F485356
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 907 | 355 | 1814 | 299 |
Family's Representative Sequence
| Representative Sequence | 3300025934|Ga0207686_10010446|Ga0207686_100104464 |
| Length | 350 |
| Sequence | LDGLAGARHMHGARIPRDTRDDRSRPRRCQCNDHKPPGHPSTNEYSELAHAFDNERGVPELPDITIYLESLSRRVLSRMLEKLRLASPFVLRTVEPAPSDVAGKRVIGLRRLGKRIVFELEGSVFIVVHLMIAGRFKWLPKGAKVPAKVGLAAFDFDNGTLLLTEAGSKRRASIHIVRGEEALHALDPGGMDVLDATLEEFRDALTRERHTLKRTLTDPHVFSGIGNAYSDEILHRARLSPVQLTTNLSAEEIERLHRATRETLIEWIDRLRAETGAGFPEKVTAFRPEMKVHGRYNQPCPDCGTPVQRIVYAENETNYCARCQTGGRLLADRALSRLLHGDWPKSIDEL |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 2 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 3 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 4 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 5 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 6 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 7 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 9 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 10 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 12 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 14 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 15 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 16 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 17 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 18 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 20 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 28 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 29 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 33 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 37 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 38 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 39 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 40 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 41 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 42 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 43 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 44 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 45 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 46 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 48 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 49 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 53 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 54 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 55 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 56 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 57 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 59 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 60 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 61 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 62 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 63 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 64 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 65 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 66 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 67 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 68 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 69 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 70 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 72 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 73 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 74 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 75 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 77 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 78 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 79 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 80 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 81 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 82 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 83 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 84 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 85 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 86 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 88 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 89 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 115 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 116 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 117 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300027364 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300027617 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 180 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 184 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 185 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 186 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 187 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 188 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 189 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 190 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 191 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 192 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 193 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 194 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 195 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 196 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 197 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 198 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 199 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 200 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 201 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 202 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 203 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 204 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 205 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 206 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 207 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 208 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 209 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 210 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 211 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 212 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 213 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 214 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 215 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 216 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 217 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 218 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 219 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 220 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 221 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 222 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 223 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 224 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 225 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 226 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 227 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 228 | 3300038735 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 | Metagenome | Unclassified |
| 229 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 230 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 231 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 232 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 233 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 234 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 235 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 236 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 237 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 238 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 239 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 240 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 241 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 242 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 243 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 244 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 245 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 246 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 247 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 248 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 249 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 250 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 281 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 282 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 283 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 284 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 285 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 286 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 287 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 288 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 289 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 290 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 291 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 292 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 293 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 295 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 296 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 297 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 298 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 299 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 300 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 301 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 302 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 303 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 304 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 305 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 306 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 307 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 308 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 309 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 310 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 311 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 312 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 313 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 314 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 315 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 316 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 317 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 318 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 319 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 320 | 3300049677 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control | Metagenome | Rhizosphere |
| 321 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 322 | 3300049684 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_B_3_control | Metagenome | Rhizosphere |
| 323 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 324 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 325 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 326 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 327 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 328 | 3300049765 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought | Metagenome | Rhizosphere |
| 329 | 3300049770 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control | Metagenome | Rhizosphere |
| 330 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 331 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 332 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 333 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 334 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 335 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 336 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 337 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 338 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 339 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 340 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 341 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 342 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 343 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 344 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 345 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300053102 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere | Metagenome | Endosphere |
| 347 | 3300053129 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere | Metagenome | Endosphere |
| 348 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 349 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 350 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 351 | 3300059423 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 352 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 353 | 3300059426 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 354 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 355 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.54 |
| Nodule | 0 |
| Rhizoplane | 2.76 |
| Rhizosphere | 93.61 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 5.18 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0207686_10010446 | 3300025934 | Bacteria | 5056 |
| 2 | rootH1_10155700 | 3300003323 | Bacteria | 2605 |
| 3 | Ga0065704_10176406 | 3300005289 | Unclassified | 1226 |
| 4 | Ga0065712_10011198 | 3300005290 | Bacteria | 2750 |
| 5 | Ga0065712_10074964 | 3300005290 | Bacteria | 3961 |
| 6 | Ga0065712_10077390 | 3300005290 | Bacteria | 3504 |
| 7 | Ga0065715_10009291 | 3300005293 | Bacteria | 4296 |
| 8 | Ga0065707_10027840 | 3300005295 | Bacteria | 1698 |
| 9 | Ga0065707_10089357 | 3300005295 | Bacteria | 4392 |
| 10 | Ga0065707_10115073 | 3300005295 | Bacteria | 2278 |
| 11 | Ga0070676_10119404 | 3300005328 | Bacteria | 1653 |
| 12 | Ga0070683_100000009 | 3300005329 | Bacteria | 319830 |
| 13 | Ga0070683_100163687 | 3300005329 | Unclassified | 2110 |
| 14 | Ga0070683_100244884 | 3300005329 | Bacteria | 1705 |
| 15 | Ga0070690_100052883 | 3300005330 | Unclassified | 2597 |
| 16 | Ga0070670_100001199 | 3300005331 | Bacteria | 20587 |
| 17 | Ga0070670_100001395 | 3300005331 | Bacteria | 19372 |
| 18 | Ga0068869_100005352 | 3300005334 | Bacteria | 8070 |
| 19 | Ga0070666_10084005 | 3300005335 | Unclassified | 2179 |
| 20 | Ga0070680_100002990 | 3300005336 | Bacteria | 12553 |
| 21 | Ga0070680_100205539 | 3300005336 | Unclassified | 1661 |
| 22 | Ga0070682_100000002 | 3300005337 | Bacteria | 506802 |
| 23 | Ga0070682_100071431 | 3300005337 | Unclassified | 2221 |
| 24 | Ga0068868_100000377 | 3300005338 | Bacteria | 30391 |
| 25 | Ga0068868_100000861 | 3300005338 | Bacteria | 20539 |
| 26 | Ga0068868_100064139 | 3300005338 | Unclassified | 2916 |
| 27 | Ga0068868_100120255 | 3300005338 | Bacteria | 2142 |
| 28 | Ga0068868_100269506 | 3300005338 | Unclassified | 1438 |
| 29 | Ga0070689_100000221 | 3300005340 | Bacteria | 34041 |
| 30 | Ga0070689_100008938 | 3300005340 | Bacteria | 7087 |
| 31 | Ga0070689_100053714 | 3300005340 | Bacteria | 3118 |
| 32 | Ga0070689_100094076 | 3300005340 | Bacteria | 2366 |
| 33 | Ga0070687_100005462 | 3300005343 | Bacteria | 5149 |
| 34 | Ga0070687_100014423 | 3300005343 | Bacteria | 3549 |
| 35 | Ga0070687_100094085 | 3300005343 | Bacteria | 1664 |
| 36 | Ga0070661_100002737 | 3300005344 | Bacteria | 12083 |
| 37 | Ga0070661_100004746 | 3300005344 | Bacteria | 9350 |
| 38 | Ga0070661_100100930 | 3300005344 | Bacteria | 2146 |
| 39 | Ga0070661_100232048 | 3300005344 | Bacteria | 1419 |
| 40 | Ga0070692_10000995 | 3300005345 | Bacteria | 9715 |
| 41 | Ga0070692_10001370 | 3300005345 | Bacteria | 8797 |
| 42 | Ga0070692_10022352 | 3300005345 | Bacteria | 3088 |
| 43 | Ga0070692_10080430 | 3300005345 | Bacteria | 1754 |
| 44 | Ga0070668_100020312 | 3300005347 | Bacteria | 5011 |
| 45 | Ga0070668_100034634 | 3300005347 | Bacteria | 3849 |
| 46 | Ga0070668_100161758 | 3300005347 | Bacteria | 1817 |
| 47 | Ga0070669_100013467 | 3300005353 | Bacteria | 5814 |
| 48 | Ga0070669_100024518 | 3300005353 | Bacteria | 4325 |
| 49 | Ga0070669_100028008 | 3300005353 | Bacteria | 4056 |
| 50 | Ga0070669_100174085 | 3300005353 | Bacteria | 1680 |
| 51 | Ga0070675_100000001 | 3300005354 | Bacteria | 448137 |
| 52 | Ga0070675_100006978 | 3300005354 | Bacteria | 8677 |
| 53 | Ga0070675_100080660 | 3300005354 | Unclassified | 2712 |
| 54 | Ga0070675_100106590 | 3300005354 | Bacteria | 2366 |
| 55 | Ga0070675_100160839 | 3300005354 | Bacteria | 1931 |
| 56 | Ga0070671_100071178 | 3300005355 | Bacteria | 2902 |
| 57 | Ga0070671_100072579 | 3300005355 | Unclassified | 2875 |
| 58 | Ga0070671_100094601 | 3300005355 | Bacteria | 2504 |
| 59 | Ga0070674_100020618 | 3300005356 | Bacteria | 4216 |
| 60 | Ga0070674_100023949 | 3300005356 | Bacteria | 3958 |
| 61 | Ga0070673_100000230 | 3300005364 | Bacteria | 28084 |
| 62 | Ga0070673_100133312 | 3300005364 | Bacteria | 2088 |
| 63 | Ga0070673_100317711 | 3300005364 | Bacteria | 1375 |
| 64 | Ga0070667_100012379 | 3300005367 | Bacteria | 7058 |
| 65 | Ga0070667_100044260 | 3300005367 | Bacteria | 3737 |
| 66 | Ga0070667_100066313 | 3300005367 | Bacteria | 3067 |
| 67 | Ga0070713_100557365 | 3300005436 | Bacteria | 1086 |
| 68 | Ga0070701_10002708 | 3300005438 | Bacteria | 6871 |
| 69 | Ga0070701_10224405 | 3300005438 | Bacteria | 1122 |
| 70 | Ga0070711_100054697 | 3300005439 | Bacteria | 2755 |
| 71 | Ga0070705_100000197 | 3300005440 | Bacteria | 35753 |
| 72 | Ga0070705_100007788 | 3300005440 | Bacteria | 5289 |
| 73 | Ga0070705_100200440 | 3300005440 | Bacteria | 1368 |
| 74 | Ga0070700_100000016 | 3300005441 | Bacteria | 147213 |
| 75 | Ga0070700_100014842 | 3300005441 | Bacteria | 4403 |
| 76 | Ga0070700_100035906 | 3300005441 | Bacteria | 3003 |
| 77 | Ga0070700_100255807 | 3300005441 | Bacteria | 1259 |
| 78 | Ga0070694_100004663 | 3300005444 | Bacteria | 8246 |
| 79 | Ga0070694_100020654 | 3300005444 | Bacteria | 4200 |
| 80 | Ga0070663_100012255 | 3300005455 | Bacteria | 5415 |
| 81 | Ga0070663_100179544 | 3300005455 | Bacteria | 1641 |
| 82 | Ga0070678_100047206 | 3300005456 | Bacteria | 3093 |
| 83 | Ga0070662_100000129 | 3300005457 | Bacteria | 42187 |
| 84 | Ga0070662_100009245 | 3300005457 | Bacteria | 6439 |
| 85 | Ga0070662_100085495 | 3300005457 | Unclassified | 2357 |
| 86 | Ga0070662_100228089 | 3300005457 | Bacteria | 1489 |
| 87 | Ga0070662_100268899 | 3300005457 | Bacteria | 1376 |
| 88 | Ga0070681_10065137 | 3300005458 | Bacteria | 3613 |
| 89 | Ga0070681_10080349 | 3300005458 | Unclassified | 3216 |
| 90 | Ga0068867_100001848 | 3300005459 | Bacteria | 14724 |
| 91 | Ga0068867_100030538 | 3300005459 | Bacteria | 3886 |
| 92 | Ga0070685_10001230 | 3300005466 | Bacteria | 13608 |
| 93 | Ga0070685_10010204 | 3300005466 | Bacteria | 4876 |
| 94 | Ga0070706_100000427 | 3300005467 | Bacteria | 50722 |
| 95 | Ga0070706_100166479 | 3300005467 | Bacteria | 2058 |
| 96 | Ga0070707_100058035 | 3300005468 | Bacteria | 3713 |
| 97 | Ga0070707_100160672 | 3300005468 | Bacteria | 2189 |
| 98 | Ga0070707_100289473 | 3300005468 | Bacteria | 1592 |
| 99 | Ga0070698_100026417 | 3300005471 | Bacteria | 6044 |
| 100 | Ga0070698_100126946 | 3300005471 | Bacteria | 2508 |
| 101 | Ga0070698_100302146 | 3300005471 | Unclassified | 1531 |
| 102 | Ga0070679_100001387 | 3300005530 | Bacteria | 21320 |
| 103 | Ga0070679_100355753 | 3300005530 | Bacteria | 1412 |
| 104 | Ga0070684_100000094 | 3300005535 | Bacteria | 57284 |
| 105 | Ga0070684_100019474 | 3300005535 | Bacteria | 5614 |
| 106 | Ga0070684_100083008 | 3300005535 | Bacteria | 2838 |
| 107 | Ga0070684_100097856 | 3300005535 | Bacteria | 2617 |
| 108 | Ga0070697_100014285 | 3300005536 | Bacteria | 6241 |
| 109 | Ga0070697_100037008 | 3300005536 | Bacteria | 3942 |
| 110 | Ga0070697_100163088 | 3300005536 | Bacteria | 1884 |
| 111 | Ga0068853_100020611 | 3300005539 | Bacteria | 5483 |
| 112 | Ga0068853_100035163 | 3300005539 | Bacteria | 4255 |
| 113 | Ga0068853_100063775 | 3300005539 | Bacteria | 3192 |
| 114 | Ga0070672_100001997 | 3300005543 | Bacteria | 12805 |
| 115 | Ga0070672_100059487 | 3300005543 | Bacteria | 3006 |
| 116 | Ga0070672_100093635 | 3300005543 | Bacteria | 2428 |
| 117 | Ga0070672_100323718 | 3300005543 | Bacteria | 1311 |
| 118 | Ga0070686_100000009 | 3300005544 | Bacteria | 202453 |
| 119 | Ga0070686_100077740 | 3300005544 | Unclassified | 2189 |
| 120 | Ga0070686_100290205 | 3300005544 | Bacteria | 1210 |
| 121 | Ga0070695_100003784 | 3300005545 | Bacteria | 8823 |
| 122 | Ga0070695_100005474 | 3300005545 | Bacteria | 7476 |
| 123 | Ga0070695_100061426 | 3300005545 | Bacteria | 2438 |
| 124 | Ga0070695_100095255 | 3300005545 | Unclassified | 1995 |
| 125 | Ga0070695_100193247 | 3300005545 | Bacteria | 1450 |
| 126 | Ga0070696_100000254 | 3300005546 | Bacteria | 32244 |
| 127 | Ga0070696_100048899 | 3300005546 | Bacteria | 2936 |
| 128 | Ga0070696_100063849 | 3300005546 | Bacteria | 2580 |
| 129 | Ga0070693_100042820 | 3300005547 | Bacteria | 2553 |
| 130 | Ga0070693_100096669 | 3300005547 | Bacteria | 1791 |
| 131 | Ga0070665_100104764 | 3300005548 | Bacteria | 2830 |
| 132 | Ga0070704_100005518 | 3300005549 | Bacteria | 7375 |
| 133 | Ga0070704_100014146 | 3300005549 | Bacteria | 4977 |
| 134 | Ga0070704_100046314 | 3300005549 | Bacteria | 3032 |
| 135 | Ga0070704_100094339 | 3300005549 | Bacteria | 2238 |
| 136 | Ga0070704_100123912 | 3300005549 | Bacteria | 1990 |
| 137 | Ga0068855_100016998 | 3300005563 | Bacteria | 8749 |
| 138 | Ga0068855_100077632 | 3300005563 | Bacteria | 3853 |
| 139 | Ga0068855_100493225 | 3300005563 | Unclassified | 1332 |
| 140 | Ga0068857_100013779 | 3300005577 | Bacteria | 7044 |
| 141 | Ga0068857_100016849 | 3300005577 | Bacteria | 6402 |
| 142 | Ga0068857_100020173 | 3300005577 | Bacteria | 5859 |
| 143 | Ga0068857_100095083 | 3300005577 | Bacteria | 2669 |
| 144 | Ga0068854_100011847 | 3300005578 | Bacteria | 5695 |
| 145 | Ga0068854_100235377 | 3300005578 | Bacteria | 1456 |
| 146 | Ga0068854_100330857 | 3300005578 | Bacteria | 1241 |
| 147 | Ga0068856_100019410 | 3300005614 | Bacteria | 6597 |
| 148 | Ga0070702_100008092 | 3300005615 | Bacteria | 5078 |
| 149 | Ga0070702_100030542 | 3300005615 | Bacteria | 2939 |
| 150 | Ga0070702_100133804 | 3300005615 | Bacteria | 1570 |
| 151 | Ga0068852_100090771 | 3300005616 | Bacteria | 2732 |
| 152 | Ga0068852_100409856 | 3300005616 | Bacteria | 1335 |
| 153 | Ga0068859_100001562 | 3300005617 | Bacteria | 23360 |
| 154 | Ga0068859_100168514 | 3300005617 | Bacteria | 2270 |
| 155 | Ga0068859_100276083 | 3300005617 | Bacteria | 1773 |
| 156 | Ga0068864_100000070 | 3300005618 | Bacteria | 113700 |
| 157 | Ga0068864_100119128 | 3300005618 | Unclassified | 2358 |
| 158 | Ga0068864_100155492 | 3300005618 | Bacteria | 2075 |
| 159 | Ga0068866_10137497 | 3300005718 | Bacteria | 1398 |
| 160 | Ga0068861_100028499 | 3300005719 | Bacteria | 4074 |
| 161 | Ga0068861_100056019 | 3300005719 | Bacteria | 3008 |
| 162 | Ga0068870_10055563 | 3300005840 | Unclassified | 2110 |
| 163 | Ga0068863_100034302 | 3300005841 | Bacteria | 4834 |
| 164 | Ga0068863_100085971 | 3300005841 | Bacteria | 2980 |
| 165 | Ga0068863_100213845 | 3300005841 | Bacteria | 1857 |
| 166 | Ga0068858_100001717 | 3300005842 | Bacteria | 22394 |
| 167 | Ga0068858_100485203 | 3300005842 | Bacteria | 1193 |
| 168 | Ga0068860_100009869 | 3300005843 | Bacteria | 9464 |
| 169 | Ga0068860_100013040 | 3300005843 | Bacteria | 8159 |
| 170 | Ga0068860_100098565 | 3300005843 | Bacteria | 2787 |
| 171 | Ga0068860_100125244 | 3300005843 | Bacteria | 2462 |
| 172 | Ga0068862_100003150 | 3300005844 | Bacteria | 14328 |
| 173 | Ga0081455_10024914 | 3300005937 | Bacteria | 5530 |
| 174 | Ga0081539_10000083 | 3300005985 | Bacteria | 218881 |
| 175 | Ga0070717_10000177 | 3300006028 | Bacteria | 47916 |
| 176 | Ga0070717_10244600 | 3300006028 | Unclassified | 1583 |
| 177 | Ga0070716_100105245 | 3300006173 | Bacteria | 1738 |
| 178 | Ga0070712_100054865 | 3300006175 | Bacteria | 2788 |
| 179 | Ga0070712_100075185 | 3300006175 | Bacteria | 2429 |
| 180 | Ga0070712_100204337 | 3300006175 | Bacteria | 1554 |
| 181 | Ga0075362_10012845 | 3300006177 | Bacteria | 3338 |
| 182 | Ga0075362_10112937 | 3300006177 | Bacteria | 1280 |
| 183 | Ga0075366_10035490 | 3300006195 | Bacteria | 2939 |
| 184 | Ga0075366_10081882 | 3300006195 | Bacteria | 1929 |
| 185 | Ga0097621_100045898 | 3300006237 | Bacteria | 3531 |
| 186 | Ga0097621_100204879 | 3300006237 | Bacteria | 1714 |
| 187 | Ga0075370_10020240 | 3300006353 | Bacteria | 3635 |
| 188 | Ga0068871_100010973 | 3300006358 | Bacteria | 6635 |
| 189 | Ga0068871_100122296 | 3300006358 | Bacteria | 2200 |
| 190 | Ga0068871_100194438 | 3300006358 | Unclassified | 1749 |
| 191 | Ga0068871_100211552 | 3300006358 | Bacteria | 1677 |
| 192 | Ga0075428_100006479 | 3300006844 | Bacteria | 13021 |
| 193 | Ga0075428_100030631 | 3300006844 | Bacteria | 5949 |
| 194 | Ga0075428_100228818 | 3300006844 | Bacteria | 2006 |
| 195 | Ga0075428_100229716 | 3300006844 | Bacteria | 2002 |
| 196 | Ga0075430_100015734 | 3300006846 | Bacteria | 6443 |
| 197 | Ga0075430_100065567 | 3300006846 | Bacteria | 3050 |
| 198 | Ga0075430_100108342 | 3300006846 | Bacteria | 2318 |
| 199 | Ga0075431_100003456 | 3300006847 | Bacteria | 15325 |
| 200 | Ga0075431_100015760 | 3300006847 | Bacteria | 7663 |
| 201 | Ga0075431_100045887 | 3300006847 | Bacteria | 4504 |
| 202 | Ga0075431_100210102 | 3300006847 | Bacteria | 1988 |
| 203 | Ga0075431_100247529 | 3300006847 | Bacteria | 1812 |
| 204 | Ga0075431_100262268 | 3300006847 | Bacteria | 1753 |
| 205 | Ga0075433_10051080 | 3300006852 | Bacteria | 3600 |
| 206 | Ga0075433_10055293 | 3300006852 | Bacteria | 3464 |
| 207 | Ga0075433_10077077 | 3300006852 | Bacteria | 2936 |
| 208 | Ga0075434_100027844 | 3300006871 | Bacteria | 5549 |
| 209 | Ga0075434_100051917 | 3300006871 | Bacteria | 4074 |
| 210 | Ga0075434_100067804 | 3300006871 | Unclassified | 3554 |
| 211 | Ga0075434_100080464 | 3300006871 | Bacteria | 3255 |
| 212 | Ga0075434_100085011 | 3300006871 | Bacteria | 3163 |
| 213 | Ga0075434_100173005 | 3300006871 | Bacteria | 2179 |
| 214 | Ga0075434_100185896 | 3300006871 | Bacteria | 2098 |
| 215 | Ga0075434_100328261 | 3300006871 | Bacteria | 1550 |
| 216 | Ga0075434_100528829 | 3300006871 | Bacteria | 1199 |
| 217 | Ga0075429_100039399 | 3300006880 | Bacteria | 4113 |
| 218 | Ga0075429_100164091 | 3300006880 | Bacteria | 1946 |
| 219 | Ga0068865_100000282 | 3300006881 | Bacteria | 28062 |
| 220 | Ga0075436_100010907 | 3300006914 | Bacteria | 6237 |
| 221 | Ga0075436_100017775 | 3300006914 | Bacteria | 4869 |
| 222 | Ga0075436_100159021 | 3300006914 | Bacteria | 1592 |
| 223 | Ga0097620_100001562 | 3300006931 | Bacteria | 23360 |
| 224 | Ga0097620_100168508 | 3300006931 | Bacteria | 2270 |
| 225 | Ga0097620_100276105 | 3300006931 | Bacteria | 1773 |
| 226 | Ga0075435_100000379 | 3300007076 | Bacteria | 27161 |
| 227 | Ga0075435_100002040 | 3300007076 | Bacteria | 13228 |
| 228 | Ga0075435_100003685 | 3300007076 | Bacteria | 10433 |
| 229 | Ga0075435_100022231 | 3300007076 | Bacteria | 4891 |
| 230 | Ga0099794_10000032 | 3300007265 | Bacteria | 57885 |
| 231 | Ga0105240_10047004 | 3300009093 | Bacteria | 5463 |
| 232 | Ga0105240_10465996 | 3300009093 | Bacteria | 1411 |
| 233 | Ga0105240_10689041 | 3300009093 | Bacteria | 1116 |
| 234 | Ga0111539_10000034 | 3300009094 | Bacteria | 154474 |
| 235 | Ga0111539_10004237 | 3300009094 | Bacteria | 18801 |
| 236 | Ga0111539_10067757 | 3300009094 | Bacteria | 4214 |
| 237 | Ga0111539_10112708 | 3300009094 | Bacteria | 3190 |
| 238 | Ga0111539_10144514 | 3300009094 | Bacteria | 2785 |
| 239 | Ga0111539_10176025 | 3300009094 | Bacteria | 2499 |
| 240 | Ga0111539_10872628 | 3300009094 | Bacteria | 1047 |
| 241 | Ga0105245_10000027 | 3300009098 | Bacteria | 162116 |
| 242 | Ga0105245_10000383 | 3300009098 | Bacteria | 41164 |
| 243 | Ga0105245_10005726 | 3300009098 | Bacteria | 10912 |
| 244 | Ga0114129_10002244 | 3300009147 | Bacteria | 26680 |
| 245 | Ga0114129_10011249 | 3300009147 | Bacteria | 12757 |
| 246 | Ga0114129_10022321 | 3300009147 | Bacteria | 8984 |
| 247 | Ga0114129_10027675 | 3300009147 | Bacteria | 8027 |
| 248 | Ga0114129_10048826 | 3300009147 | Bacteria | 5949 |
| 249 | Ga0114129_10058803 | 3300009147 | Bacteria | 5377 |
| 250 | Ga0114129_10114571 | 3300009147 | Bacteria | 3717 |
| 251 | Ga0114129_10119762 | 3300009147 | Bacteria | 3625 |
| 252 | Ga0114129_10133847 | 3300009147 | Bacteria | 3403 |
| 253 | Ga0114129_10141151 | 3300009147 | Bacteria | 3302 |
| 254 | Ga0114129_10146658 | 3300009147 | Bacteria | 3232 |
| 255 | Ga0114129_10170293 | 3300009147 | Bacteria | 2970 |
| 256 | Ga0114129_10231773 | 3300009147 | Bacteria | 2487 |
| 257 | Ga0114129_10589111 | 3300009147 | Bacteria | 1442 |
| 258 | Ga0114129_10663844 | 3300009147 | Bacteria | 1344 |
| 259 | Ga0114129_10835634 | 3300009147 | Bacteria | 1172 |
| 260 | Ga0105243_10067914 | 3300009148 | Bacteria | 2872 |
| 261 | Ga0105241_10004856 | 3300009174 | Bacteria | 9915 |
| 262 | Ga0105242_10000164 | 3300009176 | Bacteria | 49988 |
| 263 | Ga0105242_10195738 | 3300009176 | Bacteria | 1792 |
| 264 | Ga0105242_10228500 | 3300009176 | Bacteria | 1666 |
| 265 | Ga0105242_10242424 | 3300009176 | Unclassified | 1621 |
| 266 | Ga0105242_10315436 | 3300009176 | Bacteria | 1432 |
| 267 | Ga0105248_10030015 | 3300009177 | Bacteria | 6068 |
| 268 | Ga0105248_10054282 | 3300009177 | Bacteria | 4493 |
| 269 | Ga0105248_10063968 | 3300009177 | Bacteria | 4130 |
| 270 | Ga0105248_10117461 | 3300009177 | Bacteria | 3000 |
| 271 | Ga0105248_10132293 | 3300009177 | Bacteria | 2815 |
| 272 | Ga0105248_10164853 | 3300009177 | Bacteria | 2499 |
| 273 | Ga0105248_10188949 | 3300009177 | Bacteria | 2321 |
| 274 | Ga0105248_10443791 | 3300009177 | Bacteria | 1462 |
| 275 | Ga0105248_10554462 | 3300009177 | Bacteria | 1297 |
| 276 | Ga0105237_10020826 | 3300009545 | Bacteria | 6753 |
| 277 | Ga0105237_10522468 | 3300009545 | Bacteria | 1194 |
| 278 | Ga0105238_10000001 | 3300009551 | Bacteria | 2036163 |
| 279 | Ga0105238_10000108 | 3300009551 | Bacteria | 90287 |
| 280 | Ga0105238_10005742 | 3300009551 | Bacteria | 12273 |
| 281 | Ga0105238_10139119 | 3300009551 | Bacteria | 2405 |
| 282 | Ga0105249_10047058 | 3300009553 | Bacteria | 3929 |
| 283 | Ga0105249_10307860 | 3300009553 | Bacteria | 1591 |
| 284 | Ga0105249_10521648 | 3300009553 | Bacteria | 1235 |
| 285 | Ga0105249_10656225 | 3300009553 | Bacteria | 1107 |
| 286 | Ga0105239_10011332 | 3300010375 | Bacteria | 9952 |
| 287 | Ga0105239_10085960 | 3300010375 | Bacteria | 3467 |
| 288 | Ga0105239_10251805 | 3300010375 | Bacteria | 1984 |
| 289 | Ga0105246_10007835 | 3300011119 | Bacteria | 6553 |
| 290 | Ga0105246_10025979 | 3300011119 | Bacteria | 3819 |
| 291 | Ga0157373_10055087 | 3300013100 | Bacteria | 2825 |
| 292 | Ga0157371_10018331 | 3300013102 | Bacteria | 5177 |
| 293 | Ga0157374_10000005 | 3300013296 | Bacteria | 646767 |
| 294 | Ga0157374_10003277 | 3300013296 | Bacteria | 13601 |
| 295 | Ga0157374_10132391 | 3300013296 | Bacteria | 2414 |
| 296 | Ga0157374_10142440 | 3300013296 | Bacteria | 2327 |
| 297 | Ga0157378_10003838 | 3300013297 | Bacteria | 13296 |
| 298 | Ga0157378_10007395 | 3300013297 | Bacteria | 9594 |
| 299 | Ga0163162_10004825 | 3300013306 | Bacteria | 13012 |
| 300 | Ga0163162_10018184 | 3300013306 | Bacteria | 6883 |
| 301 | Ga0163162_10164803 | 3300013306 | Bacteria | 2340 |
| 302 | Ga0163162_10428833 | 3300013306 | Bacteria | 1454 |
| 303 | Ga0163162_10870788 | 3300013306 | Bacteria | 1015 |
| 304 | Ga0157372_10003786 | 3300013307 | Bacteria | 16243 |
| 305 | Ga0157375_10000004 | 3300013308 | Bacteria | 474935 |
| 306 | Ga0157375_10000103 | 3300013308 | Bacteria | 85339 |
| 307 | Ga0157375_10008426 | 3300013308 | Bacteria | 9030 |
| 308 | Ga0157375_10078162 | 3300013308 | Bacteria | 3341 |
| 309 | Ga0157375_10096670 | 3300013308 | Unclassified | 3027 |
| 310 | Ga0163163_10000008 | 3300014325 | Bacteria | 286490 |
| 311 | Ga0163163_10003990 | 3300014325 | Bacteria | 12591 |
| 312 | Ga0163163_10025642 | 3300014325 | Bacteria | 5621 |
| 313 | Ga0163163_10037695 | 3300014325 | Bacteria | 4705 |
| 314 | Ga0163163_10050994 | 3300014325 | Bacteria | 4078 |
| 315 | Ga0163163_10147521 | 3300014325 | Unclassified | 2397 |
| 316 | Ga0163163_10360508 | 3300014325 | Bacteria | 1510 |
| 317 | Ga0163163_10505072 | 3300014325 | Bacteria | 1271 |
| 318 | Ga0157380_10037844 | 3300014326 | Bacteria | 3742 |
| 319 | Ga0157377_10000001 | 3300014745 | Bacteria | 623098 |
| 320 | Ga0157377_10000155 | 3300014745 | Bacteria | 42108 |
| 321 | Ga0157377_10002118 | 3300014745 | Bacteria | 8730 |
| 322 | Ga0157379_10107538 | 3300014968 | Bacteria | 2504 |
| 323 | Ga0157379_10193181 | 3300014968 | Bacteria | 1840 |
| 324 | Ga0157376_10000011 | 3300014969 | Bacteria | 307434 |
| 325 | Ga0157376_10027416 | 3300014969 | Bacteria | 4515 |
| 326 | Ga0157376_10116853 | 3300014969 | Bacteria | 2358 |
| 327 | Ga0182007_10066144 | 3300015262 | Bacteria | 1184 |
| 328 | Ga0213876_10000064 | 3300021384 | Bacteria | 128492 |
| 329 | Ga0213876_10011720 | 3300021384 | Bacteria | 4678 |
| 330 | Ga0209051_1036215 | 3300025303 | Bacteria | 1825 |
| 331 | Ga0207697_10029539 | 3300025315 | Bacteria | 2243 |
| 332 | Ga0207656_10115430 | 3300025321 | Unclassified | 1245 |
| 333 | Ga0207653_10000903 | 3300025885 | Bacteria | 9860 |
| 334 | Ga0207688_10213227 | 3300025901 | Unclassified | 1161 |
| 335 | Ga0207647_10124919 | 3300025904 | Bacteria | 1515 |
| 336 | Ga0207645_10038973 | 3300025907 | Bacteria | 3045 |
| 337 | Ga0207645_10076763 | 3300025907 | Bacteria | 2140 |
| 338 | Ga0207643_10194613 | 3300025908 | Unclassified | 1232 |
| 339 | Ga0207705_10091663 | 3300025909 | Bacteria | 2226 |
| 340 | Ga0207684_10004682 | 3300025910 | Bacteria | 12849 |
| 341 | Ga0207654_10025696 | 3300025911 | Unclassified | 3180 |
| 342 | Ga0207707_10012311 | 3300025912 | Bacteria | 7435 |
| 343 | Ga0207707_10012577 | 3300025912 | Bacteria | 7355 |
| 344 | Ga0207707_10112540 | 3300025912 | Unclassified | 2380 |
| 345 | Ga0207695_10017334 | 3300025913 | Bacteria | 8384 |
| 346 | Ga0207671_10016209 | 3300025914 | Bacteria | 5801 |
| 347 | Ga0207693_10067186 | 3300025915 | Bacteria | 2807 |
| 348 | Ga0207693_10093698 | 3300025915 | Bacteria | 2354 |
| 349 | Ga0207663_10228268 | 3300025916 | Bacteria | 1359 |
| 350 | Ga0207660_10002208 | 3300025917 | Bacteria | 12886 |
| 351 | Ga0207660_10002302 | 3300025917 | Bacteria | 12580 |
| 352 | Ga0207660_10052099 | 3300025917 | Bacteria | 2912 |
| 353 | Ga0207660_10233433 | 3300025917 | Bacteria | 1447 |
| 354 | Ga0207662_10001174 | 3300025918 | Bacteria | 12440 |
| 355 | Ga0207662_10014409 | 3300025918 | Bacteria | 4436 |
| 356 | Ga0207657_10068015 | 3300025919 | Bacteria | 3027 |
| 357 | Ga0207657_10081430 | 3300025919 | Unclassified | 2719 |
| 358 | Ga0207649_10004134 | 3300025920 | Bacteria | 7905 |
| 359 | Ga0207649_10102525 | 3300025920 | Bacteria | 1897 |
| 360 | Ga0207649_10228204 | 3300025920 | Bacteria | 1330 |
| 361 | Ga0207652_10022315 | 3300025921 | Bacteria | 5235 |
| 362 | Ga0207646_10024203 | 3300025922 | Bacteria | 5565 |
| 363 | Ga0207646_10186316 | 3300025922 | Bacteria | 1874 |
| 364 | Ga0207681_10020865 | 3300025923 | Bacteria | 4158 |
| 365 | Ga0207681_10031714 | 3300025923 | Bacteria | 3453 |
| 366 | Ga0207681_10143894 | 3300025923 | Bacteria | 1779 |
| 367 | Ga0207694_10000001 | 3300025924 | Bacteria | 4078485 |
| 368 | Ga0207694_10000133 | 3300025924 | Bacteria | 76246 |
| 369 | Ga0207694_10168306 | 3300025924 | Unclassified | 1773 |
| 370 | Ga0207650_10000233 | 3300025925 | Bacteria | 61970 |
| 371 | Ga0207650_10009960 | 3300025925 | Bacteria | 6505 |
| 372 | Ga0207650_10016976 | 3300025925 | Bacteria | 5092 |
| 373 | Ga0207650_10047222 | 3300025925 | Bacteria | 3173 |
| 374 | Ga0207650_10124890 | 3300025925 | Bacteria | 2008 |
| 375 | Ga0207650_10152207 | 3300025925 | Unclassified | 1826 |
| 376 | Ga0207650_10186865 | 3300025925 | Bacteria | 1654 |
| 377 | Ga0207659_10000004 | 3300025926 | Bacteria | 476977 |
| 378 | Ga0207687_10000006 | 3300025927 | Bacteria | 641680 |
| 379 | Ga0207687_10000408 | 3300025927 | Bacteria | 29164 |
| 380 | Ga0207687_10088325 | 3300025927 | Unclassified | 2255 |
| 381 | Ga0207687_10155174 | 3300025927 | Bacteria | 1751 |
| 382 | Ga0207644_10026685 | 3300025931 | Bacteria | 3984 |
| 383 | Ga0207644_10029437 | 3300025931 | Bacteria | 3811 |
| 384 | Ga0207644_10073123 | 3300025931 | Bacteria | 2513 |
| 385 | Ga0207690_10165933 | 3300025932 | Bacteria | 1650 |
| 386 | Ga0207690_10169548 | 3300025932 | Unclassified | 1634 |
| 387 | Ga0207706_10000240 | 3300025933 | Bacteria | 60370 |
| 388 | Ga0207706_10000447 | 3300025933 | Bacteria | 43982 |
| 389 | Ga0207706_10003666 | 3300025933 | Bacteria | 14663 |
| 390 | Ga0207706_10006006 | 3300025933 | Bacteria | 11291 |
| 391 | Ga0207706_10071525 | 3300025933 | Bacteria | 3051 |
| 392 | Ga0207686_10068965 | 3300025934 | Bacteria | 2267 |
| 393 | Ga0207686_10344791 | 3300025934 | Bacteria | 1120 |
| 394 | Ga0207670_10009009 | 3300025936 | Bacteria | 5665 |
| 395 | Ga0207670_10059930 | 3300025936 | Bacteria | 2591 |
| 396 | Ga0207670_10061991 | 3300025936 | Bacteria | 2554 |
| 397 | Ga0207670_10107488 | 3300025936 | Bacteria | 2003 |
| 398 | Ga0207669_10093966 | 3300025937 | Bacteria | 1961 |
| 399 | Ga0207704_10002929 | 3300025938 | Bacteria | 7704 |
| 400 | Ga0207691_10002339 | 3300025940 | Bacteria | 18566 |
| 401 | Ga0207691_10005136 | 3300025940 | Bacteria | 12637 |
| 402 | Ga0207691_10013233 | 3300025940 | Bacteria | 7902 |
| 403 | Ga0207691_10095785 | 3300025940 | Bacteria | 2654 |
| 404 | Ga0207711_10079442 | 3300025941 | Bacteria | 2863 |
| 405 | Ga0207711_10200536 | 3300025941 | Bacteria | 1820 |
| 406 | Ga0207711_10221792 | 3300025941 | Bacteria | 1729 |
| 407 | Ga0207689_10003390 | 3300025942 | Bacteria | 14558 |
| 408 | Ga0207689_10026753 | 3300025942 | Bacteria | 4831 |
| 409 | Ga0207689_10027462 | 3300025942 | Bacteria | 4764 |
| 410 | Ga0207689_10113528 | 3300025942 | Bacteria | 2227 |
| 411 | Ga0207661_10000007 | 3300025944 | Bacteria | 471636 |
| 412 | Ga0207661_10095953 | 3300025944 | Bacteria | 2480 |
| 413 | Ga0207661_10102325 | 3300025944 | Bacteria | 2408 |
| 414 | Ga0207679_10021443 | 3300025945 | Bacteria | 4380 |
| 415 | Ga0207679_10082202 | 3300025945 | Unclassified | 2465 |
| 416 | Ga0207667_10000587 | 3300025949 | Bacteria | 47372 |
| 417 | Ga0207667_10022131 | 3300025949 | Bacteria | 7032 |
| 418 | Ga0207667_10122050 | 3300025949 | Bacteria | 2685 |
| 419 | Ga0207667_10266604 | 3300025949 | Bacteria | 1751 |
| 420 | Ga0207651_10000777 | 3300025960 | Bacteria | 13749 |
| 421 | Ga0207712_10178215 | 3300025961 | Bacteria | 1667 |
| 422 | Ga0207668_10076914 | 3300025972 | Bacteria | 2404 |
| 423 | Ga0207668_10104971 | 3300025972 | Bacteria | 2108 |
| 424 | Ga0207640_10004151 | 3300025981 | Bacteria | 7830 |
| 425 | Ga0207640_10027750 | 3300025981 | Bacteria | 3453 |
| 426 | Ga0207640_10129465 | 3300025981 | Bacteria | 1822 |
| 427 | Ga0207658_10050078 | 3300025986 | Bacteria | 3072 |
| 428 | Ga0207677_10000004 | 3300026023 | Bacteria | 299062 |
| 429 | Ga0207677_10000325 | 3300026023 | Bacteria | 34670 |
| 430 | Ga0207677_10022536 | 3300026023 | Bacteria | 3873 |
| 431 | Ga0207677_10093052 | 3300026023 | Bacteria | 2196 |
| 432 | Ga0207677_10262843 | 3300026023 | Unclassified | 1408 |
| 433 | Ga0207703_10000462 | 3300026035 | Bacteria | 42752 |
| 434 | Ga0207703_10200940 | 3300026035 | Bacteria | 1771 |
| 435 | Ga0207703_10454496 | 3300026035 | Bacteria | 1197 |
| 436 | Ga0207639_10023105 | 3300026041 | Bacteria | 4486 |
| 437 | Ga0207639_10056725 | 3300026041 | Bacteria | 3003 |
| 438 | Ga0207678_10158752 | 3300026067 | Bacteria | 1931 |
| 439 | Ga0207678_10299929 | 3300026067 | Bacteria | 1381 |
| 440 | Ga0207708_10000005 | 3300026075 | Bacteria | 284735 |
| 441 | Ga0207708_10004721 | 3300026075 | Bacteria | 10023 |
| 442 | Ga0207708_10047379 | 3300026075 | Bacteria | 3272 |
| 443 | Ga0207708_10050767 | 3300026075 | Bacteria | 3158 |
| 444 | Ga0207702_10129155 | 3300026078 | Unclassified | 2272 |
| 445 | Ga0207641_10159109 | 3300026088 | Bacteria | 2052 |
| 446 | Ga0207648_10002930 | 3300026089 | Bacteria | 18064 |
| 447 | Ga0207648_10023680 | 3300026089 | Bacteria | 5495 |
| 448 | Ga0207648_10038295 | 3300026089 | Bacteria | 4220 |
| 449 | Ga0207648_10118212 | 3300026089 | Bacteria | 2330 |
| 450 | Ga0207648_10640454 | 3300026089 | Bacteria | 982 |
| 451 | Ga0207676_10000014 | 3300026095 | Bacteria | 339896 |
| 452 | Ga0207676_10027783 | 3300026095 | Bacteria | 4218 |
| 453 | Ga0207676_10061156 | 3300026095 | Bacteria | 2981 |
| 454 | Ga0207676_10122372 | 3300026095 | Bacteria | 2197 |
| 455 | Ga0207674_10000541 | 3300026116 | Bacteria | 49546 |
| 456 | Ga0207674_10008945 | 3300026116 | Bacteria | 11508 |
| 457 | Ga0207674_10114375 | 3300026116 | Bacteria | 2671 |
| 458 | Ga0207674_10269922 | 3300026116 | Bacteria | 1648 |
| 459 | Ga0207675_100005595 | 3300026118 | Bacteria | 12029 |
| 460 | Ga0207675_100141896 | 3300026118 | Bacteria | 2282 |
| 461 | Ga0207675_100171412 | 3300026118 | Bacteria | 2074 |
| 462 | Ga0207675_100374974 | 3300026118 | Bacteria | 1398 |
| 463 | Ga0207683_10004511 | 3300026121 | Bacteria | 12015 |
| 464 | Ga0207683_10051252 | 3300026121 | Bacteria | 3616 |
| 465 | Ga0207683_10287132 | 3300026121 | Unclassified | 1504 |
| 466 | Ga0207698_10024707 | 3300026142 | Bacteria | 4222 |
| 467 | Ga0207698_10278599 | 3300026142 | Bacteria | 1546 |
| 468 | Ga0209967_1001263 | 3300027364 | Bacteria | 3237 |
| 469 | Ga0210002_1003169 | 3300027617 | Bacteria | 2416 |
| 470 | Ga0209588_1000093 | 3300027671 | Bacteria | 28346 |
| 471 | Ga0209588_1000243 | 3300027671 | Bacteria | 14530 |
| 472 | Ga0209971_1002499 | 3300027682 | Bacteria | 4411 |
| 473 | Ga0209998_10013095 | 3300027717 | Bacteria | 1725 |
| 474 | Ga0209974_10004353 | 3300027876 | Bacteria | 5034 |
| 475 | Ga0207428_10000062 | 3300027907 | Bacteria | 154492 |
| 476 | Ga0207428_10050618 | 3300027907 | Bacteria | 3323 |
| 477 | Ga0268266_10084164 | 3300028379 | Bacteria | 2777 |
| 478 | Ga0268266_10182556 | 3300028379 | Bacteria | 1911 |
| 479 | Ga0268265_10012771 | 3300028380 | Bacteria | 5701 |
| 480 | Ga0268265_10102250 | 3300028380 | Bacteria | 2317 |
| 481 | Ga0268264_10011345 | 3300028381 | Bacteria | 7361 |
| 482 | Ga0268264_10020504 | 3300028381 | Bacteria | 5401 |
| 483 | Ga0307517_10210973 | 3300028786 | Bacteria | 1196 |
| 484 | Ga0307515_10000037 | 3300028794 | Bacteria | 331970 |
| 485 | Ga0265338_10000042 | 3300028800 | Bacteria | 226810 |
| 486 | Ga0307511_10013052 | 3300030521 | Bacteria | 8127 |
| 487 | Ga0265332_10007167 | 3300031238 | Bacteria | 5050 |
| 488 | Ga0265340_10007097 | 3300031247 | Bacteria | 6107 |
| 489 | Ga0307513_10084027 | 3300031456 | Bacteria | 3271 |
| 490 | Ga0307408_100036558 | 3300031548 | Bacteria | 3453 |
| 491 | Ga0307408_100109649 | 3300031548 | Bacteria | 2118 |
| 492 | Ga0307508_10239748 | 3300031616 | Bacteria | 1411 |
| 493 | Ga0265314_10002966 | 3300031711 | Bacteria | 16817 |
| 494 | Ga0265314_10018487 | 3300031711 | Bacteria | 5432 |
| 495 | Ga0307413_10017462 | 3300031824 | Unclassified | 3737 |
| 496 | Ga0307413_10044228 | 3300031824 | Bacteria | 2631 |
| 497 | Ga0307410_10002105 | 3300031852 | Bacteria | 9445 |
| 498 | Ga0307410_10047952 | 3300031852 | Bacteria | 2858 |
| 499 | Ga0307410_10214414 | 3300031852 | Bacteria | 1477 |
| 500 | Ga0307406_10031967 | 3300031901 | Bacteria | 3209 |
| 501 | Ga0307407_10118199 | 3300031903 | Bacteria | 1676 |
| 502 | Ga0307407_10216629 | 3300031903 | Bacteria | 1292 |
| 503 | Ga0307412_10413572 | 3300031911 | Bacteria | 1101 |
| 504 | Ga0307409_100020304 | 3300031995 | Bacteria | 4524 |
| 505 | Ga0307409_100049598 | 3300031995 | Bacteria | 3202 |
| 506 | Ga0307409_100284731 | 3300031995 | Bacteria | 1530 |
| 507 | Ga0307409_100343710 | 3300031995 | Bacteria | 1405 |
| 508 | Ga0307416_100046424 | 3300032002 | Bacteria | 3427 |
| 509 | Ga0307416_100079900 | 3300032002 | Bacteria | 2758 |
| 510 | Ga0307416_100083885 | 3300032002 | Bacteria | 2705 |
| 511 | Ga0307416_100126835 | 3300032002 | Bacteria | 2287 |
| 512 | Ga0307416_100314647 | 3300032002 | Bacteria | 1564 |
| 513 | Ga0307411_10000724 | 3300032005 | Bacteria | 12153 |
| 514 | Ga0307411_10095068 | 3300032005 | Bacteria | 2091 |
| 515 | Ga0307415_100000688 | 3300032126 | Bacteria | 15015 |
| 516 | Ga0373948_0031744 | 3300034817 | Bacteria | 1068 |
| 517 | Ga0373959_0000032 | 3300034820 | Bacteria | 30446 |
| 518 | Ga0373926_0104011 | 3300035083 | Bacteria | 1064 |
| 519 | Ga0373929_0005908 | 3300035085 | Bacteria | 2211 |
| 520 | Ga0373934_0106031 | 3300035086 | Bacteria | 1138 |
| 521 | Ga0373949_0012544 | 3300035090 | Bacteria | 1876 |
| 522 | Ga0373951_0003547 | 3300035091 | Bacteria | 3769 |
| 523 | Ga0373923_0030423 | 3300035111 | Bacteria | 2172 |
| 524 | Ga0373932_0000866 | 3300035112 | Bacteria | 8938 |
| 525 | Ga0373932_0083827 | 3300035112 | Bacteria | 1012 |
| 526 | Ga0373936_0002740 | 3300035113 | Bacteria | 6562 |
| 527 | Ga0373956_0037529 | 3300035119 | Bacteria | 2141 |
| 528 | Ga0373955_0028740 | 3300035172 | Bacteria | 2886 |
| 529 | Ga0373955_0146867 | 3300035172 | Bacteria | 1386 |
| 530 | Ga0373961_0009290 | 3300035241 | Bacteria | 2404 |
| 531 | Ga0373962_0046928 | 3300035242 | Bacteria | 1234 |
| 532 | Ga0373924_0104567 | 3300035410 | Bacteria | 1220 |
| 533 | Ga0373931_0109420 | 3300035691 | Bacteria | 1566 |
| 534 | Ga0373935_0049092 | 3300035692 | Bacteria | 2674 |
| 535 | Ga0373927_0211588 | 3300035695 | Bacteria | 1273 |
| 536 | Ga0373933_0084655 | 3300035724 | Bacteria | 1948 |
| 537 | Ga0373933_0256724 | 3300035724 | Bacteria | 1126 |
| 538 | Ga0373947_0145163 | 3300035725 | Bacteria | 1525 |
| 539 | Ga0373937_0000258 | 3300036401 | Bacteria | 51434 |
| 540 | Ga0373937_0045095 | 3300036401 | Bacteria | 4028 |
| 541 | Ga0373937_0065568 | 3300036401 | Bacteria | 3343 |
| 542 | Ga0373937_0362547 | 3300036401 | Bacteria | 1373 |
| 543 | Ga0373925_0053797 | 3300037068 | Bacteria | 3010 |
| 544 | Ga0373925_0275505 | 3300037068 | Bacteria | 1354 |
| 545 | Ga0373925_0292286 | 3300037068 | Bacteria | 1314 |
| 546 | Ga0395899_0030876 | 3300037312 | Bacteria | 4028 |
| 547 | Ga0395905_0064600 | 3300037471 | Bacteria | 3425 |
| 548 | Ga0395905_0094803 | 3300037471 | Bacteria | 2800 |
| 549 | Ga0395905_0180191 | 3300037471 | Bacteria | 1983 |
| 550 | Ga0436364_0081202 | 3300037853 | Bacteria | 1753 |
| 551 | Ga0395901_0003731 | 3300038443 | Bacteria | 15347 |
| 552 | Ga0395901_0503338 | 3300038443 | Bacteria | 1233 |
| 553 | Ga0400485_07630 | 3300038735 | Bacteria | 1304 |
| 554 | Ga0400485_11227 | 3300038735 | Bacteria | 7385 |
| 555 | Ga0436365_0050989 | 3300039437 | Bacteria | 155528 |
| 556 | Ga0436365_0187148 | 3300039437 | Bacteria | 5450 |
| 557 | Ga0436365_0250525 | 3300039437 | Bacteria | 2466 |
| 558 | Ga0436365_0330386 | 3300039437 | Bacteria | 30524 |
| 559 | Ga0436365_1188272 | 3300039437 | Bacteria | 4174 |
| 560 | Ga0436362_1008167 | 3300039453 | Bacteria | 1854 |
| 561 | Ga0451802_2142684 | 3300041460 | Bacteria | 2217 |
| 562 | Ga0451807_1959489 | 3300041486 | Bacteria | 1083 |
| 563 | Ga0451833_1000468 | 3300041491 | Bacteria | 1159 |
| 564 | Ga0451839_1204380 | 3300041496 | Bacteria | 1987 |
| 565 | Ga0451853_1790050 | 3300041512 | Bacteria | 1063 |
| 566 | Ga0439433_0034085 | 3300041999 | Bacteria | 1171 |
| 567 | Ga0439442_029091 | 3300042002 | Bacteria | 1152 |
| 568 | Ga0439448_0008995 | 3300042005 | Bacteria | 2935 |
| 569 | Ga0439455_0018691 | 3300042012 | Bacteria | 1628 |
| 570 | Ga0439446_0001766 | 3300042156 | Bacteria | 5036 |
| 571 | Ga0439458_0016285 | 3300042157 | Bacteria | 1691 |
| 572 | Ga0439434_0008601 | 3300042435 | Bacteria | 2996 |
| 573 | Ga0439464_0003478 | 3300042439 | Bacteria | 3974 |
| 574 | Ga0439460_0010377 | 3300042461 | Bacteria | 2381 |
| 575 | Ga0439460_0027337 | 3300042461 | Bacteria | 1602 |
| 576 | Ga0451577_0046547 | 3300042876 | Bacteria | 3881 |
| 577 | Ga0451577_0338050 | 3300042876 | Unclassified | 1366 |
| 578 | Ga0466969_0033928 | 3300044656 | Unclassified | 2588 |
| 579 | Ga0453683_0090468 | 3300044673 | Unclassified | 1918 |
| 580 | Ga0453683_0128795 | 3300044673 | Bacteria | 1594 |
| 581 | Ga0466961_0023697 | 3300044693 | Bacteria | 3949 |
| 582 | Ga0466961_0193746 | 3300044693 | Bacteria | 1259 |
| 583 | Ga0451576_0002243 | 3300045051 | Bacteria | 29638 |
| 584 | Ga0451576_0005915 | 3300045051 | Bacteria | 15157 |
| 585 | Ga0451576_0015453 | 3300045051 | Bacteria | 8455 |
| 586 | Ga0451576_0069591 | 3300045051 | Bacteria | 3662 |
| 587 | Ga0451576_0097525 | 3300045051 | Bacteria | 3057 |
| 588 | Ga0495592_0009418 | 3300046454 | Bacteria | 7344 |
| 589 | Ga0495592_0076930 | 3300046454 | Bacteria | 2420 |
| 590 | Ga0495629_0167203 | 3300046459 | Bacteria | 1527 |
| 591 | Ga0495629_0359632 | 3300046459 | Bacteria | 992 |
| 592 | Ga0495641_0027673 | 3300046461 | Bacteria | 2753 |
| 593 | Ga0495653_0117990 | 3300046463 | Bacteria | 1895 |
| 594 | Ga0495580_0079240 | 3300046472 | Bacteria | 2291 |
| 595 | Ga0495582_0030405 | 3300046473 | Bacteria | 2965 |
| 596 | Ga0495639_0009927 | 3300046475 | Bacteria | 4090 |
| 597 | Ga0495662_0063107 | 3300046476 | Bacteria | 1790 |
| 598 | Ga0495608_0034111 | 3300046511 | Bacteria | 3437 |
| 599 | Ga0495630_0014597 | 3300046517 | Bacteria | 5724 |
| 600 | Ga0495630_0224937 | 3300046517 | Bacteria | 1433 |
| 601 | Ga0495632_0008011 | 3300046519 | Bacteria | 6556 |
| 602 | Ga0495643_0000024 | 3300046522 | Bacteria | 282193 |
| 603 | Ga0495652_0158827 | 3300046529 | Unclassified | 1758 |
| 604 | Ga0495598_0070143 | 3300046537 | Bacteria | 1102 |
| 605 | Ga0495597_0012906 | 3300046542 | Bacteria | 4017 |
| 606 | Ga0495667_0004888 | 3300046559 | Bacteria | 9064 |
| 607 | Ga0495667_0171396 | 3300046559 | Bacteria | 1394 |
| 608 | Ga0495667_0259181 | 3300046559 | Bacteria | 1106 |
| 609 | Ga0495634_0035536 | 3300046642 | Bacteria | 3411 |
| 610 | Ga0495634_0099357 | 3300046642 | Unclassified | 1882 |
| 611 | Ga0495634_0207503 | 3300046642 | Bacteria | 1214 |
| 612 | Ga0495625_0006218 | 3300046660 | Bacteria | 10696 |
| 613 | Ga0495657_0007485 | 3300046675 | Bacteria | 8437 |
| 614 | Ga0495599_0032269 | 3300046678 | Bacteria | 3288 |
| 615 | Ga0495658_0233636 | 3300046683 | Bacteria | 1153 |
| 616 | Ga0495649_0005235 | 3300046694 | Bacteria | 8301 |
| 617 | Ga0495600_0011430 | 3300046809 | Bacteria | 5530 |
| 618 | Ga0495660_0082742 | 3300046810 | Bacteria | 1680 |
| 619 | Ga0495581_0094759 | 3300047315 | Bacteria | 1733 |
| 620 | Ga0495674_0137878 | 3300047319 | Bacteria | 2052 |
| 621 | Ga0495680_0049453 | 3300047322 | Bacteria | 3292 |
| 622 | Ga0495687_000161 | 3300047443 | Bacteria | 100635 |
| 623 | Ga0495675_0033330 | 3300047444 | Bacteria | 3288 |
| 624 | Ga0495684_0031462 | 3300047471 | Bacteria | 4073 |
| 625 | Ga0496102_0010390 | 3300048905 | Bacteria | 8011 |
| 626 | Ga0496102_0107543 | 3300048905 | Bacteria | 2597 |
| 627 | Ga0496103_0141002 | 3300048906 | Bacteria | 1541 |
| 628 | Ga0496104_0008302 | 3300048907 | Bacteria | 9223 |
| 629 | Ga0496105_0098029 | 3300048908 | Bacteria | 2421 |
| 630 | Ga0496106_0277671 | 3300048909 | Bacteria | 1342 |
| 631 | Ga0496107_0030687 | 3300048910 | Bacteria | 3832 |
| 632 | Ga0496108_0002600 | 3300048911 | Bacteria | 14456 |
| 633 | Ga0496108_0392016 | 3300048911 | Bacteria | 1213 |
| 634 | Ga0496108_0523643 | 3300048911 | Bacteria | 1035 |
| 635 | Ga0496109_0010840 | 3300048912 | Bacteria | 7802 |
| 636 | Ga0496109_0219579 | 3300048912 | Bacteria | 1787 |
| 637 | Ga0496109_0320590 | 3300048912 | Bacteria | 1462 |
| 638 | Ga0496109_0336328 | 3300048912 | Bacteria | 1426 |
| 639 | Ga0496110_0315786 | 3300048913 | Bacteria | 1423 |
| 640 | Ga0496111_0014049 | 3300048914 | Bacteria | 5461 |
| 641 | Ga0496112_0000218 | 3300048915 | Bacteria | 37059 |
| 642 | Ga0496112_0002055 | 3300048915 | Bacteria | 15960 |
| 643 | Ga0496112_0060104 | 3300048915 | Bacteria | 3744 |
| 644 | Ga0496112_0061457 | 3300048915 | Bacteria | 3703 |
| 645 | Ga0496113_0007281 | 3300048916 | Bacteria | 7101 |
| 646 | Ga0496113_0036490 | 3300048916 | Bacteria | 3602 |
| 647 | Ga0496115_0135373 | 3300048918 | Bacteria | 2031 |
| 648 | Ga0495682_0053641 | 3300049460 | Bacteria | 1464 |
| 649 | Ga0501031_0011520 | 3300049568 | Bacteria | 5764 |
| 650 | Ga0501031_0174558 | 3300049568 | Bacteria | 1404 |
| 651 | Ga0501032_0018842 | 3300049569 | Bacteria | 4829 |
| 652 | Ga0501033_0007218 | 3300049570 | Bacteria | 8669 |
| 653 | Ga0501033_0008509 | 3300049570 | Bacteria | 7939 |
| 654 | Ga0501033_0025308 | 3300049570 | Bacteria | 4470 |
| 655 | Ga0501033_0032453 | 3300049570 | Bacteria | 3923 |
| 656 | Ga0501033_0068896 | 3300049570 | Bacteria | 2601 |
| 657 | Ga0501033_0154966 | 3300049570 | Bacteria | 1651 |
| 658 | Ga0501034_0002572 | 3300049571 | Bacteria | 21593 |
| 659 | Ga0501036_0000515 | 3300049572 | Bacteria | 27741 |
| 660 | Ga0501036_0004306 | 3300049572 | Bacteria | 11497 |
| 661 | Ga0501036_0019160 | 3300049572 | Bacteria | 5741 |
| 662 | Ga0501036_0037797 | 3300049572 | Bacteria | 4083 |
| 663 | Ga0501036_0139086 | 3300049572 | Bacteria | 2049 |
| 664 | Ga0501037_0004254 | 3300049573 | Bacteria | 10373 |
| 665 | Ga0501037_0075765 | 3300049573 | Bacteria | 2443 |
| 666 | Ga0501038_0002098 | 3300049574 | Bacteria | 18476 |
| 667 | Ga0501038_0002713 | 3300049574 | Bacteria | 16512 |
| 668 | Ga0501038_0003692 | 3300049574 | Bacteria | 14261 |
| 669 | Ga0501038_0013046 | 3300049574 | Bacteria | 7579 |
| 670 | Ga0501038_0019748 | 3300049574 | Bacteria | 6065 |
| 671 | Ga0501038_0091546 | 3300049574 | Bacteria | 2548 |
| 672 | Ga0501039_0000126 | 3300049575 | Bacteria | 52890 |
| 673 | Ga0501039_0006503 | 3300049575 | Bacteria | 8887 |
| 674 | Ga0501039_0015482 | 3300049575 | Bacteria | 5839 |
| 675 | Ga0501039_0029133 | 3300049575 | Bacteria | 4251 |
| 676 | Ga0501039_0050599 | 3300049575 | Bacteria | 3215 |
| 677 | Ga0501040_0000045 | 3300049576 | Bacteria | 57060 |
| 678 | Ga0501040_0002292 | 3300049576 | Bacteria | 12297 |
| 679 | Ga0501040_0005544 | 3300049576 | Bacteria | 8171 |
| 680 | Ga0501040_0013193 | 3300049576 | Bacteria | 5434 |
| 681 | Ga0501040_0018005 | 3300049576 | Bacteria | 4690 |
| 682 | Ga0501040_0018681 | 3300049576 | Bacteria | 4603 |
| 683 | Ga0501040_0041541 | 3300049576 | Bacteria | 3132 |
| 684 | Ga0501041_0000670 | 3300049577 | Bacteria | 18116 |
| 685 | Ga0501041_0005576 | 3300049577 | Bacteria | 7359 |
| 686 | Ga0501041_0007319 | 3300049577 | Bacteria | 6477 |
| 687 | Ga0501041_0009997 | 3300049577 | Bacteria | 5590 |
| 688 | Ga0501041_0026738 | 3300049577 | Bacteria | 3473 |
| 689 | Ga0501041_0039205 | 3300049577 | Bacteria | 2875 |
| 690 | Ga0501041_0087635 | 3300049577 | Bacteria | 1921 |
| 691 | Ga0501041_0229296 | 3300049577 | Bacteria | 1166 |
| 692 | Ga0501042_0000178 | 3300049578 | Bacteria | 29313 |
| 693 | Ga0501042_0001076 | 3300049578 | Bacteria | 15654 |
| 694 | Ga0501042_0005759 | 3300049578 | Bacteria | 8006 |
| 695 | Ga0501042_0047689 | 3300049578 | Bacteria | 3054 |
| 696 | Ga0501042_0064620 | 3300049578 | Bacteria | 2615 |
| 697 | Ga0501042_0067114 | 3300049578 | Bacteria | 2564 |
| 698 | Ga0501043_0004736 | 3300049579 | Bacteria | 11034 |
| 699 | Ga0501043_0021089 | 3300049579 | Bacteria | 5108 |
| 700 | Ga0501046_0001181 | 3300049580 | Bacteria | 25400 |
| 701 | Ga0501046_0010178 | 3300049580 | Bacteria | 8092 |
| 702 | Ga0501046_0053431 | 3300049580 | Bacteria | 3182 |
| 703 | Ga0501046_0072360 | 3300049580 | Bacteria | 2677 |
| 704 | Ga0501046_0114987 | 3300049580 | Bacteria | 2052 |
| 705 | Ga0501046_0259695 | 3300049580 | Bacteria | 1276 |
| 706 | Ga0501047_0011571 | 3300049581 | Bacteria | 8349 |
| 707 | Ga0501047_0093969 | 3300049581 | Bacteria | 2878 |
| 708 | Ga0501047_0123303 | 3300049581 | Bacteria | 2472 |
| 709 | Ga0501048_0011544 | 3300049582 | Bacteria | 6587 |
| 710 | Ga0501048_0019547 | 3300049582 | Bacteria | 4967 |
| 711 | Ga0501048_0039802 | 3300049582 | Bacteria | 3370 |
| 712 | Ga0501048_0047203 | 3300049582 | Bacteria | 3072 |
| 713 | Ga0501048_0060175 | 3300049582 | Bacteria | 2691 |
| 714 | Ga0501048_0107093 | 3300049582 | Bacteria | 1973 |
| 715 | Ga0501048_0222503 | 3300049582 | Bacteria | 1339 |
| 716 | Ga0501067_0015355 | 3300049583 | Bacteria | 4239 |
| 717 | Ga0501067_0049414 | 3300049583 | Bacteria | 2331 |
| 718 | Ga0501068_0001044 | 3300049584 | Bacteria | 14662 |
| 719 | Ga0501068_0006580 | 3300049584 | Bacteria | 6410 |
| 720 | Ga0501068_0007845 | 3300049584 | Bacteria | 5914 |
| 721 | Ga0501068_0031522 | 3300049584 | Bacteria | 3149 |
| 722 | Ga0501068_0036549 | 3300049584 | Bacteria | 2937 |
| 723 | Ga0501068_0042515 | 3300049584 | Bacteria | 2733 |
| 724 | Ga0501068_0172191 | 3300049584 | Bacteria | 1367 |
| 725 | Ga0501070_0029756 | 3300049586 | Bacteria | 4577 |
| 726 | Ga0501070_0214781 | 3300049586 | Bacteria | 1578 |
| 727 | Ga0501070_0229567 | 3300049586 | Bacteria | 1521 |
| 728 | Ga0501071_0001526 | 3300049587 | Bacteria | 13491 |
| 729 | Ga0501071_0005118 | 3300049587 | Bacteria | 8395 |
| 730 | Ga0501071_0009039 | 3300049587 | Bacteria | 6614 |
| 731 | Ga0501071_0025776 | 3300049587 | Bacteria | 4121 |
| 732 | Ga0501071_0057588 | 3300049587 | Bacteria | 2809 |
| 733 | Ga0501072_0000229 | 3300049588 | Bacteria | 41350 |
| 734 | Ga0501072_0000438 | 3300049588 | Bacteria | 29744 |
| 735 | Ga0501072_0006098 | 3300049588 | Bacteria | 9197 |
| 736 | Ga0501072_0012016 | 3300049588 | Bacteria | 6615 |
| 737 | Ga0501072_0021499 | 3300049588 | Bacteria | 5002 |
| 738 | Ga0501072_0021638 | 3300049588 | Bacteria | 4987 |
| 739 | Ga0501072_0073564 | 3300049588 | Bacteria | 2701 |
| 740 | Ga0501073_0002558 | 3300049589 | Bacteria | 13601 |
| 741 | Ga0501073_0006113 | 3300049589 | Bacteria | 8985 |
| 742 | Ga0501073_0062727 | 3300049589 | Unclassified | 2592 |
| 743 | Ga0501073_0098206 | 3300049589 | Unclassified | 2034 |
| 744 | Ga0501074_0020831 | 3300049590 | Bacteria | 4763 |
| 745 | Ga0501074_0043046 | 3300049590 | Bacteria | 3268 |
| 746 | Ga0501074_0050986 | 3300049590 | Bacteria | 2987 |
| 747 | Ga0501074_0060489 | 3300049590 | Bacteria | 2729 |
| 748 | Ga0501075_0000128 | 3300049591 | Bacteria | 37407 |
| 749 | Ga0501075_0001312 | 3300049591 | Bacteria | 16131 |
| 750 | Ga0501075_0006862 | 3300049591 | Bacteria | 7862 |
| 751 | Ga0501075_0024703 | 3300049591 | Bacteria | 4411 |
| 752 | Ga0501075_0025007 | 3300049591 | Bacteria | 4385 |
| 753 | Ga0501075_0025782 | 3300049591 | Bacteria | 4320 |
| 754 | Ga0501075_0072510 | 3300049591 | Bacteria | 2603 |
| 755 | Ga0501075_0076660 | 3300049591 | Bacteria | 2529 |
| 756 | Ga0501075_0095717 | 3300049591 | Bacteria | 2253 |
| 757 | Ga0501075_0420862 | 3300049591 | Bacteria | 1018 |
| 758 | Ga0501076_0000088 | 3300049592 | Bacteria | 48517 |
| 759 | Ga0501076_0000125 | 3300049592 | Bacteria | 42511 |
| 760 | Ga0501076_0000151 | 3300049592 | Bacteria | 39780 |
| 761 | Ga0501076_0009126 | 3300049592 | Bacteria | 7301 |
| 762 | Ga0501076_0011636 | 3300049592 | Bacteria | 6563 |
| 763 | Ga0501076_0028940 | 3300049592 | Bacteria | 4306 |
| 764 | Ga0501076_0039329 | 3300049592 | Bacteria | 3713 |
| 765 | Ga0501076_0047549 | 3300049592 | Bacteria | 3392 |
| 766 | Ga0501076_0117534 | 3300049592 | Bacteria | 2152 |
| 767 | Ga0501076_0158130 | 3300049592 | Bacteria | 1845 |
| 768 | Ga0501077_0000318 | 3300049593 | Bacteria | 28785 |
| 769 | Ga0501077_0000473 | 3300049593 | Bacteria | 24496 |
| 770 | Ga0501077_0001866 | 3300049593 | Bacteria | 12740 |
| 771 | Ga0501077_0002432 | 3300049593 | Bacteria | 11158 |
| 772 | Ga0501077_0012776 | 3300049593 | Bacteria | 5262 |
| 773 | Ga0501077_0024062 | 3300049593 | Bacteria | 3865 |
| 774 | Ga0501077_0035365 | 3300049593 | Bacteria | 3179 |
| 775 | Ga0501077_0056937 | 3300049593 | Bacteria | 2482 |
| 776 | Ga0501077_0067789 | 3300049593 | Bacteria | 2262 |
| 777 | Ga0501233_035345 | 3300049668 | Bacteria | 1151 |
| 778 | Ga0501247_003823 | 3300049677 | Bacteria | 1629 |
| 779 | Ga0501249_004234 | 3300049679 | Bacteria | 2910 |
| 780 | Ga0501255_010308 | 3300049684 | Bacteria | 1055 |
| 781 | Ga0501257_040597 | 3300049686 | Bacteria | 1142 |
| 782 | Ga0501079_0000027 | 3300049741 | Bacteria | 60858 |
| 783 | Ga0501079_0000741 | 3300049741 | Bacteria | 22136 |
| 784 | Ga0501079_0000959 | 3300049741 | Bacteria | 19899 |
| 785 | Ga0501079_0002847 | 3300049741 | Bacteria | 12617 |
| 786 | Ga0501079_0005128 | 3300049741 | Bacteria | 9737 |
| 787 | Ga0501079_0016378 | 3300049741 | Bacteria | 5662 |
| 788 | Ga0501079_0023574 | 3300049741 | Bacteria | 4722 |
| 789 | Ga0501079_0053490 | 3300049741 | Bacteria | 3114 |
| 790 | Ga0501080_0000618 | 3300049742 | Bacteria | 28164 |
| 791 | Ga0501080_0011715 | 3300049742 | Bacteria | 8036 |
| 792 | Ga0501080_0017721 | 3300049742 | Bacteria | 6590 |
| 793 | Ga0501080_0017736 | 3300049742 | Bacteria | 6588 |
| 794 | Ga0501080_0019441 | 3300049742 | Bacteria | 6292 |
| 795 | Ga0501080_0023330 | 3300049742 | Bacteria | 5737 |
| 796 | Ga0501080_0163924 | 3300049742 | Bacteria | 2052 |
| 797 | Ga0501081_0000282 | 3300049743 | Bacteria | 26838 |
| 798 | Ga0501081_0000956 | 3300049743 | Bacteria | 17189 |
| 799 | Ga0501081_0003648 | 3300049743 | Bacteria | 9859 |
| 800 | Ga0501081_0003659 | 3300049743 | Bacteria | 9845 |
| 801 | Ga0501081_0007146 | 3300049743 | Bacteria | 7258 |
| 802 | Ga0501081_0016360 | 3300049743 | Bacteria | 4902 |
| 803 | Ga0501081_0020916 | 3300049743 | Bacteria | 4366 |
| 804 | Ga0501081_0022464 | 3300049743 | Bacteria | 4222 |
| 805 | Ga0501081_0059585 | 3300049743 | Bacteria | 2643 |
| 806 | Ga0501083_0038240 | 3300049744 | Bacteria | 3263 |
| 807 | Ga0501083_0127295 | 3300049744 | Bacteria | 1669 |
| 808 | Ga0501268_003158 | 3300049765 | Bacteria | 2235 |
| 809 | Ga0501273_000558 | 3300049770 | Bacteria | 3070 |
| 810 | Ga0501035_0002633 | 3300049822 | Bacteria | 17497 |
| 811 | Ga0501035_0022543 | 3300049822 | Bacteria | 5784 |
| 812 | Ga0501035_0024143 | 3300049822 | Bacteria | 5577 |
| 813 | Ga0501035_0031926 | 3300049822 | Bacteria | 4796 |
| 814 | Ga0501044_0008693 | 3300049823 | Bacteria | 11113 |
| 815 | Ga0501045_0000141 | 3300049824 | Bacteria | 38191 |
| 816 | Ga0501045_0010151 | 3300049824 | Bacteria | 6590 |
| 817 | Ga0501045_0011938 | 3300049824 | Bacteria | 6106 |
| 818 | Ga0501045_0034703 | 3300049824 | Bacteria | 3663 |
| 819 | Ga0501045_0074823 | 3300049824 | Bacteria | 2494 |
| 820 | nmdc:mga03683_14564_c1 | 3300050489 | Bacteria | 2913 |
| 821 | nmdc:mga0k408_23178_c1 | 3300050493 | Bacteria | 3500 |
| 822 | nmdc:mga0k408_29812_c1 | 3300050493 | Bacteria | 3108 |
| 823 | nmdc:mga0k408_75900_c1 | 3300050493 | Bacteria | 1964 |
| 824 | nmdc:mga07m45_109675_c1 | 3300050496 | Bacteria | 1589 |
| 825 | nmdc:mga05p37_120336_c1 | 3300050507 | Bacteria | 3226 |
| 826 | nmdc:mga05p37_156867_c1 | 3300050507 | Bacteria | 2781 |
| 827 | nmdc:mga05p37_27090_c1 | 3300050507 | Bacteria | 6977 |
| 828 | nmdc:mga05p37_3536_c1 | 3300050507 | Bacteria | 18231 |
| 829 | nmdc:mga05p37_43051_c1 | 3300050507 | Bacteria | 5552 |
| 830 | nmdc:mga05p37_43637_c1 | 3300050507 | Bacteria | 5517 |
| 831 | nmdc:mga05p37_448779_c1 | 3300050507 | Bacteria | 1494 |
| 832 | nmdc:mga05p37_501130_c1 | 3300050507 | Bacteria | 1394 |
| 833 | nmdc:mga05p37_68775_c1 | 3300050507 | Bacteria | 4355 |
| 834 | nmdc:mga05p37_72328_c1 | 3300050507 | Bacteria | 4243 |
| 835 | nmdc:mga05p37_75313_c1 | 3300050507 | Bacteria | 4154 |
| 836 | nmdc:mga05p37_8128_c1 | 3300050507 | Bacteria | 12401 |
| 837 | nmdc:mga09592_11684_c1 | 3300050508 | Bacteria | 7141 |
| 838 | nmdc:mga09592_149546_c1 | 3300050508 | Bacteria | 2014 |
| 839 | nmdc:mga09592_246009_c1 | 3300050508 | Bacteria | 1550 |
| 840 | nmdc:mga09592_58783_c1 | 3300050508 | Bacteria | 3251 |
| 841 | nmdc:mga09592_89916_c1 | 3300050508 | Bacteria | 2623 |
| 842 | nmdc:mga0qj67_189247_c1 | 3300050509 | Bacteria | 1672 |
| 843 | nmdc:mga0qj67_65015_c1 | 3300050509 | Bacteria | 2903 |
| 844 | nmdc:mga06r32_103648_c1 | 3300050510 | Bacteria | 2793 |
| 845 | nmdc:mga06r32_12127_c1 | 3300050510 | Bacteria | 7773 |
| 846 | nmdc:mga06r32_17390_c1 | 3300050510 | Bacteria | 6562 |
| 847 | nmdc:mga06r32_336349_c1 | 3300050510 | Bacteria | 1495 |
| 848 | nmdc:mga06r32_448249_c1 | 3300050510 | Bacteria | 1270 |
| 849 | nmdc:mga06r32_9499_c1 | 3300050510 | Bacteria | 8781 |
| 850 | nmdc:mga08y16_203724_c1 | 3300050511 | Bacteria | 2050 |
| 851 | nmdc:mga08y16_285440_c1 | 3300050511 | Bacteria | 1702 |
| 852 | nmdc:mga08y16_32245_c1 | 3300050511 | Bacteria | 5509 |
| 853 | nmdc:mga08y16_36_c1 | 3300050511 | Bacteria | 155927 |
| 854 | nmdc:mga08y16_668027_c1 | 3300050511 | Bacteria | 1042 |
| 855 | nmdc:mga0n895_114608_c1 | 3300050512 | Unclassified | 2713 |
| 856 | nmdc:mga0n895_181701_c1 | 3300050512 | Bacteria | 2135 |
| 857 | nmdc:mga0n895_201165_c1 | 3300050512 | Bacteria | 2023 |
| 858 | nmdc:mga0n895_47216_c1 | 3300050512 | Bacteria | 4210 |
| 859 | nmdc:mga0n895_6018_c1 | 3300050512 | Bacteria | 10222 |
| 860 | nmdc:mga0n895_96332_c1 | 3300050512 | Bacteria | 2964 |
| 861 | nmdc:mga0n895_98798_c1 | 3300050512 | Bacteria | 2926 |
| 862 | nmdc:mga0rr50_2562_c1 | 3300050513 | Bacteria | 10299 |
| 863 | nmdc:mga0rr50_38908_c1 | 3300050513 | Bacteria | 3446 |
| 864 | nmdc:mga0rr50_517_c1 | 3300050513 | Bacteria | 20630 |
| 865 | nmdc:mga0rr50_6341_c1 | 3300050513 | Bacteria | 7191 |
| 866 | nmdc:mga08x19_133255_c1 | 3300050514 | Bacteria | 1673 |
| 867 | nmdc:mga08x19_136435_c1 | 3300050514 | Bacteria | 1654 |
| 868 | nmdc:mga08x19_43025_c1 | 3300050514 | Bacteria | 2881 |
| 869 | nmdc:mga08x19_66163_c1 | 3300050514 | Bacteria | 2348 |
| 870 | nmdc:mga0a205_185134_c1 | 3300050515 | Bacteria | 1976 |
| 871 | nmdc:mga0a205_331350_c1 | 3300050515 | Bacteria | 1392 |
| 872 | nmdc:mga0a205_37853_c1 | 3300050515 | Bacteria | 4639 |
| 873 | nmdc:mga0a205_3858_c1 | 3300050515 | Bacteria | 13428 |
| 874 | nmdc:mga0a205_400573_c1 | 3300050515 | Bacteria | 1236 |
| 875 | Ga0495619_0089681 | 3300053085 | Bacteria | 2081 |
| 876 | Ga0500554_069490 | 3300053102 | Bacteria | 1144 |
| 877 | Ga0500628_000114 | 3300053129 | Bacteria | 17065 |
| 878 | Ga0500568_0008504 | 3300053139 | Bacteria | 4939 |
| 879 | Ga0501084_0000110 | 3300054114 | Bacteria | 61578 |
| 880 | Ga0501084_0000942 | 3300054114 | Bacteria | 22522 |
| 881 | Ga0501084_0001589 | 3300054114 | Bacteria | 17987 |
| 882 | Ga0501084_0005003 | 3300054114 | Bacteria | 10839 |
| 883 | Ga0501084_0011240 | 3300054114 | Bacteria | 7412 |
| 884 | Ga0501084_0042818 | 3300054114 | Bacteria | 3788 |
| 885 | Ga0501084_0060645 | 3300054114 | Bacteria | 3166 |
| 886 | Ga0501084_0081906 | 3300054114 | Bacteria | 2707 |
| 887 | Ga0501084_0103232 | 3300054114 | Bacteria | 2394 |
| 888 | Ga0501084_0114588 | 3300054114 | Bacteria | 2266 |
| 889 | Ga0590071_000258 | 3300059421 | Bacteria | 15452 |
| 890 | Ga0590074_001031 | 3300059423 | Bacteria | 4380 |
| 891 | Ga0590075_000526 | 3300059424 | Bacteria | 10368 |
| 892 | Ga0590077_000813 | 3300059426 | Bacteria | 8056 |
| 893 | Ga0590077_033664 | 3300059426 | Bacteria | 1125 |
| 894 | Ga0501082_0000201 | 3300060353 | Bacteria | 52098 |
| 895 | Ga0501082_0010344 | 3300060353 | Bacteria | 8031 |
| 896 | Ga0501082_0015512 | 3300060353 | Bacteria | 6559 |
| 897 | Ga0501082_0025301 | 3300060353 | Bacteria | 5114 |
| 898 | Ga0501082_0145891 | 3300060353 | Bacteria | 2054 |
| 899 | Ga0501082_0271027 | 3300060353 | Bacteria | 1477 |
| 900 | Ga0530510_0000184 | 3300061734 | Bacteria | 38295 |
| 901 | Ga0530510_0000332 | 3300061734 | Bacteria | 30434 |
| 902 | Ga0530510_0000514 | 3300061734 | Bacteria | 24670 |
| 903 | Ga0530510_0004720 | 3300061734 | Bacteria | 9426 |
| 904 | Ga0530510_0012698 | 3300061734 | Bacteria | 5923 |
| 905 | Ga0530510_0104751 | 3300061734 | Bacteria | 2070 |
| 906 | Ga0530510_0108555 | 3300061734 | Bacteria | 2031 |
| 907 | Ga0530510_0180109 | 3300061734 | Bacteria | 1567 |
| 908 | Ga0207686_10010446 | |||
| 909 | rootH1_10155700 | |||
| 910 | Ga0065704_10176406 | |||
| 911 | Ga0065712_10011198 | |||
| 912 | Ga0065712_10074964 | |||
| 913 | Ga0065712_10077390 | |||
| 914 | Ga0065715_10009291 | |||
| 915 | Ga0065707_10027840 | |||
| 916 | Ga0065707_10089357 | |||
| 917 | Ga0065707_10115073 | |||
| 918 | Ga0070676_10119404 | |||
| 919 | Ga0070683_100000009 | |||
| 920 | Ga0070683_100163687 | |||
| 921 | Ga0070683_100244884 | |||
| 922 | Ga0070690_100052883 | |||
| 923 | Ga0070670_100001199 | |||
| 924 | Ga0070670_100001395 | |||
| 925 | Ga0068869_100005352 | |||
| 926 | Ga0070666_10084005 | |||
| 927 | Ga0070680_100002990 | |||
| 928 | Ga0070680_100205539 | |||
| 929 | Ga0070682_100000002 | |||
| 930 | Ga0070682_100071431 | |||
| 931 | Ga0068868_100000377 | |||
| 932 | Ga0068868_100000861 | |||
| 933 | Ga0068868_100064139 | |||
| 934 | Ga0068868_100120255 | |||
| 935 | Ga0068868_100269506 | |||
| 936 | Ga0070689_100000221 | |||
| 937 | Ga0070689_100008938 | |||
| 938 | Ga0070689_100053714 | |||
| 939 | Ga0070689_100094076 | |||
| 940 | Ga0070687_100005462 | |||
| 941 | Ga0070687_100014423 | |||
| 942 | Ga0070687_100094085 | |||
| 943 | Ga0070661_100002737 | |||
| 944 | Ga0070661_100004746 | |||
| 945 | Ga0070661_100100930 | |||
| 946 | Ga0070661_100232048 | |||
| 947 | Ga0070692_10000995 | |||
| 948 | Ga0070692_10001370 | |||
| 949 | Ga0070692_10022352 | |||
| 950 | Ga0070692_10080430 | |||
| 951 | Ga0070668_100020312 | |||
| 952 | Ga0070668_100034634 | |||
| 953 | Ga0070668_100161758 | |||
| 954 | Ga0070669_100013467 | |||
| 955 | Ga0070669_100024518 | |||
| 956 | Ga0070669_100028008 | |||
| 957 | Ga0070669_100174085 | |||
| 958 | Ga0070675_100000001 | |||
| 959 | Ga0070675_100006978 | |||
| 960 | Ga0070675_100080660 | |||
| 961 | Ga0070675_100106590 | |||
| 962 | Ga0070675_100160839 | |||
| 963 | Ga0070671_100071178 | |||
| 964 | Ga0070671_100072579 | |||
| 965 | Ga0070671_100094601 | |||
| 966 | Ga0070674_100020618 | |||
| 967 | Ga0070674_100023949 | |||
| 968 | Ga0070673_100000230 | |||
| 969 | Ga0070673_100133312 | |||
| 970 | Ga0070673_100317711 | |||
| 971 | Ga0070667_100012379 | |||
| 972 | Ga0070667_100044260 | |||
| 973 | Ga0070667_100066313 | |||
| 974 | Ga0070713_100557365 | |||
| 975 | Ga0070701_10002708 | |||
| 976 | Ga0070701_10224405 | |||
| 977 | Ga0070711_100054697 | |||
| 978 | Ga0070705_100000197 | |||
| 979 | Ga0070705_100007788 | |||
| 980 | Ga0070705_100200440 | |||
| 981 | Ga0070700_100000016 | |||
| 982 | Ga0070700_100014842 | |||
| 983 | Ga0070700_100035906 | |||
| 984 | Ga0070700_100255807 | |||
| 985 | Ga0070694_100004663 | |||
| 986 | Ga0070694_100020654 | |||
| 987 | Ga0070663_100012255 | |||
| 988 | Ga0070663_100179544 | |||
| 989 | Ga0070678_100047206 | |||
| 990 | Ga0070662_100000129 | |||
| 991 | Ga0070662_100009245 | |||
| 992 | Ga0070662_100085495 | |||
| 993 | Ga0070662_100228089 | |||
| 994 | Ga0070662_100268899 | |||
| 995 | Ga0070681_10065137 | |||
| 996 | Ga0070681_10080349 | |||
| 997 | Ga0068867_100001848 | |||
| 998 | Ga0068867_100030538 | |||
| 999 | Ga0070685_10001230 | |||
| 1000 | Ga0070685_10010204 | |||
| 1001 | Ga0070706_100000427 | |||
| 1002 | Ga0070706_100166479 | |||
| 1003 | Ga0070707_100058035 | |||
| 1004 | Ga0070707_100160672 | |||
| 1005 | Ga0070707_100289473 | |||
| 1006 | Ga0070698_100026417 | |||
| 1007 | Ga0070698_100126946 | |||
| 1008 | Ga0070698_100302146 | |||
| 1009 | Ga0070679_100001387 | |||
| 1010 | Ga0070679_100355753 | |||
| 1011 | Ga0070684_100000094 | |||
| 1012 | Ga0070684_100019474 | |||
| 1013 | Ga0070684_100083008 | |||
| 1014 | Ga0070684_100097856 | |||
| 1015 | Ga0070697_100014285 | |||
| 1016 | Ga0070697_100037008 | |||
| 1017 | Ga0070697_100163088 | |||
| 1018 | Ga0068853_100020611 | |||
| 1019 | Ga0068853_100035163 | |||
| 1020 | Ga0068853_100063775 | |||
| 1021 | Ga0070672_100001997 | |||
| 1022 | Ga0070672_100059487 | |||
| 1023 | Ga0070672_100093635 | |||
| 1024 | Ga0070672_100323718 | |||
| 1025 | Ga0070686_100000009 | |||
| 1026 | Ga0070686_100077740 | |||
| 1027 | Ga0070686_100290205 | |||
| 1028 | Ga0070695_100003784 | |||
| 1029 | Ga0070695_100005474 | |||
| 1030 | Ga0070695_100061426 | |||
| 1031 | Ga0070695_100095255 | |||
| 1032 | Ga0070695_100193247 | |||
| 1033 | Ga0070696_100000254 | |||
| 1034 | Ga0070696_100048899 | |||
| 1035 | Ga0070696_100063849 | |||
| 1036 | Ga0070693_100042820 | |||
| 1037 | Ga0070693_100096669 | |||
| 1038 | Ga0070665_100104764 | |||
| 1039 | Ga0070704_100005518 | |||
| 1040 | Ga0070704_100014146 | |||
| 1041 | Ga0070704_100046314 | |||
| 1042 | Ga0070704_100094339 | |||
| 1043 | Ga0070704_100123912 | |||
| 1044 | Ga0068855_100016998 | |||
| 1045 | Ga0068855_100077632 | |||
| 1046 | Ga0068855_100493225 | |||
| 1047 | Ga0068857_100013779 | |||
| 1048 | Ga0068857_100016849 | |||
| 1049 | Ga0068857_100020173 | |||
| 1050 | Ga0068857_100095083 | |||
| 1051 | Ga0068854_100011847 | |||
| 1052 | Ga0068854_100235377 | |||
| 1053 | Ga0068854_100330857 | |||
| 1054 | Ga0068856_100019410 | |||
| 1055 | Ga0070702_100008092 | |||
| 1056 | Ga0070702_100030542 | |||
| 1057 | Ga0070702_100133804 | |||
| 1058 | Ga0068852_100090771 | |||
| 1059 | Ga0068852_100409856 | |||
| 1060 | Ga0068859_100001562 | |||
| 1061 | Ga0068859_100168514 | |||
| 1062 | Ga0068859_100276083 | |||
| 1063 | Ga0068864_100000070 | |||
| 1064 | Ga0068864_100119128 | |||
| 1065 | Ga0068864_100155492 | |||
| 1066 | Ga0068866_10137497 | |||
| 1067 | Ga0068861_100028499 | |||
| 1068 | Ga0068861_100056019 | |||
| 1069 | Ga0068870_10055563 | |||
| 1070 | Ga0068863_100034302 | |||
| 1071 | Ga0068863_100085971 | |||
| 1072 | Ga0068863_100213845 | |||
| 1073 | Ga0068858_100001717 | |||
| 1074 | Ga0068858_100485203 | |||
| 1075 | Ga0068860_100009869 | |||
| 1076 | Ga0068860_100013040 | |||
| 1077 | Ga0068860_100098565 | |||
| 1078 | Ga0068860_100125244 | |||
| 1079 | Ga0068862_100003150 | |||
| 1080 | Ga0081455_10024914 | |||
| 1081 | Ga0081539_10000083 | |||
| 1082 | Ga0070717_10000177 | |||
| 1083 | Ga0070717_10244600 | |||
| 1084 | Ga0070716_100105245 | |||
| 1085 | Ga0070712_100054865 | |||
| 1086 | Ga0070712_100075185 | |||
| 1087 | Ga0070712_100204337 | |||
| 1088 | Ga0075362_10012845 | |||
| 1089 | Ga0075362_10112937 | |||
| 1090 | Ga0075366_10035490 | |||
| 1091 | Ga0075366_10081882 | |||
| 1092 | Ga0097621_100045898 | |||
| 1093 | Ga0097621_100204879 | |||
| 1094 | Ga0075370_10020240 | |||
| 1095 | Ga0068871_100010973 | |||
| 1096 | Ga0068871_100122296 | |||
| 1097 | Ga0068871_100194438 | |||
| 1098 | Ga0068871_100211552 | |||
| 1099 | Ga0075428_100006479 | |||
| 1100 | Ga0075428_100030631 | |||
| 1101 | Ga0075428_100228818 | |||
| 1102 | Ga0075428_100229716 | |||
| 1103 | Ga0075430_100015734 | |||
| 1104 | Ga0075430_100065567 | |||
| 1105 | Ga0075430_100108342 | |||
| 1106 | Ga0075431_100003456 | |||
| 1107 | Ga0075431_100015760 | |||
| 1108 | Ga0075431_100045887 | |||
| 1109 | Ga0075431_100210102 | |||
| 1110 | Ga0075431_100247529 | |||
| 1111 | Ga0075431_100262268 | |||
| 1112 | Ga0075433_10051080 | |||
| 1113 | Ga0075433_10055293 | |||
| 1114 | Ga0075433_10077077 | |||
| 1115 | Ga0075434_100027844 | |||
| 1116 | Ga0075434_100051917 | |||
| 1117 | Ga0075434_100067804 | |||
| 1118 | Ga0075434_100080464 | |||
| 1119 | Ga0075434_100085011 | |||
| 1120 | Ga0075434_100173005 | |||
| 1121 | Ga0075434_100185896 | |||
| 1122 | Ga0075434_100328261 | |||
| 1123 | Ga0075434_100528829 | |||
| 1124 | Ga0075429_100039399 | |||
| 1125 | Ga0075429_100164091 | |||
| 1126 | Ga0068865_100000282 | |||
| 1127 | Ga0075436_100010907 | |||
| 1128 | Ga0075436_100017775 | |||
| 1129 | Ga0075436_100159021 | |||
| 1130 | Ga0097620_100001562 | |||
| 1131 | Ga0097620_100168508 | |||
| 1132 | Ga0097620_100276105 | |||
| 1133 | Ga0075435_100000379 | |||
| 1134 | Ga0075435_100002040 | |||
| 1135 | Ga0075435_100003685 | |||
| 1136 | Ga0075435_100022231 | |||
| 1137 | Ga0099794_10000032 | |||
| 1138 | Ga0105240_10047004 | |||
| 1139 | Ga0105240_10465996 | |||
| 1140 | Ga0105240_10689041 | |||
| 1141 | Ga0111539_10000034 | |||
| 1142 | Ga0111539_10004237 | |||
| 1143 | Ga0111539_10067757 | |||
| 1144 | Ga0111539_10112708 | |||
| 1145 | Ga0111539_10144514 | |||
| 1146 | Ga0111539_10176025 | |||
| 1147 | Ga0111539_10872628 | |||
| 1148 | Ga0105245_10000027 | |||
| 1149 | Ga0105245_10000383 | |||
| 1150 | Ga0105245_10005726 | |||
| 1151 | Ga0114129_10002244 | |||
| 1152 | Ga0114129_10011249 | |||
| 1153 | Ga0114129_10022321 | |||
| 1154 | Ga0114129_10027675 | |||
| 1155 | Ga0114129_10048826 | |||
| 1156 | Ga0114129_10058803 | |||
| 1157 | Ga0114129_10114571 | |||
| 1158 | Ga0114129_10119762 | |||
| 1159 | Ga0114129_10133847 | |||
| 1160 | Ga0114129_10141151 | |||
| 1161 | Ga0114129_10146658 | |||
| 1162 | Ga0114129_10170293 | |||
| 1163 | Ga0114129_10231773 | |||
| 1164 | Ga0114129_10589111 | |||
| 1165 | Ga0114129_10663844 | |||
| 1166 | Ga0114129_10835634 | |||
| 1167 | Ga0105243_10067914 | |||
| 1168 | Ga0105241_10004856 | |||
| 1169 | Ga0105242_10000164 | |||
| 1170 | Ga0105242_10195738 | |||
| 1171 | Ga0105242_10228500 | |||
| 1172 | Ga0105242_10242424 | |||
| 1173 | Ga0105242_10315436 | |||
| 1174 | Ga0105248_10030015 | |||
| 1175 | Ga0105248_10054282 | |||
| 1176 | Ga0105248_10063968 | |||
| 1177 | Ga0105248_10117461 | |||
| 1178 | Ga0105248_10132293 | |||
| 1179 | Ga0105248_10164853 | |||
| 1180 | Ga0105248_10188949 | |||
| 1181 | Ga0105248_10443791 | |||
| 1182 | Ga0105248_10554462 | |||
| 1183 | Ga0105237_10020826 | |||
| 1184 | Ga0105237_10522468 | |||
| 1185 | Ga0105238_10000001 | |||
| 1186 | Ga0105238_10000108 | |||
| 1187 | Ga0105238_10005742 | |||
| 1188 | Ga0105238_10139119 | |||
| 1189 | Ga0105249_10047058 | |||
| 1190 | Ga0105249_10307860 | |||
| 1191 | Ga0105249_10521648 | |||
| 1192 | Ga0105249_10656225 | |||
| 1193 | Ga0105239_10011332 | |||
| 1194 | Ga0105239_10085960 | |||
| 1195 | Ga0105239_10251805 | |||
| 1196 | Ga0105246_10007835 | |||
| 1197 | Ga0105246_10025979 | |||
| 1198 | Ga0157373_10055087 | |||
| 1199 | Ga0157371_10018331 | |||
| 1200 | Ga0157374_10000005 | |||
| 1201 | Ga0157374_10003277 | |||
| 1202 | Ga0157374_10132391 | |||
| 1203 | Ga0157374_10142440 | |||
| 1204 | Ga0157378_10003838 | |||
| 1205 | Ga0157378_10007395 | |||
| 1206 | Ga0163162_10004825 | |||
| 1207 | Ga0163162_10018184 | |||
| 1208 | Ga0163162_10164803 | |||
| 1209 | Ga0163162_10428833 | |||
| 1210 | Ga0163162_10870788 | |||
| 1211 | Ga0157372_10003786 | |||
| 1212 | Ga0157375_10000004 | |||
| 1213 | Ga0157375_10000103 | |||
| 1214 | Ga0157375_10008426 | |||
| 1215 | Ga0157375_10078162 | |||
| 1216 | Ga0157375_10096670 | |||
| 1217 | Ga0163163_10000008 | |||
| 1218 | Ga0163163_10003990 | |||
| 1219 | Ga0163163_10025642 | |||
| 1220 | Ga0163163_10037695 | |||
| 1221 | Ga0163163_10050994 | |||
| 1222 | Ga0163163_10147521 | |||
| 1223 | Ga0163163_10360508 | |||
| 1224 | Ga0163163_10505072 | |||
| 1225 | Ga0157380_10037844 | |||
| 1226 | Ga0157377_10000001 | |||
| 1227 | Ga0157377_10000155 | |||
| 1228 | Ga0157377_10002118 | |||
| 1229 | Ga0157379_10107538 | |||
| 1230 | Ga0157379_10193181 | |||
| 1231 | Ga0157376_10000011 | |||
| 1232 | Ga0157376_10027416 | |||
| 1233 | Ga0157376_10116853 | |||
| 1234 | Ga0182007_10066144 | |||
| 1235 | Ga0213876_10000064 | |||
| 1236 | Ga0213876_10011720 | |||
| 1237 | Ga0209051_1036215 | |||
| 1238 | Ga0207697_10029539 | |||
| 1239 | Ga0207656_10115430 | |||
| 1240 | Ga0207653_10000903 | |||
| 1241 | Ga0207688_10213227 | |||
| 1242 | Ga0207647_10124919 | |||
| 1243 | Ga0207645_10038973 | |||
| 1244 | Ga0207645_10076763 | |||
| 1245 | Ga0207643_10194613 | |||
| 1246 | Ga0207705_10091663 | |||
| 1247 | Ga0207684_10004682 | |||
| 1248 | Ga0207654_10025696 | |||
| 1249 | Ga0207707_10012311 | |||
| 1250 | Ga0207707_10012577 | |||
| 1251 | Ga0207707_10112540 | |||
| 1252 | Ga0207695_10017334 | |||
| 1253 | Ga0207671_10016209 | |||
| 1254 | Ga0207693_10067186 | |||
| 1255 | Ga0207693_10093698 | |||
| 1256 | Ga0207663_10228268 | |||
| 1257 | Ga0207660_10002208 | |||
| 1258 | Ga0207660_10002302 | |||
| 1259 | Ga0207660_10052099 | |||
| 1260 | Ga0207660_10233433 | |||
| 1261 | Ga0207662_10001174 | |||
| 1262 | Ga0207662_10014409 | |||
| 1263 | Ga0207657_10068015 | |||
| 1264 | Ga0207657_10081430 | |||
| 1265 | Ga0207649_10004134 | |||
| 1266 | Ga0207649_10102525 | |||
| 1267 | Ga0207649_10228204 | |||
| 1268 | Ga0207652_10022315 | |||
| 1269 | Ga0207646_10024203 | |||
| 1270 | Ga0207646_10186316 | |||
| 1271 | Ga0207681_10020865 | |||
| 1272 | Ga0207681_10031714 | |||
| 1273 | Ga0207681_10143894 | |||
| 1274 | Ga0207694_10000001 | |||
| 1275 | Ga0207694_10000133 | |||
| 1276 | Ga0207694_10168306 | |||
| 1277 | Ga0207650_10000233 | |||
| 1278 | Ga0207650_10009960 | |||
| 1279 | Ga0207650_10016976 | |||
| 1280 | Ga0207650_10047222 | |||
| 1281 | Ga0207650_10124890 | |||
| 1282 | Ga0207650_10152207 | |||
| 1283 | Ga0207650_10186865 | |||
| 1284 | Ga0207659_10000004 | |||
| 1285 | Ga0207687_10000006 | |||
| 1286 | Ga0207687_10000408 | |||
| 1287 | Ga0207687_10088325 | |||
| 1288 | Ga0207687_10155174 | |||
| 1289 | Ga0207644_10026685 | |||
| 1290 | Ga0207644_10029437 | |||
| 1291 | Ga0207644_10073123 | |||
| 1292 | Ga0207690_10165933 | |||
| 1293 | Ga0207690_10169548 | |||
| 1294 | Ga0207706_10000240 | |||
| 1295 | Ga0207706_10000447 | |||
| 1296 | Ga0207706_10003666 | |||
| 1297 | Ga0207706_10006006 | |||
| 1298 | Ga0207706_10071525 | |||
| 1299 | Ga0207686_10068965 | |||
| 1300 | Ga0207686_10344791 | |||
| 1301 | Ga0207670_10009009 | |||
| 1302 | Ga0207670_10059930 | |||
| 1303 | Ga0207670_10061991 | |||
| 1304 | Ga0207670_10107488 | |||
| 1305 | Ga0207669_10093966 | |||
| 1306 | Ga0207704_10002929 | |||
| 1307 | Ga0207691_10002339 | |||
| 1308 | Ga0207691_10005136 | |||
| 1309 | Ga0207691_10013233 | |||
| 1310 | Ga0207691_10095785 | |||
| 1311 | Ga0207711_10079442 | |||
| 1312 | Ga0207711_10200536 | |||
| 1313 | Ga0207711_10221792 | |||
| 1314 | Ga0207689_10003390 | |||
| 1315 | Ga0207689_10026753 | |||
| 1316 | Ga0207689_10027462 | |||
| 1317 | Ga0207689_10113528 | |||
| 1318 | Ga0207661_10000007 | |||
| 1319 | Ga0207661_10095953 | |||
| 1320 | Ga0207661_10102325 | |||
| 1321 | Ga0207679_10021443 | |||
| 1322 | Ga0207679_10082202 | |||
| 1323 | Ga0207667_10000587 | |||
| 1324 | Ga0207667_10022131 | |||
| 1325 | Ga0207667_10122050 | |||
| 1326 | Ga0207667_10266604 | |||
| 1327 | Ga0207651_10000777 | |||
| 1328 | Ga0207712_10178215 | |||
| 1329 | Ga0207668_10076914 | |||
| 1330 | Ga0207668_10104971 | |||
| 1331 | Ga0207640_10004151 | |||
| 1332 | Ga0207640_10027750 | |||
| 1333 | Ga0207640_10129465 | |||
| 1334 | Ga0207658_10050078 | |||
| 1335 | Ga0207677_10000004 | |||
| 1336 | Ga0207677_10000325 | |||
| 1337 | Ga0207677_10022536 | |||
| 1338 | Ga0207677_10093052 | |||
| 1339 | Ga0207677_10262843 | |||
| 1340 | Ga0207703_10000462 | |||
| 1341 | Ga0207703_10200940 | |||
| 1342 | Ga0207703_10454496 | |||
| 1343 | Ga0207639_10023105 | |||
| 1344 | Ga0207639_10056725 | |||
| 1345 | Ga0207678_10158752 | |||
| 1346 | Ga0207678_10299929 | |||
| 1347 | Ga0207708_10000005 | |||
| 1348 | Ga0207708_10004721 | |||
| 1349 | Ga0207708_10047379 | |||
| 1350 | Ga0207708_10050767 | |||
| 1351 | Ga0207702_10129155 | |||
| 1352 | Ga0207641_10159109 | |||
| 1353 | Ga0207648_10002930 | |||
| 1354 | Ga0207648_10023680 | |||
| 1355 | Ga0207648_10038295 | |||
| 1356 | Ga0207648_10118212 | |||
| 1357 | Ga0207648_10640454 | |||
| 1358 | Ga0207676_10000014 | |||
| 1359 | Ga0207676_10027783 | |||
| 1360 | Ga0207676_10061156 | |||
| 1361 | Ga0207676_10122372 | |||
| 1362 | Ga0207674_10000541 | |||
| 1363 | Ga0207674_10008945 | |||
| 1364 | Ga0207674_10114375 | |||
| 1365 | Ga0207674_10269922 | |||
| 1366 | Ga0207675_100005595 | |||
| 1367 | Ga0207675_100141896 | |||
| 1368 | Ga0207675_100171412 | |||
| 1369 | Ga0207675_100374974 | |||
| 1370 | Ga0207683_10004511 | |||
| 1371 | Ga0207683_10051252 | |||
| 1372 | Ga0207683_10287132 | |||
| 1373 | Ga0207698_10024707 | |||
| 1374 | Ga0207698_10278599 | |||
| 1375 | Ga0209967_1001263 | |||
| 1376 | Ga0210002_1003169 | |||
| 1377 | Ga0209588_1000093 | |||
| 1378 | Ga0209588_1000243 | |||
| 1379 | Ga0209971_1002499 | |||
| 1380 | Ga0209998_10013095 | |||
| 1381 | Ga0209974_10004353 | |||
| 1382 | Ga0207428_10000062 | |||
| 1383 | Ga0207428_10050618 | |||
| 1384 | Ga0268266_10084164 | |||
| 1385 | Ga0268266_10182556 | |||
| 1386 | Ga0268265_10012771 | |||
| 1387 | Ga0268265_10102250 | |||
| 1388 | Ga0268264_10011345 | |||
| 1389 | Ga0268264_10020504 | |||
| 1390 | Ga0307517_10210973 | |||
| 1391 | Ga0307515_10000037 | |||
| 1392 | Ga0265338_10000042 | |||
| 1393 | Ga0307511_10013052 | |||
| 1394 | Ga0265332_10007167 | |||
| 1395 | Ga0265340_10007097 | |||
| 1396 | Ga0307513_10084027 | |||
| 1397 | Ga0307408_100036558 | |||
| 1398 | Ga0307408_100109649 | |||
| 1399 | Ga0307508_10239748 | |||
| 1400 | Ga0265314_10002966 | |||
| 1401 | Ga0265314_10018487 | |||
| 1402 | Ga0307413_10017462 | |||
| 1403 | Ga0307413_10044228 | |||
| 1404 | Ga0307410_10002105 | |||
| 1405 | Ga0307410_10047952 | |||
| 1406 | Ga0307410_10214414 | |||
| 1407 | Ga0307406_10031967 | |||
| 1408 | Ga0307407_10118199 | |||
| 1409 | Ga0307407_10216629 | |||
| 1410 | Ga0307412_10413572 | |||
| 1411 | Ga0307409_100020304 | |||
| 1412 | Ga0307409_100049598 | |||
| 1413 | Ga0307409_100284731 | |||
| 1414 | Ga0307409_100343710 | |||
| 1415 | Ga0307416_100046424 | |||
| 1416 | Ga0307416_100079900 | |||
| 1417 | Ga0307416_100083885 | |||
| 1418 | Ga0307416_100126835 | |||
| 1419 | Ga0307416_100314647 | |||
| 1420 | Ga0307411_10000724 | |||
| 1421 | Ga0307411_10095068 | |||
| 1422 | Ga0307415_100000688 | |||
| 1423 | Ga0373948_0031744 | |||
| 1424 | Ga0373959_0000032 | |||
| 1425 | Ga0373926_0104011 | |||
| 1426 | Ga0373929_0005908 | |||
| 1427 | Ga0373934_0106031 | |||
| 1428 | Ga0373949_0012544 | |||
| 1429 | Ga0373951_0003547 | |||
| 1430 | Ga0373923_0030423 | |||
| 1431 | Ga0373932_0000866 | |||
| 1432 | Ga0373932_0083827 | |||
| 1433 | Ga0373936_0002740 | |||
| 1434 | Ga0373956_0037529 | |||
| 1435 | Ga0373955_0028740 | |||
| 1436 | Ga0373955_0146867 | |||
| 1437 | Ga0373961_0009290 | |||
| 1438 | Ga0373962_0046928 | |||
| 1439 | Ga0373924_0104567 | |||
| 1440 | Ga0373931_0109420 | |||
| 1441 | Ga0373935_0049092 | |||
| 1442 | Ga0373927_0211588 | |||
| 1443 | Ga0373933_0084655 | |||
| 1444 | Ga0373933_0256724 | |||
| 1445 | Ga0373947_0145163 | |||
| 1446 | Ga0373937_0000258 | |||
| 1447 | Ga0373937_0045095 | |||
| 1448 | Ga0373937_0065568 | |||
| 1449 | Ga0373937_0362547 | |||
| 1450 | Ga0373925_0053797 | |||
| 1451 | Ga0373925_0275505 | |||
| 1452 | Ga0373925_0292286 | |||
| 1453 | Ga0395899_0030876 | |||
| 1454 | Ga0395905_0064600 | |||
| 1455 | Ga0395905_0094803 | |||
| 1456 | Ga0395905_0180191 | |||
| 1457 | Ga0436364_0081202 | |||
| 1458 | Ga0395901_0003731 | |||
| 1459 | Ga0395901_0503338 | |||
| 1460 | Ga0400485_07630 | |||
| 1461 | Ga0400485_11227 | |||
| 1462 | Ga0436365_0050989 | |||
| 1463 | Ga0436365_0187148 | |||
| 1464 | Ga0436365_0250525 | |||
| 1465 | Ga0436365_0330386 | |||
| 1466 | Ga0436365_1188272 | |||
| 1467 | Ga0436362_1008167 | |||
| 1468 | Ga0451802_2142684 | |||
| 1469 | Ga0451807_1959489 | |||
| 1470 | Ga0451833_1000468 | |||
| 1471 | Ga0451839_1204380 | |||
| 1472 | Ga0451853_1790050 | |||
| 1473 | Ga0439433_0034085 | |||
| 1474 | Ga0439442_029091 | |||
| 1475 | Ga0439448_0008995 | |||
| 1476 | Ga0439455_0018691 | |||
| 1477 | Ga0439446_0001766 | |||
| 1478 | Ga0439458_0016285 | |||
| 1479 | Ga0439434_0008601 | |||
| 1480 | Ga0439464_0003478 | |||
| 1481 | Ga0439460_0010377 | |||
| 1482 | Ga0439460_0027337 | |||
| 1483 | Ga0451577_0046547 | |||
| 1484 | Ga0451577_0338050 | |||
| 1485 | Ga0466969_0033928 | |||
| 1486 | Ga0453683_0090468 | |||
| 1487 | Ga0453683_0128795 | |||
| 1488 | Ga0466961_0023697 | |||
| 1489 | Ga0466961_0193746 | |||
| 1490 | Ga0451576_0002243 | |||
| 1491 | Ga0451576_0005915 | |||
| 1492 | Ga0451576_0015453 | |||
| 1493 | Ga0451576_0069591 | |||
| 1494 | Ga0451576_0097525 | |||
| 1495 | Ga0495592_0009418 | |||
| 1496 | Ga0495592_0076930 | |||
| 1497 | Ga0495629_0167203 | |||
| 1498 | Ga0495629_0359632 | |||
| 1499 | Ga0495641_0027673 | |||
| 1500 | Ga0495653_0117990 | |||
| 1501 | Ga0495580_0079240 | |||
| 1502 | Ga0495582_0030405 | |||
| 1503 | Ga0495639_0009927 | |||
| 1504 | Ga0495662_0063107 | |||
| 1505 | Ga0495608_0034111 | |||
| 1506 | Ga0495630_0014597 | |||
| 1507 | Ga0495630_0224937 | |||
| 1508 | Ga0495632_0008011 | |||
| 1509 | Ga0495643_0000024 | |||
| 1510 | Ga0495652_0158827 | |||
| 1511 | Ga0495598_0070143 | |||
| 1512 | Ga0495597_0012906 | |||
| 1513 | Ga0495667_0004888 | |||
| 1514 | Ga0495667_0171396 | |||
| 1515 | Ga0495667_0259181 | |||
| 1516 | Ga0495634_0035536 | |||
| 1517 | Ga0495634_0099357 | |||
| 1518 | Ga0495634_0207503 | |||
| 1519 | Ga0495625_0006218 | |||
| 1520 | Ga0495657_0007485 | |||
| 1521 | Ga0495599_0032269 | |||
| 1522 | Ga0495658_0233636 | |||
| 1523 | Ga0495649_0005235 | |||
| 1524 | Ga0495600_0011430 | |||
| 1525 | Ga0495660_0082742 | |||
| 1526 | Ga0495581_0094759 | |||
| 1527 | Ga0495674_0137878 | |||
| 1528 | Ga0495680_0049453 | |||
| 1529 | Ga0495687_000161 | |||
| 1530 | Ga0495675_0033330 | |||
| 1531 | Ga0495684_0031462 | |||
| 1532 | Ga0496102_0010390 | |||
| 1533 | Ga0496102_0107543 | |||
| 1534 | Ga0496103_0141002 | |||
| 1535 | Ga0496104_0008302 | |||
| 1536 | Ga0496105_0098029 | |||
| 1537 | Ga0496106_0277671 | |||
| 1538 | Ga0496107_0030687 | |||
| 1539 | Ga0496108_0002600 | |||
| 1540 | Ga0496108_0392016 | |||
| 1541 | Ga0496108_0523643 | |||
| 1542 | Ga0496109_0010840 | |||
| 1543 | Ga0496109_0219579 | |||
| 1544 | Ga0496109_0320590 | |||
| 1545 | Ga0496109_0336328 | |||
| 1546 | Ga0496110_0315786 | |||
| 1547 | Ga0496111_0014049 | |||
| 1548 | Ga0496112_0000218 | |||
| 1549 | Ga0496112_0002055 | |||
| 1550 | Ga0496112_0060104 | |||
| 1551 | Ga0496112_0061457 | |||
| 1552 | Ga0496113_0007281 | |||
| 1553 | Ga0496113_0036490 | |||
| 1554 | Ga0496115_0135373 | |||
| 1555 | Ga0495682_0053641 | |||
| 1556 | Ga0501031_0011520 | |||
| 1557 | Ga0501031_0174558 | |||
| 1558 | Ga0501032_0018842 | |||
| 1559 | Ga0501033_0007218 | |||
| 1560 | Ga0501033_0008509 | |||
| 1561 | Ga0501033_0025308 | |||
| 1562 | Ga0501033_0032453 | |||
| 1563 | Ga0501033_0068896 | |||
| 1564 | Ga0501033_0154966 | |||
| 1565 | Ga0501034_0002572 | |||
| 1566 | Ga0501036_0000515 | |||
| 1567 | Ga0501036_0004306 | |||
| 1568 | Ga0501036_0019160 | |||
| 1569 | Ga0501036_0037797 | |||
| 1570 | Ga0501036_0139086 | |||
| 1571 | Ga0501037_0004254 | |||
| 1572 | Ga0501037_0075765 | |||
| 1573 | Ga0501038_0002098 | |||
| 1574 | Ga0501038_0002713 | |||
| 1575 | Ga0501038_0003692 | |||
| 1576 | Ga0501038_0013046 | |||
| 1577 | Ga0501038_0019748 | |||
| 1578 | Ga0501038_0091546 | |||
| 1579 | Ga0501039_0000126 | |||
| 1580 | Ga0501039_0006503 | |||
| 1581 | Ga0501039_0015482 | |||
| 1582 | Ga0501039_0029133 | |||
| 1583 | Ga0501039_0050599 | |||
| 1584 | Ga0501040_0000045 | |||
| 1585 | Ga0501040_0002292 | |||
| 1586 | Ga0501040_0005544 | |||
| 1587 | Ga0501040_0013193 | |||
| 1588 | Ga0501040_0018005 | |||
| 1589 | Ga0501040_0018681 | |||
| 1590 | Ga0501040_0041541 | |||
| 1591 | Ga0501041_0000670 | |||
| 1592 | Ga0501041_0005576 | |||
| 1593 | Ga0501041_0007319 | |||
| 1594 | Ga0501041_0009997 | |||
| 1595 | Ga0501041_0026738 | |||
| 1596 | Ga0501041_0039205 | |||
| 1597 | Ga0501041_0087635 | |||
| 1598 | Ga0501041_0229296 | |||
| 1599 | Ga0501042_0000178 | |||
| 1600 | Ga0501042_0001076 | |||
| 1601 | Ga0501042_0005759 | |||
| 1602 | Ga0501042_0047689 | |||
| 1603 | Ga0501042_0064620 | |||
| 1604 | Ga0501042_0067114 | |||
| 1605 | Ga0501043_0004736 | |||
| 1606 | Ga0501043_0021089 | |||
| 1607 | Ga0501046_0001181 | |||
| 1608 | Ga0501046_0010178 | |||
| 1609 | Ga0501046_0053431 | |||
| 1610 | Ga0501046_0072360 | |||
| 1611 | Ga0501046_0114987 | |||
| 1612 | Ga0501046_0259695 | |||
| 1613 | Ga0501047_0011571 | |||
| 1614 | Ga0501047_0093969 | |||
| 1615 | Ga0501047_0123303 | |||
| 1616 | Ga0501048_0011544 | |||
| 1617 | Ga0501048_0019547 | |||
| 1618 | Ga0501048_0039802 | |||
| 1619 | Ga0501048_0047203 | |||
| 1620 | Ga0501048_0060175 | |||
| 1621 | Ga0501048_0107093 | |||
| 1622 | Ga0501048_0222503 | |||
| 1623 | Ga0501067_0015355 | |||
| 1624 | Ga0501067_0049414 | |||
| 1625 | Ga0501068_0001044 | |||
| 1626 | Ga0501068_0006580 | |||
| 1627 | Ga0501068_0007845 | |||
| 1628 | Ga0501068_0031522 | |||
| 1629 | Ga0501068_0036549 | |||
| 1630 | Ga0501068_0042515 | |||
| 1631 | Ga0501068_0172191 | |||
| 1632 | Ga0501070_0029756 | |||
| 1633 | Ga0501070_0214781 | |||
| 1634 | Ga0501070_0229567 | |||
| 1635 | Ga0501071_0001526 | |||
| 1636 | Ga0501071_0005118 | |||
| 1637 | Ga0501071_0009039 | |||
| 1638 | Ga0501071_0025776 | |||
| 1639 | Ga0501071_0057588 | |||
| 1640 | Ga0501072_0000229 | |||
| 1641 | Ga0501072_0000438 | |||
| 1642 | Ga0501072_0006098 | |||
| 1643 | Ga0501072_0012016 | |||
| 1644 | Ga0501072_0021499 | |||
| 1645 | Ga0501072_0021638 | |||
| 1646 | Ga0501072_0073564 | |||
| 1647 | Ga0501073_0002558 | |||
| 1648 | Ga0501073_0006113 | |||
| 1649 | Ga0501073_0062727 | |||
| 1650 | Ga0501073_0098206 | |||
| 1651 | Ga0501074_0020831 | |||
| 1652 | Ga0501074_0043046 | |||
| 1653 | Ga0501074_0050986 | |||
| 1654 | Ga0501074_0060489 | |||
| 1655 | Ga0501075_0000128 | |||
| 1656 | Ga0501075_0001312 | |||
| 1657 | Ga0501075_0006862 | |||
| 1658 | Ga0501075_0024703 | |||
| 1659 | Ga0501075_0025007 | |||
| 1660 | Ga0501075_0025782 | |||
| 1661 | Ga0501075_0072510 | |||
| 1662 | Ga0501075_0076660 | |||
| 1663 | Ga0501075_0095717 | |||
| 1664 | Ga0501075_0420862 | |||
| 1665 | Ga0501076_0000088 | |||
| 1666 | Ga0501076_0000125 | |||
| 1667 | Ga0501076_0000151 | |||
| 1668 | Ga0501076_0009126 | |||
| 1669 | Ga0501076_0011636 | |||
| 1670 | Ga0501076_0028940 | |||
| 1671 | Ga0501076_0039329 | |||
| 1672 | Ga0501076_0047549 | |||
| 1673 | Ga0501076_0117534 | |||
| 1674 | Ga0501076_0158130 | |||
| 1675 | Ga0501077_0000318 | |||
| 1676 | Ga0501077_0000473 | |||
| 1677 | Ga0501077_0001866 | |||
| 1678 | Ga0501077_0002432 | |||
| 1679 | Ga0501077_0012776 | |||
| 1680 | Ga0501077_0024062 | |||
| 1681 | Ga0501077_0035365 | |||
| 1682 | Ga0501077_0056937 | |||
| 1683 | Ga0501077_0067789 | |||
| 1684 | Ga0501233_035345 | |||
| 1685 | Ga0501247_003823 | |||
| 1686 | Ga0501249_004234 | |||
| 1687 | Ga0501255_010308 | |||
| 1688 | Ga0501257_040597 | |||
| 1689 | Ga0501079_0000027 | |||
| 1690 | Ga0501079_0000741 | |||
| 1691 | Ga0501079_0000959 | |||
| 1692 | Ga0501079_0002847 | |||
| 1693 | Ga0501079_0005128 | |||
| 1694 | Ga0501079_0016378 | |||
| 1695 | Ga0501079_0023574 | |||
| 1696 | Ga0501079_0053490 | |||
| 1697 | Ga0501080_0000618 | |||
| 1698 | Ga0501080_0011715 | |||
| 1699 | Ga0501080_0017721 | |||
| 1700 | Ga0501080_0017736 | |||
| 1701 | Ga0501080_0019441 | |||
| 1702 | Ga0501080_0023330 | |||
| 1703 | Ga0501080_0163924 | |||
| 1704 | Ga0501081_0000282 | |||
| 1705 | Ga0501081_0000956 | |||
| 1706 | Ga0501081_0003648 | |||
| 1707 | Ga0501081_0003659 | |||
| 1708 | Ga0501081_0007146 | |||
| 1709 | Ga0501081_0016360 | |||
| 1710 | Ga0501081_0020916 | |||
| 1711 | Ga0501081_0022464 | |||
| 1712 | Ga0501081_0059585 | |||
| 1713 | Ga0501083_0038240 | |||
| 1714 | Ga0501083_0127295 | |||
| 1715 | Ga0501268_003158 | |||
| 1716 | Ga0501273_000558 | |||
| 1717 | Ga0501035_0002633 | |||
| 1718 | Ga0501035_0022543 | |||
| 1719 | Ga0501035_0024143 | |||
| 1720 | Ga0501035_0031926 | |||
| 1721 | Ga0501044_0008693 | |||
| 1722 | Ga0501045_0000141 | |||
| 1723 | Ga0501045_0010151 | |||
| 1724 | Ga0501045_0011938 | |||
| 1725 | Ga0501045_0034703 | |||
| 1726 | Ga0501045_0074823 | |||
| 1727 | nmdc:mga03683_14564_c1 | |||
| 1728 | nmdc:mga0k408_23178_c1 | |||
| 1729 | nmdc:mga0k408_29812_c1 | |||
| 1730 | nmdc:mga0k408_75900_c1 | |||
| 1731 | nmdc:mga07m45_109675_c1 | |||
| 1732 | nmdc:mga05p37_120336_c1 | |||
| 1733 | nmdc:mga05p37_156867_c1 | |||
| 1734 | nmdc:mga05p37_27090_c1 | |||
| 1735 | nmdc:mga05p37_3536_c1 | |||
| 1736 | nmdc:mga05p37_43051_c1 | |||
| 1737 | nmdc:mga05p37_43637_c1 | |||
| 1738 | nmdc:mga05p37_448779_c1 | |||
| 1739 | nmdc:mga05p37_501130_c1 | |||
| 1740 | nmdc:mga05p37_68775_c1 | |||
| 1741 | nmdc:mga05p37_72328_c1 | |||
| 1742 | nmdc:mga05p37_75313_c1 | |||
| 1743 | nmdc:mga05p37_8128_c1 | |||
| 1744 | nmdc:mga09592_11684_c1 | |||
| 1745 | nmdc:mga09592_149546_c1 | |||
| 1746 | nmdc:mga09592_246009_c1 | |||
| 1747 | nmdc:mga09592_58783_c1 | |||
| 1748 | nmdc:mga09592_89916_c1 | |||
| 1749 | nmdc:mga0qj67_189247_c1 | |||
| 1750 | nmdc:mga0qj67_65015_c1 | |||
| 1751 | nmdc:mga06r32_103648_c1 | |||
| 1752 | nmdc:mga06r32_12127_c1 | |||
| 1753 | nmdc:mga06r32_17390_c1 | |||
| 1754 | nmdc:mga06r32_336349_c1 | |||
| 1755 | nmdc:mga06r32_448249_c1 | |||
| 1756 | nmdc:mga06r32_9499_c1 | |||
| 1757 | nmdc:mga08y16_203724_c1 | |||
| 1758 | nmdc:mga08y16_285440_c1 | |||
| 1759 | nmdc:mga08y16_32245_c1 | |||
| 1760 | nmdc:mga08y16_36_c1 | |||
| 1761 | nmdc:mga08y16_668027_c1 | |||
| 1762 | nmdc:mga0n895_114608_c1 | |||
| 1763 | nmdc:mga0n895_181701_c1 | |||
| 1764 | nmdc:mga0n895_201165_c1 | |||
| 1765 | nmdc:mga0n895_47216_c1 | |||
| 1766 | nmdc:mga0n895_6018_c1 | |||
| 1767 | nmdc:mga0n895_96332_c1 | |||
| 1768 | nmdc:mga0n895_98798_c1 | |||
| 1769 | nmdc:mga0rr50_2562_c1 | |||
| 1770 | nmdc:mga0rr50_38908_c1 | |||
| 1771 | nmdc:mga0rr50_517_c1 | |||
| 1772 | nmdc:mga0rr50_6341_c1 | |||
| 1773 | nmdc:mga08x19_133255_c1 | |||
| 1774 | nmdc:mga08x19_136435_c1 | |||
| 1775 | nmdc:mga08x19_43025_c1 | |||
| 1776 | nmdc:mga08x19_66163_c1 | |||
| 1777 | nmdc:mga0a205_185134_c1 | |||
| 1778 | nmdc:mga0a205_331350_c1 | |||
| 1779 | nmdc:mga0a205_37853_c1 | |||
| 1780 | nmdc:mga0a205_3858_c1 | |||
| 1781 | nmdc:mga0a205_400573_c1 | |||
| 1782 | Ga0495619_0089681 | |||
| 1783 | Ga0500554_069490 | |||
| 1784 | Ga0500628_000114 | |||
| 1785 | Ga0500568_0008504 | |||
| 1786 | Ga0501084_0000110 | |||
| 1787 | Ga0501084_0000942 | |||
| 1788 | Ga0501084_0001589 | |||
| 1789 | Ga0501084_0005003 | |||
| 1790 | Ga0501084_0011240 | |||
| 1791 | Ga0501084_0042818 | |||
| 1792 | Ga0501084_0060645 | |||
| 1793 | Ga0501084_0081906 | |||
| 1794 | Ga0501084_0103232 | |||
| 1795 | Ga0501084_0114588 | |||
| 1796 | Ga0590071_000258 | |||
| 1797 | Ga0590074_001031 | |||
| 1798 | Ga0590075_000526 | |||
| 1799 | Ga0590077_000813 | |||
| 1800 | Ga0590077_033664 | |||
| 1801 | Ga0501082_0000201 | |||
| 1802 | Ga0501082_0010344 | |||
| 1803 | Ga0501082_0015512 | |||
| 1804 | Ga0501082_0025301 | |||
| 1805 | Ga0501082_0145891 | |||
| 1806 | Ga0501082_0271027 | |||
| 1807 | Ga0530510_0000184 | |||
| 1808 | Ga0530510_0000332 | |||
| 1809 | Ga0530510_0000514 | |||
| 1810 | Ga0530510_0004720 | |||
| 1811 | Ga0530510_0012698 | |||
| 1812 | Ga0530510_0104751 | |||
| 1813 | Ga0530510_0108555 | |||
| 1814 | Ga0530510_0180109 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1kfv-assembly2.cif.gz_B | crystal structure of lactococcus lactis formamido-pyrimidine dna glycosylase (alias fpg or mutm) non covalently bound to an ap site containing dna. | 0.8871 | 3 | 268 |
| 1k82-assembly4.cif.gz_D | crystal structure of e.coli formamidopyrimidine-dna glycosylase (fpg) covalently trapped with dna | 0.8859 | 2 | 268 |
| 4v7h-assembly1.cif.gz_AM | structure of the 80s rrna and proteins and p/e trna for eukaryotic ribosome based on cryo-em map of thermomyces lanuginosus ribosome at 8.9a resolution | 0.8834 | 152 | 201 |
| 1tdz-assembly1.cif.gz_A | crystal structure complex between the lactococcus lactis fpg (mutm) and a fapy-dg containing dna | 0.883 | 3 | 268 |
| 1k82-assembly4.cif.gz_D | crystal structure of e.coli formamidopyrimidine-dna glycosylase (fpg) covalently trapped with dna | 0.8827 | 2 | 268 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1xnqM01 | Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3; | 0.9187 | 151 | 201 | 1.10.8.50 |
| af_Q2FW30_1_70_1.10.8.50 | Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3; | 0.9144 | 167 | 205 | 1.10.8.50 |
| 2y10M01 | Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3; | 0.9086 | 168 | 204 | 1.10.8.50 |
| 3sarA02 | Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3; | 0.9079 | 133 | 267 | 1.10.8.50 |
| 4kd8M01 | Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3; | 0.9007 | 151 | 203 | 1.10.8.50 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7C4U9B8-F1-model_v4 | Formamidopyrimidine-DNA glycosylase | 0.98 | 1 | 268 |
GO:0003684
GO:0006284 GO:0008270 GO:0034039 GO:0140078 |
| AF-A0A534WBK6-F1-model_v4 | Formamidopyrimidine-DNA glycosylase | 0.9796 | 1 | 276 |
GO:0003684
GO:0006284 GO:0008270 GO:0034039 GO:0140078 |
| AF-A0A7C4U9B8-F1-model_v4 | Formamidopyrimidine-DNA glycosylase | 0.9764 | 1 | 268 |
GO:0003684
GO:0006284 GO:0008270 GO:0034039 GO:0140078 |
| AF-A0A536SPC1-F1-model_v4 | Formamidopyrimidine-DNA glycosylase | 0.9737 | 1 | 292 |
GO:0003684
GO:0006284 GO:0008270 GO:0034039 GO:0140078 |
| AF-A0A2V6X5E8-F1-model_v4 | Formamidopyrimidine-DNA glycosylase | 0.9726 | 1 | 214 |
GO:0003684
GO:0006284 GO:0008270 GO:0034039 GO:0140078 |