | Ga0070660_1000375212 | 197 |
| 622 | 3300005339 | Ga0070660_100064656 | Ga0070660_1000646562 | 197 |
| 623 | 3300005344 | Ga0070661_100004591 | Ga0070661_1000045919 | 197 |
| 624 | 3300005345 | Ga0070692_10013193 | Ga0070692_100131931 | 197 |
| 625 | 3300005347 | Ga0070668_100053853 | Ga0070668_1000538534 | 197 |
| 626 | 3300005353 | Ga0070669_100080175 | Ga0070669_1000801752 | 197 |
| 627 | 3300005353 | Ga0070669_100761884 | Ga0070669_1007618841 | 197 |
| 628 | 3300005355 | Ga0070671_100010164 | Ga0070671_1000101648 | 197 |
| 629 | 3300005364 | Ga0070673_100024244 | Ga0070673_1000242443 | 197 |
| 630 | 3300005366 | Ga0070659_100001467 | Ga0070659_10000146713 | 197 |
| 631 | 3300005366 | Ga0070659_100004493 | Ga0070659_10000449311 | 197 |
| 632 | 3300005367 | Ga0070667_100032527 | Ga0070667_1000325273 | 197 |
| 633 | 3300005367 | Ga0070667_100439572 | Ga0070667_1004395721 | 197 |
| 634 | 3300005434 | Ga0070709_10149690 | Ga0070709_101496902 | 197 |
| 635 | 3300005434 | Ga0070709_10214450 | Ga0070709_102144501 | 197 |
| 636 | 3300005435 | Ga0070714_100001561 | Ga0070714_10000156118 | 197 |
| 637 | 3300005455 | Ga0070663_100003583 | Ga0070663_1000035839 | 197 |
| 638 | 3300005456 | Ga0070678_100128334 | Ga0070678_1001283342 | 197 |
| 639 | 3300005457 | Ga0070662_100000514 | Ga0070662_1000005149 | 197 |
| 640 | 3300005458 | Ga0070681_10007078 | Ga0070681_1000707811 | 197 |
| 641 | 3300005458 | Ga0070681_10045765 | Ga0070681_100457653 | 197 |
| 642 | 3300005459 | Ga0068867_100385747 | Ga0068867_1003857472 | 197 |
| 643 | 3300005530 | Ga0070679_100032998 | Ga0070679_1000329982 | 197 |
| 644 | 3300005530 | Ga0070679_100253794 | Ga0070679_1002537943 | 197 |
| 645 | 3300005535 | Ga0070684_100003343 | Ga0070684_1000033437 | 197 |
| 646 | 3300005539 | Ga0068853_100006454 | Ga0068853_10000645410 | 197 |
| 647 | 3300005539 | Ga0068853_100281420 | Ga0068853_1002814202 | 197 |
| 648 | 3300005548 | Ga0070665_100850069 | Ga0070665_1008500692 | 197 |
| 649 | 3300005563 | Ga0068855_100155977 | Ga0068855_1001559774 | 197 |
| 650 | 3300005564 | Ga0070664_100230370 | Ga0070664_1002303702 | 197 |
| 651 | 3300005564 | Ga0070664_100962318 | Ga0070664_1009623182 | 197 |
| 652 | 3300005577 | Ga0068857_100032329 | Ga0068857_1000323291 | 197 |
| 653 | 3300005577 | Ga0068857_100260336 | Ga0068857_1002603361 | 197 |
| 654 | 3300005577 | Ga0068857_100591178 | Ga0068857_1005911782 | 197 |
| 655 | 3300005614 | Ga0068856_100004285 | Ga0068856_1000042856 | 197 |
| 656 | 3300005614 | Ga0068856_100069088 | Ga0068856_1000690882 | 197 |
| 657 | 3300005616 | Ga0068852_100490942 | Ga0068852_1004909422 | 197 |
| 658 | 3300005616 | Ga0068852_100532235 | Ga0068852_1005322352 | 197 |
| 659 | 3300005618 | Ga0068864_100140941 | Ga0068864_1001409414 | 197 |
| 660 | 3300005834 | Ga0068851_10000426 | Ga0068851_100004265 | 197 |
| 661 | 3300005834 | Ga0068851_10264288 | Ga0068851_102642882 | 197 |
| 662 | 3300005841 | Ga0068863_100355213 | Ga0068863_1003552132 | 197 |
| 663 | 3300005843 | Ga0068860_100115903 | Ga0068860_1001159033 | 197 |
| 664 | 3300009093 | Ga0105240_10016388 | Ga0105240_100163881 | 197 |
| 665 | 3300009094 | Ga0111539_10701658 | Ga0111539_107016582 | 197 |
| 666 | 3300009174 | Ga0105241_10122743 | Ga0105241_101227433 | 197 |
| 667 | 3300010375 | Ga0105239_10005432 | Ga0105239_1000543212 | 197 |
| 668 | 3300013100 | Ga0157373_10001627 | Ga0157373_100016276 | 197 |
| 669 | 3300013100 | Ga0157373_10004575 | Ga0157373_100045756 | 197 |
| 670 | 3300013102 | Ga0157371_10000614 | Ga0157371_1000061439 | 197 |
| 671 | 3300013102 | Ga0157371_10098999 | Ga0157371_100989993 | 197 |
| 672 | 3300013104 | Ga0157370_10017667 | Ga0157370_100176675 | 197 |
| 673 | 3300013104 | Ga0157370_10088675 | Ga0157370_100886751 | 197 |
| 674 | 3300013104 | Ga0157370_10394901 | Ga0157370_103949012 | 197 |
| 675 | 3300013105 | Ga0157369_10073906 | Ga0157369_100739064 | 197 |
| 676 | 3300013105 | Ga0157369_10111900 | Ga0157369_101119003 | 197 |
| 677 | 3300013307 | Ga0157372_10005628 | Ga0157372_1000562813 | 197 |
| 678 | 3300013307 | Ga0157372_10039506 | Ga0157372_100395064 | 197 |
| 679 | 3300013307 | Ga0157372_10166276 | Ga0157372_101662762 | 197 |
| 680 | 3300013307 | Ga0157372_10307335 | Ga0157372_103073352 | 197 |
| 681 | 3300013307 | Ga0157372_10451955 | Ga0157372_104519552 | 197 |
| 682 | 3300014745 | Ga0157377_10680455 | Ga0157377_106804551 | 197 |
| 683 | 3300017792 | Ga0163161_10560441 | Ga0163161_105604412 | 197 |
| 684 | 3300020070 | Ga0206356_10703160 | Ga0206356_107031601 | 197 |
| 685 | 3300020082 | Ga0206353_10151062 | Ga0206353_101510622 | 197 |
| 686 | 3300025321 | Ga0207656_10019699 | Ga0207656_100196991 | 197 |
| 687 | 3300025906 | Ga0207699_10015000 | Ga0207699_100150003 | 197 |
| 688 | 3300025909 | Ga0207705_10012689 | Ga0207705_100126897 | 197 |
| 689 | 3300025911 | Ga0207654_10006442 | Ga0207654_100064427 | 197 |
| 690 | 3300025912 | Ga0207707_10012638 | Ga0207707_100126381 | 197 |
| 691 | 3300025912 | Ga0207707_10042784 | Ga0207707_100427843 | 197 |
| 692 | 3300025913 | Ga0207695_10014173 | Ga0207695_100141731 | 197 |
| 693 | 3300025913 | Ga0207695_10440028 | Ga0207695_104400282 | 197 |
| 694 | 3300025917 | Ga0207660_10006657 | Ga0207660_100066576 | 197 |
| 695 | 3300025917 | Ga0207660_10059370 | Ga0207660_100593703 | 197 |
| 696 | 3300025918 | Ga0207662_10168223 | Ga0207662_101682232 | 197 |
| 697 | 3300025919 | Ga0207657_10001514 | Ga0207657_1000151429 | 197 |
| 698 | 3300025920 | Ga0207649_10020195 | Ga0207649_100201951 | 197 |
| 699 | 3300025920 | Ga0207649_10119325 | Ga0207649_101193252 | 197 |
| 700 | 3300025920 | Ga0207649_10533631 | Ga0207649_105336311 | 197 |
| 701 | 3300025921 | Ga0207652_10216347 | Ga0207652_102163472 | 197 |
| 702 | 3300025921 | Ga0207652_10222287 | Ga0207652_102222872 | 197 |
| 703 | 3300025921 | Ga0207652_10264867 | Ga0207652_102648673 | 197 |
| 704 | 3300025924 | Ga0207694_10077340 | Ga0207694_100773401 | 197 |
| 705 | 3300025928 | Ga0207700_10223950 | Ga0207700_102239502 | 197 |
| 706 | 3300025929 | Ga0207664_10004963 | Ga0207664_100049636 | 197 |
| 707 | 3300025929 | Ga0207664_10261193 | Ga0207664_102611932 | 197 |
| 708 | 3300025932 | Ga0207690_10183824 | Ga0207690_101838242 | 197 |
| 709 | 3300025933 | Ga0207706_10313699 | Ga0207706_103136992 | 197 |
| 710 | 3300025937 | Ga0207669_10263243 | Ga0207669_102632432 | 197 |
| 711 | 3300025940 | Ga0207691_10156979 | Ga0207691_101569793 | 197 |
| 712 | 3300025944 | Ga0207661_10033692 | Ga0207661_100336925 | 197 |
| 713 | 3300025945 | Ga0207679_10202353 | Ga0207679_102023533 | 197 |
| 714 | 3300025949 | Ga0207667_10002090 | Ga0207667_100020901 | 197 |
| 715 | 3300025949 | Ga0207667_10089248 | Ga0207667_100892484 | 197 |
| 716 | 3300025949 | Ga0207667_10129870 | Ga0207667_101298703 | 197 |
| 717 | 3300025981 | Ga0207640_10004826 | Ga0207640_100048261 | 197 |
| 718 | 3300025981 | Ga0207640_10283293 | Ga0207640_102832933 | 197 |
| 719 | 3300026067 | Ga0207678_10011283 | Ga0207678_100112831 | 197 |
| 720 | 3300026078 | Ga0207702_10020849 | Ga0207702_100208494 | 197 |
| 721 | 3300026078 | Ga0207702_10022442 | Ga0207702_100224425 | 197 |
| 722 | 3300026078 | Ga0207702_10047008 | Ga0207702_100470081 | 197 |
| 723 | 3300026078 | Ga0207702_10856736 | Ga0207702_108567362 | 197 |
| 724 | 3300026088 | Ga0207641_10102994 | Ga0207641_101029944 | 197 |
| 725 | 3300026089 | Ga0207648_10096508 | Ga0207648_100965083 | 197 |
| 726 | 3300026116 | Ga0207674_10002203 | Ga0207674_100022031 | 197 |
| 727 | 3300026116 | Ga0207674_10290503 | Ga0207674_102905032 | 197 |
| 728 | 3300026118 | Ga0207675_100130544 | Ga0207675_1001305443 | 197 |
| 729 | 3300026142 | Ga0207698_10000659 | Ga0207698_100006592 | 197 |
| 730 | 3300027682 | Ga0209971_1001936 | Ga0209971_10019366 | 197 |
| 731 | 3300028379 | Ga0268266_10502027 | Ga0268266_105020272 | 197 |
| 732 | 3300028381 | Ga0268264_10601785 | Ga0268264_106017852 | 197 |
| 733 | 3300031548 | Ga0307408_100004014 | Ga0307408_1000040143 | 197 |
| 734 | 3300031731 | Ga0307405_10018794 | Ga0307405_100187943 | 197 |
| 735 | 3300031824 | Ga0307413_10007331 | Ga0307413_100073312 | 197 |
| 736 | 3300031852 | Ga0307410_10001025 | Ga0307410_100010254 | 197 |
| 737 | 3300031901 | Ga0307406_10032793 | Ga0307406_100327932 | 197 |
| 738 | 3300031903 | Ga0307407_10002673 | Ga0307407_100026732 | 197 |
| 739 | 3300031911 | Ga0307412_10009818 | Ga0307412_100098184 | 197 |
| 740 | 3300031995 | Ga0307409_100018388 | Ga0307409_1000183883 | 197 |
| 741 | 3300032002 | Ga0307416_100060819 | Ga0307416_1000608195 | 197 |
| 742 | 3300032005 | Ga0307411_10004698 | Ga0307411_100046984 | 197 |
| 743 | 3300035691 | Ga0373931_0227715 | Ga0373931_0227715_155_763 | 197 |
| 744 | 3300037471 | Ga0395905_0308615 | Ga0395905_0308615_706_1305 | 197 |
| 745 | 3300042157 | Ga0439458_0069788 | Ga0439458_0069788_17_610 | 197 |
| 746 | 3300045976 | Ga0466967_0379197 | Ga0466967_0379197_521_1129 | 197 |
| 747 | 3300048903 | Ga0496100_0146195 | Ga0496100_0146195_87_695 | 197 |
| 748 | 3300048905 | Ga0496102_0039538 | Ga0496102_0039538_1112_1720 | 197 |
| 749 | 3300048905 | Ga0496102_0422729 | Ga0496102_0422729_430_1038 | 197 |
| 750 | 3300048906 | Ga0496103_0216955 | Ga0496103_0216955_500_1108 | 197 |
| 751 | 3300048909 | Ga0496106_0015856 | Ga0496106_0015856_1482_2090 | 197 |
| 752 | 3300048910 | Ga0496107_0037561 | Ga0496107_0037561_1572_2180 | 197 |
| 753 | 3300048913 | Ga0496110_0213348 | Ga0496110_0213348_38_637 | 197 |
| 754 | 3300050514 | nmdc:mga08x19_213965_c1 | nmdc:mga08x19_213965_c1_567_1175 | 197 |
| 755 | 3300001976 | JGI24752J21851_1009839 | JGI24752J21851_10098392 | 198 |
| 756 | 3300001991 | JGI24743J22301_10011735 | JGI24743J22301_100117351 | 198 |
| 757 | 3300002239 | JGI24034J26672_10008291 | JGI24034J26672_100082912 | 198 |
| 758 | 3300002459 | JGI24751J29686_10034862 | JGI24751J29686_100348622 | 198 |
| 759 | 3300005290 | Ga0065712_10131233 | Ga0065712_101312332 | 198 |
| 760 | 3300005327 | Ga0070658_10632055 | Ga0070658_106320552 | 198 |
| 761 | 3300005329 | Ga0070683_100009470 | Ga0070683_1000094706 | 198 |
| 762 | 3300005330 | Ga0070690_100011226 | Ga0070690_1000112262 | 198 |
| 763 | 3300005331 | Ga0070670_100830440 | Ga0070670_1008304401 | 198 |
| 764 | 3300005333 | Ga0070677_10002166 | Ga0070677_100021665 | 198 |
| 765 | 3300005335 | Ga0070666_10223167 | Ga0070666_102231671 | 198 |
| 766 | 3300005336 | Ga0070680_100226029 | Ga0070680_1002260293 | 198 |
| 767 | 3300005337 | Ga0070682_100091487 | Ga0070682_1000914873 | 198 |
| 768 | 3300005339 | Ga0070660_100007823 | Ga0070660_1000078233 | 198 |
| 769 | 3300005339 | Ga0070660_100041143 | Ga0070660_1000411434 | 198 |
| 770 | 3300005340 | Ga0070689_100047874 | Ga0070689_1000478742 | 198 |
| 771 | 3300005341 | Ga0070691_10077539 | Ga0070691_100775392 | 198 |
| 772 | 3300005343 | Ga0070687_100001561 | Ga0070687_1000015617 | 198 |
| 773 | 3300005344 | Ga0070661_100019359 | Ga0070661_1000193592 | 198 |
| 774 | 3300005344 | Ga0070661_100070871 | Ga0070661_1000708712 | 198 |
| 775 | 3300005353 | Ga0070669_100157476 | Ga0070669_1001574762 | 198 |
| 776 | 3300005354 | Ga0070675_100405076 | Ga0070675_1004050762 | 198 |
| 777 | 3300005355 | Ga0070671_100647353 | Ga0070671_1006473531 | 198 |
| 778 | 3300005364 | Ga0070673_100328514 | Ga0070673_1003285142 | 198 |
| 779 | 3300005365 | Ga0070688_100006442 | Ga0070688_1000064422 | 198 |
| 780 | 3300005366 | Ga0070659_100161228 | Ga0070659_1001612282 | 198 |
| 781 | 3300005366 | Ga0070659_100678171 | Ga0070659_1006781711 | 198 |
| 782 | 3300005367 | Ga0070667_100442121 | Ga0070667_1004421212 | 198 |
| 783 | 3300005434 | Ga0070709_10011638 | Ga0070709_100116386 | 198 |
| 784 | 3300005435 | Ga0070714_100179355 | Ga0070714_1001793553 | 198 |
| 785 | 3300005436 | Ga0070713_100165937 | Ga0070713_1001659373 | 198 |
| 786 | 3300005437 | Ga0070710_10001992 | Ga0070710_100019925 | 198 |
| 787 | 3300005439 | Ga0070711_100011788 | Ga0070711_1000117883 | 198 |
| 788 | 3300005440 | Ga0070705_100099438 | Ga0070705_1000994382 | 198 |
| 789 | 3300005441 | Ga0070700_100105515 | Ga0070700_1001055152 | 198 |
| 790 | 3300005455 | Ga0070663_100016670 | Ga0070663_1000166704 | 198 |
| 791 | 3300005458 | Ga0070681_10421880 | Ga0070681_104218802 | 198 |
| 792 | 3300005459 | Ga0068867_100056617 | Ga0068867_1000566173 | 198 |
| 793 | 3300005466 | Ga0070685_10013823 | Ga0070685_100138232 | 198 |
| 794 | 3300005518 | Ga0070699_100005607 | Ga0070699_1000056076 | 198 |
| 795 | 3300005530 | Ga0070679_100051349 | Ga0070679_1000513493 | 198 |
| 796 | 3300005530 | Ga0070679_100355836 | Ga0070679_1003558362 | 198 |
| 797 | 3300005535 | Ga0070684_100061871 | Ga0070684_1000618712 | 198 |
| 798 | 3300005535 | Ga0070684_101240747 | Ga0070684_1012407471 | 198 |
| 799 | 3300005544 | Ga0070686_100003848 | Ga0070686_1000038487 | 198 |
| 800 | 3300005547 | Ga0070693_100005461 | Ga0070693_1000054614 | 198 |
| 801 | 3300005547 | Ga0070693_100204273 | Ga0070693_1002042732 | 198 |
| 802 | 3300005563 | Ga0068855_101009991 | Ga0068855_1010099911 | 198 |
| 803 | 3300005564 | Ga0070664_101057691 | Ga0070664_1010576911 | 198 |
| 804 | 3300005577 | Ga0068857_100095377 | Ga0068857_1000953772 | 198 |
| 805 | 3300005578 | Ga0068854_100127237 | Ga0068854_1001272372 | 198 |
| 806 | 3300005615 | Ga0070702_100016023 | Ga0070702_1000160233 | 198 |
| 807 | 3300005616 | Ga0068852_100066353 | Ga0068852_1000663534 | 198 |
| 808 | 3300005617 | Ga0068859_100295047 | Ga0068859_1002950471 | 198 |
| 809 | 3300005618 | Ga0068864_100010761 | Ga0068864_1000107615 | 198 |
| 810 | 3300005718 | Ga0068866_10009303 | Ga0068866_100093035 | 198 |
| 811 | 3300005719 | Ga0068861_100019043 | Ga0068861_1000190433 | 198 |
| 812 | 3300005834 | Ga0068851_10056517 | Ga0068851_100565173 | 198 |
| 813 | 3300005840 | Ga0068870_10036326 | Ga0068870_100363261 | 198 |
| 814 | 3300005842 | Ga0068858_100347013 | Ga0068858_1003470131 | 198 |
| 815 | 3300005844 | Ga0068862_100184800 | Ga0068862_1001848002 | 198 |
| 816 | 3300006358 | Ga0068871_100212526 | Ga0068871_1002125262 | 198 |
| 817 | 3300006881 | Ga0068865_100017550 | Ga0068865_1000175503 | 198 |
| 818 | 3300006931 | Ga0097620_100295058 | Ga0097620_1002950581 | 198 |
| 819 | 3300009093 | Ga0105240_10076475 | Ga0105240_100764753 | 198 |
| 820 | 3300009094 | Ga0111539_10104443 | Ga0111539_101044433 | 198 |
| 821 | 3300009148 | Ga0105243_10237471 | Ga0105243_102374712 | 198 |
| 822 | 3300009176 | Ga0105242_10365529 | Ga0105242_103655292 | 198 |
| 823 | 3300009545 | Ga0105237_10133995 | Ga0105237_101339954 | 198 |
| 824 | 3300009545 | Ga0105237_10414616 | Ga0105237_104146161 | 198 |
| 825 | 3300011119 | Ga0105246_10029542 | Ga0105246_100295423 | 198 |
| 826 | 3300013100 | Ga0157373_10170280 | Ga0157373_101702802 | 198 |
| 827 | 3300013104 | Ga0157370_10041269 | Ga0157370_100412693 | 198 |
| 828 | 3300013104 | Ga0157370_10174463 | Ga0157370_101744633 | 198 |
| 829 | 3300013105 | Ga0157369_10025834 | Ga0157369_100258342 | 198 |
| 830 | 3300013296 | Ga0157374_10009463 | Ga0157374_100094634 | 198 |
| 831 | 3300013297 | Ga0157378_10088666 | Ga0157378_100886663 | 198 |
| 832 | 3300013307 | Ga0157372_10095006 | Ga0157372_100950064 | 198 |
| 833 | 3300013307 | Ga0157372_10197651 | Ga0157372_101976512 | 198 |
| 834 | 3300014325 | Ga0163163_10008499 | Ga0163163_100084994 | 198 |
| 835 | 3300014326 | Ga0157380_10041417 | Ga0157380_100414173 | 198 |
| 836 | 3300014745 | Ga0157377_10146791 | Ga0157377_101467912 | 198 |
| 837 | 3300014968 | Ga0157379_10016387 | Ga0157379_100163875 | 198 |
| 838 | 3300014969 | Ga0157376_10125191 | Ga0157376_101251913 | 198 |
| 839 | 3300017792 | Ga0163161_10056159 | Ga0163161_100561592 | 198 |
| 840 | 3300025271 | Ga0207666_1006598 | Ga0207666_10065981 | 198 |
| 841 | 3300025315 | Ga0207697_10000020 | Ga0207697_1000002046 | 198 |
| 842 | 3300025321 | Ga0207656_10037791 | Ga0207656_100377913 | 198 |
| 843 | 3300025893 | Ga0207682_10000288 | Ga0207682_100002886 | 198 |
| 844 | 3300025898 | Ga0207692_10006582 | Ga0207692_100065824 | 198 |
| 845 | 3300025901 | Ga0207688_10001077 | Ga0207688_1000107713 | 198 |
| 846 | 3300025903 | Ga0207680_10023928 | Ga0207680_100239284 | 198 |
| 847 | 3300025906 | Ga0207699_10279188 | Ga0207699_102791882 | 198 |
| 848 | 3300025907 | Ga0207645_10000516 | Ga0207645_1000051637 | 198 |
| 849 | 3300025908 | Ga0207643_10000131 | Ga0207643_1000013113 | 198 |
| 850 | 3300025909 | Ga0207705_10164774 | Ga0207705_101647743 | 198 |
| 851 | 3300025909 | Ga0207705_10500603 | Ga0207705_105006031 | 198 |
| 852 | 3300025912 | Ga0207707_10659652 | Ga0207707_106596521 | 198 |
| 853 | 3300025913 | Ga0207695_10060626 | Ga0207695_100606263 | 198 |
| 854 | 3300025914 | Ga0207671_10355524 | Ga0207671_103555242 | 198 |
| 855 | 3300025915 | Ga0207693_10411464 | Ga0207693_104114642 | 198 |
| 856 | 3300025918 | Ga0207662_10003213 | Ga0207662_100032137 | 198 |
| 857 | 3300025919 | Ga0207657_10014488 | Ga0207657_100144883 | 198 |
| 858 | 3300025919 | Ga0207657_10027603 | Ga0207657_100276034 | 198 |
| 859 | 3300025920 | Ga0207649_10135513 | Ga0207649_101355132 | 198 |
| 860 | 3300025921 | Ga0207652_10348044 | Ga0207652_103480442 | 198 |
| 861 | 3300025923 | Ga0207681_10210403 | Ga0207681_102104032 | 198 |
| 862 | 3300025925 | Ga0207650_10015720 | Ga0207650_100157203 | 198 |
| 863 | 3300025926 | Ga0207659_10006674 | Ga0207659_100066743 | 198 |
| 864 | 3300025928 | Ga0207700_10065175 | Ga0207700_100651752 | 198 |
| 865 | 3300025929 | Ga0207664_10008325 | Ga0207664_100083256 | 198 |
| 866 | 3300025931 | Ga0207644_10219477 | Ga0207644_102194772 | 198 |
| 867 | 3300025931 | Ga0207644_10343860 | Ga0207644_103438601 | 198 |
| 868 | 3300025932 | Ga0207690_10653633 | Ga0207690_106536331 | 198 |
| 869 | 3300025933 | Ga0207706_10002570 | Ga0207706_1000257013 | 198 |
| 870 | 3300025934 | Ga0207686_10056328 | Ga0207686_100563282 | 198 |
| 871 | 3300025935 | Ga0207709_10431743 | Ga0207709_104317432 | 198 |
| 872 | 3300025936 | Ga0207670_10030209 | Ga0207670_100302092 | 198 |
| 873 | 3300025937 | Ga0207669_10006693 | Ga0207669_100066933 | 198 |
| 874 | 3300025938 | Ga0207704_10088619 | Ga0207704_100886192 | 198 |
| 875 | 3300025942 | Ga0207689_10000091 | Ga0207689_1000009133 | 198 |
| 876 | 3300025944 | Ga0207661_10182006 | Ga0207661_101820062 | 198 |
| 877 | 3300025945 | Ga0207679_10025870 | Ga0207679_100258703 | 198 |
| 878 | 3300025960 | Ga0207651_10092840 | Ga0207651_100928402 | 198 |
| 879 | 3300025961 | Ga0207712_10049868 | Ga0207712_100498683 | 198 |
| 880 | 3300025972 | Ga0207668_10112473 | Ga0207668_101124733 | 198 |
| 881 | 3300025981 | Ga0207640_10119106 | Ga0207640_101191063 | 198 |
| 882 | 3300025986 | Ga0207658_10113298 | Ga0207658_101132982 | 198 |
| 883 | 3300026041 | Ga0207639_10099426 | Ga0207639_100994263 | 198 |
| 884 | 3300026041 | Ga0207639_10197384 | Ga0207639_101973842 | 198 |
| 885 | 3300026067 | Ga0207678_10000257 | Ga0207678_1000025738 | 198 |
| 886 | 3300026075 | Ga0207708_10003069 | Ga0207708_1000306910 | 198 |
| 887 | 3300026088 | Ga0207641_10092827 | Ga0207641_100928272 | 198 |
| 888 | 3300026089 | Ga0207648_10000415 | Ga0207648_1000041517 | 198 |
| 889 | 3300026118 | Ga0207675_100002299 | Ga0207675_10000229916 | 198 |
| 890 | 3300026121 | Ga0207683_10004801 | Ga0207683_1000480113 | 198 |
| 891 | 3300028380 | Ga0268265_10259706 | Ga0268265_102597062 | 198 |
| 892 | 3300035116 | Ga0373945_0288796 | Ga0373945_0288796_37_633 | 198 |
| 893 | 3300035118 | Ga0373954_0229205 | Ga0373954_0229205_271_873 | 198 |
| 894 | 3300036401 | Ga0373937_0203914 | Ga0373937_0203914_751_1353 | 198 |
| 895 | 3300048903 | Ga0496100_0141959 | Ga0496100_0141959_842_1438 | 198 |
| 896 | 3300048904 | Ga0496101_0120097 | Ga0496101_0120097_1020_1616 | 198 |
| 897 | 3300048905 | Ga0496102_0028926 | Ga0496102_0028926_3439_4035 | 198 |
| 898 | 3300048907 | Ga0496104_0071628 | Ga0496104_0071628_1281_1877 | 198 |
| 899 | 3300048908 | Ga0496105_0206236 | Ga0496105_0206236_730_1326 | 198 |
| 900 | 3300048910 | Ga0496107_0007460 | Ga0496107_0007460_727_1323 | 198 |
| 901 | 3300048911 | Ga0496108_0003278 | Ga0496108_0003278_12295_12891 | 198 |
| 902 | 3300048912 | Ga0496109_0004927 | Ga0496109_0004927_5286_5882 | 198 |
| 903 | 3300048913 | Ga0496110_0003478 | Ga0496110_0003478_5976_6572 | 198 |
| 904 | 3300048914 | Ga0496111_0319377 | Ga0496111_0319377_134_730 | 198 |
| 905 | 3300048916 | Ga0496113_0280272 | Ga0496113_0280272_488_1084 | 198 |
| 906 | 3300048918 | Ga0496115_0369470 | Ga0496115_0369470_424_1026 | 198 |
| 907 | 3300050511 | nmdc:mga08y16_91621_c1 | nmdc:mga08y16_91621_c1_339_941 | 198 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1s7f-assembly1.cif.gz_A-2 | riml- ribosomal l7/l12 alpha-n-protein acetyltransferase crystal form i (apo) | 0.8973 | 6 | 177 |
| 3igr-assembly1.cif.gz_A | the crystal structure of ribosomal-protein-s5-alanine acetyltransferase from vibrio fischeri to 2.0a | 0.8905 | 5 | 181 |
| 1nsl-assembly1.cif.gz_D | crystal structure of probable acetyltransferase | 0.8788 | 10 | 181 |
| 1nsl-assembly1.cif.gz_B | crystal structure of probable acetyltransferase | 0.8758 | 7 | 181 |
| 8gxj-assembly1.cif.gz_A | pseudomonas aeruginosa n-acetyltransferase domain-containing protein pa3270 | 0.8727 | 7 | 189 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_A0A0R0ECR9_59_131_3.40.630.30 | Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) | 0.9398 | 110 | 180 | 3.40.630.30 |
| af_O05578_9_186_3.40.630.30 | Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) | 0.9167 | 13 | 180 | 3.40.630.30 |
| af_P0A948_10_192_3.40.630.30 | Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) | 0.9113 | 5 | 181 | 3.40.630.30 |
| af_A0A0R0ECR9_59_131_3.40.630.30 | Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) | 0.904 | 110 | 180 | 3.40.630.30 |
| af_Q54VL6_2_179_3.40.630.30 | Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) | 0.9025 | 6 | 181 | 3.40.630.30 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2D8P2J1-F1-model_v4 | deleted | 0.9808 | 112 | 182 |
|
| AF-A0A6L7TH57-F1-model_v4 | [ribosomal protein uS5]-alanine N-acetyltransferase (EC 2.3.1.267) | 0.9717 | 6 | 177 |
GO:0005737
GO:0008999 |
| AF-A0A426U3D9-F1-model_v4 | [ribosomal protein uS5]-alanine N-acetyltransferase (EC 2.3.1.267) | 0.9703 | 74 | 183 |
GO:0005737
GO:0008999 |
| AF-A0A535TLY8-F1-model_v4 | [ribosomal protein uS5]-alanine N-acetyltransferase (EC 2.3.1.267) | 0.9689 | 3 | 185 |
GO:0005737
GO:0008999 |
| AF-A0A6L6AAW3-F1-model_v4 | [ribosomal protein uS5]-alanine N-acetyltransferase (EC 2.3.1.267) | 0.9618 | 97 | 179 |
GO:0005737
GO:0008999 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar