F485349

General Info

Members Datasets Scaffolds Average Seq Length
907 303 907 195

Family's Representative Sequence

Representative Sequence 3300005614|Ga0068856_100704331|Ga0068856_1007043312
Length 218
Sequence MSGGCAKAIELRSYLRLIESIIMPTRSSSPFASGSRVYLRPPRPSDEAAFLRAARASRSLHGRWAKAPSTRTEFASFAKRFGGAAPTHIGFLVFRNADDALCGVFNFSEIVRNAFNSAYLGYYAFAPHAGGGLMTEGFALALDLAFRRLALHRIEVNVQPTNRRSLALVARLHFFCEGYSRRYVKIAGRWRDHVRFAMLAEDWSRLRSVVLTQISRRG

Samples

Sample ID Description Type Environment
1 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
2 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
3 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
4 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
5 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
6 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
7 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
14 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
15 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
16 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
17 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
18 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
19 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
20 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
21 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
22 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
23 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
24 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
25 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
26 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
27 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
28 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
29 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
30 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
31 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
32 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
33 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
34 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
35 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
36 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
37 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
38 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
39 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
40 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
41 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
42 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
43 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
44 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
45 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
46 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
47 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
48 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
49 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
50 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
51 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
52 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
53 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
54 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
55 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
56 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
57 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
58 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
59 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
60 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
61 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
62 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
63 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
64 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
65 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
66 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
67 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
68 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
69 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
70 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
71 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
72 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
73 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
74 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
75 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
76 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
77 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
78 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
79 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
80 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
81 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
82 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
83 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
84 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
85 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
86 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
87 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
88 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
89 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
90 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
91 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
92 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
93 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
94 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
95 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
96 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
97 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
98 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
99 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
100 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
101 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
102 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
103 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
104 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
105 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
106 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
107 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
108 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
109 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
110 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
111 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
112 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
113 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
114 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
115 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
116 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
117 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
118 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
119 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
120 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
121 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
122 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
123 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
191 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
192 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
193 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
197 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
198 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
199 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
200 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
201 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
202 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
203 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
204 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
205 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
206 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
207 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
208 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
209 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
210 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
211 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
212 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
213 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
214 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
215 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
216 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
217 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
218 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
219 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
220 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
221 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
222 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
223 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
224 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
225 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
226 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
227 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
228 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
229 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
230 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
231 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
232 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
233 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
234 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
235 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
236 3300042129 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 Metagenome Rhizosphere
237 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
238 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
239 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
240 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
241 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
242 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
243 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
244 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
245 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
246 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
247 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
248 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
249 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
250 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
251 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
252 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
253 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
254 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
255 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
256 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
257 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
258 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
259 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
260 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
261 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
262 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
263 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
264 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
265 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
266 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
267 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
268 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
269 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
270 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
271 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
272 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
273 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
274 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
275 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
276 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
277 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
278 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
279 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
280 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
281 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
282 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
283 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
284 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
285 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
286 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
287 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
288 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
289 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
290 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
291 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
292 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
293 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
294 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
295 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
296 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
297 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
298 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
299 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
300 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
301 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
302 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
303 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.78
Metatranscriptomes 0.22
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 3.53
Rhizosphere 96.36
Stem 0
Stem Tuber 0
Unclassified 0.11

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24752J21851_1009839 3300001976 Bacteria 1248
2 JGI24743J22301_10011735 3300001991 Unclassified 1584
3 JGI24748J21848_1021889 3300002074 Bacteria 773
4 JGI24034J26672_10008291 3300002239 Bacteria 1517
5 JGI24751J29686_10034862 3300002459 Bacteria 1043
6 JGI25406J46586_10120319 3300003203 Bacteria 773
7 Ga0065712_10131233 3300005290 Bacteria 1547
8 Ga0070658_10010289 3300005327 Bacteria 7503
9 Ga0070658_10632055 3300005327 Bacteria 928
10 Ga0070676_10001800 3300005328 Bacteria 10898
11 Ga0070676_10014144 3300005328 Bacteria 4382
12 Ga0070676_10312965 3300005328 Bacteria 1068
13 Ga0070683_100009470 3300005329 Bacteria 8331
14 Ga0070683_100136766 3300005329 Unclassified 2320
15 Ga0070683_100162470 3300005329 Bacteria 2119
16 Ga0070683_100316383 3300005329 Bacteria 1485
17 Ga0070690_100011226 3300005330 Bacteria 5236
18 Ga0070690_100016580 3300005330 Bacteria 4417
19 Ga0070690_100038809 3300005330 Bacteria 3007
20 Ga0070690_100069917 3300005330 Bacteria 2279
21 Ga0070690_100354294 3300005330 Bacteria 1066
22 Ga0070670_100029212 3300005331 Bacteria 4744
23 Ga0070670_100067874 3300005331 Bacteria 3060
24 Ga0070670_100082378 3300005331 Unclassified 2764
25 Ga0070670_100111627 3300005331 Bacteria 2356
26 Ga0070670_100234414 3300005331 Bacteria 1597
27 Ga0070670_100830440 3300005331 Bacteria 835
28 Ga0070677_10002166 3300005333 Bacteria 6280
29 Ga0070677_10027843 3300005333 Bacteria 2131
30 Ga0070677_10164128 3300005333 Unclassified 1045
31 Ga0068869_100002048 3300005334 Bacteria 12109
32 Ga0068869_100023950 3300005334 Bacteria 4224
33 Ga0068869_100097166 3300005334 Bacteria 2224
34 Ga0068869_100233465 3300005334 Bacteria 1462
35 Ga0070666_10003156 3300005335 Bacteria 10011
36 Ga0070666_10006568 3300005335 Bacteria 7146
37 Ga0070666_10066112 3300005335 Unclassified 2453
38 Ga0070666_10151823 3300005335 Bacteria 1616
39 Ga0070666_10212146 3300005335 Bacteria 1364
40 Ga0070666_10223167 3300005335 Bacteria 1329
41 Ga0070680_100029569 3300005336 Bacteria 4400
42 Ga0070680_100041080 3300005336 Bacteria 3749
43 Ga0070680_100111261 3300005336 Bacteria 2280
44 Ga0070680_100226029 3300005336 Bacteria 1580
45 Ga0070682_100018828 3300005337 Bacteria 4043
46 Ga0070682_100034586 3300005337 Bacteria 3078
47 Ga0070682_100091487 3300005337 Unclassified 1991
48 Ga0070682_100309519 3300005337 Bacteria 1162
49 Ga0068868_100000774 3300005338 Bacteria 21630
50 Ga0068868_100015861 3300005338 Bacteria 5583
51 Ga0068868_100016776 3300005338 Bacteria 5446
52 Ga0068868_100090864 3300005338 Bacteria 2459
53 Ga0068868_100165407 3300005338 Unclassified 1829
54 Ga0068868_100500833 3300005338 Bacteria 1064
55 Ga0070660_100007823 3300005339 Bacteria 7454
56 Ga0070660_100028916 3300005339 Bacteria 4150
57 Ga0070660_100037521 3300005339 Bacteria 3673
58 Ga0070660_100041143 3300005339 Bacteria 3522
59 Ga0070660_100064656 3300005339 Bacteria 2846
60 Ga0070689_100012106 3300005340 Bacteria 6203
61 Ga0070689_100047874 3300005340 Bacteria 3296
62 Ga0070689_100224826 3300005340 Bacteria 1541
63 Ga0070689_100953704 3300005340 Bacteria 761
64 Ga0070691_10077539 3300005341 Bacteria 1622
65 Ga0070687_100001561 3300005343 Bacteria 8134
66 Ga0070687_100160803 3300005343 Unclassified 1327
67 Ga0070661_100004591 3300005344 Bacteria 9497
68 Ga0070661_100019359 3300005344 Bacteria 4852
69 Ga0070661_100045024 3300005344 Unclassified 3225
70 Ga0070661_100070871 3300005344 Bacteria 2564
71 Ga0070661_100172627 3300005344 Bacteria 1642
72 Ga0070692_10013193 3300005345 Bacteria 3847
73 Ga0070692_10056178 3300005345 Bacteria 2061
74 Ga0070668_100003095 3300005347 Bacteria 12292
75 Ga0070668_100017531 3300005347 Bacteria 5371
76 Ga0070668_100023123 3300005347 Bacteria 4698
77 Ga0070668_100030960 3300005347 Bacteria 4071
78 Ga0070668_100053853 3300005347 Bacteria 3102
79 Ga0070668_100125054 3300005347 Bacteria 2059
80 Ga0070669_100001056 3300005353 Bacteria 20146
81 Ga0070669_100013619 3300005353 Bacteria 5780
82 Ga0070669_100064961 3300005353 Bacteria 2688
83 Ga0070669_100080175 3300005353 Unclassified 2429
84 Ga0070669_100110702 3300005353 Unclassified 2084
85 Ga0070669_100157476 3300005353 Unclassified 1762
86 Ga0070669_100761884 3300005353 Bacteria 821
87 Ga0070675_100003008 3300005354 Bacteria 12724
88 Ga0070675_100405076 3300005354 Bacteria 1217
89 Ga0070675_100580005 3300005354 Bacteria 1016
90 Ga0070671_100010164 3300005355 Bacteria 7553
91 Ga0070671_100014026 3300005355 Bacteria 6471
92 Ga0070671_100048480 3300005355 Bacteria 3532
93 Ga0070671_100647353 3300005355 Bacteria 915
94 Ga0070674_100002939 3300005356 Bacteria 9447
95 Ga0070674_100022959 3300005356 Bacteria 4028
96 Ga0070674_100061392 3300005356 Bacteria 2623
97 Ga0070673_100002518 3300005364 Bacteria 11189
98 Ga0070673_100024244 3300005364 Bacteria 4446
99 Ga0070673_100042195 3300005364 Bacteria 3515
100 Ga0070673_100180112 3300005364 Bacteria 1809
101 Ga0070673_100328514 3300005364 Bacteria 1352
102 Ga0070688_100006442 3300005365 Bacteria 6276
103 Ga0070688_100013781 3300005365 Bacteria 4569
104 Ga0070688_100101811 3300005365 Bacteria 1895
105 Ga0070659_100001467 3300005366 Bacteria 16988
106 Ga0070659_100004493 3300005366 Bacteria 9963
107 Ga0070659_100035551 3300005366 Unclassified 3879
108 Ga0070659_100042607 3300005366 Bacteria 3549
109 Ga0070659_100161228 3300005366 Unclassified 1834
110 Ga0070659_100417198 3300005366 Bacteria 1135
111 Ga0070659_100678171 3300005366 Bacteria 890
112 Ga0070667_100004783 3300005367 Bacteria 11341
113 Ga0070667_100032146 3300005367 Bacteria 4376
114 Ga0070667_100032527 3300005367 Bacteria 4351
115 Ga0070667_100032899 3300005367 Bacteria 4328
116 Ga0070667_100058368 3300005367 Bacteria 3262
117 Ga0070667_100123319 3300005367 Bacteria 2256
118 Ga0070667_100415956 3300005367 Bacteria 1225
119 Ga0070667_100439572 3300005367 Bacteria 1191
120 Ga0070667_100442121 3300005367 Unclassified 1187
121 Ga0070667_100753131 3300005367 Unclassified 903
122 Ga0070709_10011638 3300005434 Bacteria 4909
123 Ga0070709_10149690 3300005434 Unclassified 1612
124 Ga0070709_10163314 3300005434 Bacteria 1550
125 Ga0070709_10214450 3300005434 Unclassified 1370
126 Ga0070714_100001561 3300005435 Bacteria 16680
127 Ga0070714_100179355 3300005435 Bacteria 1926
128 Ga0070713_100000035 3300005436 Bacteria 86284
129 Ga0070713_100031713 3300005436 Bacteria 4212
130 Ga0070713_100165937 3300005436 Bacteria 1974
131 Ga0070710_10001992 3300005437 Bacteria 9678
132 Ga0070710_10111654 3300005437 Bacteria 1643
133 Ga0070711_100008712 3300005439 Bacteria 6224
134 Ga0070711_100011788 3300005439 Bacteria 5439
135 Ga0070711_100179840 3300005439 Bacteria 1619
136 Ga0070705_100065933 3300005440 Bacteria 2169
137 Ga0070705_100099438 3300005440 Unclassified 1833
138 Ga0070700_100105515 3300005441 Unclassified 1863
139 Ga0070694_100055128 3300005444 Bacteria 2695
140 Ga0070708_100001563 3300005445 Bacteria 17553
141 Ga0070708_100693996 3300005445 Unclassified 958
142 Ga0070663_100003583 3300005455 Bacteria 8971
143 Ga0070663_100016670 3300005455 Bacteria 4778
144 Ga0070663_100064818 3300005455 Unclassified 2642
145 Ga0070663_100723176 3300005455 Unclassified 848
146 Ga0070678_100003520 3300005456 Bacteria 8735
147 Ga0070678_100013450 3300005456 Bacteria 5132
148 Ga0070678_100128334 3300005456 Bacteria 2011
149 Ga0070678_100358216 3300005456 Bacteria 1256
150 Ga0070662_100000514 3300005457 Bacteria 23259
151 Ga0070662_100001751 3300005457 Bacteria 13369
152 Ga0070662_100082979 3300005457 Bacteria 2391
153 Ga0070662_100272617 3300005457 Bacteria 1367
154 Ga0070681_10007078 3300005458 Bacteria 10921
155 Ga0070681_10045765 3300005458 Bacteria 4377
156 Ga0070681_10421880 3300005458 Bacteria 1246
157 Ga0070681_10566782 3300005458 Unclassified 1049
158 Ga0068867_100007386 3300005459 Bacteria 7774
159 Ga0068867_100014417 3300005459 Bacteria 5601
160 Ga0068867_100019395 3300005459 Bacteria 4846
161 Ga0068867_100056617 3300005459 Unclassified 2901
162 Ga0068867_100288194 3300005459 Bacteria 1349
163 Ga0068867_100385747 3300005459 Bacteria 1178
164 Ga0070685_10002325 3300005466 Bacteria 9797
165 Ga0070685_10013823 3300005466 Bacteria 4267
166 Ga0070685_10318383 3300005466 Bacteria 1053
167 Ga0070706_100024696 3300005467 Bacteria 5533
168 Ga0070707_100051744 3300005468 Bacteria 3937
169 Ga0070707_100065852 3300005468 Bacteria 3481
170 Ga0070699_100005607 3300005518 Bacteria 11008
171 Ga0070679_100032998 3300005530 Bacteria 5124
172 Ga0070679_100051349 3300005530 Bacteria 4107
173 Ga0070679_100253794 3300005530 Unclassified 1714
174 Ga0070679_100355836 3300005530 Bacteria 1412
175 Ga0070679_100402222 3300005530 Bacteria 1315
176 Ga0070679_100750751 3300005530 Unclassified 918
177 Ga0070684_100003343 3300005535 Bacteria 12011
178 Ga0070684_100061871 3300005535 Bacteria 3277
179 Ga0070684_101240747 3300005535 Bacteria 701
180 Ga0070697_100088588 3300005536 Bacteria 2556
181 Ga0068853_100006454 3300005539 Bacteria 9326
182 Ga0068853_100263299 3300005539 Bacteria 1586
183 Ga0068853_100281420 3300005539 Unclassified 1533
184 Ga0070672_100012616 3300005543 Bacteria 5942
185 Ga0070672_100017957 3300005543 Bacteria 5103
186 Ga0070672_100019414 3300005543 Bacteria 4933
187 Ga0070672_100042097 3300005543 Unclassified 3515
188 Ga0070672_100083055 3300005543 Bacteria 2570
189 Ga0070672_100139150 3300005543 Bacteria 2001
190 Ga0070686_100003848 3300005544 Bacteria 8258
191 Ga0070695_100022414 3300005545 Bacteria 3873
192 Ga0070696_100039595 3300005546 Unclassified 3254
193 Ga0070696_100056482 3300005546 Bacteria 2738
194 Ga0070696_100213044 3300005546 Bacteria 1447
195 Ga0070693_100005461 3300005547 Bacteria 6112
196 Ga0070693_100006452 3300005547 Bacteria 5689
197 Ga0070693_100196895 3300005547 Unclassified 1306
198 Ga0070693_100204273 3300005547 Unclassified 1285
199 Ga0070665_100002901 3300005548 Bacteria 18520
200 Ga0070665_100004716 3300005548 Bacteria 14204
201 Ga0070665_100005543 3300005548 Bacteria 12980
202 Ga0070665_100107353 3300005548 Bacteria 2794
203 Ga0070665_100850069 3300005548 Bacteria 926
204 Ga0068855_100003365 3300005563 Bacteria 19579
205 Ga0068855_100004748 3300005563 Bacteria 16593
206 Ga0068855_100142436 3300005563 Bacteria 2731
207 Ga0068855_100155977 3300005563 Bacteria 2594
208 Ga0068855_101009991 3300005563 Bacteria 873
209 Ga0070664_100000603 3300005564 Bacteria 27498
210 Ga0070664_100015292 3300005564 Bacteria 6274
211 Ga0070664_100082272 3300005564 Bacteria 2776
212 Ga0070664_100140797 3300005564 Bacteria 2124
213 Ga0070664_100230370 3300005564 Unclassified 1660
214 Ga0070664_100962318 3300005564 Bacteria 802
215 Ga0070664_101057691 3300005564 Bacteria 764
216 Ga0068857_100008941 3300005577 Bacteria 8678
217 Ga0068857_100032329 3300005577 Bacteria 4626
218 Ga0068857_100095377 3300005577 Unclassified 2665
219 Ga0068857_100260336 3300005577 Bacteria 1592
220 Ga0068857_100591178 3300005577 Bacteria 1048
221 Ga0068854_100016392 3300005578 Bacteria 4939
222 Ga0068854_100040073 3300005578 Bacteria 3303
223 Ga0068854_100127237 3300005578 Unclassified 1941
224 Ga0068854_100168046 3300005578 Bacteria 1704
225 Ga0068854_100339589 3300005578 Bacteria 1226
226 Ga0068856_100004285 3300005614 Bacteria 14234
227 Ga0068856_100006811 3300005614 Bacteria 11183
228 Ga0068856_100015427 3300005614 Bacteria 7383
229 Ga0068856_100069088 3300005614 Bacteria 3493
230 Ga0068856_100146518 3300005614 Bacteria 2369
231 Ga0068856_100315113 3300005614 Unclassified 1582
232 Ga0068856_100421830 3300005614 Unclassified 1354
233 Ga0068856_100704331 3300005614 Bacteria 1030
234 Ga0070702_100008097 3300005615 Bacteria 5077
235 Ga0070702_100016023 3300005615 Bacteria 3839
236 Ga0068852_100004904 3300005616 Bacteria 9502
237 Ga0068852_100007597 3300005616 Bacteria 7927
238 Ga0068852_100066353 3300005616 Bacteria 3151
239 Ga0068852_100197212 3300005616 Unclassified 1903
240 Ga0068852_100229474 3300005616 Bacteria 1769
241 Ga0068852_100490942 3300005616 Unclassified 1221
242 Ga0068852_100532235 3300005616 Bacteria 1173
243 Ga0068859_100000538 3300005617 Bacteria 37506
244 Ga0068859_100002241 3300005617 Bacteria 19618
245 Ga0068859_100011797 3300005617 Bacteria 8780
246 Ga0068859_100024952 3300005617 Bacteria 6000
247 Ga0068859_100295047 3300005617 Bacteria 1714
248 Ga0068859_100602005 3300005617 Bacteria 1192
249 Ga0068859_100751572 3300005617 Bacteria 1064
250 Ga0068864_100000566 3300005618 Bacteria 31533
251 Ga0068864_100009639 3300005618 Bacteria 7967
252 Ga0068864_100010761 3300005618 Bacteria 7560
253 Ga0068864_100064811 3300005618 Bacteria 3169
254 Ga0068864_100070071 3300005618 Bacteria 3050
255 Ga0068864_100140941 3300005618 Bacteria 2175
256 Ga0068864_100415537 3300005618 Bacteria 1281
257 Ga0068866_10009303 3300005718 Bacteria 4167
258 Ga0068866_10011749 3300005718 Bacteria 3798
259 Ga0068861_100019043 3300005719 Bacteria 4899
260 Ga0068861_100037669 3300005719 Bacteria 3595
261 Ga0068861_100069168 3300005719 Bacteria 2730
262 Ga0068861_100074449 3300005719 Bacteria 2641
263 Ga0068861_100734009 3300005719 Bacteria 921
264 Ga0068851_10000426 3300005834 Bacteria 18827
265 Ga0068851_10011782 3300005834 Bacteria 4107
266 Ga0068851_10056517 3300005834 Unclassified 2002
267 Ga0068851_10130146 3300005834 Bacteria 1360
268 Ga0068851_10261738 3300005834 Bacteria 984
269 Ga0068851_10264288 3300005834 Bacteria 979
270 Ga0068870_10008049 3300005840 Bacteria 4723
271 Ga0068870_10036326 3300005840 Bacteria 2534
272 Ga0068870_10119904 3300005840 Unclassified 1514
273 Ga0068870_10210434 3300005840 Unclassified 1184
274 Ga0068863_100001174 3300005841 Bacteria 26150
275 Ga0068863_100001288 3300005841 Bacteria 25037
276 Ga0068863_100009743 3300005841 Bacteria 9371
277 Ga0068863_100022056 3300005841 Bacteria 6081
278 Ga0068863_100103620 3300005841 Bacteria 2706
279 Ga0068863_100237443 3300005841 Bacteria 1759
280 Ga0068863_100355213 3300005841 Bacteria 1428
281 Ga0068858_100001310 3300005842 Bacteria 25695
282 Ga0068858_100004050 3300005842 Bacteria 14449
283 Ga0068858_100013137 3300005842 Bacteria 7808
284 Ga0068858_100052246 3300005842 Bacteria 3780
285 Ga0068858_100347013 3300005842 Bacteria 1421
286 Ga0068860_100001659 3300005843 Bacteria 23813
287 Ga0068860_100002991 3300005843 Bacteria 17457
288 Ga0068860_100008441 3300005843 Bacteria 10261
289 Ga0068860_100036770 3300005843 Bacteria 4689
290 Ga0068860_100115903 3300005843 Bacteria 2562
291 Ga0068860_100136551 3300005843 Bacteria 2355
292 Ga0068860_100270375 3300005843 Bacteria 1659
293 Ga0068860_100358511 3300005843 Bacteria 1436
294 Ga0068862_100030188 3300005844 Bacteria 4568
295 Ga0068862_100058816 3300005844 Bacteria 3298
296 Ga0068862_100184800 3300005844 Unclassified 1872
297 Ga0081455_10450271 3300005937 Unclassified 879
298 Ga0081539_10046006 3300005985 Bacteria 2504
299 Ga0081539_10066694 3300005985 Bacteria 1949
300 Ga0070715_10004661 3300006163 Bacteria 4522
301 Ga0070716_100021241 3300006173 Bacteria 3418
302 Ga0070712_100050075 3300006175 Unclassified 2904
303 Ga0070712_100055613 3300006175 Bacteria 2772
304 Ga0097621_100002601 3300006237 Bacteria 12371
305 Ga0097621_100085550 3300006237 Unclassified 2630
306 Ga0068871_100021424 3300006358 Bacteria 4967
307 Ga0068871_100027967 3300006358 Unclassified 4416
308 Ga0068871_100036725 3300006358 Bacteria 3902
309 Ga0068871_100212526 3300006358 Bacteria 1673
310 Ga0075428_100044002 3300006844 Bacteria 4908
311 Ga0075428_100309644 3300006844 Bacteria 1697
312 Ga0075433_10371263 3300006852 Bacteria 1263
313 Ga0075434_100135392 3300006871 Bacteria 2483
314 Ga0068865_100017550 3300006881 Bacteria 4605
315 Ga0068865_100038653 3300006881 Bacteria 3232
316 Ga0068865_100052527 3300006881 Bacteria 2825
317 Ga0068865_100539139 3300006881 Bacteria 978
318 Ga0075436_100079449 3300006914 Bacteria 2272
319 Ga0097620_100000538 3300006931 Bacteria 37506
320 Ga0097620_100002241 3300006931 Bacteria 19618
321 Ga0097620_100011796 3300006931 Bacteria 8780
322 Ga0097620_100024954 3300006931 Bacteria 6000
323 Ga0097620_100295058 3300006931 Bacteria 1714
324 Ga0097620_100602056 3300006931 Bacteria 1192
325 Ga0097620_100751526 3300006931 Bacteria 1064
326 Ga0075435_100737441 3300007076 Unclassified 857
327 Ga0105240_10016388 3300009093 Bacteria 10034
328 Ga0105240_10029251 3300009093 Bacteria 7184
329 Ga0105240_10076475 3300009093 Bacteria 4126
330 Ga0111539_10104443 3300009094 Bacteria 3324
331 Ga0111539_10243953 3300009094 Bacteria 2092
332 Ga0111539_10461455 3300009094 Bacteria 1479
333 Ga0111539_10701658 3300009094 Unclassified 1178
334 Ga0105245_10004136 3300009098 Bacteria 12888
335 Ga0105245_10011558 3300009098 Bacteria 7689
336 Ga0105245_10040547 3300009098 Bacteria 4149
337 Ga0105245_10154086 3300009098 Bacteria 2175
338 Ga0105245_11355215 3300009098 Bacteria 761
339 Ga0105247_10005328 3300009101 Bacteria 8107
340 Ga0105247_10257282 3300009101 Bacteria 1196
341 Ga0105243_10237471 3300009148 Unclassified 1620
342 Ga0105241_10122743 3300009174 Bacteria 2094
343 Ga0105241_10179358 3300009174 Bacteria 1756
344 Ga0105241_10192933 3300009174 Bacteria 1696
345 Ga0105242_10024712 3300009176 Bacteria 4747
346 Ga0105242_10083702 3300009176 Bacteria 2672
347 Ga0105242_10098208 3300009176 Bacteria 2477
348 Ga0105242_10365529 3300009176 Unclassified 1336
349 Ga0105248_10001811 3300009177 Bacteria 23753
350 Ga0105248_10017422 3300009177 Bacteria 7920
351 Ga0105248_10042963 3300009177 Bacteria 5068
352 Ga0105248_10044269 3300009177 Bacteria 4992
353 Ga0105248_10392887 3300009177 Bacteria 1562
354 Ga0105248_10562616 3300009177 Bacteria 1286
355 Ga0105248_11625282 3300009177 Unclassified 732
356 Ga0105248_12174003 3300009177 Bacteria 631
357 Ga0105237_10133995 3300009545 Bacteria 2472
358 Ga0105237_10141586 3300009545 Bacteria 2399
359 Ga0105237_10414616 3300009545 Bacteria 1352
360 Ga0105238_10207161 3300009551 Bacteria 1937
361 Ga0105249_10253320 3300009553 Bacteria 1746
362 Ga0105239_10005432 3300010375 Bacteria 14957
363 Ga0105239_10104937 3300010375 Bacteria 3129
364 Ga0105246_10016551 3300011119 Bacteria 4670
365 Ga0105246_10029542 3300011119 Bacteria 3611
366 Ga0105246_11024521 3300011119 Unclassified 749
367 Ga0157373_10001627 3300013100 Bacteria 17144
368 Ga0157373_10004575 3300013100 Bacteria 10405
369 Ga0157373_10170280 3300013100 Bacteria 1532
370 Ga0157371_10000614 3300013102 Bacteria 42414
371 Ga0157371_10098999 3300013102 Bacteria 2067
372 Ga0157370_10002272 3300013104 Bacteria 23306
373 Ga0157370_10016162 3300013104 Bacteria 7565
374 Ga0157370_10017667 3300013104 Bacteria 7190
375 Ga0157370_10017934 3300013104 Bacteria 7129
376 Ga0157370_10041269 3300013104 Bacteria 4453
377 Ga0157370_10088675 3300013104 Bacteria 2905
378 Ga0157370_10174463 3300013104 Unclassified 1998
379 Ga0157370_10394901 3300013104 Unclassified 1273
380 Ga0157369_10025834 3300013105 Bacteria 6515
381 Ga0157369_10073906 3300013105 Bacteria 3656
382 Ga0157369_10111900 3300013105 Bacteria 2901
383 Ga0157369_10513243 3300013105 Bacteria 1240
384 Ga0157374_10000346 3300013296 Bacteria 42858
385 Ga0157374_10009463 3300013296 Bacteria 8365
386 Ga0157374_10040506 3300013296 Bacteria 4291
387 Ga0157374_10122413 3300013296 Unclassified 2512
388 Ga0157378_10022161 3300013297 Bacteria 5590
389 Ga0157378_10077834 3300013297 Bacteria 2990
390 Ga0157378_10088666 3300013297 Unclassified 2808
391 Ga0157378_10123824 3300013297 Bacteria 2386
392 Ga0163162_10004891 3300013306 Bacteria 12917
393 Ga0163162_10028327 3300013306 Bacteria 5541
394 Ga0163162_10045691 3300013306 Bacteria 4387
395 Ga0157372_10005628 3300013307 Bacteria 13321
396 Ga0157372_10039506 3300013307 Bacteria 5209
397 Ga0157372_10095006 3300013307 Bacteria 3396
398 Ga0157372_10152472 3300013307 Bacteria 2668
399 Ga0157372_10166276 3300013307 Bacteria 2551
400 Ga0157372_10197651 3300013307 Unclassified 2329
401 Ga0157372_10307335 3300013307 Bacteria 1845
402 Ga0157372_10451955 3300013307 Bacteria 1497
403 Ga0157372_11096720 3300013307 Bacteria 921
404 Ga0157372_11787965 3300013307 Bacteria 707
405 Ga0157375_10021582 3300013308 Bacteria 5908
406 Ga0157375_10030471 3300013308 Bacteria 5087
407 Ga0157375_10365791 3300013308 Bacteria 1608
408 Ga0157375_10683039 3300013308 Unclassified 1181
409 Ga0157375_10747611 3300013308 Bacteria 1129
410 Ga0163163_10000834 3300014325 Bacteria 26217
411 Ga0163163_10007776 3300014325 Bacteria 9473
412 Ga0163163_10008499 3300014325 Bacteria 9125
413 Ga0163163_10053997 3300014325 Bacteria 3968
414 Ga0163163_10131417 3300014325 Bacteria 2544
415 Ga0157380_10012389 3300014326 Bacteria 6186
416 Ga0157380_10040189 3300014326 Bacteria 3641
417 Ga0157380_10041417 3300014326 Bacteria 3594
418 Ga0157380_10606100 3300014326 Bacteria 1084
419 Ga0157377_10146791 3300014745 Unclassified 1455
420 Ga0157377_10680455 3300014745 Bacteria 744
421 Ga0157379_10000063 3300014968 Bacteria 68139
422 Ga0157379_10001854 3300014968 Bacteria 17491
423 Ga0157379_10004556 3300014968 Bacteria 11884
424 Ga0157379_10006330 3300014968 Bacteria 10194
425 Ga0157379_10016387 3300014968 Bacteria 6519
426 Ga0157379_11341127 3300014968 Unclassified 692
427 Ga0157376_10039073 3300014969 Bacteria 3867
428 Ga0157376_10046821 3300014969 Bacteria 3569
429 Ga0157376_10109207 3300014969 Bacteria 2431
430 Ga0157376_10125191 3300014969 Bacteria 2284
431 Ga0157376_10468579 3300014969 Bacteria 1232
432 Ga0157376_10485995 3300014969 Bacteria 1211
433 Ga0163161_10003668 3300017792 Bacteria 10770
434 Ga0163161_10056159 3300017792 Bacteria 2859
435 Ga0163161_10298053 3300017792 Bacteria 1269
436 Ga0163161_10560441 3300017792 Bacteria 937
437 Ga0206356_10703160 3300020070 Bacteria 1323
438 Ga0206353_10151062 3300020082 Bacteria 3656
439 Ga0207666_1006598 3300025271 Bacteria 1509
440 Ga0207697_10000020 3300025315 Bacteria 55999
441 Ga0207697_10036401 3300025315 Bacteria 2015
442 Ga0207697_10114552 3300025315 Bacteria 1156
443 Ga0207656_10019699 3300025321 Bacteria 2671
444 Ga0207656_10037791 3300025321 Unclassified 2033
445 Ga0207682_10000288 3300025893 Bacteria 22923
446 Ga0207682_10002688 3300025893 Bacteria 7915
447 Ga0207692_10006582 3300025898 Bacteria 4721
448 Ga0207642_10243214 3300025899 Bacteria 1017
449 Ga0207710_10102492 3300025900 Bacteria 1351
450 Ga0207688_10001077 3300025901 Bacteria 13977
451 Ga0207680_10011012 3300025903 Bacteria 4552
452 Ga0207680_10023928 3300025903 Bacteria 3343
453 Ga0207680_10098903 3300025903 Bacteria 1871
454 Ga0207680_10128823 3300025903 Unclassified 1665
455 Ga0207680_10274973 3300025903 Bacteria 1169
456 Ga0207685_10003418 3300025905 Bacteria 3857
457 Ga0207699_10015000 3300025906 Bacteria 4014
458 Ga0207699_10076189 3300025906 Bacteria 2066
459 Ga0207699_10279188 3300025906 Bacteria 1160
460 Ga0207645_10000353 3300025907 Bacteria 38206
461 Ga0207645_10000516 3300025907 Bacteria 32079
462 Ga0207645_10063635 3300025907 Bacteria 2357
463 Ga0207645_10280271 3300025907 Bacteria 1107
464 Ga0207645_10298064 3300025907 Bacteria 1073
465 Ga0207643_10000131 3300025908 Bacteria 50934
466 Ga0207643_10002024 3300025908 Bacteria 11195
467 Ga0207643_10004088 3300025908 Bacteria 7849
468 Ga0207643_10025935 3300025908 Bacteria 3243
469 Ga0207643_10357630 3300025908 Bacteria 917
470 Ga0207705_10012689 3300025909 Bacteria 6080
471 Ga0207705_10164774 3300025909 Bacteria 1666
472 Ga0207705_10500603 3300025909 Bacteria 944
473 Ga0207684_10101679 3300025910 Bacteria 2457
474 Ga0207654_10006442 3300025911 Bacteria 5910
475 Ga0207654_10138953 3300025911 Bacteria 1547
476 Ga0207654_10155206 3300025911 Bacteria 1474
477 Ga0207707_10012638 3300025912 Bacteria 7338
478 Ga0207707_10042784 3300025912 Bacteria 3952
479 Ga0207707_10309058 3300025912 Bacteria 1366
480 Ga0207707_10659652 3300025912 Bacteria 881
481 Ga0207695_10014173 3300025913 Bacteria 9460
482 Ga0207695_10044252 3300025913 Bacteria 4736
483 Ga0207695_10060626 3300025913 Bacteria 3915
484 Ga0207695_10440028 3300025913 Unclassified 1187
485 Ga0207671_10124032 3300025914 Unclassified 1977
486 Ga0207671_10355524 3300025914 Bacteria 1162
487 Ga0207693_10003162 3300025915 Bacteria 14146
488 Ga0207693_10031128 3300025915 Bacteria 4215
489 Ga0207693_10411464 3300025915 Bacteria 1057
490 Ga0207663_10048994 3300025916 Bacteria 2618
491 Ga0207663_10164514 3300025916 Bacteria 1570
492 Ga0207663_10350726 3300025916 Bacteria 1117
493 Ga0207660_10006657 3300025917 Bacteria 7494
494 Ga0207660_10059370 3300025917 Bacteria 2746
495 Ga0207660_10254586 3300025917 Bacteria 1386
496 Ga0207662_10003213 3300025918 Bacteria 8366
497 Ga0207662_10168223 3300025918 Bacteria 1404
498 Ga0207662_10177995 3300025918 Bacteria 1367
499 Ga0207657_10000838 3300025919 Bacteria 32510
500 Ga0207657_10001142 3300025919 Bacteria 28211
501 Ga0207657_10001514 3300025919 Bacteria 24886
502 Ga0207657_10005375 3300025919 Bacteria 13408
503 Ga0207657_10014488 3300025919 Bacteria 7694
504 Ga0207657_10027603 3300025919 Bacteria 5197
505 Ga0207649_10020195 3300025920 Bacteria 3817
506 Ga0207649_10092390 3300025920 Bacteria 1984
507 Ga0207649_10119325 3300025920 Bacteria 1776
508 Ga0207649_10135513 3300025920 Unclassified 1678
509 Ga0207649_10533631 3300025920 Unclassified 896
510 Ga0207652_10216347 3300025921 Bacteria 1726
511 Ga0207652_10222287 3300025921 Bacteria 1702
512 Ga0207652_10264867 3300025921 Unclassified 1550
513 Ga0207652_10328739 3300025921 Bacteria 1380
514 Ga0207652_10348044 3300025921 Bacteria 1337
515 Ga0207646_10048822 3300025922 Bacteria 3792
516 Ga0207646_10150555 3300025922 Bacteria 2098
517 Ga0207681_10001804 3300025923 Bacteria 13734
518 Ga0207681_10004889 3300025923 Bacteria 8238
519 Ga0207681_10035034 3300025923 Bacteria 3306
520 Ga0207681_10051109 3300025923 Bacteria 2799
521 Ga0207681_10117350 3300025923 Bacteria 1946
522 Ga0207681_10210403 3300025923 Bacteria 1498
523 Ga0207694_10077340 3300025924 Bacteria 2607
524 Ga0207694_10846328 3300025924 Unclassified 773
525 Ga0207650_10015720 3300025925 Bacteria 5276
526 Ga0207650_10022736 3300025925 Bacteria 4442
527 Ga0207650_10120693 3300025925 Bacteria 2040
528 Ga0207659_10006674 3300025926 Bacteria 7091
529 Ga0207659_10009505 3300025926 Bacteria 6080
530 Ga0207687_10003789 3300025927 Bacteria 10161
531 Ga0207687_10004961 3300025927 Bacteria 8830
532 Ga0207687_10048784 3300025927 Bacteria 2942
533 Ga0207687_10387516 3300025927 Bacteria 1146
534 Ga0207700_10000023 3300025928 Bacteria 152285
535 Ga0207700_10065175 3300025928 Bacteria 2778
536 Ga0207700_10069862 3300025928 Bacteria 2697
537 Ga0207700_10223950 3300025928 Unclassified 1596
538 Ga0207700_10235075 3300025928 Bacteria 1560
539 Ga0207664_10004963 3300025929 Bacteria 9050
540 Ga0207664_10008325 3300025929 Bacteria 7226
541 Ga0207664_10013621 3300025929 Bacteria 5845
542 Ga0207664_10261193 3300025929 Bacteria 1514
543 Ga0207664_11296998 3300025929 Unclassified 648
544 Ga0207644_10006550 3300025931 Bacteria 7588
545 Ga0207644_10014097 3300025931 Bacteria 5346
546 Ga0207644_10058219 3300025931 Bacteria 2792
547 Ga0207644_10130900 3300025931 Bacteria 1920
548 Ga0207644_10219477 3300025931 Bacteria 1506
549 Ga0207644_10343860 3300025931 Unclassified 1210
550 Ga0207690_10000802 3300025932 Bacteria 20178
551 Ga0207690_10019366 3300025932 Unclassified 4189
552 Ga0207690_10183824 3300025932 Bacteria 1576
553 Ga0207690_10409050 3300025932 Unclassified 1083
554 Ga0207690_10653633 3300025932 Bacteria 862
555 Ga0207706_10000052 3300025933 Bacteria 115553
556 Ga0207706_10002570 3300025933 Bacteria 17702
557 Ga0207706_10006651 3300025933 Bacteria 10690
558 Ga0207706_10046988 3300025933 Bacteria 3821
559 Ga0207706_10191791 3300025933 Unclassified 1793
560 Ga0207706_10313699 3300025933 Bacteria 1365
561 Ga0207686_10010171 3300025934 Bacteria 5114
562 Ga0207686_10015584 3300025934 Bacteria 4252
563 Ga0207686_10056328 3300025934 Bacteria 2470
564 Ga0207686_10241590 3300025934 Bacteria 1314
565 Ga0207709_10431743 3300025935 Bacteria 1014
566 Ga0207670_10004757 3300025936 Bacteria 7364
567 Ga0207670_10030209 3300025936 Bacteria 3460
568 Ga0207670_10156813 3300025936 Bacteria 1695
569 Ga0207670_10779584 3300025936 Bacteria 796
570 Ga0207669_10003089 3300025937 Bacteria 7169
571 Ga0207669_10006693 3300025937 Bacteria 5284
572 Ga0207669_10007153 3300025937 Bacteria 5140
573 Ga0207669_10070770 3300025937 Bacteria 2188
574 Ga0207669_10263243 3300025937 Bacteria 1291
575 Ga0207704_10088619 3300025938 Bacteria 2025
576 Ga0207704_10109488 3300025938 Bacteria 1863
577 Ga0207665_10012112 3300025939 Bacteria 5659
578 Ga0207665_10025691 3300025939 Bacteria 3887
579 Ga0207691_10000663 3300025940 Bacteria 33984
580 Ga0207691_10031723 3300025940 Bacteria 4930
581 Ga0207691_10038134 3300025940 Bacteria 4446
582 Ga0207691_10042435 3300025940 Unclassified 4193
583 Ga0207691_10054892 3300025940 Bacteria 3633
584 Ga0207691_10084220 3300025940 Bacteria 2854
585 Ga0207691_10156979 3300025940 Bacteria 1998
586 Ga0207691_10230540 3300025940 Unclassified 1604
587 Ga0207691_10679550 3300025940 Unclassified 869
588 Ga0207711_10000741 3300025941 Bacteria 32019
589 Ga0207711_10027614 3300025941 Bacteria 4768
590 Ga0207711_10134208 3300025941 Archaea 2222
591 Ga0207711_10229408 3300025941 Bacteria 1700
592 Ga0207711_10396589 3300025941 Unclassified 1282
593 Ga0207689_10000091 3300025942 Bacteria 73260
594 Ga0207689_10002629 3300025942 Bacteria 16626
595 Ga0207689_10005593 3300025942 Bacteria 11204
596 Ga0207689_10021888 3300025942 Bacteria 5376
597 Ga0207689_10027409 3300025942 Unclassified 4769
598 Ga0207689_10081081 3300025942 Bacteria 2667
599 Ga0207689_10239495 3300025942 Bacteria 1500
600 Ga0207689_10242062 3300025942 Bacteria 1491
601 Ga0207661_10033692 3300025944 Bacteria 3977
602 Ga0207661_10182006 3300025944 Unclassified 1836
603 Ga0207679_10009761 3300025945 Bacteria 6158
604 Ga0207679_10025870 3300025945 Bacteria 4041
605 Ga0207679_10034570 3300025945 Bacteria 3567
606 Ga0207679_10138470 3300025945 Bacteria 1964
607 Ga0207679_10143797 3300025945 Bacteria 1931
608 Ga0207679_10202353 3300025945 Unclassified 1659
609 Ga0207667_10002090 3300025949 Bacteria 25032
610 Ga0207667_10004899 3300025949 Bacteria 16348
611 Ga0207667_10016222 3300025949 Bacteria 8418
612 Ga0207667_10089248 3300025949 Bacteria 3186
613 Ga0207667_10126075 3300025949 Bacteria 2637
614 Ga0207667_10129870 3300025949 Bacteria 2595
615 Ga0207667_10161080 3300025949 Bacteria 2308
616 Ga0207667_10810816 3300025949 Unclassified 932
617 Ga0207651_10023051 3300025960 Bacteria 3821
618 Ga0207651_10026254 3300025960 Bacteria 3634
619 Ga0207651_10092840 3300025960 Unclassified 2214
620 Ga0207651_10147366 3300025960 Bacteria 1827
621 Ga0207712_10049868 3300025961 Unclassified 2920
622 Ga0207712_10058143 3300025961 Bacteria 2731
623 Ga0207712_10143346 3300025961 Bacteria 1836
624 Ga0207668_10035134 3300025972 Bacteria 3334
625 Ga0207668_10102684 3300025972 Bacteria 2128
626 Ga0207668_10112473 3300025972 Bacteria 2045
627 Ga0207668_10176614 3300025972 Bacteria 1680
628 Ga0207668_11092287 3300025972 Unclassified 715
629 Ga0207640_10004826 3300025981 Bacteria 7324
630 Ga0207640_10037589 3300025981 Bacteria 3047
631 Ga0207640_10091174 3300025981 Unclassified 2111
632 Ga0207640_10119106 3300025981 Bacteria 1887
633 Ga0207640_10249758 3300025981 Unclassified 1376
634 Ga0207640_10283293 3300025981 Bacteria 1303
635 Ga0207658_10002498 3300025986 Bacteria 13399
636 Ga0207658_10022714 3300025986 Bacteria 4369
637 Ga0207658_10024031 3300025986 Bacteria 4259
638 Ga0207658_10074568 3300025986 Bacteria 2578
639 Ga0207658_10090467 3300025986 Bacteria 2372
640 Ga0207658_10113298 3300025986 Unclassified 2148
641 Ga0207658_10138516 3300025986 Bacteria 1966
642 Ga0207658_10240003 3300025986 Bacteria 1535
643 Ga0207658_10348030 3300025986 Bacteria 1290
644 Ga0207677_10000945 3300026023 Bacteria 16205
645 Ga0207677_10007706 3300026023 Bacteria 5976
646 Ga0207677_10026625 3300026023 Bacteria 3631
647 Ga0207677_10130342 3300026023 Unclassified 1908
648 Ga0207677_10175540 3300026023 Bacteria 1680
649 Ga0207677_10314425 3300026023 Bacteria 1299
650 Ga0207703_10003421 3300026035 Bacteria 13323
651 Ga0207703_10003665 3300026035 Bacteria 12803
652 Ga0207703_10006642 3300026035 Bacteria 9226
653 Ga0207703_10009304 3300026035 Bacteria 7723
654 Ga0207703_10397061 3300026035 Bacteria 1279
655 Ga0207639_10099426 3300026041 Bacteria 2347
656 Ga0207639_10175514 3300026041 Bacteria 1819
657 Ga0207639_10197384 3300026041 Unclassified 1723
658 Ga0207639_10296693 3300026041 Bacteria 1427
659 Ga0207678_10000257 3300026067 Bacteria 48122
660 Ga0207678_10011283 3300026067 Bacteria 7845
661 Ga0207678_10021509 3300026067 Bacteria 5656
662 Ga0207678_10120513 3300026067 Bacteria 2239
663 Ga0207678_10315514 3300026067 Bacteria 1344
664 Ga0207678_10399312 3300026067 Bacteria 1190
665 Ga0207678_10441966 3300026067 Unclassified 1130
666 Ga0207708_10003069 3300026075 Bacteria 12298
667 Ga0207702_10001528 3300026078 Bacteria 22893
668 Ga0207702_10020849 3300026078 Bacteria 5422
669 Ga0207702_10022442 3300026078 Bacteria 5232
670 Ga0207702_10029568 3300026078 Bacteria 4560
671 Ga0207702_10047008 3300026078 Bacteria 3635
672 Ga0207702_10856736 3300026078 Bacteria 900
673 Ga0207641_10005302 3300026088 Bacteria 11014
674 Ga0207641_10010744 3300026088 Bacteria 7506
675 Ga0207641_10048832 3300026088 Bacteria 3574
676 Ga0207641_10063530 3300026088 Bacteria 3154
677 Ga0207641_10092827 3300026088 Bacteria 2644
678 Ga0207641_10102994 3300026088 Bacteria 2518
679 Ga0207641_10188814 3300026088 Bacteria 1892
680 Ga0207641_10444051 3300026088 Bacteria 1253
681 Ga0207648_10000306 3300026089 Bacteria 53612
682 Ga0207648_10000415 3300026089 Bacteria 47449
683 Ga0207648_10006931 3300026089 Bacteria 11223
684 Ga0207648_10021907 3300026089 Bacteria 5740
685 Ga0207648_10035512 3300026089 Bacteria 4391
686 Ga0207648_10078366 3300026089 Unclassified 2882
687 Ga0207648_10096508 3300026089 Bacteria 2587
688 Ga0207676_10000576 3300026095 Bacteria 30160
689 Ga0207676_10010947 3300026095 Bacteria 6474
690 Ga0207676_10021336 3300026095 Bacteria 4751
691 Ga0207676_10189304 3300026095 Bacteria 1809
692 Ga0207676_10681372 3300026095 Unclassified 994
693 Ga0207676_10777592 3300026095 Unclassified 933
694 Ga0207674_10002203 3300026116 Bacteria 24677
695 Ga0207674_10009218 3300026116 Bacteria 11314
696 Ga0207674_10011259 3300026116 Bacteria 10055
697 Ga0207674_10071748 3300026116 Bacteria 3479
698 Ga0207674_10290503 3300026116 Bacteria 1583
699 Ga0207675_100002299 3300026118 Bacteria 18975
700 Ga0207675_100027539 3300026118 Bacteria 5293
701 Ga0207675_100075541 3300026118 Bacteria 3154
702 Ga0207675_100130544 3300026118 Bacteria 2382
703 Ga0207675_100242021 3300026118 Bacteria 1744
704 Ga0207675_100477586 3300026118 Unclassified 1238
705 Ga0207675_101043099 3300026118 Unclassified 837
706 Ga0207683_10001496 3300026121 Bacteria 21076
707 Ga0207683_10004801 3300026121 Bacteria 11638
708 Ga0207683_10008139 3300026121 Bacteria 8968
709 Ga0207683_10010604 3300026121 Bacteria 7859
710 Ga0207683_10641681 3300026121 Unclassified 983
711 Ga0207698_10000659 3300026142 Bacteria 20017
712 Ga0207698_10024376 3300026142 Bacteria 4246
713 Ga0207698_10264090 3300026142 Bacteria 1583
714 Ga0209983_1016566 3300027665 Bacteria 1523
715 Ga0209983_1024795 3300027665 Bacteria 1264
716 Ga0209971_1001936 3300027682 Bacteria 5058
717 Ga0209966_1046711 3300027695 Bacteria 914
718 Ga0268266_10011604 3300028379 Bacteria 7648
719 Ga0268266_10085665 3300028379 Bacteria 2753
720 Ga0268266_10502027 3300028379 Bacteria 1158
721 Ga0268265_10029710 3300028380 Bacteria 3928
722 Ga0268265_10044623 3300028380 Bacteria 3302
723 Ga0268265_10048032 3300028380 Bacteria 3202
724 Ga0268265_10128928 3300028380 Bacteria 2098
725 Ga0268265_10259706 3300028380 Bacteria 1543
726 Ga0268264_10000599 3300028381 Bacteria 43601
727 Ga0268264_10006545 3300028381 Bacteria 9808
728 Ga0268264_10008391 3300028381 Bacteria 8588
729 Ga0268264_10046042 3300028381 Bacteria 3623
730 Ga0268264_10110557 3300028381 Bacteria 2406
731 Ga0268264_10121263 3300028381 Bacteria 2304
732 Ga0268264_10172945 3300028381 Bacteria 1955
733 Ga0268264_10601785 3300028381 Bacteria 1083
734 Ga0268264_10633059 3300028381 Archaea 1057
735 Ga0265332_10002051 3300031238 Bacteria 10534
736 Ga0265325_10035231 3300031241 Bacteria 2659
737 Ga0265329_10006644 3300031242 Bacteria 4567
738 Ga0265331_10000485 3300031250 Bacteria 38062
739 Ga0265327_10013562 3300031251 Bacteria 5405
740 Ga0265316_10015334 3300031344 Bacteria 6704
741 Ga0307408_100004014 3300031548 Bacteria 10035
742 Ga0307408_100019001 3300031548 Bacteria 4622
743 Ga0265314_10009143 3300031711 Bacteria 8409
744 Ga0265342_10010277 3300031712 Bacteria 6514
745 Ga0307405_10014503 3300031731 Bacteria 4239
746 Ga0307405_10018794 3300031731 Bacteria 3821
747 Ga0307413_10007331 3300031824 Bacteria 5114
748 Ga0307413_10160338 3300031824 Bacteria 1579
749 Ga0307410_10001025 3300031852 Bacteria 12119
750 Ga0307410_10001357 3300031852 Bacteria 10985
751 Ga0307406_10032793 3300031901 Bacteria 3173
752 Ga0307406_10037070 3300031901 Bacteria 3008
753 Ga0307407_10002673 3300031903 Bacteria 7063
754 Ga0307407_10041821 3300031903 Bacteria 2565
755 Ga0307412_10009818 3300031911 Bacteria 5497
756 Ga0307412_10081877 3300031911 Bacteria 2233
757 Ga0307409_100012473 3300031995 Bacteria 5417
758 Ga0307409_100018388 3300031995 Bacteria 4697
759 Ga0307416_100060819 3300032002 Unclassified 3078
760 Ga0307416_100203594 3300032002 Bacteria 1880
761 Ga0307414_10230346 3300032004 Bacteria 1527
762 Ga0307411_10004698 3300032005 Bacteria 6592
763 Ga0307411_10105760 3300032005 Bacteria 2001
764 Ga0307415_100006430 3300032126 Bacteria 6335
765 Ga0373934_0103572 3300035086 Bacteria 1151
766 Ga0373934_0124891 3300035086 Bacteria 1048
767 Ga0373944_0015297 3300035089 Bacteria 2152
768 Ga0373945_0006448 3300035116 Bacteria 3785
769 Ga0373945_0060435 3300035116 Bacteria 1413
770 Ga0373945_0134193 3300035116 Unclassified 994
771 Ga0373945_0147991 3300035116 Unclassified 950
772 Ga0373945_0288796 3300035116 Bacteria 700
773 Ga0373953_0008343 3300035117 Bacteria 3515
774 Ga0373954_0002402 3300035118 Bacteria 7846
775 Ga0373954_0229205 3300035118 Bacteria 914
776 Ga0373954_0234894 3300035118 Bacteria 902
777 Ga0373956_0042193 3300035119 Bacteria 2027
778 Ga0373957_0006034 3300035120 Bacteria 3795
779 Ga0373946_0064905 3300035171 Unclassified 1562
780 Ga0373955_0084787 3300035172 Unclassified 1797
781 Ga0373924_0207673 3300035410 Bacteria 864
782 Ga0373931_0033564 3300035691 Bacteria 2660
783 Ga0373931_0173261 3300035691 Bacteria 1273
784 Ga0373931_0227715 3300035691 Unclassified 1125
785 Ga0373935_0019078 3300035692 Bacteria 4182
786 Ga0373935_0068211 3300035692 Bacteria 2288
787 Ga0373935_0100658 3300035692 Unclassified 1905
788 Ga0373927_0006664 3300035695 Bacteria 7858
789 Ga0373927_0124947 3300035695 Bacteria 1679
790 Ga0373927_0186264 3300035695 Bacteria 1362
791 Ga0373933_0005336 3300035724 Bacteria 7005
792 Ga0373933_0036393 3300035724 Bacteria 2881
793 Ga0373933_0070172 3300035724 Unclassified 2131
794 Ga0373947_0015338 3300035725 Bacteria 4398
795 Ga0373947_0285839 3300035725 Bacteria 1097
796 Ga0373937_0028859 3300036401 Bacteria 5023
797 Ga0373937_0042165 3300036401 Bacteria 4164
798 Ga0373937_0203914 3300036401 Unclassified 1859
799 Ga0373937_0232966 3300036401 Bacteria 1734
800 Ga0373937_0470532 3300036401 Bacteria 1194
801 Ga0373937_0858090 3300036401 Unclassified 856
802 Ga0373925_0163243 3300037068 Bacteria 1755
803 Ga0373925_0183922 3300037068 Bacteria 1656
804 Ga0373925_0209796 3300037068 Bacteria 1551
805 Ga0373925_0237926 3300037068 Unclassified 1457
806 Ga0373925_0511692 3300037068 Unclassified 986
807 Ga0395905_0308615 3300037471 Unclassified 1470
808 Ga0451853_2525184 3300041512 Bacteria 1535
809 Ga0439448_0025256 3300042005 Bacteria 1863
810 Ga0450891_023889 3300042129 Bacteria 611
811 Ga0439458_0069788 3300042157 Bacteria 886
812 Ga0439435_0029683 3300042436 Unclassified 1478
813 Ga0451577_0080614 3300042876 Bacteria 2903
814 Ga0451577_0280096 3300042876 Unclassified 1511
815 Ga0451576_0377529 3300045051 Unclassified 1486
816 Ga0466967_0379197 3300045976 Bacteria 1373
817 Ga0495651_0191090 3300046462 Bacteria 1441
818 Ga0495651_0250168 3300046462 Unclassified 1211
819 Ga0495653_0130897 3300046463 Bacteria 1776
820 Ga0495580_0010175 3300046472 Bacteria 7344
821 Ga0495580_0077356 3300046472 Bacteria 2320
822 Ga0495580_0299883 3300046472 Bacteria 1094
823 Ga0495582_0009981 3300046473 Bacteria 5226
824 Ga0495639_0005310 3300046475 Bacteria 5548
825 Ga0495662_0085792 3300046476 Unclassified 1533
826 Ga0495664_0030616 3300046477 Bacteria 3153
827 Ga0495664_0540979 3300046477 Bacteria 694
828 Ga0495594_0017270 3300046499 Bacteria 3810
829 Ga0495628_0127544 3300046516 Bacteria 1948
830 Ga0495630_0135258 3300046517 Bacteria 1873
831 Ga0495666_0086173 3300046526 Bacteria 1484
832 Ga0495665_0022338 3300046531 Bacteria 3400
833 Ga0495586_0064780 3300046535 Bacteria 1992
834 Ga0495621_0002673 3300046539 Bacteria 4826
835 Ga0495645_0006508 3300046543 Bacteria 8112
836 Ga0495645_0282285 3300046543 Bacteria 1091
837 Ga0495635_0021390 3300046663 Bacteria 4507
838 Ga0495635_0619942 3300046663 Bacteria 705
839 Ga0495659_0011305 3300046664 Bacteria 2876
840 Ga0495623_0070732 3300046679 Bacteria 2173
841 Ga0495658_0046521 3300046683 Bacteria 2439
842 Ga0495600_0029604 3300046809 Bacteria 3546
843 Ga0495581_0008149 3300047315 Bacteria 6067
844 Ga0495604_0179273 3300047317 Bacteria 1483
845 Ga0495674_0157749 3300047319 Bacteria 1900
846 Ga0495680_0075719 3300047322 Bacteria 2553
847 Ga0495684_0003967 3300047471 Bacteria 11537
848 Ga0495602_0073475 3300048088 Bacteria 2911
849 Ga0496100_0141959 3300048903 Bacteria 1703
850 Ga0496100_0146195 3300048903 Bacteria 1681
851 Ga0496101_0120097 3300048904 Unclassified 1986
852 Ga0496102_0028926 3300048905 Bacteria 4954
853 Ga0496102_0039538 3300048905 Bacteria 4262
854 Ga0496102_0039809 3300048905 Unclassified 4249
855 Ga0496102_0422729 3300048905 Bacteria 1252
856 Ga0496103_0216955 3300048906 Unclassified 1230
857 Ga0496104_0071628 3300048907 Bacteria 3295
858 Ga0496104_0101161 3300048907 Bacteria 2759
859 Ga0496104_0380993 3300048907 Bacteria 1323
860 Ga0496105_0022793 3300048908 Bacteria 5074
861 Ga0496105_0206236 3300048908 Bacteria 1603
862 Ga0496106_0015856 3300048909 Bacteria 5573
863 Ga0496106_0217851 3300048909 Unclassified 1522
864 Ga0496107_0007460 3300048910 Bacteria 7540
865 Ga0496107_0037561 3300048910 Bacteria 3475
866 Ga0496107_0151599 3300048910 Bacteria 1715
867 Ga0496108_0003278 3300048911 Bacteria 13001
868 Ga0496108_0147764 3300048911 Bacteria 2027
869 Ga0496109_0004927 3300048912 Bacteria 11142
870 Ga0496109_0040016 3300048912 Bacteria 4245
871 Ga0496110_0003478 3300048913 Bacteria 12080
872 Ga0496110_0198982 3300048913 Bacteria 1820
873 Ga0496110_0213348 3300048913 Unclassified 1755
874 Ga0496110_0461402 3300048913 Unclassified 1158
875 Ga0496111_0106968 3300048914 Unclassified 2059
876 Ga0496111_0319377 3300048914 Bacteria 1150
877 Ga0496112_0001998 3300048915 Bacteria 16138
878 Ga0496113_0280272 3300048916 Bacteria 1333
879 Ga0496114_0038202 3300048917 Bacteria 3972
880 Ga0496115_0369470 3300048918 Bacteria 1168
881 Ga0501034_0009235 3300049571 Bacteria 10337
882 Ga0501047_0011148 3300049581 Bacteria 8507
883 Ga0501067_0191117 3300049583 Bacteria 1140
884 Ga0501070_0001616 3300049586 Bacteria 19990
885 Ga0501071_0361408 3300049587 Bacteria 1106
886 Ga0501072_0093139 3300049588 Bacteria 2393
887 Ga0501075_0451477 3300049591 Unclassified 980
888 Ga0501076_0277016 3300049592 Unclassified 1374
889 Ga0501080_0010533 3300049742 Bacteria 8468
890 Ga0501083_0073067 3300049744 Bacteria 2279
891 Ga0501083_0099826 3300049744 Bacteria 1914
892 Ga0501045_0061866 3300049824 Bacteria 2747
893 nmdc:mga08y16_1190169_c1 3300050511 Bacteria 733
894 nmdc:mga08y16_91621_c1 3300050511 Bacteria 3168
895 nmdc:mga0n895_341536_c1 3300050512 Bacteria 1516
896 nmdc:mga0n895_735150_c1 3300050512 Bacteria 981
897 nmdc:mga0rr50_572116_c1 3300050513 Bacteria 962
898 nmdc:mga0rr50_850105_c1 3300050513 Unclassified 778
899 nmdc:mga0rr50_928671_c1 3300050513 Unclassified 742
900 nmdc:mga08x19_213965_c1 3300050514 Bacteria 1323
901 nmdc:mga08x19_755365_c1 3300050514 Unclassified 690
902 nmdc:mga0a205_281765_c1 3300050515 Bacteria 1537
903 Ga0495601_0254616 3300053077 Bacteria 1146
904 Ga0495601_0303835 3300053077 Unclassified 1039
905 Ga0495612_0049642 3300053078 Unclassified 1722
906 Ga0495619_0052673 3300053085 Bacteria 2690
907 Ga0501082_0094150 3300060353 Bacteria 2588

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049587 Ga0501071_0361408 Ga0501071_0361408_11_484 157
2 3300005843 Ga0068860_100358511 Ga0068860_1003585112 160
3 3300025927 Ga0207687_10387516 Ga0207687_103875161 160
4 3300026095 Ga0207676_10189304 Ga0207676_101893043 160
5 3300036401 Ga0373937_0858090 Ga0373937_0858090_104_619 167
6 3300027665 Ga0209983_1024795 Ga0209983_10247952 168
7 3300005455 Ga0070663_100723176 Ga0070663_1007231761 171
8 3300014968 Ga0157379_11341127 Ga0157379_113411271 174
9 3300025940 Ga0207691_10230540 Ga0207691_102305402 174
10 3300025986 Ga0207658_10348030 Ga0207658_103480302 174
11 3300028381 Ga0268264_10172945 Ga0268264_101729452 174
12 3300006871 Ga0075434_100135392 Ga0075434_1001353923 176
13 3300050512 nmdc:mga0n895_735150_c1 nmdc:mga0n895_735150_c1_322_873 176
14 3300005328 Ga0070676_10001800 Ga0070676_1000180010 178
15 3300005330 Ga0070690_100038809 Ga0070690_1000388093 178
16 3300005331 Ga0070670_100111627 Ga0070670_1001116271 178
17 3300005333 Ga0070677_10027843 Ga0070677_100278432 178
18 3300005334 Ga0068869_100097166 Ga0068869_1000971662 178
19 3300005334 Ga0068869_100233465 Ga0068869_1002334652 178
20 3300005335 Ga0070666_10003156 Ga0070666_100031568 178
21 3300005338 Ga0068868_100000774 Ga0068868_1000007746 178
22 3300005340 Ga0070689_100224826 Ga0070689_1002248262 178
23 3300005347 Ga0070668_100023123 Ga0070668_1000231232 178
24 3300005347 Ga0070668_100125054 Ga0070668_1001250542 178
25 3300005353 Ga0070669_100001056 Ga0070669_10000105616 178
26 3300005354 Ga0070675_100003008 Ga0070675_1000030089 178
27 3300005355 Ga0070671_100014026 Ga0070671_1000140264 178
28 3300005356 Ga0070674_100061392 Ga0070674_1000613922 178
29 3300005364 Ga0070673_100002518 Ga0070673_10000251810 178
30 3300005365 Ga0070688_100101811 Ga0070688_1001018112 178
31 3300005367 Ga0070667_100004783 Ga0070667_1000047837 178
32 3300005456 Ga0070678_100003520 Ga0070678_1000035205 178
33 3300005459 Ga0068867_100019395 Ga0068867_1000193954 178
34 3300005466 Ga0070685_10318383 Ga0070685_103183831 178
35 3300005543 Ga0070672_100012616 Ga0070672_1000126164 178
36 3300005548 Ga0070665_100005543 Ga0070665_1000055438 178
37 3300005617 Ga0068859_100002241 Ga0068859_10000224114 178
38 3300005617 Ga0068859_100024952 Ga0068859_1000249525 178
39 3300005618 Ga0068864_100009639 Ga0068864_1000096392 178
40 3300005719 Ga0068861_100069168 Ga0068861_1000691683 178
41 3300005834 Ga0068851_10261738 Ga0068851_102617382 178
42 3300005840 Ga0068870_10008049 Ga0068870_100080493 178
43 3300005841 Ga0068863_100009743 Ga0068863_1000097437 178
44 3300005841 Ga0068863_100103620 Ga0068863_1001036202 178
45 3300005842 Ga0068858_100001310 Ga0068858_10000131024 178
46 3300005843 Ga0068860_100002991 Ga0068860_1000029914 178
47 3300005844 Ga0068862_100030188 Ga0068862_1000301887 178
48 3300005844 Ga0068862_100058816 Ga0068862_1000588162 178
49 3300006237 Ga0097621_100002601 Ga0097621_1000026019 178
50 3300006358 Ga0068871_100021424 Ga0068871_1000214244 178
51 3300006844 Ga0075428_100309644 Ga0075428_1003096442 178
52 3300006881 Ga0068865_100038653 Ga0068865_1000386532 178
53 3300006931 Ga0097620_100002241 Ga0097620_10000224114 178
54 3300006931 Ga0097620_100024954 Ga0097620_1000249544 178
55 3300009098 Ga0105245_11355215 Ga0105245_113552152 178
56 3300009177 Ga0105248_10001811 Ga0105248_100018118 178
57 3300009177 Ga0105248_10042963 Ga0105248_100429634 178
58 3300013296 Ga0157374_10000346 Ga0157374_1000034636 178
59 3300013297 Ga0157378_10022161 Ga0157378_100221619 178
60 3300013306 Ga0163162_10045691 Ga0163162_100456912 178
61 3300013308 Ga0157375_10021582 Ga0157375_100215826 178
62 3300014325 Ga0163163_10053997 Ga0163163_100539972 178
63 3300014326 Ga0157380_10040189 Ga0157380_100401896 178
64 3300014968 Ga0157379_10006330 Ga0157379_1000633010 178
65 3300014969 Ga0157376_10109207 Ga0157376_101092072 178
66 3300017792 Ga0163161_10003668 Ga0163161_100036686 178
67 3300025893 Ga0207682_10002688 Ga0207682_100026884 178
68 3300025903 Ga0207680_10011012 Ga0207680_100110126 178
69 3300025907 Ga0207645_10000353 Ga0207645_1000035310 178
70 3300025908 Ga0207643_10004088 Ga0207643_100040883 178
71 3300025923 Ga0207681_10001804 Ga0207681_100018047 178
72 3300025923 Ga0207681_10051109 Ga0207681_100511093 178
73 3300025925 Ga0207650_10022736 Ga0207650_100227364 178
74 3300025926 Ga0207659_10009505 Ga0207659_100095054 178
75 3300025931 Ga0207644_10014097 Ga0207644_100140973 178
76 3300025933 Ga0207706_10191791 Ga0207706_101917912 178
77 3300025936 Ga0207670_10156813 Ga0207670_101568132 178
78 3300025937 Ga0207669_10070770 Ga0207669_100707702 178
79 3300025940 Ga0207691_10000663 Ga0207691_100006638 178
80 3300025940 Ga0207691_10038134 Ga0207691_100381345 178
81 3300025941 Ga0207711_10027614 Ga0207711_100276147 178
82 3300025942 Ga0207689_10005593 Ga0207689_100055937 178
83 3300025942 Ga0207689_10239495 Ga0207689_102394952 178
84 3300025961 Ga0207712_10058143 Ga0207712_100581433 178
85 3300025972 Ga0207668_10102684 Ga0207668_101026843 178
86 3300025986 Ga0207658_10002498 Ga0207658_100024988 178
87 3300025986 Ga0207658_10138516 Ga0207658_101385162 178
88 3300026023 Ga0207677_10007706 Ga0207677_100077066 178
89 3300026035 Ga0207703_10009304 Ga0207703_100093047 178
90 3300026067 Ga0207678_10399312 Ga0207678_103993122 178
91 3300026088 Ga0207641_10005302 Ga0207641_100053028 178
92 3300026088 Ga0207641_10188814 Ga0207641_101888142 178
93 3300026089 Ga0207648_10000306 Ga0207648_1000030626 178
94 3300026089 Ga0207648_10021907 Ga0207648_100219074 178
95 3300026095 Ga0207676_10021336 Ga0207676_100213364 178
96 3300026118 Ga0207675_100027539 Ga0207675_1000275395 178
97 3300026118 Ga0207675_100242021 Ga0207675_1002420212 178
98 3300026121 Ga0207683_10010604 Ga0207683_100106044 178
99 3300028380 Ga0268265_10029710 Ga0268265_100297104 178
100 3300028380 Ga0268265_10128928 Ga0268265_101289283 178
101 3300028381 Ga0268264_10008391 Ga0268264_100083917 178
102 3300035691 Ga0373931_0173261 Ga0373931_0173261_200_736 178
103 3300042129 Ga0450891_023889 Ga0450891_023889_55_600 178
104 3300048911 Ga0496108_0147764 Ga0496108_0147764_899_1435 178
105 3300048913 Ga0496110_0198982 Ga0496110_0198982_843_1379 178
106 3300049571 Ga0501034_0009235 Ga0501034_0009235_421_978 178
107 3300049581 Ga0501047_0011148 Ga0501047_0011148_4591_5148 178
108 3300049583 Ga0501067_0191117 Ga0501067_0191117_528_1085 178
109 3300049586 Ga0501070_0001616 Ga0501070_0001616_8532_9089 178
110 3300049588 Ga0501072_0093139 Ga0501072_0093139_1775_2332 178
111 3300049742 Ga0501080_0010533 Ga0501080_0010533_1578_2135 178
112 3300049744 Ga0501083_0073067 Ga0501083_0073067_936_1493 178
113 3300049744 Ga0501083_0099826 Ga0501083_0099826_566_1123 178
114 3300060353 Ga0501082_0094150 Ga0501082_0094150_864_1421 178
115 3300005436 Ga0070713_100000035 Ga0070713_10000003516 179
116 3300006175 Ga0070712_100050075 Ga0070712_1000500753 179
117 3300025928 Ga0207700_10000023 Ga0207700_10000023146 179
118 3300053077 Ga0495601_0254616 Ga0495601_0254616_304_906 179
119 3300009176 Ga0105242_10098208 Ga0105242_100982083 182
120 3300014326 Ga0157380_10012389 Ga0157380_100123892 182
121 3300025934 Ga0207686_10010171 Ga0207686_100101715 182
122 3300035086 Ga0373934_0124891 Ga0373934_0124891_388_972 183
123 3300035724 Ga0373933_0070172 Ga0373933_0070172_1424_2008 183
124 3300007076 Ga0075435_100737441 Ga0075435_1007374412 186
125 3300050513 nmdc:mga0rr50_850105_c1 nmdc:mga0rr50_850105_c1_125_730 186
126 3300002074 JGI24748J21848_1021889 JGI24748J21848_10218892 187
127 3300005328 Ga0070676_10312965 Ga0070676_103129652 187
128 3300005329 Ga0070683_100136766 Ga0070683_1001367662 187
129 3300005330 Ga0070690_100016580 Ga0070690_1000165806 187
130 3300005330 Ga0070690_100354294 Ga0070690_1003542941 187
131 3300005331 Ga0070670_100029212 Ga0070670_1000292123 187
132 3300005334 Ga0068869_100023950 Ga0068869_1000239503 187
133 3300005335 Ga0070666_10006568 Ga0070666_100065683 187
134 3300005336 Ga0070680_100041080 Ga0070680_1000410806 187
135 3300005337 Ga0070682_100018828 Ga0070682_1000188283 187
136 3300005338 Ga0068868_100015861 Ga0068868_1000158617 187
137 3300005340 Ga0070689_100012106 Ga0070689_1000121063 187
138 3300005345 Ga0070692_10056178 Ga0070692_100561783 187
139 3300005356 Ga0070674_100022959 Ga0070674_1000229592 187
140 3300005364 Ga0070673_100042195 Ga0070673_1000421953 187
141 3300005365 Ga0070688_100013781 Ga0070688_1000137814 187
142 3300005366 Ga0070659_100042607 Ga0070659_1000426074 187
143 3300005366 Ga0070659_100417198 Ga0070659_1004171982 187
144 3300005434 Ga0070709_10163314 Ga0070709_101633142 187
145 3300005436 Ga0070713_100031713 Ga0070713_1000317133 187
146 3300005437 Ga0070710_10111654 Ga0070710_101116542 187
147 3300005439 Ga0070711_100008712 Ga0070711_1000087128 187
148 3300005440 Ga0070705_100065933 Ga0070705_1000659332 187
149 3300005444 Ga0070694_100055128 Ga0070694_1000551283 187
150 3300005455 Ga0070663_100064818 Ga0070663_1000648184 187
151 3300005457 Ga0070662_100001751 Ga0070662_1000017519 187
152 3300005457 Ga0070662_100272617 Ga0070662_1002726173 187
153 3300005458 Ga0070681_10566782 Ga0070681_105667822 187
154 3300005459 Ga0068867_100288194 Ga0068867_1002881942 187
155 3300005466 Ga0070685_10002325 Ga0070685_100023252 187
156 3300005467 Ga0070706_100024696 Ga0070706_1000246966 187
157 3300005468 Ga0070707_100051744 Ga0070707_1000517444 187
158 3300005468 Ga0070707_100065852 Ga0070707_1000658523 187
159 3300005530 Ga0070679_100750751 Ga0070679_1007507511 187
160 3300005536 Ga0070697_100088588 Ga0070697_1000885883 187
161 3300005543 Ga0070672_100139150 Ga0070672_1001391502 187
162 3300005545 Ga0070695_100022414 Ga0070695_1000224143 187
163 3300005546 Ga0070696_100039595 Ga0070696_1000395954 187
164 3300005546 Ga0070696_100056482 Ga0070696_1000564824 187
165 3300005547 Ga0070693_100006452 Ga0070693_1000064523 187
166 3300005548 Ga0070665_100004716 Ga0070665_1000047162 187
167 3300005564 Ga0070664_100140797 Ga0070664_1001407972 187
168 3300005578 Ga0068854_100016392 Ga0068854_1000163926 187
169 3300005578 Ga0068854_100040073 Ga0068854_1000400733 187
170 3300005614 Ga0068856_100015427 Ga0068856_1000154274 187
171 3300005615 Ga0070702_100008097 Ga0070702_1000080976 187
172 3300005616 Ga0068852_100197212 Ga0068852_1001972121 187
173 3300005617 Ga0068859_100011797 Ga0068859_1000117974 187
174 3300005618 Ga0068864_100070071 Ga0068864_1000700713 187
175 3300005718 Ga0068866_10011749 Ga0068866_100117494 187
176 3300005719 Ga0068861_100734009 Ga0068861_1007340092 187
177 3300005840 Ga0068870_10119904 Ga0068870_101199042 187
178 3300005841 Ga0068863_100001174 Ga0068863_10000117424 187
179 3300005842 Ga0068858_100052246 Ga0068858_1000522463 187
180 3300005843 Ga0068860_100008441 Ga0068860_1000084413 187
181 3300006163 Ga0070715_10004661 Ga0070715_100046612 187
182 3300006173 Ga0070716_100021241 Ga0070716_1000212412 187
183 3300006175 Ga0070712_100055613 Ga0070712_1000556132 187
184 3300006358 Ga0068871_100036725 Ga0068871_1000367256 187
185 3300006881 Ga0068865_100052527 Ga0068865_1000525274 187
186 3300006914 Ga0075436_100079449 Ga0075436_1000794493 187
187 3300006931 Ga0097620_100011796 Ga0097620_1000117964 187
188 3300009093 Ga0105240_10029251 Ga0105240_100292516 187
189 3300009098 Ga0105245_10004136 Ga0105245_1000413615 187
190 3300009098 Ga0105245_10011558 Ga0105245_100115587 187
191 3300009098 Ga0105245_10040547 Ga0105245_100405476 187
192 3300009101 Ga0105247_10005328 Ga0105247_100053283 187
193 3300009174 Ga0105241_10179358 Ga0105241_101793582 187
194 3300009174 Ga0105241_10192933 Ga0105241_101929332 187
195 3300009176 Ga0105242_10024712 Ga0105242_100247123 187
196 3300009176 Ga0105242_10083702 Ga0105242_100837024 187
197 3300009177 Ga0105248_10044269 Ga0105248_100442694 187
198 3300009545 Ga0105237_10141586 Ga0105237_101415863 187
199 3300009551 Ga0105238_10207161 Ga0105238_102071612 187
200 3300010375 Ga0105239_10104937 Ga0105239_101049373 187
201 3300011119 Ga0105246_10016551 Ga0105246_100165513 187
202 3300013104 Ga0157370_10017934 Ga0157370_100179344 187
203 3300013105 Ga0157369_10513243 Ga0157369_105132432 187
204 3300013296 Ga0157374_10040506 Ga0157374_100405063 187
205 3300013297 Ga0157378_10077834 Ga0157378_100778342 187
206 3300013297 Ga0157378_10123824 Ga0157378_101238242 187
207 3300013306 Ga0163162_10004891 Ga0163162_1000489115 187
208 3300013306 Ga0163162_10028327 Ga0163162_100283278 187
209 3300013307 Ga0157372_11787965 Ga0157372_117879651 187
210 3300013308 Ga0157375_10030471 Ga0157375_100304713 187
211 3300014325 Ga0163163_10000834 Ga0163163_1000083424 187
212 3300014968 Ga0157379_10004556 Ga0157379_100045566 187
213 3300014969 Ga0157376_10039073 Ga0157376_100390732 187
214 3300014969 Ga0157376_10046821 Ga0157376_100468214 187
215 3300017792 Ga0163161_10298053 Ga0163161_102980532 187
216 3300025899 Ga0207642_10243214 Ga0207642_102432142 187
217 3300025900 Ga0207710_10102492 Ga0207710_101024922 187
218 3300025903 Ga0207680_10098903 Ga0207680_100989032 187
219 3300025905 Ga0207685_10003418 Ga0207685_100034182 187
220 3300025906 Ga0207699_10076189 Ga0207699_100761892 187
221 3300025907 Ga0207645_10298064 Ga0207645_102980642 187
222 3300025908 Ga0207643_10025935 Ga0207643_100259354 187
223 3300025910 Ga0207684_10101679 Ga0207684_101016791 187
224 3300025911 Ga0207654_10138953 Ga0207654_101389532 187
225 3300025911 Ga0207654_10155206 Ga0207654_101552062 187
226 3300025912 Ga0207707_10309058 Ga0207707_103090582 187
227 3300025913 Ga0207695_10044252 Ga0207695_100442522 187
228 3300025914 Ga0207671_10124032 Ga0207671_101240322 187
229 3300025915 Ga0207693_10003162 Ga0207693_100031623 187
230 3300025915 Ga0207693_10031128 Ga0207693_100311283 187
231 3300025916 Ga0207663_10048994 Ga0207663_100489942 187
232 3300025916 Ga0207663_10350726 Ga0207663_103507262 187
233 3300025917 Ga0207660_10254586 Ga0207660_102545862 187
234 3300025919 Ga0207657_10005375 Ga0207657_1000537512 187
235 3300025921 Ga0207652_10328739 Ga0207652_103287392 187
236 3300025922 Ga0207646_10048822 Ga0207646_100488223 187
237 3300025922 Ga0207646_10150555 Ga0207646_101505552 187
238 3300025924 Ga0207694_10846328 Ga0207694_108463281 187
239 3300025927 Ga0207687_10003789 Ga0207687_100037899 187
240 3300025927 Ga0207687_10004961 Ga0207687_100049612 187
241 3300025927 Ga0207687_10048784 Ga0207687_100487843 187
242 3300025928 Ga0207700_10069862 Ga0207700_100698622 187
243 3300025929 Ga0207664_10013621 Ga0207664_100136219 187
244 3300025929 Ga0207664_11296998 Ga0207664_112969981 187
245 3300025931 Ga0207644_10006550 Ga0207644_100065505 187
246 3300025931 Ga0207644_10130900 Ga0207644_101309003 187
247 3300025932 Ga0207690_10409050 Ga0207690_104090502 187
248 3300025933 Ga0207706_10006651 Ga0207706_100066513 187
249 3300025934 Ga0207686_10015584 Ga0207686_100155844 187
250 3300025934 Ga0207686_10241590 Ga0207686_102415902 187
251 3300025936 Ga0207670_10004757 Ga0207670_100047575 187
252 3300025937 Ga0207669_10007153 Ga0207669_100071533 187
253 3300025938 Ga0207704_10109488 Ga0207704_101094883 187
254 3300025939 Ga0207665_10012112 Ga0207665_100121123 187
255 3300025939 Ga0207665_10025691 Ga0207665_100256913 187
256 3300025940 Ga0207691_10054892 Ga0207691_100548922 187
257 3300025941 Ga0207711_10000741 Ga0207711_1000074115 187
258 3300025942 Ga0207689_10021888 Ga0207689_100218884 187
259 3300025942 Ga0207689_10027409 Ga0207689_100274097 187
260 3300025942 Ga0207689_10081081 Ga0207689_100810814 187
261 3300025945 Ga0207679_10143797 Ga0207679_101437973 187
262 3300025949 Ga0207667_10810816 Ga0207667_108108162 187
263 3300025960 Ga0207651_10026254 Ga0207651_100262544 187
264 3300025981 Ga0207640_10037589 Ga0207640_100375893 187
265 3300025986 Ga0207658_10022714 Ga0207658_100227143 187
266 3300026023 Ga0207677_10000945 Ga0207677_100009453 187
267 3300026023 Ga0207677_10026625 Ga0207677_100266252 187
268 3300026035 Ga0207703_10003665 Ga0207703_100036658 187
269 3300026041 Ga0207639_10175514 Ga0207639_101755142 187
270 3300026041 Ga0207639_10296693 Ga0207639_102966933 187
271 3300026067 Ga0207678_10120513 Ga0207678_101205132 187
272 3300026067 Ga0207678_10315514 Ga0207678_103155142 187
273 3300026078 Ga0207702_10029568 Ga0207702_100295682 187
274 3300026088 Ga0207641_10010744 Ga0207641_100107445 187
275 3300026089 Ga0207648_10035512 Ga0207648_100355124 187
276 3300026095 Ga0207676_10000576 Ga0207676_1000057621 187
277 3300026116 Ga0207674_10009218 Ga0207674_100092188 187
278 3300026121 Ga0207683_10008139 Ga0207683_100081394 187
279 3300026142 Ga0207698_10264090 Ga0207698_102640902 187
280 3300028381 Ga0268264_10006545 Ga0268264_1000654510 187
281 3300028381 Ga0268264_10110557 Ga0268264_101105572 187
282 3300035086 Ga0373934_0103572 Ga0373934_0103572_207_800 187
283 3300035089 Ga0373944_0015297 Ga0373944_0015297_246_830 187
284 3300035116 Ga0373945_0006448 Ga0373945_0006448_505_1089 187
285 3300035116 Ga0373945_0060435 Ga0373945_0060435_538_1131 187
286 3300035116 Ga0373945_0134193 Ga0373945_0134193_42_635 187
287 3300035116 Ga0373945_0147991 Ga0373945_0147991_93_686 187
288 3300035117 Ga0373953_0008343 Ga0373953_0008343_1510_2103 187
289 3300035118 Ga0373954_0002402 Ga0373954_0002402_6346_6939 187
290 3300035118 Ga0373954_0234894 Ga0373954_0234894_298_882 187
291 3300035119 Ga0373956_0042193 Ga0373956_0042193_1210_1803 187
292 3300035120 Ga0373957_0006034 Ga0373957_0006034_741_1334 187
293 3300035171 Ga0373946_0064905 Ga0373946_0064905_312_896 187
294 3300035172 Ga0373955_0084787 Ga0373955_0084787_419_1012 187
295 3300035410 Ga0373924_0207673 Ga0373924_0207673_184_777 187
296 3300035692 Ga0373935_0019078 Ga0373935_0019078_990_1583 187
297 3300035692 Ga0373935_0068211 Ga0373935_0068211_403_996 187
298 3300035695 Ga0373927_0006664 Ga0373927_0006664_5371_5955 187
299 3300035695 Ga0373927_0124947 Ga0373927_0124947_255_848 187
300 3300035724 Ga0373933_0005336 Ga0373933_0005336_5753_6346 187
301 3300035724 Ga0373933_0036393 Ga0373933_0036393_930_1523 187
302 3300035725 Ga0373947_0015338 Ga0373947_0015338_2602_3195 187
303 3300035725 Ga0373947_0285839 Ga0373947_0285839_17_610 187
304 3300036401 Ga0373937_0028859 Ga0373937_0028859_4153_4746 187
305 3300036401 Ga0373937_0042165 Ga0373937_0042165_3167_3751 187
306 3300036401 Ga0373937_0232966 Ga0373937_0232966_540_1124 187
307 3300037068 Ga0373925_0163243 Ga0373925_0163243_41_634 187
308 3300037068 Ga0373925_0183922 Ga0373925_0183922_555_1139 187
309 3300037068 Ga0373925_0209796 Ga0373925_0209796_392_976 187
310 3300037068 Ga0373925_0237926 Ga0373925_0237926_776_1369 187
311 3300041512 Ga0451853_2525184 Ga0451853_2525184_367_960 187
312 3300042005 Ga0439448_0025256 Ga0439448_0025256_1066_1659 187
313 3300046462 Ga0495651_0191090 Ga0495651_0191090_19_612 187
314 3300046462 Ga0495651_0250168 Ga0495651_0250168_152_745 187
315 3300046463 Ga0495653_0130897 Ga0495653_0130897_183_767 187
316 3300046472 Ga0495580_0010175 Ga0495580_0010175_104_688 187
317 3300046472 Ga0495580_0077356 Ga0495580_0077356_1490_2074 187
318 3300046472 Ga0495580_0299883 Ga0495580_0299883_54_647 187
319 3300046473 Ga0495582_0009981 Ga0495582_0009981_671_1255 187
320 3300046475 Ga0495639_0005310 Ga0495639_0005310_934_1518 187
321 3300046476 Ga0495662_0085792 Ga0495662_0085792_704_1288 187
322 3300046477 Ga0495664_0030616 Ga0495664_0030616_325_918 187
323 3300046477 Ga0495664_0540979 Ga0495664_0540979_90_683 187
324 3300046499 Ga0495594_0017270 Ga0495594_0017270_1763_2347 187
325 3300046516 Ga0495628_0127544 Ga0495628_0127544_1034_1627 187
326 3300046517 Ga0495630_0135258 Ga0495630_0135258_795_1388 187
327 3300046526 Ga0495666_0086173 Ga0495666_0086173_733_1317 187
328 3300046531 Ga0495665_0022338 Ga0495665_0022338_1468_2052 187
329 3300046535 Ga0495586_0064780 Ga0495586_0064780_1210_1803 187
330 3300046539 Ga0495621_0002673 Ga0495621_0002673_2011_2604 187
331 3300046543 Ga0495645_0006508 Ga0495645_0006508_5245_5838 187
332 3300046543 Ga0495645_0282285 Ga0495645_0282285_293_886 187
333 3300046663 Ga0495635_0021390 Ga0495635_0021390_3574_4158 187
334 3300046663 Ga0495635_0619942 Ga0495635_0619942_67_660 187
335 3300046664 Ga0495659_0011305 Ga0495659_0011305_1358_1951 187
336 3300046679 Ga0495623_0070732 Ga0495623_0070732_660_1253 187
337 3300046683 Ga0495658_0046521 Ga0495658_0046521_1799_2392 187
338 3300046809 Ga0495600_0029604 Ga0495600_0029604_1789_2373 187
339 3300047315 Ga0495581_0008149 Ga0495581_0008149_5375_5959 187
340 3300047317 Ga0495604_0179273 Ga0495604_0179273_423_1016 187
341 3300047319 Ga0495674_0157749 Ga0495674_0157749_813_1406 187
342 3300047322 Ga0495680_0075719 Ga0495680_0075719_495_1079 187
343 3300047471 Ga0495684_0003967 Ga0495684_0003967_6455_7039 187
344 3300048088 Ga0495602_0073475 Ga0495602_0073475_2307_2891 187
345 3300048905 Ga0496102_0039809 Ga0496102_0039809_561_1145 187
346 3300048907 Ga0496104_0101161 Ga0496104_0101161_352_945 187
347 3300048908 Ga0496105_0022793 Ga0496105_0022793_3237_3830 187
348 3300048910 Ga0496107_0151599 Ga0496107_0151599_696_1289 187
349 3300048912 Ga0496109_0040016 Ga0496109_0040016_1661_2254 187
350 3300048914 Ga0496111_0106968 Ga0496111_0106968_249_842 187
351 3300048915 Ga0496112_0001998 Ga0496112_0001998_3850_4443 187
352 3300048917 Ga0496114_0038202 Ga0496114_0038202_1793_2386 187
353 3300053077 Ga0495601_0303835 Ga0495601_0303835_246_839 187
354 3300053078 Ga0495612_0049642 Ga0495612_0049642_655_1248 187
355 3300053085 Ga0495619_0052673 Ga0495619_0052673_1320_1904 187
356 3300003203 JGI25406J46586_10120319 JGI25406J46586_101203191 188
357 3300005985 Ga0081539_10066694 Ga0081539_100666942 188
358 3300026118 Ga0207675_101043099 Ga0207675_1010430992 188
359 3300031238 Ga0265332_10002051 Ga0265332_1000205114 188
360 3300031241 Ga0265325_10035231 Ga0265325_100352313 188
361 3300031242 Ga0265329_10006644 Ga0265329_100066444 188
362 3300031250 Ga0265331_10000485 Ga0265331_1000048527 188
363 3300031251 Ga0265327_10013562 Ga0265327_100135624 188
364 3300031344 Ga0265316_10015334 Ga0265316_100153343 188
365 3300031711 Ga0265314_10009143 Ga0265314_100091434 188
366 3300031712 Ga0265342_10010277 Ga0265342_100102772 188
367 3300005543 Ga0070672_100083055 Ga0070672_1000830553 189
368 3300005563 Ga0068855_100003365 Ga0068855_10000336519 189
369 3300005564 Ga0070664_100000603 Ga0070664_10000060320 189
370 3300005614 Ga0068856_100006811 Ga0068856_1000068112 189
371 3300005616 Ga0068852_100007597 Ga0068852_1000075975 189
372 3300005617 Ga0068859_100602005 Ga0068859_1006020052 189
373 3300005834 Ga0068851_10130146 Ga0068851_101301462 189
374 3300006931 Ga0097620_100602056 Ga0097620_1006020562 189
375 3300014969 Ga0157376_10468579 Ga0157376_104685792 189
376 3300025907 Ga0207645_10280271 Ga0207645_102802712 189
377 3300025919 Ga0207657_10000838 Ga0207657_1000083810 189
378 3300025923 Ga0207681_10117350 Ga0207681_101173503 189
379 3300025932 Ga0207690_10000802 Ga0207690_1000080213 189
380 3300025933 Ga0207706_10000052 Ga0207706_1000005274 189
381 3300025940 Ga0207691_10084220 Ga0207691_100842203 189
382 3300025945 Ga0207679_10034570 Ga0207679_100345704 189
383 3300025949 Ga0207667_10004899 Ga0207667_100048993 189
384 3300025960 Ga0207651_10023051 Ga0207651_100230513 189
385 3300025981 Ga0207640_10091174 Ga0207640_100911744 189
386 3300025986 Ga0207658_10024031 Ga0207658_100240313 189
387 3300026023 Ga0207677_10130342 Ga0207677_101303423 189
388 3300026067 Ga0207678_10021509 Ga0207678_100215095 189
389 3300026078 Ga0207702_10001528 Ga0207702_1000152819 189
390 3300026142 Ga0207698_10024376 Ga0207698_100243763 189
391 3300036401 Ga0373937_0470532 Ga0373937_0470532_558_1160 189
392 3300006844 Ga0075428_100044002 Ga0075428_1000440022 190
393 3300014326 Ga0157380_10606100 Ga0157380_106061002 190
394 3300025972 Ga0207668_10035134 Ga0207668_100351343 190
395 3300025972 Ga0207668_11092287 Ga0207668_110922872 190
396 3300027665 Ga0209983_1016566 Ga0209983_10165662 190
397 3300027695 Ga0209966_1046711 Ga0209966_10467112 190
398 3300005366 Ga0070659_100035551 Ga0070659_1000355512 191
399 3300009177 Ga0105248_11625282 Ga0105248_116252821 191
400 3300025928 Ga0207700_10235075 Ga0207700_102350751 191
401 3300025941 Ga0207711_10134208 Ga0207711_101342081 191
402 3300025942 Ga0207689_10242062 Ga0207689_102420622 191
403 3300005329 Ga0070683_100162470 Ga0070683_1001624702 192
404 3300005331 Ga0070670_100082378 Ga0070670_1000823783 192
405 3300005333 Ga0070677_10164128 Ga0070677_101641282 192
406 3300005335 Ga0070666_10066112 Ga0070666_100661123 192
407 3300005338 Ga0068868_100016776 Ga0068868_1000167763 192
408 3300005338 Ga0068868_100500833 Ga0068868_1005008332 192
409 3300005344 Ga0070661_100045024 Ga0070661_1000450243 192
410 3300005356 Ga0070674_100002939 Ga0070674_1000029396 192
411 3300005456 Ga0070678_100013450 Ga0070678_1000134503 192
412 3300005459 Ga0068867_100014417 Ga0068867_1000144174 192
413 3300005543 Ga0070672_100042097 Ga0070672_1000420974 192
414 3300005548 Ga0070665_100002901 Ga0070665_1000029012 192
415 3300005564 Ga0070664_100082272 Ga0070664_1000822723 192
416 3300005616 Ga0068852_100004904 Ga0068852_10000490411 192
417 3300005834 Ga0068851_10011782 Ga0068851_100117823 192
418 3300006237 Ga0097621_100085550 Ga0097621_1000855502 192
419 3300006358 Ga0068871_100027967 Ga0068871_1000279673 192
420 3300006881 Ga0068865_100539139 Ga0068865_1005391392 192
421 3300009177 Ga0105248_10562616 Ga0105248_105626163 192
422 3300013296 Ga0157374_10122413 Ga0157374_101224133 192
423 3300013308 Ga0157375_10747611 Ga0157375_107476112 192
424 3300025903 Ga0207680_10128823 Ga0207680_101288232 192
425 3300025925 Ga0207650_10120693 Ga0207650_101206933 192
426 3300025937 Ga0207669_10003089 Ga0207669_100030895 192
427 3300025940 Ga0207691_10042435 Ga0207691_100424354 192
428 3300025941 Ga0207711_10396589 Ga0207711_103965892 192
429 3300026089 Ga0207648_10078366 Ga0207648_100783664 192
430 3300026095 Ga0207676_10777592 Ga0207676_107775922 192
431 3300026121 Ga0207683_10001496 Ga0207683_100014966 192
432 3300028379 Ga0268266_10011604 Ga0268266_100116043 192
433 3300035691 Ga0373931_0033564 Ga0373931_0033564_540_1121 192
434 3300005439 Ga0070711_100179840 Ga0070711_1001798402 193
435 3300025916 Ga0207663_10164514 Ga0207663_101645143 193
436 3300005367 Ga0070667_100415956 Ga0070667_1004159561 194
437 3300005614 Ga0068856_100704331 Ga0068856_1007043312 194
438 3300042436 Ga0439435_0029683 Ga0439435_0029683_263_853 194
439 3300049591 Ga0501075_0451477 Ga0501075_0451477_253_843 194
440 3300049592 Ga0501076_0277016 Ga0501076_0277016_485_1075 194
441 3300049824 Ga0501045_0061866 Ga0501045_0061866_1851_2441 194
442 3300005347 Ga0070668_100030960 Ga0070668_1000309604 195
443 3300005353 Ga0070669_100110702 Ga0070669_1001107023 195
444 3300005564 Ga0070664_100015292 Ga0070664_1000152925 195
445 3300005614 Ga0068856_100146518 Ga0068856_1001465182 195
446 3300005614 Ga0068856_100421830 Ga0068856_1004218302 195
447 3300005618 Ga0068864_100064811 Ga0068864_1000648111 195
448 3300005618 Ga0068864_100415537 Ga0068864_1004155372 195
449 3300005719 Ga0068861_100074449 Ga0068861_1000744492 195
450 3300005841 Ga0068863_100237443 Ga0068863_1002374431 195
451 3300005843 Ga0068860_100036770 Ga0068860_1000367703 195
452 3300005843 Ga0068860_100136551 Ga0068860_1001365514 195
453 3300009094 Ga0111539_10461455 Ga0111539_104614553 195
454 3300011119 Ga0105246_11024521 Ga0105246_110245211 195
455 3300013307 Ga0157372_10152472 Ga0157372_101524722 195
456 3300013308 Ga0157375_10365791 Ga0157375_103657912 195
457 3300014969 Ga0157376_10485995 Ga0157376_104859951 195
458 3300025945 Ga0207679_10009761 Ga0207679_100097615 195
459 3300026035 Ga0207703_10397061 Ga0207703_103970612 195
460 3300026088 Ga0207641_10048832 Ga0207641_100488321 195
461 3300026088 Ga0207641_10444051 Ga0207641_104440511 195
462 3300026095 Ga0207676_10681372 Ga0207676_106813722 195
463 3300026118 Ga0207675_100477586 Ga0207675_1004775862 195
464 3300028380 Ga0268265_10044623 Ga0268265_100446233 195
465 3300028381 Ga0268264_10121263 Ga0268264_101212632 195
466 3300042876 Ga0451577_0080614 Ga0451577_0080614_2180_2773 195
467 3300042876 Ga0451577_0280096 Ga0451577_0280096_240_842 195
468 3300045051 Ga0451576_0377529 Ga0451576_0377529_857_1459 195
469 3300048907 Ga0496104_0380993 Ga0496104_0380993_452_1045 195
470 3300048909 Ga0496106_0217851 Ga0496106_0217851_398_991 195
471 3300050513 nmdc:mga0rr50_928671_c1 nmdc:mga0rr50_928671_c1_71_673 195
472 3300050514 nmdc:mga08x19_755365_c1 nmdc:mga08x19_755365_c1_38_661 195
473 3300005330 Ga0070690_100069917 Ga0070690_1000699173 196
474 3300005331 Ga0070670_100067874 Ga0070670_1000678743 196
475 3300005334 Ga0068869_100002048 Ga0068869_10000204811 196
476 3300005335 Ga0070666_10151823 Ga0070666_101518232 196
477 3300005339 Ga0070660_100028916 Ga0070660_1000289163 196
478 3300005340 Ga0070689_100953704 Ga0070689_1009537041 196
479 3300005343 Ga0070687_100160803 Ga0070687_1001608032 196
480 3300005344 Ga0070661_100172627 Ga0070661_1001726273 196
481 3300005347 Ga0070668_100003095 Ga0070668_1000030953 196
482 3300005347 Ga0070668_100017531 Ga0070668_1000175314 196
483 3300005353 Ga0070669_100013619 Ga0070669_1000136196 196
484 3300005353 Ga0070669_100064961 Ga0070669_1000649614 196
485 3300005354 Ga0070675_100580005 Ga0070675_1005800051 196
486 3300005355 Ga0070671_100048480 Ga0070671_1000484803 196
487 3300005364 Ga0070673_100180112 Ga0070673_1001801123 196
488 3300005367 Ga0070667_100032146 Ga0070667_1000321466 196
489 3300005367 Ga0070667_100032899 Ga0070667_1000328994 196
490 3300005367 Ga0070667_100058368 Ga0070667_1000583684 196
491 3300005367 Ga0070667_100123319 Ga0070667_1001233193 196
492 3300005367 Ga0070667_100753131 Ga0070667_1007531312 196
493 3300005445 Ga0070708_100001563 Ga0070708_1000015635 196
494 3300005445 Ga0070708_100693996 Ga0070708_1006939962 196
495 3300005456 Ga0070678_100358216 Ga0070678_1003582163 196
496 3300005457 Ga0070662_100082979 Ga0070662_1000829792 196
497 3300005459 Ga0068867_100007386 Ga0068867_1000073869 196
498 3300005530 Ga0070679_100402222 Ga0070679_1004022222 196
499 3300005539 Ga0068853_100263299 Ga0068853_1002632992 196
500 3300005543 Ga0070672_100017957 Ga0070672_1000179576 196
501 3300005543 Ga0070672_100019414 Ga0070672_1000194146 196
502 3300005546 Ga0070696_100213044 Ga0070696_1002130442 196
503 3300005547 Ga0070693_100196895 Ga0070693_1001968952 196
504 3300005548 Ga0070665_100107353 Ga0070665_1001073534 196
505 3300005563 Ga0068855_100004748 Ga0068855_10000474818 196
506 3300005563 Ga0068855_100142436 Ga0068855_1001424364 196
507 3300005577 Ga0068857_100008941 Ga0068857_1000089418 196
508 3300005578 Ga0068854_100168046 Ga0068854_1001680463 196
509 3300005578 Ga0068854_100339589 Ga0068854_1003395892 196
510 3300005614 Ga0068856_100315113 Ga0068856_1003151132 196
511 3300005616 Ga0068852_100229474 Ga0068852_1002294742 196
512 3300005617 Ga0068859_100000538 Ga0068859_10000053829 196
513 3300005617 Ga0068859_100751572 Ga0068859_1007515722 196
514 3300005618 Ga0068864_100000566 Ga0068864_10000056612 196
515 3300005719 Ga0068861_100037669 Ga0068861_1000376693 196
516 3300005840 Ga0068870_10210434 Ga0068870_102104342 196
517 3300005841 Ga0068863_100001288 Ga0068863_10000128816 196
518 3300005841 Ga0068863_100022056 Ga0068863_1000220565 196
519 3300005842 Ga0068858_100004050 Ga0068858_10000405017 196
520 3300005842 Ga0068858_100013137 Ga0068858_1000131373 196
521 3300005843 Ga0068860_100001659 Ga0068860_10000165916 196
522 3300005843 Ga0068860_100270375 Ga0068860_1002703753 196
523 3300005937 Ga0081455_10450271 Ga0081455_104502712 196
524 3300005985 Ga0081539_10046006 Ga0081539_100460062 196
525 3300006852 Ga0075433_10371263 Ga0075433_103712632 196
526 3300006931 Ga0097620_100000538 Ga0097620_10000053816 196
527 3300006931 Ga0097620_100751526 Ga0097620_1007515262 196
528 3300009094 Ga0111539_10243953 Ga0111539_102439532 196
529 3300009098 Ga0105245_10154086 Ga0105245_101540862 196
530 3300009101 Ga0105247_10257282 Ga0105247_102572822 196
531 3300009177 Ga0105248_10017422 Ga0105248_100174228 196
532 3300009177 Ga0105248_10392887 Ga0105248_103928873 196
533 3300009177 Ga0105248_12174003 Ga0105248_121740031 196
534 3300009553 Ga0105249_10253320 Ga0105249_102533203 196
535 3300013104 Ga0157370_10002272 Ga0157370_1000227216 196
536 3300013104 Ga0157370_10016162 Ga0157370_100161625 196
537 3300013307 Ga0157372_11096720 Ga0157372_110967202 196
538 3300013308 Ga0157375_10683039 Ga0157375_106830391 196
539 3300014325 Ga0163163_10007776 Ga0163163_100077764 196
540 3300014325 Ga0163163_10131417 Ga0163163_101314171 196
541 3300014968 Ga0157379_10000063 Ga0157379_1000006311 196
542 3300014968 Ga0157379_10001854 Ga0157379_1000185414 196
543 3300025315 Ga0207697_10036401 Ga0207697_100364012 196
544 3300025315 Ga0207697_10114552 Ga0207697_101145522 196
545 3300025903 Ga0207680_10274973 Ga0207680_102749732 196
546 3300025907 Ga0207645_10063635 Ga0207645_100636354 196
547 3300025908 Ga0207643_10002024 Ga0207643_100020246 196
548 3300025908 Ga0207643_10357630 Ga0207643_103576301 196
549 3300025918 Ga0207662_10177995 Ga0207662_101779952 196
550 3300025919 Ga0207657_10001142 Ga0207657_100011425 196
551 3300025920 Ga0207649_10092390 Ga0207649_100923902 196
552 3300025923 Ga0207681_10004889 Ga0207681_100048896 196
553 3300025923 Ga0207681_10035034 Ga0207681_100350342 196
554 3300025931 Ga0207644_10058219 Ga0207644_100582194 196
555 3300025932 Ga0207690_10019366 Ga0207690_100193664 196
556 3300025933 Ga0207706_10046988 Ga0207706_100469883 196
557 3300025936 Ga0207670_10779584 Ga0207670_107795841 196
558 3300025940 Ga0207691_10031723 Ga0207691_100317236 196
559 3300025940 Ga0207691_10679550 Ga0207691_106795501 196
560 3300025941 Ga0207711_10229408 Ga0207711_102294083 196
561 3300025942 Ga0207689_10002629 Ga0207689_100026298 196
562 3300025945 Ga0207679_10138470 Ga0207679_101384702 196
563 3300025949 Ga0207667_10016222 Ga0207667_100162223 196
564 3300025949 Ga0207667_10126075 Ga0207667_101260753 196
565 3300025949 Ga0207667_10161080 Ga0207667_101610802 196
566 3300025960 Ga0207651_10147366 Ga0207651_101473662 196
567 3300025961 Ga0207712_10143346 Ga0207712_101433462 196
568 3300025972 Ga0207668_10176614 Ga0207668_101766142 196
569 3300025981 Ga0207640_10249758 Ga0207640_102497582 196
570 3300025986 Ga0207658_10074568 Ga0207658_100745684 196
571 3300025986 Ga0207658_10090467 Ga0207658_100904672 196
572 3300025986 Ga0207658_10240003 Ga0207658_102400033 196
573 3300026023 Ga0207677_10175540 Ga0207677_101755402 196
574 3300026023 Ga0207677_10314425 Ga0207677_103144252 196
575 3300026035 Ga0207703_10003421 Ga0207703_1000342113 196
576 3300026035 Ga0207703_10006642 Ga0207703_100066429 196
577 3300026067 Ga0207678_10441966 Ga0207678_104419662 196
578 3300026088 Ga0207641_10063530 Ga0207641_100635302 196
579 3300026089 Ga0207648_10006931 Ga0207648_100069318 196
580 3300026095 Ga0207676_10010947 Ga0207676_100109476 196
581 3300026116 Ga0207674_10011259 Ga0207674_100112596 196
582 3300026116 Ga0207674_10071748 Ga0207674_100717484 196
583 3300026118 Ga0207675_100075541 Ga0207675_1000755414 196
584 3300026121 Ga0207683_10641681 Ga0207683_106416812 196
585 3300028379 Ga0268266_10085665 Ga0268266_100856654 196
586 3300028380 Ga0268265_10048032 Ga0268265_100480323 196
587 3300028381 Ga0268264_10000599 Ga0268264_1000059917 196
588 3300028381 Ga0268264_10046042 Ga0268264_100460425 196
589 3300028381 Ga0268264_10633059 Ga0268264_106330592 196
590 3300031548 Ga0307408_100019001 Ga0307408_1000190013 196
591 3300031731 Ga0307405_10014503 Ga0307405_100145035 196
592 3300031824 Ga0307413_10160338 Ga0307413_101603383 196
593 3300031852 Ga0307410_10001357 Ga0307410_100013575 196
594 3300031901 Ga0307406_10037070 Ga0307406_100370704 196
595 3300031903 Ga0307407_10041821 Ga0307407_100418214 196
596 3300031911 Ga0307412_10081877 Ga0307412_100818773 196
597 3300031995 Ga0307409_100012473 Ga0307409_1000124737 196
598 3300032002 Ga0307416_100203594 Ga0307416_1002035942 196
599 3300032004 Ga0307414_10230346 Ga0307414_102303462 196
600 3300032005 Ga0307411_10105760 Ga0307411_101057603 196
601 3300032126 Ga0307415_100006430 Ga0307415_1000064302 196
602 3300035692 Ga0373935_0100658 Ga0373935_0100658_925_1515 196
603 3300035695 Ga0373927_0186264 Ga0373927_0186264_573_1163 196
604 3300037068 Ga0373925_0511692 Ga0373925_0511692_235_825 196
605 3300048913 Ga0496110_0461402 Ga0496110_0461402_151_747 196
606 3300050511 nmdc:mga08y16_1190169_c1 nmdc:mga08y16_1190169_c1_85_681 196
607 3300050512 nmdc:mga0n895_341536_c1 nmdc:mga0n895_341536_c1_325_921 196
608 3300050513 nmdc:mga0rr50_572116_c1 nmdc:mga0rr50_572116_c1_307_921 196
609 3300050515 nmdc:mga0a205_281765_c1 nmdc:mga0a205_281765_c1_486_1082 196
610 3300005327 Ga0070658_10010289 Ga0070658_100102896 197
611 3300005328 Ga0070676_10014144 Ga0070676_100141443 197
612 3300005329 Ga0070683_100316383 Ga0070683_1003163832 197
613 3300005331 Ga0070670_100234414 Ga0070670_1002344142 197
614 3300005335 Ga0070666_10212146 Ga0070666_102121462 197
615 3300005336 Ga0070680_100029569 Ga0070680_1000295694 197
616 3300005336 Ga0070680_100111261 Ga0070680_1001112613 197
617 3300005337 Ga0070682_100034586 Ga0070682_1000345861 197
618 3300005337 Ga0070682_100309519 Ga0070682_1003095192 197
619 3300005338 Ga0068868_100090864 Ga0068868_1000908643 197
620 3300005338 Ga0068868_100165407 Ga0068868_1001654072 197
621 3300005339 Ga0070660_100037521 Ga0070660_1000375212 197
622 3300005339 Ga0070660_100064656 Ga0070660_1000646562 197
623 3300005344 Ga0070661_100004591 Ga0070661_1000045919 197
624 3300005345 Ga0070692_10013193 Ga0070692_100131931 197
625 3300005347 Ga0070668_100053853 Ga0070668_1000538534 197
626 3300005353 Ga0070669_100080175 Ga0070669_1000801752 197
627 3300005353 Ga0070669_100761884 Ga0070669_1007618841 197
628 3300005355 Ga0070671_100010164 Ga0070671_1000101648 197
629 3300005364 Ga0070673_100024244 Ga0070673_1000242443 197
630 3300005366 Ga0070659_100001467 Ga0070659_10000146713 197
631 3300005366 Ga0070659_100004493 Ga0070659_10000449311 197
632 3300005367 Ga0070667_100032527 Ga0070667_1000325273 197
633 3300005367 Ga0070667_100439572 Ga0070667_1004395721 197
634 3300005434 Ga0070709_10149690 Ga0070709_101496902 197
635 3300005434 Ga0070709_10214450 Ga0070709_102144501 197
636 3300005435 Ga0070714_100001561 Ga0070714_10000156118 197
637 3300005455 Ga0070663_100003583 Ga0070663_1000035839 197
638 3300005456 Ga0070678_100128334 Ga0070678_1001283342 197
639 3300005457 Ga0070662_100000514 Ga0070662_1000005149 197
640 3300005458 Ga0070681_10007078 Ga0070681_1000707811 197
641 3300005458 Ga0070681_10045765 Ga0070681_100457653 197
642 3300005459 Ga0068867_100385747 Ga0068867_1003857472 197
643 3300005530 Ga0070679_100032998 Ga0070679_1000329982 197
644 3300005530 Ga0070679_100253794 Ga0070679_1002537943 197
645 3300005535 Ga0070684_100003343 Ga0070684_1000033437 197
646 3300005539 Ga0068853_100006454 Ga0068853_10000645410 197
647 3300005539 Ga0068853_100281420 Ga0068853_1002814202 197
648 3300005548 Ga0070665_100850069 Ga0070665_1008500692 197
649 3300005563 Ga0068855_100155977 Ga0068855_1001559774 197
650 3300005564 Ga0070664_100230370 Ga0070664_1002303702 197
651 3300005564 Ga0070664_100962318 Ga0070664_1009623182 197
652 3300005577 Ga0068857_100032329 Ga0068857_1000323291 197
653 3300005577 Ga0068857_100260336 Ga0068857_1002603361 197
654 3300005577 Ga0068857_100591178 Ga0068857_1005911782 197
655 3300005614 Ga0068856_100004285 Ga0068856_1000042856 197
656 3300005614 Ga0068856_100069088 Ga0068856_1000690882 197
657 3300005616 Ga0068852_100490942 Ga0068852_1004909422 197
658 3300005616 Ga0068852_100532235 Ga0068852_1005322352 197
659 3300005618 Ga0068864_100140941 Ga0068864_1001409414 197
660 3300005834 Ga0068851_10000426 Ga0068851_100004265 197
661 3300005834 Ga0068851_10264288 Ga0068851_102642882 197
662 3300005841 Ga0068863_100355213 Ga0068863_1003552132 197
663 3300005843 Ga0068860_100115903 Ga0068860_1001159033 197
664 3300009093 Ga0105240_10016388 Ga0105240_100163881 197
665 3300009094 Ga0111539_10701658 Ga0111539_107016582 197
666 3300009174 Ga0105241_10122743 Ga0105241_101227433 197
667 3300010375 Ga0105239_10005432 Ga0105239_1000543212 197
668 3300013100 Ga0157373_10001627 Ga0157373_100016276 197
669 3300013100 Ga0157373_10004575 Ga0157373_100045756 197
670 3300013102 Ga0157371_10000614 Ga0157371_1000061439 197
671 3300013102 Ga0157371_10098999 Ga0157371_100989993 197
672 3300013104 Ga0157370_10017667 Ga0157370_100176675 197
673 3300013104 Ga0157370_10088675 Ga0157370_100886751 197
674 3300013104 Ga0157370_10394901 Ga0157370_103949012 197
675 3300013105 Ga0157369_10073906 Ga0157369_100739064 197
676 3300013105 Ga0157369_10111900 Ga0157369_101119003 197
677 3300013307 Ga0157372_10005628 Ga0157372_1000562813 197
678 3300013307 Ga0157372_10039506 Ga0157372_100395064 197
679 3300013307 Ga0157372_10166276 Ga0157372_101662762 197
680 3300013307 Ga0157372_10307335 Ga0157372_103073352 197
681 3300013307 Ga0157372_10451955 Ga0157372_104519552 197
682 3300014745 Ga0157377_10680455 Ga0157377_106804551 197
683 3300017792 Ga0163161_10560441 Ga0163161_105604412 197
684 3300020070 Ga0206356_10703160 Ga0206356_107031601 197
685 3300020082 Ga0206353_10151062 Ga0206353_101510622 197
686 3300025321 Ga0207656_10019699 Ga0207656_100196991 197
687 3300025906 Ga0207699_10015000 Ga0207699_100150003 197
688 3300025909 Ga0207705_10012689 Ga0207705_100126897 197
689 3300025911 Ga0207654_10006442 Ga0207654_100064427 197
690 3300025912 Ga0207707_10012638 Ga0207707_100126381 197
691 3300025912 Ga0207707_10042784 Ga0207707_100427843 197
692 3300025913 Ga0207695_10014173 Ga0207695_100141731 197
693 3300025913 Ga0207695_10440028 Ga0207695_104400282 197
694 3300025917 Ga0207660_10006657 Ga0207660_100066576 197
695 3300025917 Ga0207660_10059370 Ga0207660_100593703 197
696 3300025918 Ga0207662_10168223 Ga0207662_101682232 197
697 3300025919 Ga0207657_10001514 Ga0207657_1000151429 197
698 3300025920 Ga0207649_10020195 Ga0207649_100201951 197
699 3300025920 Ga0207649_10119325 Ga0207649_101193252 197
700 3300025920 Ga0207649_10533631 Ga0207649_105336311 197
701 3300025921 Ga0207652_10216347 Ga0207652_102163472 197
702 3300025921 Ga0207652_10222287 Ga0207652_102222872 197
703 3300025921 Ga0207652_10264867 Ga0207652_102648673 197
704 3300025924 Ga0207694_10077340 Ga0207694_100773401 197
705 3300025928 Ga0207700_10223950 Ga0207700_102239502 197
706 3300025929 Ga0207664_10004963 Ga0207664_100049636 197
707 3300025929 Ga0207664_10261193 Ga0207664_102611932 197
708 3300025932 Ga0207690_10183824 Ga0207690_101838242 197
709 3300025933 Ga0207706_10313699 Ga0207706_103136992 197
710 3300025937 Ga0207669_10263243 Ga0207669_102632432 197
711 3300025940 Ga0207691_10156979 Ga0207691_101569793 197
712 3300025944 Ga0207661_10033692 Ga0207661_100336925 197
713 3300025945 Ga0207679_10202353 Ga0207679_102023533 197
714 3300025949 Ga0207667_10002090 Ga0207667_100020901 197
715 3300025949 Ga0207667_10089248 Ga0207667_100892484 197
716 3300025949 Ga0207667_10129870 Ga0207667_101298703 197
717 3300025981 Ga0207640_10004826 Ga0207640_100048261 197
718 3300025981 Ga0207640_10283293 Ga0207640_102832933 197
719 3300026067 Ga0207678_10011283 Ga0207678_100112831 197
720 3300026078 Ga0207702_10020849 Ga0207702_100208494 197
721 3300026078 Ga0207702_10022442 Ga0207702_100224425 197
722 3300026078 Ga0207702_10047008 Ga0207702_100470081 197
723 3300026078 Ga0207702_10856736 Ga0207702_108567362 197
724 3300026088 Ga0207641_10102994 Ga0207641_101029944 197
725 3300026089 Ga0207648_10096508 Ga0207648_100965083 197
726 3300026116 Ga0207674_10002203 Ga0207674_100022031 197
727 3300026116 Ga0207674_10290503 Ga0207674_102905032 197
728 3300026118 Ga0207675_100130544 Ga0207675_1001305443 197
729 3300026142 Ga0207698_10000659 Ga0207698_100006592 197
730 3300027682 Ga0209971_1001936 Ga0209971_10019366 197
731 3300028379 Ga0268266_10502027 Ga0268266_105020272 197
732 3300028381 Ga0268264_10601785 Ga0268264_106017852 197
733 3300031548 Ga0307408_100004014 Ga0307408_1000040143 197
734 3300031731 Ga0307405_10018794 Ga0307405_100187943 197
735 3300031824 Ga0307413_10007331 Ga0307413_100073312 197
736 3300031852 Ga0307410_10001025 Ga0307410_100010254 197
737 3300031901 Ga0307406_10032793 Ga0307406_100327932 197
738 3300031903 Ga0307407_10002673 Ga0307407_100026732 197
739 3300031911 Ga0307412_10009818 Ga0307412_100098184 197
740 3300031995 Ga0307409_100018388 Ga0307409_1000183883 197
741 3300032002 Ga0307416_100060819 Ga0307416_1000608195 197
742 3300032005 Ga0307411_10004698 Ga0307411_100046984 197
743 3300035691 Ga0373931_0227715 Ga0373931_0227715_155_763 197
744 3300037471 Ga0395905_0308615 Ga0395905_0308615_706_1305 197
745 3300042157 Ga0439458_0069788 Ga0439458_0069788_17_610 197
746 3300045976 Ga0466967_0379197 Ga0466967_0379197_521_1129 197
747 3300048903 Ga0496100_0146195 Ga0496100_0146195_87_695 197
748 3300048905 Ga0496102_0039538 Ga0496102_0039538_1112_1720 197
749 3300048905 Ga0496102_0422729 Ga0496102_0422729_430_1038 197
750 3300048906 Ga0496103_0216955 Ga0496103_0216955_500_1108 197
751 3300048909 Ga0496106_0015856 Ga0496106_0015856_1482_2090 197
752 3300048910 Ga0496107_0037561 Ga0496107_0037561_1572_2180 197
753 3300048913 Ga0496110_0213348 Ga0496110_0213348_38_637 197
754 3300050514 nmdc:mga08x19_213965_c1 nmdc:mga08x19_213965_c1_567_1175 197
755 3300001976 JGI24752J21851_1009839 JGI24752J21851_10098392 198
756 3300001991 JGI24743J22301_10011735 JGI24743J22301_100117351 198
757 3300002239 JGI24034J26672_10008291 JGI24034J26672_100082912 198
758 3300002459 JGI24751J29686_10034862 JGI24751J29686_100348622 198
759 3300005290 Ga0065712_10131233 Ga0065712_101312332 198
760 3300005327 Ga0070658_10632055 Ga0070658_106320552 198
761 3300005329 Ga0070683_100009470 Ga0070683_1000094706 198
762 3300005330 Ga0070690_100011226 Ga0070690_1000112262 198
763 3300005331 Ga0070670_100830440 Ga0070670_1008304401 198
764 3300005333 Ga0070677_10002166 Ga0070677_100021665 198
765 3300005335 Ga0070666_10223167 Ga0070666_102231671 198
766 3300005336 Ga0070680_100226029 Ga0070680_1002260293 198
767 3300005337 Ga0070682_100091487 Ga0070682_1000914873 198
768 3300005339 Ga0070660_100007823 Ga0070660_1000078233 198
769 3300005339 Ga0070660_100041143 Ga0070660_1000411434 198
770 3300005340 Ga0070689_100047874 Ga0070689_1000478742 198
771 3300005341 Ga0070691_10077539 Ga0070691_100775392 198
772 3300005343 Ga0070687_100001561 Ga0070687_1000015617 198
773 3300005344 Ga0070661_100019359 Ga0070661_1000193592 198
774 3300005344 Ga0070661_100070871 Ga0070661_1000708712 198
775 3300005353 Ga0070669_100157476 Ga0070669_1001574762 198
776 3300005354 Ga0070675_100405076 Ga0070675_1004050762 198
777 3300005355 Ga0070671_100647353 Ga0070671_1006473531 198
778 3300005364 Ga0070673_100328514 Ga0070673_1003285142 198
779 3300005365 Ga0070688_100006442 Ga0070688_1000064422 198
780 3300005366 Ga0070659_100161228 Ga0070659_1001612282 198
781 3300005366 Ga0070659_100678171 Ga0070659_1006781711 198
782 3300005367 Ga0070667_100442121 Ga0070667_1004421212 198
783 3300005434 Ga0070709_10011638 Ga0070709_100116386 198
784 3300005435 Ga0070714_100179355 Ga0070714_1001793553 198
785 3300005436 Ga0070713_100165937 Ga0070713_1001659373 198
786 3300005437 Ga0070710_10001992 Ga0070710_100019925 198
787 3300005439 Ga0070711_100011788 Ga0070711_1000117883 198
788 3300005440 Ga0070705_100099438 Ga0070705_1000994382 198
789 3300005441 Ga0070700_100105515 Ga0070700_1001055152 198
790 3300005455 Ga0070663_100016670 Ga0070663_1000166704 198
791 3300005458 Ga0070681_10421880 Ga0070681_104218802 198
792 3300005459 Ga0068867_100056617 Ga0068867_1000566173 198
793 3300005466 Ga0070685_10013823 Ga0070685_100138232 198
794 3300005518 Ga0070699_100005607 Ga0070699_1000056076 198
795 3300005530 Ga0070679_100051349 Ga0070679_1000513493 198
796 3300005530 Ga0070679_100355836 Ga0070679_1003558362 198
797 3300005535 Ga0070684_100061871 Ga0070684_1000618712 198
798 3300005535 Ga0070684_101240747 Ga0070684_1012407471 198
799 3300005544 Ga0070686_100003848 Ga0070686_1000038487 198
800 3300005547 Ga0070693_100005461 Ga0070693_1000054614 198
801 3300005547 Ga0070693_100204273 Ga0070693_1002042732 198
802 3300005563 Ga0068855_101009991 Ga0068855_1010099911 198
803 3300005564 Ga0070664_101057691 Ga0070664_1010576911 198
804 3300005577 Ga0068857_100095377 Ga0068857_1000953772 198
805 3300005578 Ga0068854_100127237 Ga0068854_1001272372 198
806 3300005615 Ga0070702_100016023 Ga0070702_1000160233 198
807 3300005616 Ga0068852_100066353 Ga0068852_1000663534 198
808 3300005617 Ga0068859_100295047 Ga0068859_1002950471 198
809 3300005618 Ga0068864_100010761 Ga0068864_1000107615 198
810 3300005718 Ga0068866_10009303 Ga0068866_100093035 198
811 3300005719 Ga0068861_100019043 Ga0068861_1000190433 198
812 3300005834 Ga0068851_10056517 Ga0068851_100565173 198
813 3300005840 Ga0068870_10036326 Ga0068870_100363261 198
814 3300005842 Ga0068858_100347013 Ga0068858_1003470131 198
815 3300005844 Ga0068862_100184800 Ga0068862_1001848002 198
816 3300006358 Ga0068871_100212526 Ga0068871_1002125262 198
817 3300006881 Ga0068865_100017550 Ga0068865_1000175503 198
818 3300006931 Ga0097620_100295058 Ga0097620_1002950581 198
819 3300009093 Ga0105240_10076475 Ga0105240_100764753 198
820 3300009094 Ga0111539_10104443 Ga0111539_101044433 198
821 3300009148 Ga0105243_10237471 Ga0105243_102374712 198
822 3300009176 Ga0105242_10365529 Ga0105242_103655292 198
823 3300009545 Ga0105237_10133995 Ga0105237_101339954 198
824 3300009545 Ga0105237_10414616 Ga0105237_104146161 198
825 3300011119 Ga0105246_10029542 Ga0105246_100295423 198
826 3300013100 Ga0157373_10170280 Ga0157373_101702802 198
827 3300013104 Ga0157370_10041269 Ga0157370_100412693 198
828 3300013104 Ga0157370_10174463 Ga0157370_101744633 198
829 3300013105 Ga0157369_10025834 Ga0157369_100258342 198
830 3300013296 Ga0157374_10009463 Ga0157374_100094634 198
831 3300013297 Ga0157378_10088666 Ga0157378_100886663 198
832 3300013307 Ga0157372_10095006 Ga0157372_100950064 198
833 3300013307 Ga0157372_10197651 Ga0157372_101976512 198
834 3300014325 Ga0163163_10008499 Ga0163163_100084994 198
835 3300014326 Ga0157380_10041417 Ga0157380_100414173 198
836 3300014745 Ga0157377_10146791 Ga0157377_101467912 198
837 3300014968 Ga0157379_10016387 Ga0157379_100163875 198
838 3300014969 Ga0157376_10125191 Ga0157376_101251913 198
839 3300017792 Ga0163161_10056159 Ga0163161_100561592 198
840 3300025271 Ga0207666_1006598 Ga0207666_10065981 198
841 3300025315 Ga0207697_10000020 Ga0207697_1000002046 198
842 3300025321 Ga0207656_10037791 Ga0207656_100377913 198
843 3300025893 Ga0207682_10000288 Ga0207682_100002886 198
844 3300025898 Ga0207692_10006582 Ga0207692_100065824 198
845 3300025901 Ga0207688_10001077 Ga0207688_1000107713 198
846 3300025903 Ga0207680_10023928 Ga0207680_100239284 198
847 3300025906 Ga0207699_10279188 Ga0207699_102791882 198
848 3300025907 Ga0207645_10000516 Ga0207645_1000051637 198
849 3300025908 Ga0207643_10000131 Ga0207643_1000013113 198
850 3300025909 Ga0207705_10164774 Ga0207705_101647743 198
851 3300025909 Ga0207705_10500603 Ga0207705_105006031 198
852 3300025912 Ga0207707_10659652 Ga0207707_106596521 198
853 3300025913 Ga0207695_10060626 Ga0207695_100606263 198
854 3300025914 Ga0207671_10355524 Ga0207671_103555242 198
855 3300025915 Ga0207693_10411464 Ga0207693_104114642 198
856 3300025918 Ga0207662_10003213 Ga0207662_100032137 198
857 3300025919 Ga0207657_10014488 Ga0207657_100144883 198
858 3300025919 Ga0207657_10027603 Ga0207657_100276034 198
859 3300025920 Ga0207649_10135513 Ga0207649_101355132 198
860 3300025921 Ga0207652_10348044 Ga0207652_103480442 198
861 3300025923 Ga0207681_10210403 Ga0207681_102104032 198
862 3300025925 Ga0207650_10015720 Ga0207650_100157203 198
863 3300025926 Ga0207659_10006674 Ga0207659_100066743 198
864 3300025928 Ga0207700_10065175 Ga0207700_100651752 198
865 3300025929 Ga0207664_10008325 Ga0207664_100083256 198
866 3300025931 Ga0207644_10219477 Ga0207644_102194772 198
867 3300025931 Ga0207644_10343860 Ga0207644_103438601 198
868 3300025932 Ga0207690_10653633 Ga0207690_106536331 198
869 3300025933 Ga0207706_10002570 Ga0207706_1000257013 198
870 3300025934 Ga0207686_10056328 Ga0207686_100563282 198
871 3300025935 Ga0207709_10431743 Ga0207709_104317432 198
872 3300025936 Ga0207670_10030209 Ga0207670_100302092 198
873 3300025937 Ga0207669_10006693 Ga0207669_100066933 198
874 3300025938 Ga0207704_10088619 Ga0207704_100886192 198
875 3300025942 Ga0207689_10000091 Ga0207689_1000009133 198
876 3300025944 Ga0207661_10182006 Ga0207661_101820062 198
877 3300025945 Ga0207679_10025870 Ga0207679_100258703 198
878 3300025960 Ga0207651_10092840 Ga0207651_100928402 198
879 3300025961 Ga0207712_10049868 Ga0207712_100498683 198
880 3300025972 Ga0207668_10112473 Ga0207668_101124733 198
881 3300025981 Ga0207640_10119106 Ga0207640_101191063 198
882 3300025986 Ga0207658_10113298 Ga0207658_101132982 198
883 3300026041 Ga0207639_10099426 Ga0207639_100994263 198
884 3300026041 Ga0207639_10197384 Ga0207639_101973842 198
885 3300026067 Ga0207678_10000257 Ga0207678_1000025738 198
886 3300026075 Ga0207708_10003069 Ga0207708_1000306910 198
887 3300026088 Ga0207641_10092827 Ga0207641_100928272 198
888 3300026089 Ga0207648_10000415 Ga0207648_1000041517 198
889 3300026118 Ga0207675_100002299 Ga0207675_10000229916 198
890 3300026121 Ga0207683_10004801 Ga0207683_1000480113 198
891 3300028380 Ga0268265_10259706 Ga0268265_102597062 198
892 3300035116 Ga0373945_0288796 Ga0373945_0288796_37_633 198
893 3300035118 Ga0373954_0229205 Ga0373954_0229205_271_873 198
894 3300036401 Ga0373937_0203914 Ga0373937_0203914_751_1353 198
895 3300048903 Ga0496100_0141959 Ga0496100_0141959_842_1438 198
896 3300048904 Ga0496101_0120097 Ga0496101_0120097_1020_1616 198
897 3300048905 Ga0496102_0028926 Ga0496102_0028926_3439_4035 198
898 3300048907 Ga0496104_0071628 Ga0496104_0071628_1281_1877 198
899 3300048908 Ga0496105_0206236 Ga0496105_0206236_730_1326 198
900 3300048910 Ga0496107_0007460 Ga0496107_0007460_727_1323 198
901 3300048911 Ga0496108_0003278 Ga0496108_0003278_12295_12891 198
902 3300048912 Ga0496109_0004927 Ga0496109_0004927_5286_5882 198
903 3300048913 Ga0496110_0003478 Ga0496110_0003478_5976_6572 198
904 3300048914 Ga0496111_0319377 Ga0496111_0319377_134_730 198
905 3300048916 Ga0496113_0280272 Ga0496113_0280272_488_1084 198
906 3300048918 Ga0496115_0369470 Ga0496115_0369470_424_1026 198
907 3300050511 nmdc:mga08y16_91621_c1 nmdc:mga08y16_91621_c1_339_941 198

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13302

Acetyltransf_3

Acetyltransferase (GNAT) domain

36

174

0.88

PF00583

Acetyltransf_1

Acetyltransferase (GNAT) family

54

174

0.76

Structural Annotation

Top 5 Hits

ID Description Score Start End
1s7f-assembly1.cif.gz_A-2 riml- ribosomal l7/l12 alpha-n-protein acetyltransferase crystal form i (apo) 0.8973 6 177
3igr-assembly1.cif.gz_A the crystal structure of ribosomal-protein-s5-alanine acetyltransferase from vibrio fischeri to 2.0a 0.8905 5 181
1nsl-assembly1.cif.gz_D crystal structure of probable acetyltransferase 0.8788 10 181
1nsl-assembly1.cif.gz_B crystal structure of probable acetyltransferase 0.8758 7 181
8gxj-assembly1.cif.gz_A pseudomonas aeruginosa n-acetyltransferase domain-containing protein pa3270 0.8727 7 189
ID Description Score Start End Superfamily
af_A0A0R0ECR9_59_131_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9398 110 180 3.40.630.30
af_O05578_9_186_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9167 13 180 3.40.630.30
af_P0A948_10_192_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9113 5 181 3.40.630.30
af_A0A0R0ECR9_59_131_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.904 110 180 3.40.630.30
af_Q54VL6_2_179_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9025 6 181 3.40.630.30
ID Description Score Start End GO Terms
AF-A0A2D8P2J1-F1-model_v4 deleted 0.9808 112 182
AF-A0A6L7TH57-F1-model_v4 [ribosomal protein uS5]-alanine N-acetyltransferase (EC 2.3.1.267) 0.9717 6 177 GO:0005737
GO:0008999
AF-A0A426U3D9-F1-model_v4 [ribosomal protein uS5]-alanine N-acetyltransferase (EC 2.3.1.267) 0.9703 74 183 GO:0005737
GO:0008999
AF-A0A535TLY8-F1-model_v4 [ribosomal protein uS5]-alanine N-acetyltransferase (EC 2.3.1.267) 0.9689 3 185 GO:0005737
GO:0008999
AF-A0A6L6AAW3-F1-model_v4 [ribosomal protein uS5]-alanine N-acetyltransferase (EC 2.3.1.267) 0.9618 97 179 GO:0005737
GO:0008999

Feature Viewer

pLDDT pTM Quality
91.53 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map