F485352

General Info

Members Datasets Scaffolds Average Seq Length
907 511 795 156

Family's Representative Sequence

Representative Sequence 3300009147|Ga0114129_10198599|Ga0114129_101985993
Length 180
Sequence VTYEGELIMQARIKNPAFVVPGAMQALQALAASAEKGGVPKRTLSLIHLRISQINGCGVCLDLHLRGFHEEETNERLLTVAGWRDAPYFTDAERAALALAEAVTRLADRPDPVPDAIWDEAAKHYDERQLGALVLGISAVNVWNRLNVSTRQVAGEWAAASEGQKRAESRTSNPAATATA

Samples

Sample ID Description Type Environment
1 2510065019 Rhizobium leguminosarum bv. trifolii WSM1689 Isolate Nodule
2 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
3 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
4 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
5 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
6 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
7 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
8 2513237138 Rhizobium favelukesii OR191 Isolate Nodule
9 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
10 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
11 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
12 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
13 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
14 2515154134 Rhizobium gallicum bv. gallicum R602sp Isolate Nodule
15 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
16 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
17 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
18 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
19 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
20 2529292951 Rhizobium sp. CCGE 510 Isolate Nodule
21 2534681796 Rhizobium grahamii CCGE 502 Isolate Nodule
22 2582581298 Rhizobium alamii YR540 Isolate Rhizosphere
23 2582581866 Rhizobium sp. CF097 Isolate Rhizosphere
24 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
25 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
26 2585427528 Rhizobium leguminosarum CF307 Isolate Rhizosphere
27 2585427529 Rhizobium alamii YR584 Isolate Rhizosphere
28 2585427590 Rhizobium sp. CF048 Isolate Rhizosphere
29 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
30 2626541554 Frankia sp. AvcI.1 Isolate Nodule
31 2643221599 Rhizobium sp. Root708 Isolate Unclassified
32 2643221961 Aeromicrobium sp. Root236 Isolate Unclassified
33 2718217882 Rhizobium sp. N741 Isolate Nodule
34 2718218009 Rhizobium sp. N561 Isolate Nodule
35 2718218363 Rhizobium sp. N113 Isolate Nodule
36 2718218365 Rhizobium sp. N731 Isolate Nodule
37 2718218366 Rhizobium sp. N621 Isolate Nodule
38 2721755514 Rhizobium sp. N6212 Isolate Nodule
39 2721755810 Rhizobium sp. N871 Isolate Nodule
40 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
41 2728369365 Rhizobium sp. N1341 Isolate Nodule
42 2728369397 Rhizobium sp. N1314 Isolate Nodule
43 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
44 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
45 2791355260 Rhizobium sp. L9 Isolate Nodule
46 2791355264 Rhizobium sp. S9 Isolate Nodule
47 2802429605 Rhizobium sophoriradicis L101 Isolate Nodule
48 2802429633 Rhizobium anhuiense J3 Isolate Nodule
49 2802429634 Rhizobium anhuiense S10 Isolate Nodule
50 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
51 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
52 2802429637 Rhizobium anhuiense C15 Isolate Nodule
53 2838022645 Rhizobium aethiopicum SEMIA 4074 Isolate Nodule
54 2838668709 Rhizobium sophoriradicis SEMIA 403 Isolate Nodule
55 2838680041 Rhizobium leguminosarum SEMIA 415 Isolate Nodule
56 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
57 2838694306 Rhizobium leguminosarum SEMIA 421 Isolate Nodule
58 2838701080 Rhizobium aethiopicum SEMIA 428 Isolate Nodule
59 2838707686 Rhizobium leguminosarum SEMIA 430 Isolate Nodule
60 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
61 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
62 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
63 2842077413 Rhizobium leguminosarum SEMIA 422 Isolate Nodule
64 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
65 2842118031 Rhizobium esperanzae SEMIA 420 Isolate Nodule
66 2842146304 Rhizobium sophoriradicis SEMIA 454 Isolate Nodule
67 2842156927 Rhizobium leguminosarum SEMIA 459 Isolate Nodule
68 2842163707 Rhizobium leguminosarum SEMIA 460 Isolate Nodule
69 2842180545 Rhizobium leguminosarum SEMIA 463 Isolate Nodule
70 2842192696 Rhizobium esperanzae SEMIA 468 Isolate Nodule
71 2842198810 Rhizobium aethiopicum SEMIA 470 Isolate Nodule
72 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
73 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
74 2842237096 Rhizobium leguminosarum SEMIA 482 Isolate Nodule
75 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
76 2842250916 Rhizobium etli SEMIA 484 Isolate Nodule
77 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
78 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
79 2842291075 Rhizobium leguminosarum SEMIA 491 Isolate Nodule
80 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
81 2842370503 Rhizobium leguminosarum SEMIA 4022 Isolate Nodule
82 2842377471 Rhizobium leguminosarum SEMIA 4024 Isolate Nodule
83 2842384541 Rhizobium leguminosarum SEMIA 4025 Isolate Nodule
84 2842489311 Rhizobium sophoriradicis SEMIA 4061 Isolate Nodule
85 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
86 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
87 2862290372 Streptomyces triticagri NEAU-YY421 Isolate Rhizosphere
88 2884215851 Edaphobacter sp. 12200R-103 Isolate Rhizosphere
89 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
90 2923556063 Rhizobium tibeticum 3740 Isolate Unclassified
91 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
92 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
93 2935894831 Rhizobium leguminosarum SEMIA 419 Isolate Nodule
94 2935901341 Rhizobium leguminosarum SEMIA 4082 Isolate Nodule
95 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
96 2936375103 Rhizobium changzhiense WYCCWR 11317 Isolate Nodule
97 2996887358 Rhizobium sp. R711 Isolate Nodule
98 2996893221 Rhizobium sp. R635 Isolate Nodule
99 3002141150 Phyllobacterium sp. 628 Isolate Unclassified
100 3005452660 Rhizobium grahamii BG7 Isolate Unclassified
101 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
102 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
103 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
104 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
105 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
106 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
107 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
108 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
109 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
110 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
111 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
112 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
113 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
114 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
115 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
116 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
117 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
118 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
119 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
120 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
121 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
122 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
123 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
124 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
125 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
126 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
127 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
128 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
129 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
130 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
131 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
132 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
133 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
134 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
135 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
136 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
137 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
138 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
139 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
140 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
141 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
142 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
143 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
144 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
145 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
146 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
147 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
148 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
149 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
150 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
151 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
152 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
153 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
154 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
155 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
156 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
157 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
158 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
159 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
160 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
161 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
162 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
163 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
164 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
165 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
166 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
167 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
168 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
169 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
170 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
171 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
172 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
173 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
174 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
175 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
176 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
177 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
178 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
179 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
180 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
181 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
182 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
183 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
184 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
185 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
186 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
187 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
188 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
189 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
190 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
191 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
192 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
193 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
194 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
195 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
196 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
197 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
198 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
199 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
200 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
201 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
202 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
203 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
204 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
205 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
206 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
207 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
208 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
209 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
210 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
211 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
212 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
213 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
214 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
215 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
216 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
217 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
218 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
219 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
220 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
221 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
222 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
223 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
224 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
225 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
226 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
227 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
228 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
229 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
230 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
231 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
232 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
233 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
234 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
235 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
236 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
237 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
238 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
239 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
240 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
241 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
242 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
243 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
244 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
245 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
246 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
247 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
248 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
249 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
250 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
251 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
252 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
253 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
254 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
255 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
256 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
257 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
258 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
259 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
260 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
261 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
262 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
263 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
264 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
265 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
266 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
267 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
268 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
269 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
270 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
271 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
272 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
273 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
274 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
275 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
276 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
277 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
278 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
279 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
280 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
281 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
282 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
283 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
284 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
285 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
286 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
287 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
288 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
289 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
290 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
291 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
292 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
293 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
294 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
295 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
296 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
297 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
298 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
299 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
300 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
301 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
302 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
303 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
304 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
305 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
306 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
307 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
308 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
309 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
310 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
311 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
312 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
313 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
314 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
315 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
316 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
317 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
318 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
319 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
320 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
321 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
322 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
323 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
324 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
325 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
326 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
327 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
328 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
329 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
330 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
331 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
332 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
333 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
334 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
335 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
336 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
337 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
338 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
339 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
340 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
341 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
342 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
343 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
344 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
345 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
346 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
347 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
348 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
349 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
350 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
351 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
352 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
353 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
354 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
355 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
356 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
357 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
358 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
359 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
360 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
361 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
362 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
363 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
364 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
365 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
366 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
367 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
368 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
369 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
370 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
371 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
372 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
373 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
374 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
375 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
376 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
377 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
378 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
379 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
380 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
381 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
382 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
383 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
384 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
385 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
386 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
387 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
388 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
389 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
390 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
391 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
392 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
393 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
394 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
395 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
396 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
397 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
398 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
399 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
400 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
401 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
402 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
403 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
404 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
405 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
406 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
407 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
408 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
409 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
410 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
411 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
412 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
413 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
414 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
415 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
416 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
417 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
418 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
419 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
420 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
421 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
422 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
423 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
424 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
425 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
426 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
427 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
428 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
429 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
430 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
431 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
432 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
433 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
434 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
435 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
436 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
437 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
438 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
439 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
440 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
441 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
442 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
443 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
444 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
445 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
446 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
447 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
448 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
449 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
450 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
451 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
452 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
453 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
454 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
455 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
456 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
457 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
458 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
459 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
460 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
461 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
462 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
463 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
464 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
465 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
466 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
467 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
468 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
469 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
470 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
471 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
472 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
473 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
474 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
475 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
476 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
477 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
478 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
479 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
480 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
481 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
482 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
483 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
484 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
485 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
486 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
487 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
488 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
489 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
490 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
491 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
492 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
493 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
494 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
495 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
496 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
497 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
498 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
499 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
500 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
501 8005307578 Rhizobium leguminosarum bv. phaseoli LCS0306 Isolate Unclassified
502 8005321885 Rhizobium sp. R72 Isolate Nodule
503 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
504 8005460587 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
505 8005556819 Rhizobium sp. WYCCWR 11128 Isolate Nodule
506 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
507 8005570704 Rhizobium anhuiense bv. trifolii WYCCWR10015 Isolate Nodule
508 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule
509 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule
510 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule
511 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 87.1
Metatranscriptomes 0.55
Isolates 12.35

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.46
Nodule 9.92
Rhizoplane 5.07
Rhizosphere 65.16
Stem 0
Stem Tuber 0
Unclassified 7.39

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25158J39367_1001249 3300002739 Bacteria 4549
2 JGI25159J45721_1005399 3300002987 Bacteria 4018
3 JGI25153J46596_10006039 3300003215 Bacteria 6224
4 JGI25153J46596_10021365 3300003215 Bacteria 2414
5 JGI25160J50197_1001537 3300003354 Bacteria 11423
6 JGI25160J50197_1029600 3300003354 Bacteria 1444
7 JGI25161J50226_1000463 3300003374 Bacteria 18654
8 JGI25161J50226_1008346 3300003374 Bacteria 1606
9 Ga0055526_1003736 3300003771 Bacteria 9505
10 Ga0055526_1012487 3300003771 Bacteria 3697
11 Ga0055524_1006013 3300003775 Bacteria 5328
12 Ga0055528_1011201 3300003790 Bacteria 3583
13 Ga0055528_1035642 3300003790 Bacteria 1204
14 Ga0055540_1002996 3300003792 Bacteria 8457
15 Ga0055540_1023510 3300003792 Bacteria 1551
16 Ga0055543_1000021 3300004625 Bacteria 150116
17 Ga0055543_1000591 3300004625 Bacteria 19944
18 Ga0065165_1002401 3300005262 Bacteria 16003
19 Ga0065712_10164627 3300005290 Bacteria 1280
20 Ga0070658_10006016 3300005327 Bacteria 9843
21 Ga0070658_10076404 3300005327 Bacteria 2747
22 Ga0070683_100152100 3300005329 Bacteria 2194
23 Ga0070683_100338461 3300005329 Unclassified 1433
24 Ga0070690_100753207 3300005330 Bacteria 752
25 Ga0068869_100019939 3300005334 Bacteria 4591
26 Ga0068869_100047278 3300005334 Bacteria 3107
27 Ga0068869_100152072 3300005334 Bacteria 1796
28 Ga0070666_10190980 3300005335 Bacteria 1439
29 Ga0070680_100086284 3300005336 Bacteria 2594
30 Ga0070660_100032812 3300005339 Bacteria 3911
31 Ga0070668_100358640 3300005347 Bacteria 1236
32 Ga0070669_100769514 3300005353 Unclassified 817
33 Ga0070675_100291754 3300005354 Bacteria 1435
34 Ga0070675_100622863 3300005354 Bacteria 980
35 Ga0070671_101612622 3300005355 Bacteria 575
36 Ga0070659_101465187 3300005366 Bacteria 608
37 Ga0070714_100095478 3300005435 Bacteria 2611
38 Ga0070714_100137393 3300005435 Bacteria 2190
39 Ga0070713_100396104 3300005436 Bacteria 1289
40 Ga0070713_101384098 3300005436 Bacteria 682
41 Ga0070711_100002332 3300005439 Bacteria 10785
42 Ga0070711_100674830 3300005439 Unclassified 868
43 Ga0070705_100479682 3300005440 Bacteria 939
44 Ga0070663_100667365 3300005455 Bacteria 881
45 Ga0070663_100969648 3300005455 Bacteria 738
46 Ga0070663_102101182 3300005455 Bacteria 509
47 Ga0070678_100015069 3300005456 Bacteria 4901
48 Ga0070662_100145660 3300005457 Bacteria 1839
49 Ga0070681_10057249 3300005458 Bacteria 3878
50 Ga0070681_10077610 3300005458 Bacteria 3279
51 Ga0070681_10242083 3300005458 Bacteria 1717
52 Ga0068867_100941102 3300005459 Bacteria 780
53 Ga0070706_100007435 3300005467 Bacteria 10273
54 Ga0070707_100279434 3300005468 Bacteria 1623
55 Ga0070707_101422746 3300005468 Bacteria 660
56 Ga0070698_100639517 3300005471 Bacteria 1005
57 Ga0070699_100299395 3300005518 Bacteria 1443
58 Ga0070699_100397347 3300005518 Bacteria 1246
59 Ga0070679_100026849 3300005530 Bacteria 5663
60 Ga0070679_100084582 3300005530 Bacteria 3160
61 Ga0070679_100499093 3300005530 Bacteria 1161
62 Ga0070679_101736848 3300005530 Bacteria 572
63 Ga0070684_100036209 3300005535 Bacteria 4228
64 Ga0070684_100168617 3300005535 Bacteria 1988
65 Ga0070684_100644409 3300005535 Bacteria 986
66 Ga0070697_100313233 3300005536 Bacteria 1351
67 Ga0070697_100865924 3300005536 Bacteria 801
68 Ga0068853_100456012 3300005539 Bacteria 1203
69 Ga0068853_101391586 3300005539 Bacteria 678
70 Ga0070686_100420663 3300005544 Bacteria 1021
71 Ga0070665_100000728 3300005548 Bacteria 43882
72 Ga0070665_100000791 3300005548 Bacteria 41601
73 Ga0070665_100298875 3300005548 Bacteria 1612
74 Ga0070665_100469893 3300005548 Bacteria 1268
75 Ga0068855_100008482 3300005563 Bacteria 12423
76 Ga0068855_100028847 3300005563 Bacteria 6640
77 Ga0068855_100229948 3300005563 Bacteria 2077
78 Ga0068855_100383538 3300005563 Bacteria 1543
79 Ga0068855_100422172 3300005563 Bacteria 1458
80 Ga0068855_101137067 3300005563 Bacteria 815
81 Ga0070664_101163525 3300005564 Unclassified 727
82 Ga0068857_100029109 3300005577 Bacteria 4874
83 Ga0068857_100067585 3300005577 Bacteria 3181
84 Ga0068854_100467312 3300005578 Bacteria 1057
85 Ga0068856_100465624 3300005614 Unclassified 1285
86 Ga0068856_101192112 3300005614 Bacteria 778
87 Ga0068856_101920824 3300005614 Bacteria 603
88 Ga0068852_100382396 3300005616 Bacteria 1381
89 Ga0068852_100730430 3300005616 Bacteria 1002
90 Ga0068859_100118930 3300005617 Bacteria 2708
91 Ga0068859_100212397 3300005617 Bacteria 2021
92 Ga0068864_100023676 3300005618 Bacteria 5159
93 Ga0068864_100068003 3300005618 Bacteria 3094
94 Ga0068864_100229661 3300005618 Unclassified 1716
95 Ga0068861_100337047 3300005719 Bacteria 1319
96 Ga0068870_10127815 3300005840 Bacteria 1472
97 Ga0068863_100002809 3300005841 Bacteria 17251
98 Ga0068863_100113646 3300005841 Unclassified 2579
99 Ga0068863_101303125 3300005841 Unclassified 733
100 Ga0068858_100046662 3300005842 Bacteria 4016
101 Ga0068858_100074409 3300005842 Bacteria 3154
102 Ga0068858_100698504 3300005842 Bacteria 987
103 Ga0068860_100102994 3300005843 Bacteria 2724
104 Ga0068862_100076450 3300005844 Bacteria 2898
105 Ga0068862_100122152 3300005844 Unclassified 2296
106 Ga0081455_10225778 3300005937 Bacteria 1385
107 Ga0081455_10291286 3300005937 Bacteria 1175
108 Ga0081539_10004015 3300005985 Bacteria 16914
109 Ga0081539_10010322 3300005985 Bacteria 7604
110 Ga0081539_10028448 3300005985 Bacteria 3514
111 Ga0070717_11317747 3300006028 Bacteria 656
112 Ga0075365_10016164 3300006038 Bacteria 4531
113 Ga0075365_10089833 3300006038 Bacteria 2092
114 Ga0075365_10197780 3300006038 Bacteria 1408
115 Ga0075368_10142881 3300006042 Bacteria 998
116 Ga0075368_10271186 3300006042 Bacteria 728
117 Ga0075363_100299148 3300006048 Bacteria 933
118 Ga0075364_10034376 3300006051 Bacteria 3269
119 Ga0070715_10002024 3300006163 Bacteria 6113
120 Ga0070716_100003137 3300006173 Bacteria 7726
121 Ga0070716_100274077 3300006173 Bacteria 1161
122 Ga0070716_100720123 3300006173 Bacteria 764
123 Ga0070712_100000811 3300006175 Bacteria 18572
124 Ga0070712_100004288 3300006175 Bacteria 8783
125 Ga0070712_100048063 3300006175 Bacteria 2956
126 Ga0075362_10176267 3300006177 Bacteria 1034
127 Ga0075367_10037081 3300006178 Bacteria 2830
128 Ga0075367_10054071 3300006178 Bacteria 2380
129 Ga0075367_10074206 3300006178 Bacteria 2051
130 Ga0075367_10133979 3300006178 Bacteria 1532
131 Ga0075367_10534822 3300006178 Bacteria 744
132 Ga0075366_10013745 3300006195 Bacteria 4612
133 Ga0075366_10058999 3300006195 Bacteria 2279
134 Ga0075366_10177987 3300006195 Bacteria 1291
135 Ga0097621_100494068 3300006237 Bacteria 1108
136 Ga0075370_10011541 3300006353 Bacteria 4646
137 Ga0075370_10168720 3300006353 Bacteria 1286
138 Ga0075370_10299398 3300006353 Bacteria 956
139 Ga0068871_100463377 3300006358 Bacteria 1138
140 Ga0075428_100605178 3300006844 Bacteria 1170
141 Ga0075430_100937093 3300006846 Unclassified 713
142 Ga0075431_100098700 3300006847 Bacteria 3015
143 Ga0075431_100371664 3300006847 Bacteria 1435
144 Ga0075433_10001208 3300006852 Bacteria 18831
145 Ga0075433_10012335 3300006852 Bacteria 6897
146 Ga0075433_10028698 3300006852 Bacteria 4733
147 Ga0075433_11233745 3300006852 Bacteria 648
148 Ga0075434_100003941 3300006871 Bacteria 13299
149 Ga0075434_100011264 3300006871 Bacteria 8424
150 Ga0075434_100040251 3300006871 Bacteria 4629
151 Ga0075434_100052129 3300006871 Bacteria 4065
152 Ga0075434_100056525 3300006871 Bacteria 3900
153 Ga0075434_100373812 3300006871 Bacteria 1446
154 Ga0075429_100088861 3300006880 Bacteria 2693
155 Ga0068865_100108053 3300006881 Bacteria 2047
156 Ga0068865_100346794 3300006881 Bacteria 1202
157 Ga0097620_100118945 3300006931 Bacteria 2708
158 Ga0097620_100212395 3300006931 Bacteria 2021
159 Ga0075435_100022058 3300007076 Bacteria 4908
160 Ga0075435_100130969 3300007076 Bacteria 2099
161 Ga0075435_100466990 3300007076 Bacteria 1089
162 Ga0099794_10003779 3300007265 Bacteria 5840
163 Ga0105251_10014997 3300009011 Bacteria 4252
164 Ga0105240_10000236 3300009093 Bacteria 110204
165 Ga0105240_10027757 3300009093 Bacteria 7409
166 Ga0105240_10146629 3300009093 Bacteria 2816
167 Ga0105240_10694477 3300009093 Bacteria 1111
168 Ga0105240_11205953 3300009093 Bacteria 801
169 Ga0111539_11753926 3300009094 Bacteria 720
170 Ga0105245_10680151 3300009098 Bacteria 1061
171 Ga0105245_11250084 3300009098 Bacteria 791
172 Ga0114129_10001748 3300009147 Bacteria 29570
173 Ga0114129_10184658 3300009147 Bacteria 2835
174 Ga0114129_10198599 3300009147 Bacteria 2718
175 Ga0114129_10499196 3300009147 Bacteria 1590
176 Ga0105243_10057884 3300009148 Bacteria 3088
177 Ga0105243_12015925 3300009148 Bacteria 612
178 Ga0105241_10614057 3300009174 Bacteria 984
179 Ga0105242_10276255 3300009176 Bacteria 1524
180 Ga0105242_10431605 3300009176 Bacteria 1237
181 Ga0105248_10057210 3300009177 Bacteria 4376
182 Ga0105248_10225927 3300009177 Bacteria 2107
183 Ga0105237_10102750 3300009545 Bacteria 2850
184 Ga0105237_10121540 3300009545 Bacteria 2606
185 Ga0105237_10148699 3300009545 Bacteria 2338
186 Ga0105237_10365467 3300009545 Bacteria 1447
187 Ga0105237_10792101 3300009545 Bacteria 955
188 Ga0105238_10018641 3300009551 Bacteria 7067
189 Ga0105238_10681464 3300009551 Bacteria 1039
190 Ga0105238_10706887 3300009551 Bacteria 1020
191 Ga0105238_11721024 3300009551 Bacteria 658
192 Ga0105249_10082992 3300009553 Bacteria 2982
193 Ga0105249_10135024 3300009553 Unclassified 2360
194 Ga0105249_10419582 3300009553 Bacteria 1371
195 Ga0105239_10121061 3300010375 Bacteria 2906
196 Ga0105239_10995605 3300010375 Bacteria 964
197 Ga0105239_11295452 3300010375 Bacteria 840
198 Ga0105239_11369391 3300010375 Bacteria 817
199 Ga0105246_10014526 3300011119 Bacteria 4953
200 Ga0105246_10726432 3300011119 Bacteria 873
201 Ga0157371_10146701 3300013102 Bacteria 1681
202 Ga0157371_10865301 3300013102 Bacteria 684
203 Ga0157370_10007688 3300013104 Bacteria 11695
204 Ga0157370_10034135 3300013104 Bacteria 4957
205 Ga0157370_10250016 3300013104 Bacteria 1640
206 Ga0157370_10619621 3300013104 Bacteria 990
207 Ga0157374_10079900 3300013296 Bacteria 3100
208 Ga0163162_10157402 3300013306 Bacteria 2392
209 Ga0157372_10197434 3300013307 Bacteria 2330
210 Ga0157372_10282003 3300013307 Unclassified 1931
211 Ga0157372_10365459 3300013307 Bacteria 1681
212 Ga0157375_10100228 3300013308 Bacteria 2977
213 Ga0157375_10189132 3300013308 Bacteria 2213
214 Ga0157375_10241809 3300013308 Bacteria 1965
215 Ga0157375_10252261 3300013308 Bacteria 1925
216 Ga0163163_10024959 3300014325 Bacteria 5692
217 Ga0163163_10030962 3300014325 Bacteria 5160
218 Ga0163163_10533614 3300014325 Bacteria 1236
219 Ga0163163_11049830 3300014325 Bacteria 878
220 Ga0163163_11060929 3300014325 Bacteria 873
221 Ga0163163_12210481 3300014325 Bacteria 609
222 Ga0157377_10113719 3300014745 Unclassified 1630
223 Ga0157379_10021508 3300014968 Bacteria 5710
224 Ga0157379_10146089 3300014968 Bacteria 2132
225 Ga0157379_10630833 3300014968 Bacteria 1002
226 Ga0157379_10962201 3300014968 Bacteria 812
227 Ga0197907_11104677 3300020069 Bacteria 701
228 Ga0206356_10551594 3300020070 Bacteria 698
229 Ga0206350_10448529 3300020080 Bacteria 936
230 Ga0206353_11551518 3300020082 Bacteria 783
231 Ga0213875_10181766 3300021388 Bacteria 988
232 Ga0224712_10140603 3300022467 Bacteria 1062
233 Ga0209436_100004 3300025208 Bacteria 196698
234 Ga0207425_1000736 3300025245 Bacteria 17202
235 Ga0207425_1003419 3300025245 Bacteria 5088
236 Ga0209129_1000622 3300025258 Bacteria 23811
237 Ga0209129_1008265 3300025258 Bacteria 2922
238 Ga0209673_1002989 3300025273 Bacteria 10528
239 Ga0209673_1011979 3300025273 Bacteria 3530
240 Ga0209673_1019500 3300025273 Bacteria 2432
241 Ga0209130_1000001 3300025284 Bacteria 831557
242 Ga0209675_1048502 3300025291 Bacteria 888
243 Ga0209676_1080480 3300025292 Bacteria 744
244 Ga0209025_1000072 3300025294 Bacteria 283452
245 Ga0209025_1008821 3300025294 Bacteria 7164
246 Ga0209025_1077979 3300025294 Bacteria 1139
247 Ga0209564_1001641 3300025295 Bacteria 21606
248 Ga0209564_1001805 3300025295 Bacteria 19744
249 Ga0209564_1002167 3300025295 Bacteria 16556
250 Ga0209758_1000053 3300025297 Bacteria 337751
251 Ga0209758_1003660 3300025297 Bacteria 13697
252 Ga0209758_1005280 3300025297 Bacteria 10097
253 Ga0209758_1006260 3300025297 Bacteria 8663
254 Ga0209758_1036886 3300025297 Bacteria 1899
255 Ga0209758_1146557 3300025297 Bacteria 605
256 Ga0209256_1008889 3300025299 Bacteria 4534
257 Ga0209256_1012955 3300025299 Bacteria 3135
258 Ga0209256_1033728 3300025299 Bacteria 1372
259 Ga0207426_1000005 3300025302 Bacteria 1037188
260 Ga0207426_1000035 3300025302 Bacteria 448327
261 Ga0209051_1004166 3300025303 Bacteria 9037
262 Ga0209051_1012390 3300025303 Bacteria 4127
263 Ga0209051_1022802 3300025303 Bacteria 2624
264 Ga0209051_1040134 3300025303 Bacteria 1681
265 Ga0209257_1021221 3300025304 Bacteria 2368
266 Ga0207642_10069267 3300025899 Bacteria 1672
267 Ga0207710_10131906 3300025900 Bacteria 1200
268 Ga0207685_10029134 3300025905 Bacteria 1951
269 Ga0207699_10025679 3300025906 Bacteria 3237
270 Ga0207699_10129378 3300025906 Bacteria 1644
271 Ga0207645_10130102 3300025907 Bacteria 1638
272 Ga0207705_10010749 3300025909 Bacteria 6645
273 Ga0207705_10033327 3300025909 Bacteria 3679
274 Ga0207705_10254393 3300025909 Bacteria 1340
275 Ga0207684_10023669 3300025910 Bacteria 5243
276 Ga0207707_10047727 3300025912 Bacteria 3729
277 Ga0207707_10052017 3300025912 Bacteria 3567
278 Ga0207707_10121000 3300025912 Bacteria 2289
279 Ga0207707_10266303 3300025912 Bacteria 1486
280 Ga0207707_10361175 3300025912 Unclassified 1250
281 Ga0207695_10001342 3300025913 Bacteria 41747
282 Ga0207695_10008466 3300025913 Bacteria 12875
283 Ga0207695_10181605 3300025913 Bacteria 2025
284 Ga0207695_10583333 3300025913 Bacteria 999
285 Ga0207671_10257114 3300025914 Bacteria 1374
286 Ga0207693_10007740 3300025915 Bacteria 8818
287 Ga0207693_10042995 3300025915 Bacteria 3557
288 Ga0207693_10156613 3300025915 Bacteria 1792
289 Ga0207663_10012062 3300025916 Bacteria 4660
290 Ga0207663_10087480 3300025916 Bacteria 2058
291 Ga0207660_10075463 3300025917 Bacteria 2463
292 Ga0207662_10014961 3300025918 Bacteria 4358
293 Ga0207662_10566934 3300025918 Bacteria 787
294 Ga0207657_10042626 3300025919 Bacteria 4002
295 Ga0207652_10052481 3300025921 Bacteria 3499
296 Ga0207652_10359455 3300025921 Bacteria 1314
297 Ga0207652_10725081 3300025921 Bacteria 886
298 Ga0207646_10028312 3300025922 Bacteria 5102
299 Ga0207646_10044882 3300025922 Bacteria 3967
300 Ga0207646_10047226 3300025922 Bacteria 3862
301 Ga0207681_10255482 3300025923 Bacteria 1370
302 Ga0207681_10958131 3300025923 Bacteria 717
303 Ga0207694_10080762 3300025924 Bacteria 2552
304 Ga0207694_10100228 3300025924 Bacteria 2294
305 Ga0207650_10353637 3300025925 Bacteria 1209
306 Ga0207659_10235378 3300025926 Bacteria 1479
307 Ga0207659_11133907 3300025926 Bacteria 673
308 Ga0207700_10172853 3300025928 Bacteria 1804
309 Ga0207700_10538849 3300025928 Bacteria 1035
310 Ga0207700_10636868 3300025928 Bacteria 950
311 Ga0207700_10941549 3300025928 Bacteria 773
312 Ga0207664_10189038 3300025929 Bacteria 1772
313 Ga0207664_10203727 3300025929 Bacteria 1709
314 Ga0207644_10006295 3300025931 Bacteria 7730
315 Ga0207690_10221404 3300025932 Bacteria 1448
316 Ga0207690_10260348 3300025932 Bacteria 1344
317 Ga0207706_10123463 3300025933 Bacteria 2278
318 Ga0207706_10238832 3300025933 Bacteria 1589
319 Ga0207669_10207959 3300025937 Bacteria 1426
320 Ga0207704_10173973 3300025938 Bacteria 1548
321 Ga0207704_10427062 3300025938 Bacteria 1052
322 Ga0207704_10518823 3300025938 Bacteria 963
323 Ga0207665_10006502 3300025939 Bacteria 7748
324 Ga0207665_10154841 3300025939 Bacteria 1644
325 Ga0207691_10706598 3300025940 Bacteria 850
326 Ga0207711_10241084 3300025941 Bacteria 1658
327 Ga0207711_10402706 3300025941 Bacteria 1272
328 Ga0207711_10825449 3300025941 Bacteria 863
329 Ga0207689_10096486 3300025942 Bacteria 2428
330 Ga0207689_10096567 3300025942 Bacteria 2427
331 Ga0207689_10113796 3300025942 Bacteria 2224
332 Ga0207661_10192740 3300025944 Bacteria 1788
333 Ga0207661_11138195 3300025944 Unclassified 718
334 Ga0207679_10456244 3300025945 Bacteria 1134
335 Ga0207679_10920749 3300025945 Unclassified 800
336 Ga0207667_10042630 3300025949 Bacteria 4822
337 Ga0207667_10324169 3300025949 Bacteria 1573
338 Ga0207667_10324704 3300025949 Bacteria 1572
339 Ga0207667_11370360 3300025949 Unclassified 681
340 Ga0207651_10489016 3300025960 Bacteria 1062
341 Ga0207712_10107157 3300025961 Unclassified 2089
342 Ga0207712_11303352 3300025961 Bacteria 649
343 Ga0207668_10299870 3300025972 Bacteria 1326
344 Ga0207658_10336268 3300025986 Bacteria 1311
345 Ga0207703_10017685 3300026035 Bacteria 5566
346 Ga0207703_10083515 3300026035 Bacteria 2669
347 Ga0207639_10489589 3300026041 Bacteria 1122
348 Ga0207678_10207851 3300026067 Bacteria 1674
349 Ga0207678_10264635 3300026067 Bacteria 1474
350 Ga0207678_10717776 3300026067 Bacteria 880
351 Ga0207678_10968642 3300026067 Bacteria 753
352 Ga0207708_10043077 3300026075 Bacteria 3440
353 Ga0207702_10080335 3300026078 Bacteria 2829
354 Ga0207702_10390682 3300026078 Unclassified 1340
355 Ga0207641_10007276 3300026088 Bacteria 9221
356 Ga0207641_10155165 3300026088 Bacteria 2076
357 Ga0207641_10179393 3300026088 Bacteria 1939
358 Ga0207648_10038978 3300026089 Bacteria 4179
359 Ga0207648_10118613 3300026089 Bacteria 2325
360 Ga0207648_10925622 3300026089 Bacteria 815
361 Ga0207676_10115941 3300026095 Unclassified 2250
362 Ga0207676_10633666 3300026095 Bacteria 1030
363 Ga0207674_10006588 3300026116 Bacteria 13651
364 Ga0207674_10075071 3300026116 Bacteria 3391
365 Ga0207674_10103624 3300026116 Bacteria 2824
366 Ga0207674_11747576 3300026116 Bacteria 590
367 Ga0207675_100062979 3300026118 Bacteria 3465
368 Ga0207675_100154707 3300026118 Bacteria 2184
369 Ga0207683_10081047 3300026121 Unclassified 2880
370 Ga0207698_10302307 3300026142 Bacteria 1490
371 Ga0209588_1005097 3300027671 Bacteria 3743
372 Ga0209813_10096829 3300027866 Bacteria 998
373 Ga0268266_10000385 3300028379 Bacteria 67236
374 Ga0268266_10005306 3300028379 Bacteria 12083
375 Ga0268266_10184131 3300028379 Bacteria 1903
376 Ga0268266_10263218 3300028379 Bacteria 1599
377 Ga0268264_10522491 3300028381 Bacteria 1161
378 Ga0268264_10683321 3300028381 Bacteria 1018
379 Ga0265319_1056801 3300028563 Bacteria 1278
380 Ga0307515_10006687 3300028794 Bacteria 22962
381 Ga0307515_10020927 3300028794 Bacteria 11627
382 Ga0307515_10608019 3300028794 Bacteria 704
383 Ga0265338_10045794 3300028800 Bacteria 4018
384 Ga0265338_10047201 3300028800 Bacteria 3936
385 Ga0265332_10014480 3300031238 Bacteria 3489
386 Ga0265320_10186864 3300031240 Bacteria 927
387 Ga0265325_10085388 3300031241 Bacteria 1564
388 Ga0265331_10074271 3300031250 Bacteria 1587
389 Ga0307513_10006532 3300031456 Bacteria 15229
390 Ga0307513_10017597 3300031456 Bacteria 8568
391 Ga0307513_10539324 3300031456 Bacteria 880
392 Ga0307513_10707989 3300031456 Bacteria 713
393 Ga0265313_10100213 3300031595 Bacteria 1286
394 Ga0307508_10068897 3300031616 Bacteria 3108
395 Ga0307508_10226654 3300031616 Bacteria 1468
396 Ga0265314_10030808 3300031711 Bacteria 3967
397 Ga0307405_10911815 3300031731 Bacteria 744
398 Ga0307406_10775090 3300031901 Bacteria 807
399 Ga0307407_10083629 3300031903 Bacteria 1937
400 Ga0307409_100084839 3300031995 Bacteria 2573
401 Ga0307414_10865539 3300032004 Bacteria 827
402 Ga0307415_100230230 3300032126 Bacteria 1492
403 Ga0307415_101891550 3300032126 Bacteria 579
404 Ga0373923_0024781 3300035111 Bacteria 2371
405 Ga0373936_0128281 3300035113 Bacteria 1088
406 Ga0373953_0102334 3300035117 Bacteria 1206
407 Ga0373953_0205047 3300035117 Bacteria 853
408 Ga0373956_0258275 3300035119 Bacteria 828
409 Ga0373943_0135228 3300035170 Bacteria 1323
410 Ga0373943_0419323 3300035170 Bacteria 774
411 Ga0373955_0239248 3300035172 Bacteria 1087
412 Ga0373935_0041914 3300035692 Bacteria 2877
413 Ga0373935_0223968 3300035692 Bacteria 1307
414 Ga0373935_1121596 3300035692 Bacteria 586
415 Ga0395899_0075022 3300037312 Bacteria 2470
416 Ga0395900_0039256 3300037418 Bacteria 4878
417 Ga0395900_0643559 3300037418 Bacteria 997
418 Ga0395900_0684649 3300037418 Bacteria 960
419 Ga0395898_0029479 3300037466 Bacteria 5497
420 Ga0395898_0074177 3300037466 Bacteria 3287
421 Ga0395898_0270911 3300037466 Bacteria 1619
422 Ga0395898_0944145 3300037466 Bacteria 800
423 Ga0395898_1223131 3300037466 Bacteria 682
424 Ga0395905_0068863 3300037471 Bacteria 3315
425 Ga0436364_1105312 3300037853 Bacteria 2417
426 Ga0395901_0008223 3300038443 Bacteria 10541
427 Ga0395901_0010855 3300038443 Bacteria 9233
428 Ga0395901_0027274 3300038443 Bacteria 5867
429 Ga0395901_0075917 3300038443 Bacteria 3506
430 Ga0395901_0843184 3300038443 Bacteria 902
431 Ga0439465_0044599 3300041413 Bacteria 1441
432 Ga0439465_0074331 3300041413 Bacteria 1143
433 Ga0451795_0515187 3300041456 Bacteria 1107
434 Ga0451798_0628373 3300041458 Bacteria 580
435 Ga0451802_0018767 3300041460 Bacteria 1026
436 Ga0451833_0039522 3300041491 Bacteria 552
437 Ga0451835_1244665 3300041492 Bacteria 1175
438 Ga0451837_0636900 3300041494 Bacteria 4002
439 Ga0451837_0648854 3300041494 Bacteria 727
440 Ga0451839_1217916 3300041496 Bacteria 3006
441 Ga0451841_0208921 3300041498 Bacteria 5583
442 Ga0451841_1433549 3300041498 Bacteria 665
443 Ga0451847_0291403 3300041503 Bacteria 1031
444 Ga0451847_0548471 3300041503 Bacteria 1045
445 Ga0451847_0810882 3300041503 Bacteria 1161
446 Ga0451849_1042723 3300041505 Bacteria 1849
447 Ga0451849_1232725 3300041505 Bacteria 727
448 Ga0451851_0003858 3300041507 Bacteria 1758
449 Ga0451855_0798708 3300041511 Bacteria 2535
450 Ga0451855_1111775 3300041511 Bacteria 2740
451 Ga0451853_1646649 3300041512 Bacteria 1175
452 Ga0451853_3517822 3300041512 Bacteria 1143
453 Ga0439449_0070506 3300042007 Bacteria 1288
454 Ga0466969_0046389 3300044656 Bacteria 2155
455 Ga0466961_0140369 3300044693 Bacteria 1513
456 Ga0466963_0015037 3300044694 Bacteria 4784
457 Ga0466963_0036049 3300044694 Bacteria 3224
458 Ga0466963_0949590 3300044694 Bacteria 606
459 Ga0453684_0270104 3300044712 Unclassified 1944
460 Ga0466971_0034965 3300044719 Bacteria 2252
461 Ga0466957_0033468 3300044842 Bacteria 3084
462 Ga0466957_1071136 3300044842 Bacteria 581
463 Ga0466959_0084002 3300045049 Bacteria 2292
464 Ga0451576_0258571 3300045051 Unclassified 1820
465 Ga0466958_0167808 3300045836 Bacteria 1389
466 Ga0466967_0501224 3300045976 Bacteria 1191
467 Ga0466967_1431975 3300045976 Bacteria 688
468 Ga0466967_1545306 3300045976 Bacteria 661
469 Ga0495592_0442873 3300046454 Bacteria 815
470 Ga0495603_0370783 3300046455 Bacteria 821
471 Ga0495590_0113032 3300046457 Bacteria 970
472 Ga0495629_0177464 3300046459 Bacteria 1477
473 Ga0495638_0047808 3300046460 Bacteria 2681
474 Ga0495641_0068198 3300046461 Bacteria 1599
475 Ga0495651_0120370 3300046462 Bacteria 1929
476 Ga0495650_0050972 3300046471 Bacteria 1708
477 Ga0495580_0088261 3300046472 Unclassified 2160
478 Ga0495580_0475582 3300046472 Bacteria 836
479 Ga0495582_0469804 3300046473 Bacteria 727
480 Ga0495582_0624869 3300046473 Bacteria 623
481 Ga0495605_0131350 3300046474 Bacteria 1129
482 Ga0495662_0260710 3300046476 Bacteria 853
483 Ga0495664_0079021 3300046477 Bacteria 1971
484 Ga0495664_0167618 3300046477 Bacteria 1332
485 Ga0495664_0346476 3300046477 Bacteria 895
486 Ga0495584_0177050 3300046491 Bacteria 1084
487 Ga0495585_0039212 3300046492 Bacteria 2663
488 Ga0495594_0561719 3300046499 Unclassified 647
489 Ga0495596_0164197 3300046500 Bacteria 863
490 Ga0495607_0133769 3300046501 Bacteria 1287
491 Ga0495583_0024919 3300046506 Bacteria 2997
492 Ga0495606_0026405 3300046507 Bacteria 4140
493 Ga0495606_0159510 3300046507 Bacteria 1317
494 Ga0495608_0030457 3300046511 Bacteria 3653
495 Ga0495610_0009978 3300046512 Bacteria 5938
496 Ga0495610_0025500 3300046512 Bacteria 3171
497 Ga0495618_0138541 3300046514 Bacteria 1556
498 Ga0495628_0016355 3300046516 Bacteria 6189
499 Ga0495628_0041503 3300046516 Bacteria 3673
500 Ga0495630_0017664 3300046517 Bacteria 5228
501 Ga0495632_0029055 3300046519 Bacteria 2882
502 Ga0495632_0053879 3300046519 Bacteria 1973
503 Ga0495643_0082069 3300046522 Bacteria 1675
504 Ga0495643_0088869 3300046522 Bacteria 1596
505 Ga0495648_0044019 3300046524 Bacteria 2790
506 Ga0495666_0067286 3300046526 Bacteria 1707
507 Ga0495652_0270806 3300046529 Bacteria 1248
508 Ga0495652_0790292 3300046529 Bacteria 632
509 Ga0495665_0113047 3300046531 Bacteria 1424
510 Ga0495665_0192125 3300046531 Bacteria 1059
511 Ga0495640_0037607 3300046533 Bacteria 3413
512 Ga0495640_0141839 3300046533 Bacteria 1548
513 Ga0495640_0607472 3300046533 Bacteria 660
514 Ga0495586_0770474 3300046535 Bacteria 555
515 Ga0495609_0032374 3300046538 Bacteria 2375
516 Ga0495645_0020314 3300046543 Bacteria 4789
517 Ga0495645_0067316 3300046543 Bacteria 2586
518 Ga0495645_0310305 3300046543 Bacteria 1027
519 Ga0495645_0396895 3300046543 Bacteria 880
520 Ga0495633_0027211 3300046558 Bacteria 2796
521 Ga0495667_0024475 3300046559 Bacteria 4065
522 Ga0495656_0236216 3300046615 Bacteria 919
523 Ga0495656_0290091 3300046615 Bacteria 836
524 Ga0495668_0120771 3300046616 Bacteria 1433
525 Ga0495634_0065718 3300046642 Bacteria 2403
526 Ga0495611_0033998 3300046648 Bacteria 2252
527 Ga0495611_0510183 3300046648 Bacteria 546
528 Ga0495625_0012457 3300046660 Bacteria 6891
529 Ga0495625_0317585 3300046660 Bacteria 992
530 Ga0495635_0002552 3300046663 Bacteria 12466
531 Ga0495635_0220023 3300046663 Bacteria 1284
532 Ga0495661_0082457 3300046665 Bacteria 1851
533 Ga0495657_0088066 3300046675 Bacteria 1997
534 Ga0495599_0092297 3300046678 Bacteria 1889
535 Ga0495599_0190108 3300046678 Bacteria 1263
536 Ga0495646_0200692 3300046680 Bacteria 1086
537 Ga0495647_0156202 3300046681 Bacteria 981
538 Ga0495669_0010535 3300046684 Bacteria 3909
539 Ga0495669_0192443 3300046684 Bacteria 974
540 Ga0495613_0013199 3300046689 Bacteria 6139
541 Ga0495613_0545267 3300046689 Bacteria 777
542 Ga0495624_0484400 3300046690 Bacteria 740
543 Ga0495670_0032853 3300046691 Bacteria 2581
544 Ga0495670_0187932 3300046691 Bacteria 1092
545 Ga0495671_0121734 3300046692 Bacteria 1273
546 Ga0495589_0306109 3300046794 Bacteria 736
547 Ga0495600_0096759 3300046809 Bacteria 1924
548 Ga0495660_0033062 3300046810 Bacteria 2902
549 Ga0495581_0194674 3300047315 Bacteria 1186
550 Ga0495636_0056613 3300047318 Bacteria 1651
551 Ga0495674_0022180 3300047319 Bacteria 5858
552 Ga0495674_0720563 3300047319 Bacteria 781
553 Ga0495676_0156971 3300047321 Bacteria 1613
554 Ga0495676_0734481 3300047321 Bacteria 638
555 Ga0495680_0000756 3300047322 Bacteria 36274
556 Ga0495687_045764 3300047443 Bacteria 1893
557 Ga0495675_0535707 3300047444 Bacteria 669
558 Ga0495679_070161 3300047446 Bacteria 1011
559 Ga0495685_183376 3300047447 Bacteria 674
560 Ga0495681_0166282 3300047470 Bacteria 915
561 Ga0495686_0026774 3300047472 Bacteria 3772
562 Ga0495686_0238906 3300047472 Bacteria 1025
563 Ga0495615_0045113 3300048090 Bacteria 1115
564 Ga0495626_0163004 3300048091 Bacteria 934
565 Ga0496100_0004243 3300048903 Bacteria 7576
566 Ga0496100_0056576 3300048903 Bacteria 2566
567 Ga0496101_0012645 3300048904 Bacteria 5639
568 Ga0496101_0015190 3300048904 Bacteria 5183
569 Ga0496101_0239376 3300048904 Bacteria 1412
570 Ga0496101_0927100 3300048904 Bacteria 685
571 Ga0496102_0000708 3300048905 Bacteria 33054
572 Ga0496102_0002815 3300048905 Bacteria 14815
573 Ga0496102_0402758 3300048905 Bacteria 1286
574 Ga0496103_0000018 3300048906 Bacteria 239585
575 Ga0496104_0099517 3300048907 Bacteria 2783
576 Ga0496104_0129735 3300048907 Bacteria 2421
577 Ga0496104_0315073 3300048907 Bacteria 1477
578 Ga0496104_1120492 3300048907 Bacteria 690
579 Ga0496104_1267175 3300048907 Unclassified 640
580 Ga0496105_0001678 3300048908 Bacteria 15793
581 Ga0496105_0093108 3300048908 Bacteria 2488
582 Ga0496106_0000980 3300048909 Bacteria 20817
583 Ga0496106_0006199 3300048909 Bacteria 8844
584 Ga0496107_0004141 3300048910 Bacteria 9779
585 Ga0496107_0204060 3300048910 Bacteria 1469
586 Ga0496107_0271574 3300048910 Bacteria 1262
587 Ga0496108_0060695 3300048911 Unclassified 3182
588 Ga0496108_0071347 3300048911 Bacteria 2930
589 Ga0496109_0060375 3300048912 Bacteria 3464
590 Ga0496109_0206711 3300048912 Unclassified 1846
591 Ga0496109_0564107 3300048912 Bacteria 1074
592 Ga0496109_0834768 3300048912 Bacteria 859
593 Ga0496109_0929205 3300048912 Bacteria 808
594 Ga0496110_0023391 3300048913 Bacteria 5254
595 Ga0496110_0070996 3300048913 Bacteria 3086
596 Ga0496110_0250421 3300048913 Bacteria 1612
597 Ga0496111_0055669 3300048914 Bacteria 2861
598 Ga0496111_0474979 3300048914 Bacteria 921
599 Ga0496112_0008770 3300048915 Bacteria 9072
600 Ga0496112_0128805 3300048915 Bacteria 2501
601 Ga0496113_0023265 3300048916 Bacteria 4393
602 Ga0496113_0027550 3300048916 Unclassified 4075
603 Ga0496113_0735195 3300048916 Bacteria 786
604 Ga0496114_0227454 3300048917 Bacteria 1638
605 Ga0496114_0379473 3300048917 Bacteria 1251
606 Ga0496115_0007450 3300048918 Bacteria 8054
607 Ga0496115_0046227 3300048918 Bacteria 3478
608 Ga0496116_0001070 3300048919 Bacteria 33015
609 Ga0496116_0008239 3300048919 Bacteria 9082
610 Ga0496116_0054024 3300048919 Bacteria 2649
611 Ga0496117_0001527 3300048920 Bacteria 33054
612 Ga0496117_0063956 3300048920 Bacteria 2512
613 Ga0496118_0000172 3300048921 Bacteria 116150
614 Ga0496118_0053901 3300048921 Bacteria 3051
615 Ga0496119_0001107 3300048922 Bacteria 33974
616 Ga0496119_0346548 3300048922 Bacteria 720
617 Ga0496120_0014411 3300048923 Bacteria 5271
618 Ga0496120_0082594 3300048923 Bacteria 1736
619 Ga0496121_0006442 3300048924 Bacteria 14570
620 Ga0496121_0017288 3300048924 Bacteria 7378
621 Ga0496122_0059208 3300048925 Bacteria 2828
622 Ga0496122_0061593 3300048925 Bacteria 2753
623 Ga0496122_0139350 3300048925 Bacteria 1521
624 Ga0496123_0077509 3300048926 Bacteria 2041
625 Ga0496124_0014794 3300048927 Bacteria 7525
626 Ga0496124_0019059 3300048927 Bacteria 6403
627 Ga0496124_0049168 3300048927 Bacteria 3598
628 Ga0496124_0273256 3300048927 Bacteria 1236
629 Ga0496125_0011267 3300048928 Bacteria 8962
630 Ga0496125_0025682 3300048928 Bacteria 5387
631 Ga0496125_0082927 3300048928 Bacteria 2441
632 Ga0496125_0178708 3300048928 Bacteria 1417
633 Ga0496126_0001683 3300048929 Bacteria 33054
634 Ga0496126_0104011 3300048929 Bacteria 2481
635 Ga0496126_0533638 3300048929 Bacteria 933
636 Ga0496126_0563825 3300048929 Bacteria 902
637 Ga0501031_0007537 3300049568 Bacteria 7088
638 Ga0501032_0000196 3300049569 Bacteria 50261
639 Ga0501032_0062314 3300049569 Bacteria 2499
640 Ga0501032_0138922 3300049569 Bacteria 1600
641 Ga0501032_0477523 3300049569 Bacteria 797
642 Ga0501033_0003209 3300049570 Bacteria 13536
643 Ga0501033_0356247 3300049570 Bacteria 1024
644 Ga0501033_0694835 3300049570 Bacteria 692
645 Ga0501033_0789573 3300049570 Bacteria 642
646 Ga0501034_0001151 3300049571 Bacteria 36663
647 Ga0501034_0003462 3300049571 Bacteria 17971
648 Ga0501034_0024163 3300049571 Bacteria 6182
649 Ga0501034_0237707 3300049571 Bacteria 1769
650 Ga0501034_0316051 3300049571 Bacteria 1495
651 Ga0501036_0001626 3300049572 Bacteria 17386
652 Ga0501036_0009212 3300049572 Bacteria 8116
653 Ga0501036_0773600 3300049572 Bacteria 791
654 Ga0501037_0001377 3300049573 Bacteria 17808
655 Ga0501037_0010257 3300049573 Bacteria 6875
656 Ga0501037_0083507 3300049573 Bacteria 2314
657 Ga0501038_0001622 3300049574 Bacteria 20925
658 Ga0501039_0001302 3300049575 Bacteria 18240
659 Ga0501040_0541533 3300049576 Bacteria 840
660 Ga0501042_1191770 3300049578 Bacteria 555
661 Ga0501043_0000409 3300049579 Bacteria 38657
662 Ga0501043_0002131 3300049579 Bacteria 16886
663 Ga0501043_0054990 3300049579 Bacteria 3126
664 Ga0501043_0202230 3300049579 Bacteria 1541
665 Ga0501043_1129224 3300049579 Bacteria 553
666 Ga0501046_0000011 3300049580 Bacteria 326457
667 Ga0501046_0000181 3300049580 Bacteria 64035
668 Ga0501046_0015303 3300049580 Bacteria 6451
669 Ga0501046_0048166 3300049580 Bacteria 3376
670 Ga0501046_0746871 3300049580 Bacteria 687
671 Ga0501047_0000161 3300049581 Bacteria 81928
672 Ga0501047_0002426 3300049581 Bacteria 17808
673 Ga0501047_0476395 3300049581 Bacteria 1076
674 Ga0501047_0846751 3300049581 Bacteria 728
675 Ga0501048_0001687 3300049582 Bacteria 16834
676 Ga0501048_0003595 3300049582 Bacteria 11806
677 Ga0501067_0000145 3300049583 Bacteria 39277
678 Ga0501067_0130999 3300049583 Bacteria 1396
679 Ga0501067_0333142 3300049583 Bacteria 845
680 Ga0501068_0002577 3300049584 Bacteria 9611
681 Ga0501069_0003759 3300049585 Bacteria 7805
682 Ga0501069_0630720 3300049585 Bacteria 644
683 Ga0501070_0028493 3300049586 Bacteria 4684
684 Ga0501070_0055720 3300049586 Bacteria 3277
685 Ga0501071_0094786 3300049587 Bacteria 2196
686 Ga0501072_0017020 3300049588 Bacteria 5585
687 Ga0501073_0000027 3300049589 Bacteria 121860
688 Ga0501073_0034095 3300049589 Bacteria 3624
689 Ga0501073_0043888 3300049589 Bacteria 3152
690 Ga0501073_0157840 3300049589 Bacteria 1572
691 Ga0501073_0453721 3300049589 Bacteria 886
692 Ga0501073_0548848 3300049589 Bacteria 798
693 Ga0501074_0001347 3300049590 Bacteria 16291
694 Ga0501074_0003607 3300049590 Bacteria 10993
695 Ga0501076_0275383 3300049592 Bacteria 1378
696 Ga0501076_1456036 3300049592 Bacteria 562
697 Ga0501080_0002621 3300049742 Bacteria 15752
698 Ga0501080_0003069 3300049742 Bacteria 14746
699 Ga0501080_0520591 3300049742 Bacteria 1061
700 Ga0501080_1863084 3300049742 Bacteria 504
701 Ga0501081_0426003 3300049743 Bacteria 984
702 Ga0501083_0002123 3300049744 Bacteria 13604
703 Ga0501083_0006827 3300049744 Bacteria 8101
704 Ga0501083_0097960 3300049744 Bacteria 1934
705 Ga0501035_0001852 3300049822 Bacteria 21281
706 Ga0501035_0157404 3300049822 Bacteria 1968
707 Ga0501035_0513419 3300049822 Bacteria 985
708 Ga0501044_0001758 3300049823 Bacteria 25308
709 Ga0501044_0003498 3300049823 Bacteria 17680
710 Ga0501044_0069873 3300049823 Bacteria 3574
711 Ga0501044_0142679 3300049823 Bacteria 2383
712 Ga0501044_0478662 3300049823 Bacteria 1148
713 Ga0501045_0014292 3300049824 Bacteria 5626
714 Ga0501045_0068930 3300049824 Bacteria 2599
715 nmdc:mga03n38_176199_c1 3300050490 Bacteria 1093
716 nmdc:mga00v17_174389_c1 3300050491 Bacteria 1387
717 nmdc:mga00v17_42401_c1 3300050491 Bacteria 2737
718 nmdc:mga00v17_469155_c1 3300050491 Bacteria 817
719 nmdc:mga0yw44_249038_c1 3300050492 Bacteria 1182
720 nmdc:mga0yw44_33973_c1 3300050492 Bacteria 2985
721 nmdc:mga0yw44_422136_c1 3300050492 Bacteria 903
722 nmdc:mga0yw44_51203_c1 3300050492 Bacteria 2499
723 nmdc:mga0yw44_75566_c1 3300050492 Bacteria 2101
724 nmdc:mga0k408_19984_c1 3300050493 Bacteria 3748
725 nmdc:mga0k408_764347_c1 3300050493 Bacteria 564
726 nmdc:mga06z11_103722_c1 3300050494 Bacteria 1564
727 nmdc:mga06z11_166516_c1 3300050494 Bacteria 1263
728 nmdc:mga06z11_26431_c1 3300050494 Bacteria 2762
729 nmdc:mga06z11_546294_c1 3300050494 Bacteria 703
730 nmdc:mga04h51_114479_c1 3300050495 Bacteria 998
731 nmdc:mga04h51_98384_c1 3300050495 Bacteria 1063
732 nmdc:mga07m45_296324_c1 3300050496 Bacteria 941
733 nmdc:mga07m45_46561_c1 3300050496 Bacteria 1921
734 nmdc:mga07m45_746266_c1 3300050496 Bacteria 562
735 nmdc:mga05p37_123970_c1 3300050507 Bacteria 3174
736 nmdc:mga05p37_174908_c1 3300050507 Bacteria 2616
737 nmdc:mga05p37_300629_c1 3300050507 Bacteria 1907
738 nmdc:mga05p37_414185_c1 3300050507 Bacteria 1570
739 nmdc:mga09592_90126_c1 3300050508 Bacteria 2620
740 nmdc:mga0qj67_12245_c1 3300050509 Bacteria 6459
741 nmdc:mga0qj67_420171_c1 3300050509 Bacteria 1078
742 nmdc:mga06r32_396103_c1 3300050510 Bacteria 1363
743 nmdc:mga06r32_4162_c1 3300050510 Bacteria 12958
744 nmdc:mga0n895_131371_c1 3300050512 Bacteria 2529
745 nmdc:mga0n895_150460_c1 3300050512 Bacteria 2358
746 nmdc:mga0n895_337627_c1 3300050512 Bacteria 1526
747 nmdc:mga0n895_66587_c1 3300050512 Bacteria 3567
748 nmdc:mga0n895_8089_c1 3300050512 Bacteria 9080
749 nmdc:mga0n895_98890_c1 3300050512 Bacteria 2925
750 nmdc:mga0rr50_178234_c1 3300050513 Bacteria 1736
751 nmdc:mga0rr50_26047_c1 3300050513 Bacteria 4074
752 nmdc:mga0rr50_446149_c1 3300050513 Bacteria 1096
753 nmdc:mga0rr50_653668_c1 3300050513 Bacteria 897
754 nmdc:mga0a205_1624_c1 3300050515 Bacteria 19322
755 nmdc:mga0a205_3536_c1 3300050515 Bacteria 13971
756 nmdc:mga0a205_37613_c1 3300050515 Bacteria 4654
757 nmdc:mga0a205_44757_c1 3300050515 Bacteria 4268
758 nmdc:mga0a205_489914_c1 3300050515 Bacteria 1087
759 nmdc:mga0a205_9896_c1 3300050515 Bacteria 8744
760 nmdc:mga0sz30_443206_c1 3300050516 Bacteria 583
761 Ga0495601_0019454 3300053077 Bacteria 4140
762 Ga0495601_0159538 3300053077 Bacteria 1474
763 Ga0495612_0016451 3300053078 Bacteria 2963
764 Ga0500610_0152431 3300053079 Bacteria 1157
765 Ga0495655_0014889 3300053083 Bacteria 1641
766 Ga0495595_0227493 3300053084 Bacteria 931
767 Ga0500578_0175378 3300053086 Bacteria 1323
768 Ga0500643_051773 3300053087 Bacteria 1172
769 Ga0500651_0068330 3300053093 Bacteria 2213
770 Ga0500555_003122 3300053103 Bacteria 4726
771 Ga0500594_0026187 3300053118 Bacteria 1501
772 Ga0500652_069402 3300053131 Bacteria 1458
773 Ga0500658_0022106 3300053134 Bacteria 2414
774 Ga0500658_0026760 3300053134 Bacteria 2224
775 Ga0500568_0001209 3300053139 Bacteria 17208
776 Ga0500568_0360392 3300053139 Bacteria 527
777 Ga0500616_0000251 3300053153 Bacteria 83237
778 Ga0500616_0000627 3300053153 Bacteria 42906
779 Ga0500616_0036732 3300053153 Bacteria 2657
780 Ga0500620_123787 3300053155 Bacteria 906
781 Ga0500622_0000099 3300053156 Bacteria 86951
782 Ga0500627_0075987 3300053158 Bacteria 1493
783 Ga0500627_0429170 3300053158 Bacteria 559
784 Ga0500633_0000560 3300053160 Bacteria 6053
785 Ga0500639_078842 3300053163 Bacteria 1663
786 Ga0500645_000647 3300053730 Bacteria 22079
787 Ga0501084_0003235 3300054114 Bacteria 13188
788 Ga0501084_0464675 3300054114 Bacteria 1070
789 Ga0501084_0488221 3300054114 Bacteria 1041
790 Ga0501084_1322111 3300054114 Bacteria 604
791 Ga0501084_1374220 3300054114 Bacteria 592
792 Ga0501082_0005376 3300060353 Bacteria 11113
793 Ga0501082_0196049 3300060353 Bacteria 1757
794 Ga0501082_0301848 3300060353 Bacteria 1394
795 Ga0530510_0232518 3300061734 Bacteria 1371

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300037466 Ga0395898_0944145 Ga0395898_0944145_26_466 137
2 3300046543 Ga0495645_0396895 Ga0495645_0396895_355_855 139
3 3300009147 Ga0114129_10499196 Ga0114129_104991963 141
4 3300050507 nmdc:mga05p37_300629_c1 nmdc:mga05p37_300629_c1_1069_1497 141
5 3300050508 nmdc:mga09592_90126_c1 nmdc:mga09592_90126_c1_1950_2378 141
6 3300050509 nmdc:mga0qj67_12245_c1 nmdc:mga0qj67_12245_c1_4554_4982 141
7 3300050510 nmdc:mga06r32_4162_c1 nmdc:mga06r32_4162_c1_8423_8851 141
8 iso_pu_bacteria 2626541554 2626639266 142
9 3300005468 Ga0070707_100279434 Ga0070707_1002794341 143
10 3300032126 Ga0307415_101891550 Ga0307415_1018915501 143
11 3300046535 Ga0495586_0770474 Ga0495586_0770474_41_517 143
12 3300046543 Ga0495645_0020314 Ga0495645_0020314_1127_1603 143
13 3300046678 Ga0495599_0092297 Ga0495599_0092297_1121_1597 143
14 3300049578 Ga0501042_1191770 Ga0501042_1191770_30_491 143
15 3300050493 nmdc:mga0k408_764347_c1 nmdc:mga0k408_764347_c1_78_554 143
16 3300005618 Ga0068864_100068003 Ga0068864_1000680034 145
17 3300005841 Ga0068863_100002809 Ga0068863_10000280914 145
18 3300007265 Ga0099794_10003779 Ga0099794_100037794 145
19 3300014325 Ga0163163_11060929 Ga0163163_110609291 145
20 3300014968 Ga0157379_10021508 Ga0157379_100215082 145
21 3300026088 Ga0207641_10007276 Ga0207641_100072768 145
22 3300026095 Ga0207676_10633666 Ga0207676_106336661 145
23 3300035692 Ga0373935_1121596 Ga0373935_1121596_99_566 145
24 3300037466 Ga0395898_0270911 Ga0395898_0270911_490_930 145
25 3300038443 Ga0395901_0075917 Ga0395901_0075917_2602_3042 145
26 3300048903 Ga0496100_0056576 Ga0496100_0056576_1156_1614 145
27 3300048904 Ga0496101_0012645 Ga0496101_0012645_4544_5002 145
28 3300048905 Ga0496102_0000708 Ga0496102_0000708_16241_16699 145
29 3300048906 Ga0496103_0000018 Ga0496103_0000018_222889_223347 145
30 3300048910 Ga0496107_0204060 Ga0496107_0204060_594_1052 145
31 3300048912 Ga0496109_0834768 Ga0496109_0834768_315_773 145
32 3300048913 Ga0496110_0250421 Ga0496110_0250421_327_785 145
33 3300048917 Ga0496114_0379473 Ga0496114_0379473_286_744 145
34 3300048919 Ga0496116_0001070 Ga0496116_0001070_16336_16794 145
35 3300048920 Ga0496117_0001527 Ga0496117_0001527_16356_16814 145
36 3300048921 Ga0496118_0000172 Ga0496118_0000172_16241_16699 145
37 3300048922 Ga0496119_0001107 Ga0496119_0001107_16219_16677 145
38 3300048923 Ga0496120_0014411 Ga0496120_0014411_3517_3975 145
39 3300048924 Ga0496121_0017288 Ga0496121_0017288_1895_2353 145
40 3300048925 Ga0496122_0139350 Ga0496122_0139350_204_662 145
41 3300048927 Ga0496124_0014794 Ga0496124_0014794_120_578 145
42 3300048928 Ga0496125_0025682 Ga0496125_0025682_4869_5327 145
43 3300048929 Ga0496126_0001683 Ga0496126_0001683_16241_16699 145
44 3300003792 Ga0055540_1002996 Ga0055540_10029962 146
45 3300003792 Ga0055540_1023510 Ga0055540_10235101 146
46 3300009093 Ga0105240_10027757 Ga0105240_100277575 146
47 3300009093 Ga0105240_10146629 Ga0105240_101466293 146
48 3300009093 Ga0105240_10694477 Ga0105240_106944771 146
49 3300009093 Ga0105240_11205953 Ga0105240_112059532 146
50 3300009177 Ga0105248_10225927 Ga0105248_102259271 146
51 3300009545 Ga0105237_10102750 Ga0105237_101027503 146
52 3300009545 Ga0105237_10148699 Ga0105237_101486992 146
53 3300009551 Ga0105238_10018641 Ga0105238_100186413 146
54 3300009551 Ga0105238_10706887 Ga0105238_107068872 146
55 3300009551 Ga0105238_11721024 Ga0105238_117210241 146
56 3300010375 Ga0105239_10121061 Ga0105239_101210614 146
57 3300010375 Ga0105239_10995605 Ga0105239_109956052 146
58 3300013102 Ga0157371_10865301 Ga0157371_108653011 146
59 3300013104 Ga0157370_10007688 Ga0157370_100076888 146
60 3300013104 Ga0157370_10034135 Ga0157370_100341355 146
61 3300013104 Ga0157370_10619621 Ga0157370_106196212 146
62 3300022467 Ga0224712_10140603 Ga0224712_101406032 146
63 3300025303 Ga0209051_1004166 Ga0209051_10041661 146
64 3300037418 Ga0395900_0039256 Ga0395900_0039256_2646_3098 146
65 3300037466 Ga0395898_0074177 Ga0395898_0074177_2740_3192 146
66 3300038443 Ga0395901_0010855 Ga0395901_0010855_2518_2970 146
67 3300044842 Ga0466957_1071136 Ga0466957_1071136_35_487 146
68 3300045976 Ga0466967_1545306 Ga0466967_1545306_107_559 146
69 3300046477 Ga0495664_0346476 Ga0495664_0346476_16_459 146
70 3300046529 Ga0495652_0790292 Ga0495652_0790292_173_616 146
71 3300049571 Ga0501034_0237707 Ga0501034_0237707_908_1360 146
72 3300049583 Ga0501067_0130999 Ga0501067_0130999_263_706 146
73 3300049589 Ga0501073_0034095 Ga0501073_0034095_3035_3487 146
74 3300049589 Ga0501073_0157840 Ga0501073_0157840_857_1309 146
75 3300049742 Ga0501080_0520591 Ga0501080_0520591_242_694 146
76 3300053087 Ga0500643_051773 Ga0500643_051773_407_859 146
77 3300014325 Ga0163163_12210481 Ga0163163_122104811 147
78 3300035111 Ga0373923_0024781 Ga0373923_0024781_523_969 147
79 3300035113 Ga0373936_0128281 Ga0373936_0128281_159_605 147
80 3300035117 Ga0373953_0205047 Ga0373953_0205047_305_751 147
81 3300035119 Ga0373956_0258275 Ga0373956_0258275_131_577 147
82 3300035170 Ga0373943_0419323 Ga0373943_0419323_99_545 147
83 3300035172 Ga0373955_0239248 Ga0373955_0239248_246_692 147
84 3300035692 Ga0373935_0223968 Ga0373935_0223968_599_1045 147
85 3300041456 Ga0451795_0515187 Ga0451795_0515187_93_539 147
86 3300041458 Ga0451798_0628373 Ga0451798_0628373_49_495 147
87 3300044719 Ga0466971_0034965 Ga0466971_0034965_775_1218 147
88 3300048928 Ga0496125_0178708 Ga0496125_0178708_193_639 147
89 3300049580 Ga0501046_0000011 Ga0501046_0000011_220894_221340 147
90 3300050491 nmdc:mga00v17_42401_c1 nmdc:mga00v17_42401_c1_1788_2234 147
91 3300050512 nmdc:mga0n895_66587_c1 nmdc:mga0n895_66587_c1_210_704 147
92 3300050515 nmdc:mga0a205_1624_c1 nmdc:mga0a205_1624_c1_3491_3985 147
93 iso_pu_bacteria 2643221961 2645719651 147
94 iso_pu_bacteria 2862290372 2862292071 147
95 3300009011 Ga0105251_10014997 Ga0105251_100149973 148
96 3300009093 Ga0105240_10000236 Ga0105240_1000023628 148
97 3300009147 Ga0114129_10184658 Ga0114129_101846582 148
98 3300009177 Ga0105248_10057210 Ga0105248_100572103 148
99 3300009545 Ga0105237_10792101 Ga0105237_107921012 148
100 3300009553 Ga0105249_10419582 Ga0105249_104195823 148
101 3300013104 Ga0157370_10250016 Ga0157370_102500163 148
102 3300013307 Ga0157372_10282003 Ga0157372_102820031 148
103 3300014325 Ga0163163_10024959 Ga0163163_100249591 148
104 3300014325 Ga0163163_10533614 Ga0163163_105336142 148
105 3300014968 Ga0157379_10962201 Ga0157379_109622012 148
106 3300025918 Ga0207662_10566934 Ga0207662_105669342 148
107 3300025932 Ga0207690_10221404 Ga0207690_102214042 148
108 3300037312 Ga0395899_0075022 Ga0395899_0075022_1980_2426 148
109 3300037418 Ga0395900_0643559 Ga0395900_0643559_232_678 148
110 3300037466 Ga0395898_1223131 Ga0395898_1223131_131_577 148
111 3300038443 Ga0395901_0008223 Ga0395901_0008223_9242_9688 148
112 3300038443 Ga0395901_0843184 Ga0395901_0843184_420_866 148
113 3300041491 Ga0451833_0039522 Ga0451833_0039522_79_525 148
114 3300041498 Ga0451841_1433549 Ga0451841_1433549_141_587 148
115 3300045051 Ga0451576_0258571 Ga0451576_0258571_560_1051 148
116 3300046457 Ga0495590_0113032 Ga0495590_0113032_485_931 148
117 3300046460 Ga0495638_0047808 Ga0495638_0047808_396_842 148
118 3300046471 Ga0495650_0050972 Ga0495650_0050972_483_929 148
119 3300046474 Ga0495605_0131350 Ga0495605_0131350_220_666 148
120 3300046501 Ga0495607_0133769 Ga0495607_0133769_48_494 148
121 3300046507 Ga0495606_0026405 Ga0495606_0026405_420_866 148
122 3300046512 Ga0495610_0009978 Ga0495610_0009978_5116_5562 148
123 3300046512 Ga0495610_0025500 Ga0495610_0025500_603_1049 148
124 3300046519 Ga0495632_0053879 Ga0495632_0053879_1160_1606 148
125 3300046522 Ga0495643_0082069 Ga0495643_0082069_444_890 148
126 3300046538 Ga0495609_0032374 Ga0495609_0032374_1359_1805 148
127 3300046660 Ga0495625_0012457 Ga0495625_0012457_5975_6421 148
128 3300046810 Ga0495660_0033062 Ga0495660_0033062_2047_2493 148
129 3300047318 Ga0495636_0056613 Ga0495636_0056613_1093_1539 148
130 3300047443 Ga0495687_045764 Ga0495687_045764_944_1390 148
131 3300047447 Ga0495685_183376 Ga0495685_183376_124_570 148
132 3300047472 Ga0495686_0026774 Ga0495686_0026774_408_854 148
133 3300048904 Ga0496101_0927100 Ga0496101_0927100_120_566 148
134 3300048905 Ga0496102_0402758 Ga0496102_0402758_292_738 148
135 3300048907 Ga0496104_0129735 Ga0496104_0129735_1433_1879 148
136 3300048908 Ga0496105_0001678 Ga0496105_0001678_323_769 148
137 3300048909 Ga0496106_0000980 Ga0496106_0000980_17262_17708 148
138 3300048910 Ga0496107_0271574 Ga0496107_0271574_563_1009 148
139 3300048912 Ga0496109_0564107 Ga0496109_0564107_595_1041 148
140 3300048913 Ga0496110_0023391 Ga0496110_0023391_346_792 148
141 3300048914 Ga0496111_0474979 Ga0496111_0474979_465_911 148
142 3300048916 Ga0496113_0735195 Ga0496113_0735195_292_738 148
143 3300048917 Ga0496114_0227454 Ga0496114_0227454_220_666 148
144 3300048919 Ga0496116_0054024 Ga0496116_0054024_1126_1572 148
145 3300048920 Ga0496117_0063956 Ga0496117_0063956_1875_2321 148
146 3300048921 Ga0496118_0053901 Ga0496118_0053901_194_640 148
147 3300048922 Ga0496119_0346548 Ga0496119_0346548_185_631 148
148 3300048923 Ga0496120_0082594 Ga0496120_0082594_201_647 148
149 3300048925 Ga0496122_0059208 Ga0496122_0059208_1047_1493 148
150 3300048925 Ga0496122_0061593 Ga0496122_0061593_703_1149 148
151 3300048926 Ga0496123_0077509 Ga0496123_0077509_601_1047 148
152 3300048927 Ga0496124_0049168 Ga0496124_0049168_2906_3352 148
153 3300048927 Ga0496124_0273256 Ga0496124_0273256_375_821 148
154 3300048928 Ga0496125_0011267 Ga0496125_0011267_4314_4760 148
155 3300048928 Ga0496125_0082927 Ga0496125_0082927_534_980 148
156 3300048929 Ga0496126_0104011 Ga0496126_0104011_17_472 148
157 3300048929 Ga0496126_0533638 Ga0496126_0533638_52_498 148
158 3300049569 Ga0501032_0138922 Ga0501032_0138922_452_898 148
159 3300049569 Ga0501032_0477523 Ga0501032_0477523_149_595 148
160 3300049570 Ga0501033_0356247 Ga0501033_0356247_354_800 148
161 3300049570 Ga0501033_0694835 Ga0501033_0694835_153_599 148
162 3300049571 Ga0501034_0024163 Ga0501034_0024163_2321_2767 148
163 3300049572 Ga0501036_0773600 Ga0501036_0773600_40_486 148
164 3300049573 Ga0501037_0083507 Ga0501037_0083507_1486_1932 148
165 3300049579 Ga0501043_0054990 Ga0501043_0054990_489_935 148
166 3300049579 Ga0501043_0202230 Ga0501043_0202230_342_788 148
167 3300049580 Ga0501046_0048166 Ga0501046_0048166_952_1398 148
168 3300049580 Ga0501046_0746871 Ga0501046_0746871_67_513 148
169 3300049583 Ga0501067_0333142 Ga0501067_0333142_323_769 148
170 3300049589 Ga0501073_0548848 Ga0501073_0548848_124_570 148
171 3300049742 Ga0501080_1863084 Ga0501080_1863084_36_482 148
172 3300049744 Ga0501083_0097960 Ga0501083_0097960_1013_1459 148
173 3300049822 Ga0501035_0157404 Ga0501035_0157404_1007_1453 148
174 3300049823 Ga0501044_0069873 Ga0501044_0069873_2512_2958 148
175 3300050490 nmdc:mga03n38_176199_c1 nmdc:mga03n38_176199_c1_521_967 148
176 3300050492 nmdc:mga0yw44_422136_c1 nmdc:mga0yw44_422136_c1_253_699 148
177 3300050494 nmdc:mga06z11_546294_c1 nmdc:mga06z11_546294_c1_123_569 148
178 3300050496 nmdc:mga07m45_746266_c1 nmdc:mga07m45_746266_c1_23_469 148
179 3300050507 nmdc:mga05p37_174908_c1 nmdc:mga05p37_174908_c1_1842_2300 148
180 3300050512 nmdc:mga0n895_98890_c1 nmdc:mga0n895_98890_c1_991_1485 148
181 3300050513 nmdc:mga0rr50_446149_c1 nmdc:mga0rr50_446149_c1_139_633 148
182 3300050515 nmdc:mga0a205_489914_c1 nmdc:mga0a205_489914_c1_547_1059 148
183 3300053086 Ga0500578_0175378 Ga0500578_0175378_533_979 148
184 3300053093 Ga0500651_0068330 Ga0500651_0068330_37_483 148
185 3300053118 Ga0500594_0026187 Ga0500594_0026187_716_1162 148
186 3300053134 Ga0500658_0022106 Ga0500658_0022106_113_559 148
187 3300053134 Ga0500658_0026760 Ga0500658_0026760_430_876 148
188 3300053139 Ga0500568_0001209 Ga0500568_0001209_16293_16739 148
189 3300053139 Ga0500568_0360392 Ga0500568_0360392_22_474 148
190 3300053153 Ga0500616_0000627 Ga0500616_0000627_36279_36773 148
191 3300053153 Ga0500616_0036732 Ga0500616_0036732_500_946 148
192 3300053155 Ga0500620_123787 Ga0500620_123787_191_637 148
193 3300053156 Ga0500622_0000099 Ga0500622_0000099_542_988 148
194 3300053158 Ga0500627_0075987 Ga0500627_0075987_75_521 148
195 3300053158 Ga0500627_0429170 Ga0500627_0429170_79_525 148
196 3300053160 Ga0500633_0000560 Ga0500633_0000560_5279_5725 148
197 3300054114 Ga0501084_0464675 Ga0501084_0464675_438_884 148
198 3300054114 Ga0501084_1374220 Ga0501084_1374220_117_566 148
199 3300060353 Ga0501082_0301848 Ga0501082_0301848_470_916 148
200 iso_pu_bacteria 2510065019 2510136550 148
201 iso_pu_bacteria 2510917030 2511199835 148
202 iso_pu_bacteria 2513237084 2513569595 148
203 iso_pu_bacteria 2513237085 2513576427 148
204 iso_pu_bacteria 2513237093 2513635262 148
205 iso_pu_bacteria 2513237103 2513709838 148
206 iso_pu_bacteria 2513237138 2513870064 148
207 iso_pu_bacteria 2515075009 2515115122 148
208 iso_pu_bacteria 2515154134 2515741970 148
209 iso_pu_bacteria 2516653077 2517041876 148
210 iso_pu_bacteria 2516653085 2517081088 148
211 iso_pu_bacteria 2517093000 2517098567 148
212 iso_pu_bacteria 2524023228 2524535378 148
213 iso_pu_bacteria 2529292951 2530644542 148
214 iso_pu_bacteria 2534681796 2535520275 148
215 iso_pu_bacteria 2582581298 2585221567 148
216 iso_pu_bacteria 2582581866 2585392668 148
217 iso_pu_bacteria 2582581867 2585404116 148
218 iso_pu_bacteria 2585427526 2585524216 148
219 iso_pu_bacteria 2585427529 2585544263 148
220 iso_pu_bacteria 2585427590 2585819998 148
221 iso_pu_bacteria 2643221599 2644003455 148
222 iso_pu_bacteria 2718217882 2719183809 148
223 iso_pu_bacteria 2718218009 2719728250 148
224 iso_pu_bacteria 2718218363 2721145111 148
225 iso_pu_bacteria 2718218365 2721155848 148
226 iso_pu_bacteria 2718218366 2721167198 148
227 iso_pu_bacteria 2721755514 2722838176 148
228 iso_pu_bacteria 2721755810 2724042444 148
229 iso_pu_bacteria 2724679232 2725946272 148
230 iso_pu_bacteria 2728369365 2730161949 148
231 iso_pu_bacteria 2728369397 2730300955 148
232 iso_pu_bacteria 2765235942 2766068431 148
233 iso_pu_bacteria 2791355260 2793324001 148
234 iso_pu_bacteria 2791355264 2793346286 148
235 iso_pu_bacteria 2802429605 2805929100 148
236 iso_pu_bacteria 2838022645 2838027224 148
237 iso_pu_bacteria 2838668709 2838671538 148
238 iso_pu_bacteria 2838680041 2838684452 148
239 iso_pu_bacteria 2838686498 2838693791 148
240 iso_pu_bacteria 2838694306 2838699943 148
241 iso_pu_bacteria 2838701080 2838704195 148
242 iso_pu_bacteria 2838707686 2838711772 148
243 iso_pu_bacteria 2838729681 2838735499 148
244 iso_pu_bacteria 2838742623 2838748401 148
245 iso_pu_bacteria 2841851746 2841858561 148
246 iso_pu_bacteria 2842077413 2842081919 148
247 iso_pu_bacteria 2842110456 2842115764 148
248 iso_pu_bacteria 2842118031 2842122495 148
249 iso_pu_bacteria 2842146304 2842149187 148
250 iso_pu_bacteria 2842156927 2842162713 148
251 iso_pu_bacteria 2842163707 2842167084 148
252 iso_pu_bacteria 2842180545 2842186217 148
253 iso_pu_bacteria 2842192696 2842195304 148
254 iso_pu_bacteria 2842198810 2842203403 148
255 iso_pu_bacteria 2842217011 2842222206 148
256 iso_pu_bacteria 2842229732 2842236609 148
257 iso_pu_bacteria 2842237096 2842241184 148
258 iso_pu_bacteria 2842243621 2842250292 148
259 iso_pu_bacteria 2842250916 2842253646 148
260 iso_pu_bacteria 2842257432 2842263319 148
261 iso_pu_bacteria 2842271015 2842278358 148
262 iso_pu_bacteria 2842291075 2842295574 148
263 iso_pu_bacteria 2842304105 2842310003 148
264 iso_pu_bacteria 2842370503 2842377360 148
265 iso_pu_bacteria 2842377471 2842381650 148
266 iso_pu_bacteria 2842384541 2842389043 148
267 iso_pu_bacteria 2842489311 2842491497 148
268 iso_pu_bacteria 2844454524 2844461061 148
269 iso_pu_bacteria 2857516855 2857519232 148
270 iso_pu_bacteria 2884215851 2884218895 148
271 iso_pu_bacteria 2919100787 2919103517 148
272 iso_pu_bacteria 2933570622 2933576444 148
273 iso_pu_bacteria 2933586486 2933591730 148
274 iso_pu_bacteria 2935894831 2935898208 148
275 iso_pu_bacteria 2935901341 2935905796 148
276 iso_pu_bacteria 2936367885 2936370238 148
277 iso_pu_bacteria 2936375103 2936377910 148
278 iso_pu_bacteria 2996887358 2996887671 148
279 iso_pu_bacteria 3002141150 3002142216 148
280 iso_pu_bacteria 3005452660 3005456852 148
281 iso_pu_bacteria 639633055 639651766 148
282 iso_pu_bacteria 8005307578 8005313076 148
283 iso_pu_bacteria 8005321885 8005322198 148
284 iso_pu_bacteria 8005376324 8005381919 148
285 iso_pu_bacteria 8005460587 8005466849 148
286 iso_pu_bacteria 8005556819 8005562155 148
287 iso_pu_bacteria 8005563573 8005567086 148
288 iso_pu_bacteria 8005688590 8005689486 148
289 iso_pu_bacteria 8023680758 8023682410 148
290 iso_pu_bacteria 8024479707 8024483741 148
291 iso_pu_bacteria 8057874678 8057878386 148
292 3300005334 Ga0068869_100019939 Ga0068869_1000199391 149
293 3300005539 Ga0068853_101391586 Ga0068853_1013915861 149
294 3300005563 Ga0068855_100229948 Ga0068855_1002299483 149
295 3300005578 Ga0068854_100467312 Ga0068854_1004673122 149
296 3300005985 Ga0081539_10010322 Ga0081539_100103223 149
297 3300007076 Ga0075435_100130969 Ga0075435_1001309693 149
298 3300009545 Ga0105237_10365467 Ga0105237_103654671 149
299 3300025912 Ga0207707_10266303 Ga0207707_102663032 149
300 3300025941 Ga0207711_10402706 Ga0207711_104027061 149
301 3300025942 Ga0207689_10096486 Ga0207689_100964863 149
302 3300025949 Ga0207667_10324704 Ga0207667_103247041 149
303 3300026116 Ga0207674_11747576 Ga0207674_117475761 149
304 3300027671 Ga0209588_1005097 Ga0209588_10050975 149
305 3300031456 Ga0307513_10006532 Ga0307513_1000653211 149
306 3300031616 Ga0307508_10068897 Ga0307508_100688972 149
307 3300045976 Ga0466967_1431975 Ga0466967_1431975_33_512 149
308 3300046472 Ga0495580_0088261 Ga0495580_0088261_1044_1493 149
309 3300047315 Ga0495581_0194674 Ga0495581_0194674_647_1096 149
310 3300048912 Ga0496109_0929205 Ga0496109_0929205_253_738 149
311 3300050513 nmdc:mga0rr50_653668_c1 nmdc:mga0rr50_653668_c1_220_675 149
312 iso_pu_bacteria 2923556063 2923559678 149
313 3300005327 Ga0070658_10006016 Ga0070658_100060165 150
314 3300005336 Ga0070680_100086284 Ga0070680_1000862842 150
315 3300005339 Ga0070660_100032812 Ga0070660_1000328125 150
316 3300005366 Ga0070659_101465187 Ga0070659_1014651871 150
317 3300005458 Ga0070681_10057249 Ga0070681_100572492 150
318 3300005458 Ga0070681_10077610 Ga0070681_100776103 150
319 3300005530 Ga0070679_100026849 Ga0070679_1000268493 150
320 3300005530 Ga0070679_100499093 Ga0070679_1004990931 150
321 3300005539 Ga0068853_100456012 Ga0068853_1004560121 150
322 3300005548 Ga0070665_100000728 Ga0070665_10000072835 150
323 3300005548 Ga0070665_100000791 Ga0070665_10000079128 150
324 3300005548 Ga0070665_100298875 Ga0070665_1002988752 150
325 3300005563 Ga0068855_100008482 Ga0068855_10000848211 150
326 3300005563 Ga0068855_100383538 Ga0068855_1003835381 150
327 3300005563 Ga0068855_101137067 Ga0068855_1011370672 150
328 3300005577 Ga0068857_100067585 Ga0068857_1000675853 150
329 3300005614 Ga0068856_100465624 Ga0068856_1004656241 150
330 3300005616 Ga0068852_100730430 Ga0068852_1007304301 150
331 3300005842 Ga0068858_100074409 Ga0068858_1000744091 150
332 3300005842 Ga0068858_100698504 Ga0068858_1006985042 150
333 3300005937 Ga0081455_10291286 Ga0081455_102912862 150
334 3300006038 Ga0075365_10089833 Ga0075365_100898332 150
335 3300006042 Ga0075368_10142881 Ga0075368_101428812 150
336 3300006178 Ga0075367_10074206 Ga0075367_100742062 150
337 3300006358 Ga0068871_100463377 Ga0068871_1004633772 150
338 3300006847 Ga0075431_100098700 Ga0075431_1000987001 150
339 3300006880 Ga0075429_100088861 Ga0075429_1000888612 150
340 3300006881 Ga0068865_100108053 Ga0068865_1001080532 150
341 3300006881 Ga0068865_100346794 Ga0068865_1003467942 150
342 3300009094 Ga0111539_11753926 Ga0111539_117539262 150
343 3300009098 Ga0105245_10680151 Ga0105245_106801511 150
344 3300009098 Ga0105245_11250084 Ga0105245_112500842 150
345 3300009176 Ga0105242_10276255 Ga0105242_102762552 150
346 3300010375 Ga0105239_11369391 Ga0105239_113693911 150
347 3300013308 Ga0157375_10100228 Ga0157375_101002282 150
348 3300020069 Ga0197907_11104677 Ga0197907_111046771 150
349 3300020070 Ga0206356_10551594 Ga0206356_105515941 150
350 3300020082 Ga0206353_11551518 Ga0206353_115515181 150
351 3300025909 Ga0207705_10010749 Ga0207705_100107495 150
352 3300025909 Ga0207705_10254393 Ga0207705_102543932 150
353 3300025912 Ga0207707_10047727 Ga0207707_100477272 150
354 3300025912 Ga0207707_10052017 Ga0207707_100520172 150
355 3300025913 Ga0207695_10008466 Ga0207695_100084663 150
356 3300025913 Ga0207695_10181605 Ga0207695_101816053 150
357 3300025913 Ga0207695_10583333 Ga0207695_105833332 150
358 3300025917 Ga0207660_10075463 Ga0207660_100754632 150
359 3300025919 Ga0207657_10042626 Ga0207657_100426262 150
360 3300025921 Ga0207652_10052481 Ga0207652_100524813 150
361 3300025921 Ga0207652_10725081 Ga0207652_107250812 150
362 3300025924 Ga0207694_10080762 Ga0207694_100807622 150
363 3300025924 Ga0207694_10100228 Ga0207694_101002281 150
364 3300025932 Ga0207690_10260348 Ga0207690_102603482 150
365 3300025938 Ga0207704_10173973 Ga0207704_101739732 150
366 3300025938 Ga0207704_10427062 Ga0207704_104270621 150
367 3300025941 Ga0207711_10825449 Ga0207711_108254491 150
368 3300025945 Ga0207679_10456244 Ga0207679_104562442 150
369 3300025949 Ga0207667_10042630 Ga0207667_100426303 150
370 3300025949 Ga0207667_10324169 Ga0207667_103241692 150
371 3300026035 Ga0207703_10083515 Ga0207703_100835152 150
372 3300026041 Ga0207639_10489589 Ga0207639_104895892 150
373 3300026078 Ga0207702_10390682 Ga0207702_103906821 150
374 3300026089 Ga0207648_10925622 Ga0207648_109256221 150
375 3300026116 Ga0207674_10075071 Ga0207674_100750716 150
376 3300026116 Ga0207674_10103624 Ga0207674_101036244 150
377 3300026142 Ga0207698_10302307 Ga0207698_103023072 150
378 3300027866 Ga0209813_10096829 Ga0209813_100968292 150
379 3300028379 Ga0268266_10000385 Ga0268266_1000038535 150
380 3300028379 Ga0268266_10184131 Ga0268266_101841312 150
381 3300028800 Ga0265338_10045794 Ga0265338_100457941 150
382 3300028800 Ga0265338_10047201 Ga0265338_100472012 150
383 3300031238 Ga0265332_10014480 Ga0265332_100144802 150
384 3300031241 Ga0265325_10085388 Ga0265325_100853882 150
385 3300031250 Ga0265331_10074271 Ga0265331_100742712 150
386 3300031456 Ga0307513_10539324 Ga0307513_105393241 150
387 3300031595 Ga0265313_10100213 Ga0265313_101002131 150
388 3300031711 Ga0265314_10030808 Ga0265314_100308083 150
389 3300031903 Ga0307407_10083629 Ga0307407_100836293 150
390 3300031995 Ga0307409_100084839 Ga0307409_1000848392 150
391 3300032004 Ga0307414_10865539 Ga0307414_108655392 150
392 3300037466 Ga0395898_0029479 Ga0395898_0029479_4399_4905 150
393 3300037471 Ga0395905_0068863 Ga0395905_0068863_1280_1786 150
394 3300038443 Ga0395901_0027274 Ga0395901_0027274_4255_4761 150
395 3300044694 Ga0466963_0949590 Ga0466963_0949590_86_562 150
396 3300046473 Ga0495582_0469804 Ga0495582_0469804_205_663 150
397 3300046516 Ga0495628_0016355 Ga0495628_0016355_2543_2998 150
398 3300046533 Ga0495640_0607472 Ga0495640_0607472_156_611 150
399 3300046543 Ga0495645_0067316 Ga0495645_0067316_277_732 150
400 3300046615 Ga0495656_0236216 Ga0495656_0236216_435_905 150
401 3300046642 Ga0495634_0065718 Ga0495634_0065718_204_659 150
402 3300046648 Ga0495611_0510183 Ga0495611_0510183_26_496 150
403 3300046663 Ga0495635_0002552 Ga0495635_0002552_7171_7626 150
404 3300047319 Ga0495674_0720563 Ga0495674_0720563_72_527 150
405 3300048904 Ga0496101_0239376 Ga0496101_0239376_692_1162 150
406 3300049576 Ga0501040_0541533 Ga0501040_0541533_292_786 150
407 3300049743 Ga0501081_0426003 Ga0501081_0426003_168_662 150
408 3300049823 Ga0501044_0142679 Ga0501044_0142679_229_696 150
409 3300050492 nmdc:mga0yw44_75566_c1 nmdc:mga0yw44_75566_c1_1150_1608 150
410 3300050494 nmdc:mga06z11_103722_c1 nmdc:mga06z11_103722_c1_437_988 150
411 3300050495 nmdc:mga04h51_114479_c1 nmdc:mga04h51_114479_c1_222_773 150
412 3300050507 nmdc:mga05p37_414185_c1 nmdc:mga05p37_414185_c1_151_624 150
413 3300053077 Ga0495601_0019454 Ga0495601_0019454_1109_1564 150
414 3300053078 Ga0495612_0016451 Ga0495612_0016451_150_605 150
415 3300053153 Ga0500616_0000251 Ga0500616_0000251_3284_3739 150
416 3300003771 Ga0055526_1012487 Ga0055526_10124874 151
417 3300005262 Ga0065165_1002401 Ga0065165_10024019 151
418 3300005334 Ga0068869_100047278 Ga0068869_1000472783 151
419 3300005440 Ga0070705_100479682 Ga0070705_1004796821 151
420 3300005458 Ga0070681_10242083 Ga0070681_102420832 151
421 3300005530 Ga0070679_100084582 Ga0070679_1000845824 151
422 3300006051 Ga0075364_10034376 Ga0075364_100343762 151
423 3300006353 Ga0075370_10168720 Ga0075370_101687202 151
424 3300006844 Ga0075428_100605178 Ga0075428_1006051781 151
425 3300006846 Ga0075430_100937093 Ga0075430_1009370931 151
426 3300006847 Ga0075431_100371664 Ga0075431_1003716642 151
427 3300006852 Ga0075433_10012335 Ga0075433_100123357 151
428 3300006871 Ga0075434_100011264 Ga0075434_1000112641 151
429 3300009147 Ga0114129_10198599 Ga0114129_101985993 151
430 3300011119 Ga0105246_10014526 Ga0105246_100145262 151
431 3300013296 Ga0157374_10079900 Ga0157374_100799002 151
432 3300013308 Ga0157375_10189132 Ga0157375_101891321 151
433 3300014968 Ga0157379_10630833 Ga0157379_106308331 151
434 3300025295 Ga0209564_1001641 Ga0209564_10016416 151
435 3300025912 Ga0207707_10361175 Ga0207707_103611752 151
436 3300025942 Ga0207689_10096567 Ga0207689_100965673 151
437 3300025944 Ga0207661_10192740 Ga0207661_101927402 151
438 3300026078 Ga0207702_10080335 Ga0207702_100803352 151
439 3300028563 Ga0265319_1056801 Ga0265319_10568012 151
440 3300028794 Ga0307515_10020927 Ga0307515_100209274 151
441 3300031240 Ga0265320_10186864 Ga0265320_101868641 151
442 3300031456 Ga0307513_10017597 Ga0307513_100175974 151
443 3300031456 Ga0307513_10707989 Ga0307513_107079891 151
444 3300031616 Ga0307508_10226654 Ga0307508_102266542 151
445 3300035117 Ga0373953_0102334 Ga0373953_0102334_697_1167 151
446 3300035170 Ga0373943_0135228 Ga0373943_0135228_370_840 151
447 3300035692 Ga0373935_0041914 Ga0373935_0041914_259_729 151
448 3300041460 Ga0451802_0018767 Ga0451802_0018767_132_590 151
449 3300041503 Ga0451847_0548471 Ga0451847_0548471_415_885 151
450 3300041505 Ga0451849_1232725 Ga0451849_1232725_185_655 151
451 3300044694 Ga0466963_0015037 Ga0466963_0015037_2670_3164 151
452 3300044842 Ga0466957_0033468 Ga0466957_0033468_1293_1787 151
453 3300046454 Ga0495592_0442873 Ga0495592_0442873_59_529 151
454 3300046477 Ga0495664_0167618 Ga0495664_0167618_437_907 151
455 3300046519 Ga0495632_0029055 Ga0495632_0029055_55_510 151
456 3300046531 Ga0495665_0192125 Ga0495665_0192125_116_586 151
457 3300046533 Ga0495640_0141839 Ga0495640_0141839_444_914 151
458 3300047321 Ga0495676_0156971 Ga0495676_0156971_453_923 151
459 3300047444 Ga0495675_0535707 Ga0495675_0535707_20_490 151
460 3300048903 Ga0496100_0004243 Ga0496100_0004243_5669_6139 151
461 3300048904 Ga0496101_0015190 Ga0496101_0015190_50_520 151
462 3300048905 Ga0496102_0002815 Ga0496102_0002815_12868_13338 151
463 3300048907 Ga0496104_0099517 Ga0496104_0099517_555_1025 151
464 3300048908 Ga0496105_0093108 Ga0496105_0093108_300_770 151
465 3300048909 Ga0496106_0006199 Ga0496106_0006199_5845_6315 151
466 3300048910 Ga0496107_0004141 Ga0496107_0004141_5489_5959 151
467 3300048911 Ga0496108_0071347 Ga0496108_0071347_1291_1761 151
468 3300048912 Ga0496109_0060375 Ga0496109_0060375_2368_2838 151
469 3300048913 Ga0496110_0070996 Ga0496110_0070996_1763_2233 151
470 3300048914 Ga0496111_0055669 Ga0496111_0055669_2306_2776 151
471 3300048915 Ga0496112_0128805 Ga0496112_0128805_143_613 151
472 3300048916 Ga0496113_0023265 Ga0496113_0023265_2843_3313 151
473 3300048918 Ga0496115_0007450 Ga0496115_0007450_1991_2461 151
474 3300049569 Ga0501032_0062314 Ga0501032_0062314_1561_2022 151
475 3300049571 Ga0501034_0003462 Ga0501034_0003462_4536_4997 151
476 3300049571 Ga0501034_0316051 Ga0501034_0316051_482_943 151
477 3300049572 Ga0501036_0001626 Ga0501036_0001626_12004_12465 151
478 3300049573 Ga0501037_0010257 Ga0501037_0010257_4280_4741 151
479 3300049579 Ga0501043_0002131 Ga0501043_0002131_10060_10521 151
480 3300049580 Ga0501046_0015303 Ga0501046_0015303_2001_2462 151
481 3300049581 Ga0501047_0000161 Ga0501047_0000161_7760_8221 151
482 3300049581 Ga0501047_0846751 Ga0501047_0846751_65_526 151
483 3300049582 Ga0501048_0001687 Ga0501048_0001687_12176_12637 151
484 3300049586 Ga0501070_0055720 Ga0501070_0055720_37_498 151
485 3300049589 Ga0501073_0043888 Ga0501073_0043888_1637_2098 151
486 3300049590 Ga0501074_0003607 Ga0501074_0003607_9740_10201 151
487 3300049742 Ga0501080_0003069 Ga0501080_0003069_1332_1793 151
488 3300049744 Ga0501083_0006827 Ga0501083_0006827_6186_6647 151
489 3300049822 Ga0501035_0513419 Ga0501035_0513419_412_873 151
490 3300049823 Ga0501044_0001758 Ga0501044_0001758_11568_12029 151
491 3300049823 Ga0501044_0478662 Ga0501044_0478662_574_1035 151
492 3300049824 Ga0501045_0068930 Ga0501045_0068930_1525_1986 151
493 3300050509 nmdc:mga0qj67_420171_c1 nmdc:mga0qj67_420171_c1_131_658 151
494 3300050510 nmdc:mga06r32_396103_c1 nmdc:mga06r32_396103_c1_655_1110 151
495 3300053083 Ga0495655_0014889 Ga0495655_0014889_1115_1570 151
496 3300053131 Ga0500652_069402 Ga0500652_069402_12_467 151
497 3300053163 Ga0500639_078842 Ga0500639_078842_350_826 151
498 3300060353 Ga0501082_0196049 Ga0501082_0196049_159_620 151
499 3300002739 JGI25158J39367_1001249 JGI25158J39367_10012492 152
500 3300002987 JGI25159J45721_1005399 JGI25159J45721_10053994 152
501 3300003215 JGI25153J46596_10006039 JGI25153J46596_100060392 152
502 3300003215 JGI25153J46596_10021365 JGI25153J46596_100213652 152
503 3300003354 JGI25160J50197_1001537 JGI25160J50197_10015373 152
504 3300003354 JGI25160J50197_1029600 JGI25160J50197_10296002 152
505 3300003374 JGI25161J50226_1000463 JGI25161J50226_10004634 152
506 3300003374 JGI25161J50226_1008346 JGI25161J50226_10083462 152
507 3300003771 Ga0055526_1003736 Ga0055526_10037368 152
508 3300003775 Ga0055524_1006013 Ga0055524_10060133 152
509 3300003790 Ga0055528_1011201 Ga0055528_10112013 152
510 3300003790 Ga0055528_1035642 Ga0055528_10356421 152
511 3300004625 Ga0055543_1000021 Ga0055543_10000219 152
512 3300004625 Ga0055543_1000591 Ga0055543_10005916 152
513 3300005290 Ga0065712_10164627 Ga0065712_101646272 152
514 3300005327 Ga0070658_10076404 Ga0070658_100764042 152
515 3300005329 Ga0070683_100152100 Ga0070683_1001521003 152
516 3300005329 Ga0070683_100338461 Ga0070683_1003384612 152
517 3300005330 Ga0070690_100753207 Ga0070690_1007532072 152
518 3300005334 Ga0068869_100152072 Ga0068869_1001520722 152
519 3300005335 Ga0070666_10190980 Ga0070666_101909802 152
520 3300005347 Ga0070668_100358640 Ga0070668_1003586402 152
521 3300005353 Ga0070669_100769514 Ga0070669_1007695141 152
522 3300005354 Ga0070675_100291754 Ga0070675_1002917542 152
523 3300005354 Ga0070675_100622863 Ga0070675_1006228632 152
524 3300005355 Ga0070671_101612622 Ga0070671_1016126221 152
525 3300005435 Ga0070714_100095478 Ga0070714_1000954782 152
526 3300005435 Ga0070714_100137393 Ga0070714_1001373933 152
527 3300005436 Ga0070713_100396104 Ga0070713_1003961041 152
528 3300005436 Ga0070713_101384098 Ga0070713_1013840981 152
529 3300005439 Ga0070711_100002332 Ga0070711_1000023326 152
530 3300005439 Ga0070711_100674830 Ga0070711_1006748302 152
531 3300005455 Ga0070663_100667365 Ga0070663_1006673652 152
532 3300005455 Ga0070663_100969648 Ga0070663_1009696481 152
533 3300005455 Ga0070663_102101182 Ga0070663_1021011821 152
534 3300005456 Ga0070678_100015069 Ga0070678_1000150694 152
535 3300005457 Ga0070662_100145660 Ga0070662_1001456602 152
536 3300005459 Ga0068867_100941102 Ga0068867_1009411021 152
537 3300005467 Ga0070706_100007435 Ga0070706_1000074356 152
538 3300005468 Ga0070707_101422746 Ga0070707_1014227462 152
539 3300005471 Ga0070698_100639517 Ga0070698_1006395172 152
540 3300005518 Ga0070699_100299395 Ga0070699_1002993952 152
541 3300005518 Ga0070699_100397347 Ga0070699_1003973471 152
542 3300005530 Ga0070679_101736848 Ga0070679_1017368481 152
543 3300005535 Ga0070684_100036209 Ga0070684_1000362093 152
544 3300005535 Ga0070684_100168617 Ga0070684_1001686173 152
545 3300005535 Ga0070684_100644409 Ga0070684_1006444092 152
546 3300005536 Ga0070697_100313233 Ga0070697_1003132333 152
547 3300005536 Ga0070697_100865924 Ga0070697_1008659241 152
548 3300005544 Ga0070686_100420663 Ga0070686_1004206632 152
549 3300005548 Ga0070665_100469893 Ga0070665_1004698932 152
550 3300005563 Ga0068855_100028847 Ga0068855_1000288477 152
551 3300005563 Ga0068855_100422172 Ga0068855_1004221722 152
552 3300005564 Ga0070664_101163525 Ga0070664_1011635252 152
553 3300005577 Ga0068857_100029109 Ga0068857_1000291093 152
554 3300005614 Ga0068856_101192112 Ga0068856_1011921122 152
555 3300005614 Ga0068856_101920824 Ga0068856_1019208241 152
556 3300005616 Ga0068852_100382396 Ga0068852_1003823961 152
557 3300005617 Ga0068859_100118930 Ga0068859_1001189302 152
558 3300005617 Ga0068859_100212397 Ga0068859_1002123973 152
559 3300005618 Ga0068864_100023676 Ga0068864_1000236765 152
560 3300005618 Ga0068864_100229661 Ga0068864_1002296611 152
561 3300005719 Ga0068861_100337047 Ga0068861_1003370471 152
562 3300005840 Ga0068870_10127815 Ga0068870_101278153 152
563 3300005841 Ga0068863_100113646 Ga0068863_1001136462 152
564 3300005841 Ga0068863_101303125 Ga0068863_1013031251 152
565 3300005842 Ga0068858_100046662 Ga0068858_1000466625 152
566 3300005843 Ga0068860_100102994 Ga0068860_1001029942 152
567 3300005844 Ga0068862_100076450 Ga0068862_1000764503 152
568 3300005844 Ga0068862_100122152 Ga0068862_1001221524 152
569 3300005937 Ga0081455_10225778 Ga0081455_102257782 152
570 3300005985 Ga0081539_10004015 Ga0081539_100040158 152
571 3300005985 Ga0081539_10028448 Ga0081539_100284483 152
572 3300006028 Ga0070717_11317747 Ga0070717_113177471 152
573 3300006038 Ga0075365_10016164 Ga0075365_100161643 152
574 3300006038 Ga0075365_10197780 Ga0075365_101977802 152
575 3300006042 Ga0075368_10271186 Ga0075368_102711861 152
576 3300006048 Ga0075363_100299148 Ga0075363_1002991481 152
577 3300006163 Ga0070715_10002024 Ga0070715_100020246 152
578 3300006173 Ga0070716_100003137 Ga0070716_1000031373 152
579 3300006173 Ga0070716_100274077 Ga0070716_1002740772 152
580 3300006173 Ga0070716_100720123 Ga0070716_1007201232 152
581 3300006175 Ga0070712_100000811 Ga0070712_10000081114 152
582 3300006175 Ga0070712_100004288 Ga0070712_10000428811 152
583 3300006175 Ga0070712_100048063 Ga0070712_1000480634 152
584 3300006177 Ga0075362_10176267 Ga0075362_101762672 152
585 3300006178 Ga0075367_10037081 Ga0075367_100370812 152
586 3300006178 Ga0075367_10054071 Ga0075367_100540712 152
587 3300006178 Ga0075367_10133979 Ga0075367_101339792 152
588 3300006178 Ga0075367_10534822 Ga0075367_105348221 152
589 3300006195 Ga0075366_10013745 Ga0075366_100137452 152
590 3300006195 Ga0075366_10058999 Ga0075366_100589992 152
591 3300006195 Ga0075366_10177987 Ga0075366_101779872 152
592 3300006237 Ga0097621_100494068 Ga0097621_1004940682 152
593 3300006353 Ga0075370_10011541 Ga0075370_100115413 152
594 3300006353 Ga0075370_10299398 Ga0075370_102993982 152
595 3300006852 Ga0075433_10001208 Ga0075433_100012084 152
596 3300006852 Ga0075433_10028698 Ga0075433_100286985 152
597 3300006852 Ga0075433_11233745 Ga0075433_112337451 152
598 3300006871 Ga0075434_100003941 Ga0075434_10000394110 152
599 3300006871 Ga0075434_100040251 Ga0075434_1000402515 152
600 3300006871 Ga0075434_100052129 Ga0075434_1000521293 152
601 3300006871 Ga0075434_100056525 Ga0075434_1000565253 152
602 3300006871 Ga0075434_100373812 Ga0075434_1003738123 152
603 3300006931 Ga0097620_100118945 Ga0097620_1001189452 152
604 3300006931 Ga0097620_100212395 Ga0097620_1002123953 152
605 3300007076 Ga0075435_100022058 Ga0075435_1000220583 152
606 3300007076 Ga0075435_100466990 Ga0075435_1004669902 152
607 3300009147 Ga0114129_10001748 Ga0114129_1000174814 152
608 3300009148 Ga0105243_10057884 Ga0105243_100578842 152
609 3300009148 Ga0105243_12015925 Ga0105243_120159251 152
610 3300009174 Ga0105241_10614057 Ga0105241_106140572 152
611 3300009176 Ga0105242_10431605 Ga0105242_104316052 152
612 3300009545 Ga0105237_10121540 Ga0105237_101215402 152
613 3300009551 Ga0105238_10681464 Ga0105238_106814642 152
614 3300009553 Ga0105249_10082992 Ga0105249_100829922 152
615 3300009553 Ga0105249_10135024 Ga0105249_101350244 152
616 3300010375 Ga0105239_11295452 Ga0105239_112954522 152
617 3300011119 Ga0105246_10726432 Ga0105246_107264322 152
618 3300013102 Ga0157371_10146701 Ga0157371_101467012 152
619 3300013306 Ga0163162_10157402 Ga0163162_101574023 152
620 3300013307 Ga0157372_10197434 Ga0157372_101974342 152
621 3300013307 Ga0157372_10365459 Ga0157372_103654592 152
622 3300013308 Ga0157375_10241809 Ga0157375_102418094 152
623 3300013308 Ga0157375_10252261 Ga0157375_102522612 152
624 3300014325 Ga0163163_10030962 Ga0163163_100309621 152
625 3300014325 Ga0163163_11049830 Ga0163163_110498301 152
626 3300014745 Ga0157377_10113719 Ga0157377_101137191 152
627 3300014968 Ga0157379_10146089 Ga0157379_101460893 152
628 3300020080 Ga0206350_10448529 Ga0206350_104485291 152
629 3300021388 Ga0213875_10181766 Ga0213875_101817661 152
630 3300025208 Ga0209436_100004 Ga0209436_100004162 152
631 3300025245 Ga0207425_1000736 Ga0207425_10007362 152
632 3300025245 Ga0207425_1003419 Ga0207425_10034192 152
633 3300025258 Ga0209129_1000622 Ga0209129_100062216 152
634 3300025258 Ga0209129_1008265 Ga0209129_10082652 152
635 3300025273 Ga0209673_1002989 Ga0209673_10029899 152
636 3300025273 Ga0209673_1011979 Ga0209673_10119792 152
637 3300025273 Ga0209673_1019500 Ga0209673_10195003 152
638 3300025284 Ga0209130_1000001 Ga0209130_1000001262 152
639 3300025291 Ga0209675_1048502 Ga0209675_10485022 152
640 3300025292 Ga0209676_1080480 Ga0209676_10804801 152
641 3300025294 Ga0209025_1000072 Ga0209025_1000072126 152
642 3300025294 Ga0209025_1008821 Ga0209025_10088212 152
643 3300025294 Ga0209025_1077979 Ga0209025_10779792 152
644 3300025295 Ga0209564_1001805 Ga0209564_10018053 152
645 3300025295 Ga0209564_1002167 Ga0209564_100216713 152
646 3300025297 Ga0209758_1000053 Ga0209758_1000053107 152
647 3300025297 Ga0209758_1003660 Ga0209758_10036605 152
648 3300025297 Ga0209758_1005280 Ga0209758_10052805 152
649 3300025297 Ga0209758_1006260 Ga0209758_10062603 152
650 3300025297 Ga0209758_1036886 Ga0209758_10368862 152
651 3300025297 Ga0209758_1146557 Ga0209758_11465571 152
652 3300025299 Ga0209256_1008889 Ga0209256_10088893 152
653 3300025299 Ga0209256_1012955 Ga0209256_10129552 152
654 3300025299 Ga0209256_1033728 Ga0209256_10337282 152
655 3300025302 Ga0207426_1000005 Ga0207426_1000005867 152
656 3300025302 Ga0207426_1000035 Ga0207426_1000035181 152
657 3300025303 Ga0209051_1012390 Ga0209051_10123904 152
658 3300025303 Ga0209051_1022802 Ga0209051_10228022 152
659 3300025303 Ga0209051_1040134 Ga0209051_10401342 152
660 3300025304 Ga0209257_1021221 Ga0209257_10212212 152
661 3300025899 Ga0207642_10069267 Ga0207642_100692673 152
662 3300025900 Ga0207710_10131906 Ga0207710_101319062 152
663 3300025905 Ga0207685_10029134 Ga0207685_100291342 152
664 3300025906 Ga0207699_10025679 Ga0207699_100256793 152
665 3300025906 Ga0207699_10129378 Ga0207699_101293781 152
666 3300025907 Ga0207645_10130102 Ga0207645_101301022 152
667 3300025909 Ga0207705_10033327 Ga0207705_100333271 152
668 3300025910 Ga0207684_10023669 Ga0207684_100236697 152
669 3300025912 Ga0207707_10121000 Ga0207707_101210003 152
670 3300025913 Ga0207695_10001342 Ga0207695_100013429 152
671 3300025914 Ga0207671_10257114 Ga0207671_102571142 152
672 3300025915 Ga0207693_10007740 Ga0207693_100077401 152
673 3300025915 Ga0207693_10042995 Ga0207693_100429953 152
674 3300025915 Ga0207693_10156613 Ga0207693_101566132 152
675 3300025916 Ga0207663_10012062 Ga0207663_100120626 152
676 3300025916 Ga0207663_10087480 Ga0207663_100874803 152
677 3300025918 Ga0207662_10014961 Ga0207662_100149612 152
678 3300025921 Ga0207652_10359455 Ga0207652_103594551 152
679 3300025922 Ga0207646_10028312 Ga0207646_100283128 152
680 3300025922 Ga0207646_10044882 Ga0207646_100448824 152
681 3300025922 Ga0207646_10047226 Ga0207646_100472265 152
682 3300025923 Ga0207681_10255482 Ga0207681_102554822 152
683 3300025923 Ga0207681_10958131 Ga0207681_109581312 152
684 3300025925 Ga0207650_10353637 Ga0207650_103536372 152
685 3300025926 Ga0207659_10235378 Ga0207659_102353781 152
686 3300025926 Ga0207659_11133907 Ga0207659_111339072 152
687 3300025928 Ga0207700_10172853 Ga0207700_101728531 152
688 3300025928 Ga0207700_10538849 Ga0207700_105388491 152
689 3300025928 Ga0207700_10636868 Ga0207700_106368681 152
690 3300025928 Ga0207700_10941549 Ga0207700_109415491 152
691 3300025929 Ga0207664_10189038 Ga0207664_101890381 152
692 3300025929 Ga0207664_10203727 Ga0207664_102037272 152
693 3300025931 Ga0207644_10006295 Ga0207644_1000629510 152
694 3300025933 Ga0207706_10123463 Ga0207706_101234633 152
695 3300025933 Ga0207706_10238832 Ga0207706_102388322 152
696 3300025937 Ga0207669_10207959 Ga0207669_102079592 152
697 3300025938 Ga0207704_10518823 Ga0207704_105188232 152
698 3300025939 Ga0207665_10006502 Ga0207665_100065023 152
699 3300025939 Ga0207665_10154841 Ga0207665_101548412 152
700 3300025940 Ga0207691_10706598 Ga0207691_107065981 152
701 3300025941 Ga0207711_10241084 Ga0207711_102410842 152
702 3300025942 Ga0207689_10113796 Ga0207689_101137962 152
703 3300025944 Ga0207661_11138195 Ga0207661_111381951 152
704 3300025945 Ga0207679_10920749 Ga0207679_109207491 152
705 3300025949 Ga0207667_11370360 Ga0207667_113703601 152
706 3300025960 Ga0207651_10489016 Ga0207651_104890162 152
707 3300025961 Ga0207712_10107157 Ga0207712_101071572 152
708 3300025961 Ga0207712_11303352 Ga0207712_113033522 152
709 3300025972 Ga0207668_10299870 Ga0207668_102998702 152
710 3300025986 Ga0207658_10336268 Ga0207658_103362682 152
711 3300026035 Ga0207703_10017685 Ga0207703_100176853 152
712 3300026067 Ga0207678_10207851 Ga0207678_102078512 152
713 3300026067 Ga0207678_10264635 Ga0207678_102646351 152
714 3300026067 Ga0207678_10717776 Ga0207678_107177762 152
715 3300026067 Ga0207678_10968642 Ga0207678_109686422 152
716 3300026075 Ga0207708_10043077 Ga0207708_100430774 152
717 3300026088 Ga0207641_10155165 Ga0207641_101551652 152
718 3300026088 Ga0207641_10179393 Ga0207641_101793932 152
719 3300026089 Ga0207648_10038978 Ga0207648_100389784 152
720 3300026089 Ga0207648_10118613 Ga0207648_101186133 152
721 3300026095 Ga0207676_10115941 Ga0207676_101159411 152
722 3300026116 Ga0207674_10006588 Ga0207674_100065885 152
723 3300026118 Ga0207675_100062979 Ga0207675_1000629792 152
724 3300026118 Ga0207675_100154707 Ga0207675_1001547072 152
725 3300026121 Ga0207683_10081047 Ga0207683_100810472 152
726 3300028379 Ga0268266_10005306 Ga0268266_100053066 152
727 3300028379 Ga0268266_10263218 Ga0268266_102632183 152
728 3300028381 Ga0268264_10522491 Ga0268264_105224912 152
729 3300028381 Ga0268264_10683321 Ga0268264_106833211 152
730 3300028794 Ga0307515_10006687 Ga0307515_100066873 152
731 3300028794 Ga0307515_10608019 Ga0307515_106080191 152
732 3300031731 Ga0307405_10911815 Ga0307405_109118152 152
733 3300031901 Ga0307406_10775090 Ga0307406_107750901 152
734 3300032126 Ga0307415_100230230 Ga0307415_1002302302 152
735 3300037418 Ga0395900_0684649 Ga0395900_0684649_245_730 152
736 3300037853 Ga0436364_1105312 Ga0436364_1105312_86_577 152
737 3300041413 Ga0439465_0044599 Ga0439465_0044599_630_1154 152
738 3300041413 Ga0439465_0074331 Ga0439465_0074331_116_640 152
739 3300041492 Ga0451835_1244665 Ga0451835_1244665_189_665 152
740 3300041494 Ga0451837_0636900 Ga0451837_0636900_3018_3494 152
741 3300041494 Ga0451837_0648854 Ga0451837_0648854_67_543 152
742 3300041496 Ga0451839_1217916 Ga0451839_1217916_611_1087 152
743 3300041498 Ga0451841_0208921 Ga0451841_0208921_2058_2534 152
744 3300041503 Ga0451847_0291403 Ga0451847_0291403_102_578 152
745 3300041503 Ga0451847_0810882 Ga0451847_0810882_149_625 152
746 3300041505 Ga0451849_1042723 Ga0451849_1042723_61_537 152
747 3300041507 Ga0451851_0003858 Ga0451851_0003858_809_1285 152
748 3300041511 Ga0451855_0798708 Ga0451855_0798708_1321_1797 152
749 3300041511 Ga0451855_1111775 Ga0451855_1111775_314_790 152
750 3300041512 Ga0451853_1646649 Ga0451853_1646649_229_705 152
751 3300041512 Ga0451853_3517822 Ga0451853_3517822_130_606 152
752 3300042007 Ga0439449_0070506 Ga0439449_0070506_594_1211 152
753 3300044656 Ga0466969_0046389 Ga0466969_0046389_1069_1542 152
754 3300044693 Ga0466961_0140369 Ga0466961_0140369_887_1360 152
755 3300044694 Ga0466963_0036049 Ga0466963_0036049_273_770 152
756 3300044712 Ga0453684_0270104 Ga0453684_0270104_1398_1901 152
757 3300045049 Ga0466959_0084002 Ga0466959_0084002_484_957 152
758 3300045836 Ga0466958_0167808 Ga0466958_0167808_485_958 152
759 3300045976 Ga0466967_0501224 Ga0466967_0501224_598_1077 152
760 3300046455 Ga0495603_0370783 Ga0495603_0370783_37_612 152
761 3300046459 Ga0495629_0177464 Ga0495629_0177464_515_1015 152
762 3300046461 Ga0495641_0068198 Ga0495641_0068198_94_594 152
763 3300046462 Ga0495651_0120370 Ga0495651_0120370_833_1333 152
764 3300046472 Ga0495580_0475582 Ga0495580_0475582_239_742 152
765 3300046473 Ga0495582_0624869 Ga0495582_0624869_88_591 152
766 3300046476 Ga0495662_0260710 Ga0495662_0260710_287_787 152
767 3300046477 Ga0495664_0079021 Ga0495664_0079021_581_1081 152
768 3300046491 Ga0495584_0177050 Ga0495584_0177050_281_784 152
769 3300046492 Ga0495585_0039212 Ga0495585_0039212_500_976 152
770 3300046499 Ga0495594_0561719 Ga0495594_0561719_115_618 152
771 3300046500 Ga0495596_0164197 Ga0495596_0164197_199_675 152
772 3300046506 Ga0495583_0024919 Ga0495583_0024919_527_1054 152
773 3300046507 Ga0495606_0159510 Ga0495606_0159510_779_1306 152
774 3300046511 Ga0495608_0030457 Ga0495608_0030457_2738_3238 152
775 3300046514 Ga0495618_0138541 Ga0495618_0138541_622_1122 152
776 3300046516 Ga0495628_0041503 Ga0495628_0041503_2798_3298 152
777 3300046517 Ga0495630_0017664 Ga0495630_0017664_1882_2382 152
778 3300046522 Ga0495643_0088869 Ga0495643_0088869_384_911 152
779 3300046524 Ga0495648_0044019 Ga0495648_0044019_1873_2349 152
780 3300046526 Ga0495666_0067286 Ga0495666_0067286_787_1287 152
781 3300046529 Ga0495652_0270806 Ga0495652_0270806_269_769 152
782 3300046531 Ga0495665_0113047 Ga0495665_0113047_187_690 152
783 3300046533 Ga0495640_0037607 Ga0495640_0037607_1047_1547 152
784 3300046543 Ga0495645_0310305 Ga0495645_0310305_142_642 152
785 3300046558 Ga0495633_0027211 Ga0495633_0027211_1758_2234 152
786 3300046559 Ga0495667_0024475 Ga0495667_0024475_2970_3470 152
787 3300046615 Ga0495656_0290091 Ga0495656_0290091_338_814 152
788 3300046616 Ga0495668_0120771 Ga0495668_0120771_762_1238 152
789 3300046648 Ga0495611_0033998 Ga0495611_0033998_265_741 152
790 3300046660 Ga0495625_0317585 Ga0495625_0317585_275_751 152
791 3300046663 Ga0495635_0220023 Ga0495635_0220023_130_630 152
792 3300046665 Ga0495661_0082457 Ga0495661_0082457_1346_1822 152
793 3300046675 Ga0495657_0088066 Ga0495657_0088066_433_933 152
794 3300046678 Ga0495599_0190108 Ga0495599_0190108_471_971 152
795 3300046680 Ga0495646_0200692 Ga0495646_0200692_558_1058 152
796 3300046681 Ga0495647_0156202 Ga0495647_0156202_112_570 152
797 3300046684 Ga0495669_0010535 Ga0495669_0010535_666_1169 152
798 3300046684 Ga0495669_0192443 Ga0495669_0192443_34_528 152
799 3300046689 Ga0495613_0013199 Ga0495613_0013199_826_1326 152
800 3300046689 Ga0495613_0545267 Ga0495613_0545267_303_761 152
801 3300046690 Ga0495624_0484400 Ga0495624_0484400_143_643 152
802 3300046691 Ga0495670_0032853 Ga0495670_0032853_1835_2311 152
803 3300046691 Ga0495670_0187932 Ga0495670_0187932_180_638 152
804 3300046692 Ga0495671_0121734 Ga0495671_0121734_526_1002 152
805 3300046794 Ga0495589_0306109 Ga0495589_0306109_203_679 152
806 3300046809 Ga0495600_0096759 Ga0495600_0096759_1147_1647 152
807 3300047319 Ga0495674_0022180 Ga0495674_0022180_102_602 152
808 3300047321 Ga0495676_0734481 Ga0495676_0734481_165_623 152
809 3300047322 Ga0495680_0000756 Ga0495680_0000756_13626_14126 152
810 3300047446 Ga0495679_070161 Ga0495679_070161_80_556 152
811 3300047470 Ga0495681_0166282 Ga0495681_0166282_302_778 152
812 3300047472 Ga0495686_0238906 Ga0495686_0238906_370_846 152
813 3300048090 Ga0495615_0045113 Ga0495615_0045113_291_767 152
814 3300048091 Ga0495626_0163004 Ga0495626_0163004_362_838 152
815 3300048907 Ga0496104_0315073 Ga0496104_0315073_826_1332 152
816 3300048907 Ga0496104_1120492 Ga0496104_1120492_147_650 152
817 3300048907 Ga0496104_1267175 Ga0496104_1267175_103_606 152
818 3300048911 Ga0496108_0060695 Ga0496108_0060695_799_1302 152
819 3300048912 Ga0496109_0206711 Ga0496109_0206711_494_997 152
820 3300048915 Ga0496112_0008770 Ga0496112_0008770_3387_3890 152
821 3300048916 Ga0496113_0027550 Ga0496113_0027550_421_924 152
822 3300048918 Ga0496115_0046227 Ga0496115_0046227_2430_2936 152
823 3300048919 Ga0496116_0008239 Ga0496116_0008239_5537_6064 152
824 3300048924 Ga0496121_0006442 Ga0496121_0006442_11191_11718 152
825 3300048927 Ga0496124_0019059 Ga0496124_0019059_5489_6016 152
826 3300048929 Ga0496126_0563825 Ga0496126_0563825_167_673 152
827 3300049568 Ga0501031_0007537 Ga0501031_0007537_6489_6959 152
828 3300049569 Ga0501032_0000196 Ga0501032_0000196_7152_7622 152
829 3300049570 Ga0501033_0003209 Ga0501033_0003209_7115_7573 152
830 3300049570 Ga0501033_0789573 Ga0501033_0789573_105_563 152
831 3300049571 Ga0501034_0001151 Ga0501034_0001151_7152_7622 152
832 3300049572 Ga0501036_0009212 Ga0501036_0009212_7152_7622 152
833 3300049573 Ga0501037_0001377 Ga0501037_0001377_10187_10657 152
834 3300049574 Ga0501038_0001622 Ga0501038_0001622_6990_7460 152
835 3300049575 Ga0501039_0001302 Ga0501039_0001302_12987_13457 152
836 3300049579 Ga0501043_0000409 Ga0501043_0000409_31036_31506 152
837 3300049579 Ga0501043_1129224 Ga0501043_1129224_16_474 152
838 3300049580 Ga0501046_0000181 Ga0501046_0000181_7152_7622 152
839 3300049581 Ga0501047_0002426 Ga0501047_0002426_7152_7622 152
840 3300049581 Ga0501047_0476395 Ga0501047_0476395_585_1043 152
841 3300049582 Ga0501048_0003595 Ga0501048_0003595_4196_4666 152
842 3300049583 Ga0501067_0000145 Ga0501067_0000145_7107_7565 152
843 3300049584 Ga0501068_0002577 Ga0501068_0002577_4781_5251 152
844 3300049585 Ga0501069_0003759 Ga0501069_0003759_6568_7038 152
845 3300049585 Ga0501069_0630720 Ga0501069_0630720_22_480 152
846 3300049586 Ga0501070_0028493 Ga0501070_0028493_3720_4190 152
847 3300049587 Ga0501071_0094786 Ga0501071_0094786_547_1017 152
848 3300049588 Ga0501072_0017020 Ga0501072_0017020_4758_5228 152
849 3300049589 Ga0501073_0000027 Ga0501073_0000027_8195_8665 152
850 3300049589 Ga0501073_0453721 Ga0501073_0453721_114_578 152
851 3300049590 Ga0501074_0001347 Ga0501074_0001347_6647_7117 152
852 3300049592 Ga0501076_0275383 Ga0501076_0275383_38_508 152
853 3300049592 Ga0501076_1456036 Ga0501076_1456036_23_514 152
854 3300049742 Ga0501080_0002621 Ga0501080_0002621_7152_7622 152
855 3300049744 Ga0501083_0002123 Ga0501083_0002123_4382_4852 152
856 3300049822 Ga0501035_0001852 Ga0501035_0001852_7152_7622 152
857 3300049823 Ga0501044_0003498 Ga0501044_0003498_10059_10529 152
858 3300049824 Ga0501045_0014292 Ga0501045_0014292_460_930 152
859 3300050491 nmdc:mga00v17_174389_c1 nmdc:mga00v17_174389_c1_482_1027 152
860 3300050491 nmdc:mga00v17_469155_c1 nmdc:mga00v17_469155_c1_193_702 152
861 3300050492 nmdc:mga0yw44_249038_c1 nmdc:mga0yw44_249038_c1_528_986 152
862 3300050492 nmdc:mga0yw44_33973_c1 nmdc:mga0yw44_33973_c1_401_877 152
863 3300050492 nmdc:mga0yw44_51203_c1 nmdc:mga0yw44_51203_c1_1451_1915 152
864 3300050493 nmdc:mga0k408_19984_c1 nmdc:mga0k408_19984_c1_1033_1542 152
865 3300050494 nmdc:mga06z11_166516_c1 nmdc:mga06z11_166516_c1_298_774 152
866 3300050494 nmdc:mga06z11_26431_c1 nmdc:mga06z11_26431_c1_1789_2301 152
867 3300050495 nmdc:mga04h51_98384_c1 nmdc:mga04h51_98384_c1_80_592 152
868 3300050496 nmdc:mga07m45_296324_c1 nmdc:mga07m45_296324_c1_319_831 152
869 3300050496 nmdc:mga07m45_46561_c1 nmdc:mga07m45_46561_c1_683_1159 152
870 3300050507 nmdc:mga05p37_123970_c1 nmdc:mga05p37_123970_c1_519_1025 152
871 3300050512 nmdc:mga0n895_131371_c1 nmdc:mga0n895_131371_c1_285_791 152
872 3300050512 nmdc:mga0n895_150460_c1 nmdc:mga0n895_150460_c1_709_1212 152
873 3300050512 nmdc:mga0n895_337627_c1 nmdc:mga0n895_337627_c1_359_844 152
874 3300050512 nmdc:mga0n895_8089_c1 nmdc:mga0n895_8089_c1_6694_7224 152
875 3300050513 nmdc:mga0rr50_178234_c1 nmdc:mga0rr50_178234_c1_534_1037 152
876 3300050513 nmdc:mga0rr50_26047_c1 nmdc:mga0rr50_26047_c1_2219_2749 152
877 3300050515 nmdc:mga0a205_3536_c1 nmdc:mga0a205_3536_c1_12821_13351 152
878 3300050515 nmdc:mga0a205_37613_c1 nmdc:mga0a205_37613_c1_508_1014 152
879 3300050515 nmdc:mga0a205_44757_c1 nmdc:mga0a205_44757_c1_176_646 152
880 3300050515 nmdc:mga0a205_9896_c1 nmdc:mga0a205_9896_c1_552_1055 152
881 3300050516 nmdc:mga0sz30_443206_c1 nmdc:mga0sz30_443206_c1_11_556 152
882 3300053077 Ga0495601_0159538 Ga0495601_0159538_927_1427 152
883 3300053079 Ga0500610_0152431 Ga0500610_0152431_466_969 152
884 3300053084 Ga0495595_0227493 Ga0495595_0227493_371_871 152
885 3300053103 Ga0500555_003122 Ga0500555_003122_3403_3897 152
886 3300053730 Ga0500645_000647 Ga0500645_000647_16886_17380 152
887 3300054114 Ga0501084_0003235 Ga0501084_0003235_7530_8000 152
888 3300054114 Ga0501084_0488221 Ga0501084_0488221_510_1001 152
889 3300054114 Ga0501084_1322111 Ga0501084_1322111_97_561 152
890 3300060353 Ga0501082_0005376 Ga0501082_0005376_3493_3963 152
891 3300061734 Ga0530510_0232518 Ga0530510_0232518_293_784 152
892 iso_pu_bacteria 2510461076 2510900182 152
893 iso_pu_bacteria 2513237162 2514018826 152
894 iso_pu_bacteria 2515154113 2515633304 152
895 iso_pu_bacteria 2515154114 2515642529 152
896 iso_pu_bacteria 2515154116 2515658506 152
897 iso_pu_bacteria 2517287029 2517410879 152
898 iso_pu_bacteria 2585427528 2585539252 152
899 iso_pu_bacteria 2585427593 2585837206 152
900 iso_pu_bacteria 2738541333 2739033702 152
901 iso_pu_bacteria 2802429633 2806044799 152
902 iso_pu_bacteria 2802429634 2806054041 152
903 iso_pu_bacteria 2802429635 2806059867 152
904 iso_pu_bacteria 2802429636 2806066080 152
905 iso_pu_bacteria 2802429637 2806073338 152
906 iso_pu_bacteria 2996893221 2996896919 152
907 iso_pu_bacteria 8005570704 8005576341 152

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02627

CMD

Carboxymuconolactone decarboxylase family

21

102

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
7xw1-assembly1.cif.gz_A the crystal structure of ahpd from pseudomonas aeruginosa 0.9632 12 145
2ijc-assembly2.cif.gz_I structure of a conserved protein of unknown function pa0269 from pseudomonas aeruginosa 0.9522 1 147
7xw1-assembly1.cif.gz_A the crystal structure of ahpd from pseudomonas aeruginosa 0.9493 12 145
2ijc-assembly2.cif.gz_I structure of a conserved protein of unknown function pa0269 from pseudomonas aeruginosa 0.9396 1 147
2gmy-assembly1.cif.gz_C crystal structure of a protein of unknown function atu0492 from agrobacterium tumefaciens, putative antioxidant defence protein ahpd 0.9187 2 150
ID Description Score Start End Superfamily
2o4dA00 Mainly Alpha;Up-down Bundle;AhpD-like;AhpD-like 0.9564 9 142 1.20.1290.10
2ijcF00 Mainly Alpha;Up-down Bundle;AhpD-like;AhpD-like 0.9554 9 142 1.20.1290.10
af_Q2FVE0_2_139_1.20.1290.10 Mainly Alpha;Up-down Bundle;AhpD-like;AhpD-like 0.9222 5 145 1.20.1290.10
af_Q2FVE0_2_139_1.20.1290.10 Mainly Alpha;Up-down Bundle;AhpD-like;AhpD-like 0.9159 5 145 1.20.1290.10
2gmyF00 Mainly Alpha;Up-down Bundle;AhpD-like;AhpD-like 0.9135 2 151 1.20.1290.10
ID Description Score Start End GO Terms
AF-A0A4V3MQQ2-F1-model_v4 deleted 0.9968 37 134
AF-A0A7Y6PXN4-F1-model_v4 Carboxymuconolactone decarboxylase family protein 0.9887 1 140 GO:0051920
AF-A0A109K3L9-F1-model_v4 Alkylhydroperoxidase 0.9877 1 152 GO:0051920
AF-Q1IKT6-F1-model_v4 Alkylhydroperoxidase AhpD 0.9867 1 150 GO:0051920
AF-A0A023XRL7-F1-model_v4 deleted 0.9866 1 152

Feature Viewer

pLDDT pTM Quality
96.64 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map