F485398
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 908 | 595 | 1816 | 184 |
Family's Representative Sequence
| Representative Sequence | 3300046558|Ga0495633_0153696|Ga0495633_0153696_32_682 |
| Length | 216 |
| Sequence | MPMPLXXXXTRAVSEAKADGKTTIRSSRAMTTRDLVLISLFSAIIIALGLLPPITLGFIPVPITAQSLGVMLAGVVLGAKRGTLAVLLTILIAAIGLPVLSGGRGGLSIFTTPTTGFLIGWIAAAFVTGTLSEKLVNRGQSALTQGIGFFIASLAGGVVVLYAFGITYLALVVGLGFEKAFMGSLAFIPGDALKAVLAALAGRAVMAGYPLLPQRA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 2 | 3300002704 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB | Metagenome | Unclassified |
| 3 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 4 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 5 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 6 | 3300002739 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA | Metagenome | Endosphere |
| 7 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 8 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 9 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 10 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 11 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 12 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 13 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 14 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 15 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 16 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 17 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 18 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 19 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 20 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 21 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 22 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 23 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 24 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 25 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 26 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 27 | 3300003856 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz | Metagenome | Rhizosphere |
| 28 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 29 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 30 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 35 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 41 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 42 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 43 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 45 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 46 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 47 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 48 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 49 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 50 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 51 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 52 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 53 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 54 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 55 | 3300006941 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW | Metagenome | Nodule |
| 56 | 3300006942 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW | Metagenome | Nodule |
| 57 | 3300006943 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW | Metagenome | Nodule |
| 58 | 3300006944 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW | Metagenome | Nodule |
| 59 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 60 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 61 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300009765 | Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule | Metagenome | Nodule |
| 68 | 3300009766 | Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule | Metagenome | Nodule |
| 69 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300012513 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 | Metagenome | Rhizosphere |
| 72 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 78 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 79 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 80 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 81 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 82 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 83 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 84 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 85 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 86 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 87 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 88 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 89 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 90 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 91 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 92 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 93 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 94 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 95 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 96 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 97 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 98 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 99 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 100 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 101 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 102 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 120 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 121 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300027357 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 123 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 124 | 3300027363 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 125 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 126 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 128 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 129 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 130 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 131 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 132 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 133 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 134 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 135 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 136 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 137 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 138 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 139 | 3300041441 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG | Metagenome | Rhizoplane |
| 140 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 141 | 3300041458 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG | Metagenome | Rhizoplane |
| 142 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 143 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 144 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 145 | 3300041501 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG | Metagenome | Unclassified |
| 146 | 3300041502 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaT | Metatranscriptome | Unclassified |
| 147 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 148 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 149 | 3300041511 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG | Metagenome | Unclassified |
| 150 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 151 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 152 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 153 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 154 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 155 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 156 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 157 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 158 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 159 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 160 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 161 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 162 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 209 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 210 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 211 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 212 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 213 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 214 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 215 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 216 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 217 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 218 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 219 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 220 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 221 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 222 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 223 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 224 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 225 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 226 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 227 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 228 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 229 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 231 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 232 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 233 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 234 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 235 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 236 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 237 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 238 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 239 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 240 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 241 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 242 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 243 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 244 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 245 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 246 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 247 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 248 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 249 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 250 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 251 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 252 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 254 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 255 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 256 | 3300053107 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere | Metagenome | Endosphere |
| 257 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 258 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 259 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 260 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 261 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 262 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 263 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 264 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 265 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 266 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 267 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 268 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 269 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 270 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 271 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 272 | 3300059492 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 273 | 3300059642 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 274 | 3300059643 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 275 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 276 | 2509276021 | Rhizobium leguminosarum bv. trifolii WSM597 | Isolate | Nodule |
| 277 | 2509276033 | Rhizobium leguminosarum bv. trifolii WSM2012 | Isolate | Nodule |
| 278 | 2510065019 | Rhizobium leguminosarum bv. trifolii WSM1689 | Isolate | Nodule |
| 279 | 2510461069 | Rhizobium sp. PDO1-076 | Isolate | Rhizosphere |
| 280 | 2510461076 | Rhizobium leguminosarum bv. trifolii TA1 | Isolate | Nodule |
| 281 | 2510917022 | Rhizobium sp. AP16 | Isolate | Rhizosphere |
| 282 | 2510917026 | Rhizobium sp. CF80 | Isolate | Rhizosphere |
| 283 | 2510917028 | Rhizobium sp. CF122 | Isolate | Rhizosphere |
| 284 | 2510917030 | Rhizobium sp. CF142 | Isolate | Rhizosphere |
| 285 | 2513237084 | Rhizobium leguminosarum bv. viciae UPM1131 | Isolate | Nodule |
| 286 | 2513237085 | Rhizobium leguminosarum bv. viciae UPM1137 | Isolate | Nodule |
| 287 | 2513237088 | Rhizobium mesoamericanum STM6155 | Isolate | Nodule |
| 288 | 2513237093 | Rhizobium leguminosarum bv. phaseoli FA23 | Isolate | Nodule |
| 289 | 2513237103 | Rhizobium leguminosarum bv. viciae VF39 | Isolate | Nodule |
| 290 | 2513237138 | Rhizobium favelukesii OR191 | Isolate | Nodule |
| 291 | 2513237144 | Rhizobium sullae WSM1592 | Isolate | Nodule |
| 292 | 2513237146 | Rhizobium mongolense USDA 1844 (Illumina) | Isolate | Nodule |
| 293 | 2513237162 | Rhizobium ruizarguesonis GB30 | Isolate | Nodule |
| 294 | 2515075009 | Rhizobium leguminosarum bv. viciae 248 | Isolate | Nodule |
| 295 | 2515154113 | Rhizobium ruizarguesonis Vc2 | Isolate | Nodule |
| 296 | 2515154114 | Rhizobium ruizarguesonis Vh3 | Isolate | Nodule |
| 297 | 2515154116 | Rhizobium ruizarguesonis Ps8 | Isolate | Nodule |
| 298 | 2515154134 | Rhizobium gallicum bv. gallicum R602sp | Isolate | Nodule |
| 299 | 2516653077 | Rhizobium acaciae WSM1481 | Isolate | Nodule |
| 300 | 2516653085 | Rhizobium leguminosarum bv. phaseoli 4292 | Isolate | Nodule |
| 301 | 2517093000 | Rhizobium leguminosarum bv. trifolii SRDI943 | Isolate | Nodule |
| 302 | 2517287029 | Rhizobium leguminosarum bv. trifolii SRDI565 | Isolate | Nodule |
| 303 | 2519899620 | Rhizobium sp. Pop5 | Isolate | Nodule |
| 304 | 2524023209 | Rhizobium leucaenae USDA 9039 | Isolate | Nodule |
| 305 | 2529292951 | Rhizobium sp. CCGE 510 | Isolate | Nodule |
| 306 | 2534681796 | Rhizobium grahamii CCGE 502 | Isolate | Nodule |
| 307 | 2537561587 | Agrobacterium tumefaciens Cherry 2E-2-2 | Isolate | Rhizosphere |
| 308 | 2554235003 | Agrobacterium tumefaciens WRT31 | Isolate | Rhizosphere |
| 309 | 2558860242 | Agrobacterium fabacearum P4 | Isolate | Rhizosphere |
| 310 | 2558860983 | Allorhizobium undicola ATCC 700741 | Isolate | Rhizoplane |
| 311 | 2582581294 | Rhizobium sp. CF394 | Isolate | Rhizosphere |
| 312 | 2582581298 | Rhizobium alamii YR540 | Isolate | Rhizosphere |
| 313 | 2582581299 | Rhizobium leguminosarum OV483 | Isolate | Rhizosphere |
| 314 | 2582581304 | Rhizobium sp. YR519 | Isolate | Rhizosphere |
| 315 | 2582581307 | Rhizobium sp. YR060 | Isolate | Rhizosphere |
| 316 | 2582581308 | Rhizobium sp. OK494 | Isolate | Rhizosphere |
| 317 | 2582581315 | Agrobacterium rhizogenes YR147 | Isolate | Rhizosphere |
| 318 | 2582581316 | Agrobacterium rhizogenes OK036 | Isolate | Rhizosphere |
| 319 | 2582581867 | Rhizobium sp. OV201 | Isolate | Rhizosphere |
| 320 | 2585427526 | Rhizobium leguminosarum OV152 | Isolate | Rhizosphere |
| 321 | 2585427527 | Rhizobium lusitanum YR374 | Isolate | Rhizosphere |
| 322 | 2585427528 | Rhizobium leguminosarum CF307 | Isolate | Rhizosphere |
| 323 | 2585427529 | Rhizobium alamii YR584 | Isolate | Rhizosphere |
| 324 | 2585427530 | Rhizobium tropici YR635 | Isolate | Rhizosphere |
| 325 | 2585427531 | Agrobacterium rhizogenes YR530 | Isolate | Rhizosphere |
| 326 | 2585427590 | Rhizobium sp. CF048 | Isolate | Rhizosphere |
| 327 | 2585427593 | Rhizobium tropici CF286 | Isolate | Rhizosphere |
| 328 | 2585427594 | Rhizobium sp. YR528 | Isolate | Rhizosphere |
| 329 | 2585427608 | Agrobacterium rhizogenes OV677 | Isolate | Rhizosphere |
| 330 | 2585427609 | Agrobacterium rhizogenes CF263 | Isolate | Rhizosphere |
| 331 | 2585427633 | Neorhizobium galegae bv. officinalis HAMBI 1141 | Isolate | Nodule |
| 332 | 2585427634 | Neorhizobium galegae bv. orientalis HAMBI 540 | Isolate | Nodule |
| 333 | 2585428125 | Agrobacterium rhizogenes CF262 | Isolate | Rhizosphere |
| 334 | 2599185170 | Rhizobium mongolense USDA 1844 (PacBio) | Isolate | Nodule |
| 335 | 2599185210 | Rhizobium sp. NFACC06-2 | Isolate | Rhizoplane |
| 336 | 2599185236 | Rhizobium sp. NFR07 | Isolate | Rhizoplane |
| 337 | 2600254933 | Rhizobium sp. NFR12 | Isolate | Rhizoplane |
| 338 | 2600255279 | Rhizobium sp. NFIX01 | Isolate | Rhizoplane |
| 339 | 2600255308 | Rhizobium sp. NFIX02 | Isolate | Rhizoplane |
| 340 | 2615840624 | Rhizobium aethiopicum HBR26 | Isolate | Nodule |
| 341 | 2615840626 | Rhizobium lusitanum P1-7 | Isolate | Nodule |
| 342 | 2615840698 | Rhizobium multihospitium HAMBI 2975 | Isolate | Nodule |
| 343 | 2617270742 | Rhizobium miluonense HAMBI 2971 | Isolate | Nodule |
| 344 | 2643221546 | Microbacterium sp. Root53 | Isolate | Unclassified |
| 345 | 2643221568 | Rhizobium sp. Root564 | Isolate | Unclassified |
| 346 | 2643221582 | Rhizobium sp. Root651 | Isolate | Unclassified |
| 347 | 2643221599 | Rhizobium sp. Root708 | Isolate | Unclassified |
| 348 | 2643221634 | Rhizobium sp. Root1203 | Isolate | Unclassified |
| 349 | 2643221643 | Rhizobium sp. Root1220 | Isolate | Unclassified |
| 350 | 2643221651 | Afipia sp. Root123D2 | Isolate | Unclassified |
| 351 | 2643221693 | Rhizobium sp. Root491 | Isolate | Unclassified |
| 352 | 2667528174 | Rhizobium sp. NFR17 | Isolate | Rhizoplane |
| 353 | 2718217882 | Rhizobium sp. N741 | Isolate | Nodule |
| 354 | 2718217927 | Rhizobium sp. N324 | Isolate | Nodule |
| 355 | 2718217997 | Rhizobium phaseoli sv. phaseoli R723 | Isolate | Nodule |
| 356 | 2718218009 | Rhizobium sp. N561 | Isolate | Nodule |
| 357 | 2718218199 | Rhizobium phaseoli sv. phaseoli N261 | Isolate | Nodule |
| 358 | 2718218232 | Rhizobium phaseoli sv. phaseoli N161 | Isolate | Nodule |
| 359 | 2718218233 | Rhizobium phaseoli sv. phaseoli R744 | Isolate | Nodule |
| 360 | 2718218235 | Rhizobium phaseoli sv. phaseoli R620 | Isolate | Nodule |
| 361 | 2718218269 | Rhizobium phaseoli sv. phaseoli N671 | Isolate | Nodule |
| 362 | 2718218363 | Rhizobium sp. N113 | Isolate | Nodule |
| 363 | 2718218365 | Rhizobium sp. N731 | Isolate | Nodule |
| 364 | 2718218366 | Rhizobium sp. N621 | Isolate | Nodule |
| 365 | 2718218423 | Rhizobium sp. N941 | Isolate | Nodule |
| 366 | 2721755514 | Rhizobium sp. N6212 | Isolate | Nodule |
| 367 | 2721755556 | Rhizobium phaseoli sv. phaseoli N931 | Isolate | Nodule |
| 368 | 2721755684 | Rhizobium phaseoli sv. phaseoli N841 | Isolate | Nodule |
| 369 | 2721755685 | Rhizobium phaseoli sv. phaseoli R611 | Isolate | Nodule |
| 370 | 2721755809 | Rhizobium sp. N541 | Isolate | Nodule |
| 371 | 2721755810 | Rhizobium sp. N871 | Isolate | Nodule |
| 372 | 2721755819 | Rhizobium phaseoli sv. phaseoli N771 | Isolate | Nodule |
| 373 | 2721755822 | Rhizobium phaseoli sv. phaseoli R650 | Isolate | Nodule |
| 374 | 2721755823 | Rhizobium phaseoli sv. phaseoli R630 | Isolate | Nodule |
| 375 | 2724679232 | Rhizobium leguminosarum Vaf12 | Isolate | Unclassified |
| 376 | 2728368998 | Bradyrhizobium macuxiense BR 10303 | Isolate | Nodule |
| 377 | 2728369352 | Rhizobium phaseoli sv. phaseoli N831 | Isolate | Nodule |
| 378 | 2728369365 | Rhizobium sp. N1341 | Isolate | Nodule |
| 379 | 2728369397 | Rhizobium sp. N1314 | Isolate | Nodule |
| 380 | 2738541293 | Rhizobium sp. GV031 | Isolate | Unclassified |
| 381 | 2738541317 | Rhizobium halophytocola DSM 21600 | Isolate | Unclassified |
| 382 | 2738541333 | Rhizobium sophoriradicis CCBAU 03470 | Isolate | Unclassified |
| 383 | 2751185800 | Brucella pituitosa AA2 | Isolate | Unclassified |
| 384 | 2758568016 | [Ochrobactrum] quorumnocens A44 | Isolate | Rhizosphere |
| 385 | 2765235942 | Rhizobium sp. WYCCWR10014 | Isolate | Nodule |
| 386 | 2775507266 | Rhizobium tropici PRF 81 | Isolate | Nodule |
| 387 | 2791355256 | Rhizobium sp. M10 | Isolate | Nodule |
| 388 | 2791355259 | Rhizobium hidalgonense FH14 | Isolate | Nodule |
| 389 | 2791355260 | Rhizobium sp. L9 | Isolate | Nodule |
| 390 | 2791355261 | Rhizobium sp. J15 | Isolate | Nodule |
| 391 | 2791355262 | Rhizobium sp. M1 | Isolate | Nodule |
| 392 | 2791355263 | Rhizobium chutanense C5 | Isolate | Nodule |
| 393 | 2791355264 | Rhizobium sp. S9 | Isolate | Nodule |
| 394 | 2791355265 | Rhizobium sp. H4 | Isolate | Nodule |
| 395 | 2791355266 | Rhizobium sp. L43 | Isolate | Nodule |
| 396 | 2791355267 | Rhizobium sp. L18 | Isolate | Nodule |
| 397 | 2802429605 | Rhizobium sophoriradicis L101 | Isolate | Nodule |
| 398 | 2802429606 | Rhizobium sophoriradicis JJW1 | Isolate | Nodule |
| 399 | 2802429633 | Rhizobium anhuiense J3 | Isolate | Nodule |
| 400 | 2802429634 | Rhizobium anhuiense S10 | Isolate | Nodule |
| 401 | 2802429635 | Rhizobium anhuiense Y27 | Isolate | Nodule |
| 402 | 2802429636 | Rhizobium anhuiense JX3 | Isolate | Nodule |
| 403 | 2802429637 | Rhizobium anhuiense C15 | Isolate | Nodule |
| 404 | 2808606387 | Rhizobium sp. SJZ105 | Isolate | Rhizosphere |
| 405 | 2818991439 | Agrobacterium tumefaciens 1187 | Isolate | Unclassified |
| 406 | 2818991448 | Rhizobium miluonense 1234 | Isolate | Unclassified |
| 407 | 2818991453 | Rhizobium lusitanum 1158 | Isolate | Unclassified |
| 408 | 2818991461 | Neorhizobium alkalisoli 1225 | Isolate | Unclassified |
| 409 | 2821123053 | Rhizobium cellulosilyticum 1193 | Isolate | Unclassified |
| 410 | 2838016132 | Rhizobium phaseoli SEMIA 4071 | Isolate | Nodule |
| 411 | 2838022645 | Rhizobium aethiopicum SEMIA 4074 | Isolate | Nodule |
| 412 | 2838029111 | Rhizobium tropici SEMIA 4079 | Isolate | Nodule |
| 413 | 2838035591 | Rhizobium mongolense SEMIA 4087 | Isolate | Nodule |
| 414 | 2838042994 | Rhizobium esperanzae SEMIA 4089 | Isolate | Nodule |
| 415 | 2838048938 | Rhizobium pisi 27/80 | Isolate | Nodule |
| 416 | 2838061910 | Rhizobium phaseoli L15 | Isolate | Nodule |
| 417 | 2838068647 | Rhizobium esperanzae VC28 | Isolate | Nodule |
| 418 | 2838661181 | Rhizobium mongolense SEMIA 402 | Isolate | Nodule |
| 419 | 2838668709 | Rhizobium sophoriradicis SEMIA 403 | Isolate | Nodule |
| 420 | 2838675328 | Agrobacterium radiobacter SEMIA 410 | Isolate | Nodule |
| 421 | 2838680041 | Rhizobium leguminosarum SEMIA 415 | Isolate | Nodule |
| 422 | 2838686498 | Rhizobium leguminosarum SEMIA 416 | Isolate | Nodule |
| 423 | 2838694306 | Rhizobium leguminosarum SEMIA 421 | Isolate | Nodule |
| 424 | 2838701080 | Rhizobium aethiopicum SEMIA 428 | Isolate | Nodule |
| 425 | 2838707686 | Rhizobium leguminosarum SEMIA 430 | Isolate | Nodule |
| 426 | 2838714209 | Agrobacterium radiobacter SEMIA 435 | Isolate | Nodule |
| 427 | 2838719591 | Agrobacterium radiobacter SEMIA 436 | Isolate | Nodule |
| 428 | 2838724970 | Agrobacterium radiobacter SEMIA 437 | Isolate | Nodule |
| 429 | 2838729681 | Rhizobium leguminosarum SEMIA 445 | Isolate | Nodule |
| 430 | 2838736955 | Rhizobium cellulosilyticum SEMIA 448 | Isolate | Nodule |
| 431 | 2838742623 | Rhizobium leguminosarum SEMIA 449 | Isolate | Nodule |
| 432 | 2841840854 | Rhizobium cellulosilyticum SEMIA 444 | Isolate | Nodule |
| 433 | 2841846520 | Agrobacterium radiobacter SEMIA 440 | Isolate | Nodule |
| 434 | 2841851746 | Rhizobium leguminosarum SEMIA 498 | Isolate | Nodule |
| 435 | 2841859092 | Agrobacterium radiobacter SEMIA 4026 | Isolate | Nodule |
| 436 | 2841864319 | Rhizobium leguminosarum SEMIA 4052 | Isolate | Nodule |
| 437 | 2841974524 | Bradyrhizobium sp. CIR48 | Isolate | Nodule |
| 438 | 2842077413 | Rhizobium leguminosarum SEMIA 422 | Isolate | Nodule |
| 439 | 2842110456 | Rhizobium esperanzae SEMIA 414 | Isolate | Nodule |
| 440 | 2842118031 | Rhizobium esperanzae SEMIA 420 | Isolate | Nodule |
| 441 | 2842124991 | Agrobacterium radiobacter SEMIA 434 | Isolate | Nodule |
| 442 | 2842130223 | Agrobacterium radiobacter SEMIA 441 | Isolate | Nodule |
| 443 | 2842140634 | Rhizobium cellulosilyticum SEMIA 452 | Isolate | Nodule |
| 444 | 2842146304 | Rhizobium sophoriradicis SEMIA 454 | Isolate | Nodule |
| 445 | 2842152218 | Agrobacterium radiobacter SEMIA 457 | Isolate | Nodule |
| 446 | 2842156927 | Rhizobium leguminosarum SEMIA 459 | Isolate | Nodule |
| 447 | 2842163707 | Rhizobium leguminosarum SEMIA 460 | Isolate | Nodule |
| 448 | 2842170452 | Agrobacterium radiobacter SEMIA 461 | Isolate | Nodule |
| 449 | 2842175837 | Agrobacterium radiobacter SEMIA 462 | Isolate | Nodule |
| 450 | 2842180545 | Rhizobium leguminosarum SEMIA 463 | Isolate | Nodule |
| 451 | 2842187318 | Agrobacterium radiobacter SEMIA 464 | Isolate | Nodule |
| 452 | 2842192696 | Rhizobium esperanzae SEMIA 468 | Isolate | Nodule |
| 453 | 2842198810 | Rhizobium aethiopicum SEMIA 470 | Isolate | Nodule |
| 454 | 2842205361 | Rhizobium etli SEMIA 471 | Isolate | Nodule |
| 455 | 2842211629 | Agrobacterium radiobacter SEMIA 472 | Isolate | Nodule |
| 456 | 2842217011 | Rhizobium leguminosarum SEMIA 475 | Isolate | Nodule |
| 457 | 2842224351 | Agrobacterium radiobacter SEMIA 480 | Isolate | Nodule |
| 458 | 2842229732 | Rhizobium leguminosarum SEMIA 481 | Isolate | Nodule |
| 459 | 2842237096 | Rhizobium leguminosarum SEMIA 482 | Isolate | Nodule |
| 460 | 2842243621 | Rhizobium leguminosarum SEMIA 483 | Isolate | Nodule |
| 461 | 2842250916 | Rhizobium etli SEMIA 484 | Isolate | Nodule |
| 462 | 2842257432 | Rhizobium leguminosarum SEMIA 485 | Isolate | Nodule |
| 463 | 2842264693 | Rhizobium phaseoli SEMIA 487 | Isolate | Nodule |
| 464 | 2842271015 | Rhizobium leguminosarum SEMIA 488 | Isolate | Nodule |
| 465 | 2842278818 | Rhizobium etli SEMIA 489 | Isolate | Nodule |
| 466 | 2842285085 | Rhizobium lentis SEMIA 490 | Isolate | Nodule |
| 467 | 2842291075 | Rhizobium leguminosarum SEMIA 491 | Isolate | Nodule |
| 468 | 2842298080 | Rhizobium leucaenae SEMIA 492 | Isolate | Nodule |
| 469 | 2842304105 | Rhizobium leguminosarum SEMIA 499 | Isolate | Nodule |
| 470 | 2842311132 | Rhizobium phaseoli SEMIA 4002 | Isolate | Nodule |
| 471 | 2842317721 | Rhizobium etli SEMIA 4004 | Isolate | Nodule |
| 472 | 2842341865 | Rhizobium leguminosarum SEMIA 4011 | Isolate | Nodule |
| 473 | 2842357229 | Rhizobium leucaenae SEMIA 4015 | Isolate | Nodule |
| 474 | 2842363717 | Rhizobium leguminosarum SEMIA 4016 | Isolate | Nodule |
| 475 | 2842370503 | Rhizobium leguminosarum SEMIA 4022 | Isolate | Nodule |
| 476 | 2842377471 | Rhizobium leguminosarum SEMIA 4024 | Isolate | Nodule |
| 477 | 2842384541 | Rhizobium leguminosarum SEMIA 4025 | Isolate | Nodule |
| 478 | 2842395702 | Rhizobium ecuadorense SEMIA 4029 | Isolate | Nodule |
| 479 | 2842402390 | Rhizobium lentis SEMIA 4033 | Isolate | Nodule |
| 480 | 2842409023 | Rhizobium lentis SEMIA 4034 | Isolate | Nodule |
| 481 | 2842415677 | Rhizobium lentis SEMIA 4036 | Isolate | Nodule |
| 482 | 2842422224 | Rhizobium esperanzae SEMIA 4042 | Isolate | Nodule |
| 483 | 2842428310 | Rhizobium phaseoli SEMIA 4050 | Isolate | Nodule |
| 484 | 2842434925 | Rhizobium esperanzae SEMIA 4051 | Isolate | Nodule |
| 485 | 2842441272 | Rhizobium esperanzae SEMIA 4053 | Isolate | Nodule |
| 486 | 2842447887 | Rhizobium esperanzae SEMIA 4055 | Isolate | Nodule |
| 487 | 2842462802 | Rhizobium phaseoli SEMIA 4057 | Isolate | Nodule |
| 488 | 2842469257 | Rhizobium phaseoli SEMIA 4058 | Isolate | Nodule |
| 489 | 2842475841 | Rhizobium tropici SEMIA 4059 | Isolate | Nodule |
| 490 | 2842482326 | Rhizobium lusitanum SEMIA 4060 | Isolate | Nodule |
| 491 | 2842489311 | Rhizobium sophoriradicis SEMIA 4061 | Isolate | Nodule |
| 492 | 2842495871 | Rhizobium etli SEMIA 4062 | Isolate | Nodule |
| 493 | 2842502639 | Rhizobium tropici SEMIA 4063 | Isolate | Nodule |
| 494 | 2842509118 | Rhizobium paranaense SEMIA 4064 | Isolate | Nodule |
| 495 | 2842515876 | Agrobacterium radiobacter SEMIA 4072 | Isolate | Nodule |
| 496 | 2844454524 | Rhizobium leguminosarum bv. viciae BIHB 1217 | Isolate | Nodule |
| 497 | 2847930680 | Bradyrhizobium zhanjiangense CCBAU 51778 | Isolate | Unclassified |
| 498 | 2852387548 | Rhizobium jaguaris CCGE525 | Isolate | Unclassified |
| 499 | 2854896431 | Neorhizobium alkalisoli DSM 21826 | Isolate | Unclassified |
| 500 | 2854916844 | Neorhizobium huautlense DSM 21817 | Isolate | Unclassified |
| 501 | 2857516855 | Rhizobium sp. R-72456 | Isolate | Unclassified |
| 502 | 2857531043 | Neorhizobium sp. R-72160 | Isolate | Unclassified |
| 503 | 2899792073 | Agrobacterium deltaense CNPSo 3391 | Isolate | Nodule |
| 504 | 2899803654 | Agrobacterium sp. a22-2 | Isolate | Unclassified |
| 505 | 2899845264 | Agrobacterium fabacearum CNPSo 675 | Isolate | Unclassified |
| 506 | 2906643746 | Bradyrhizobium genosp. SA-3 Rp7b | Isolate | Unclassified |
| 507 | 2913308742 | Rhizobium halophytocola DSM 21600 | Isolate | Unclassified |
| 508 | 2919100787 | Rhizobium sp. 1399 | Isolate | Rhizosphere |
| 509 | 2919114240 | Agrobacterium tumefaciens 1457 | Isolate | Rhizosphere |
| 510 | 2919166419 | Agrobacterium cavarae 2074 | Isolate | Unclassified |
| 511 | 2919171160 | Neorhizobium sp. 2083 | Isolate | Unclassified |
| 512 | 2919408235 | Rhizobium miluonense 3199 | Isolate | Unclassified |
| 513 | 2919450847 | Ancylobacter sp. 3268 | Isolate | Rhizosphere |
| 514 | 2923556063 | Rhizobium tibeticum 3740 | Isolate | Unclassified |
| 515 | 2926754445 | Agrobacterium radiobacter SLBN-94 | Isolate | Rhizosphere |
| 516 | 2926760298 | Agrobacterium tumefaciens SLBN-170 | Isolate | Rhizosphere |
| 517 | 2929138655 | Agrobacterium sp. R-72433 Hybrid assembly | Isolate | Unclassified |
| 518 | 2933006813 | Rhizobium sp. SEMIA 439 | Isolate | Unclassified |
| 519 | 2933011516 | Rhizobium sp. SEMIA 4032 | Isolate | Unclassified |
| 520 | 2933016740 | Rhizobium sp. SEMIA 4085 | Isolate | Nodule |
| 521 | 2933570622 | Rhizobium leguminosarum SEMIA 409 | Isolate | Nodule |
| 522 | 2933586486 | Rhizobium leguminosarum SEMIA 4039 | Isolate | Nodule |
| 523 | 2933594066 | Agrobacterium fabrum 35/80 | Isolate | Nodule |
| 524 | 2933599457 | Rhizobium phaseoli M3 | Isolate | Nodule |
| 525 | 2935648319 | Bradyrhizobium sp. JR4.3 | Isolate | Nodule |
| 526 | 2935656913 | Bradyrhizobium sp. JR5.3 | Isolate | Nodule |
| 527 | 2935894831 | Rhizobium leguminosarum SEMIA 419 | Isolate | Nodule |
| 528 | 2935901341 | Rhizobium leguminosarum SEMIA 4082 | Isolate | Nodule |
| 529 | 2936011229 | Bradyrhizobium sp. JR1.1 | Isolate | Nodule |
| 530 | 2936019824 | Bradyrhizobium sp. JR1.5 | Isolate | Nodule |
| 531 | 2936028420 | Bradyrhizobium sp. JR1.7 | Isolate | Nodule |
| 532 | 2936046547 | Bradyrhizobium sp. JR3.12 | Isolate | Nodule |
| 533 | 2936055302 | Bradyrhizobium sp. JR4.1 | Isolate | Nodule |
| 534 | 2936367885 | Rhizobium changzhiense WYCCWR 11290 | Isolate | Nodule |
| 535 | 2936375103 | Rhizobium changzhiense WYCCWR 11317 | Isolate | Nodule |
| 536 | 2936381700 | Rhizobium chutanense C16 | Isolate | Unclassified |
| 537 | 2978969890 | Agrobacterium sp. SORGH_AS 787 | Isolate | Unclassified |
| 538 | 2979089926 | Agrobacterium sp. SORGH_AS 745 | Isolate | Unclassified |
| 539 | 2979095461 | Agrobacterium tumefaciens SORGH_AS 749 | Isolate | Unclassified |
| 540 | 2979100975 | Agrobacterium pusense SORGH_AS 755 | Isolate | Unclassified |
| 541 | 2984509177 | Agrobacterium pusense SORGH_AS260 | Isolate | Aerial Root |
| 542 | 2984518228 | Agrobacterium pusense SORGH_AS285 | Isolate | Aerial Root |
| 543 | 2984537506 | Agrobacterium sp. SORGH_AS440 | Isolate | Aerial Root |
| 544 | 2984587000 | Agrobacterium larrymoorei SORGH_AS974 | Isolate | Aerial Root |
| 545 | 2984601300 | Rhizobium pusense SORGH_AS1083 | Isolate | Aerial Root |
| 546 | 2996336353 | Mesorhizobium sp. YM1C-6-2 | Isolate | Unclassified |
| 547 | 2996887358 | Rhizobium sp. R711 | Isolate | Nodule |
| 548 | 2996893221 | Rhizobium sp. R635 | Isolate | Nodule |
| 549 | 3005409236 | Rhizobium sp. P32RR-XVIII | Isolate | Rhizosphere |
| 550 | 3005416602 | Rhizobium sp. P40RR-XXII | Isolate | Rhizosphere |
| 551 | 3005445848 | Rhizobium sp. WYJ-E13 | Isolate | Unclassified |
| 552 | 3005452660 | Rhizobium grahamii BG7 | Isolate | Unclassified |
| 553 | 639633055 | Rhizobium leguminosarum bv. viciae 3841 | Isolate | Unclassified |
| 554 | 8001845381 | Ancylobacter sonchi VKM B-3145 | Isolate | Unclassified |
| 555 | 8003570095 | Agrobacterium rhizogenes GBBC3284 | Isolate | Unclassified |
| 556 | 8005258706 | Rhizobium sp. R693 | Isolate | Nodule |
| 557 | 8005275841 | Rhizobium sp. N4311 | Isolate | Nodule |
| 558 | 8005282627 | Rhizobium phaseoli NC1 | Isolate | Nodule |
| 559 | 8005289223 | Rhizobium bangladeshense 1002 | Isolate | Nodule |
| 560 | 8005301065 | Rhizobium bangladeshense 1017 | Isolate | Nodule |
| 561 | 8005307578 | Rhizobium leguminosarum bv. phaseoli LCS0306 | Isolate | Unclassified |
| 562 | 8005314921 | Rhizobium sp. P28RR-XV | Isolate | Rhizosphere |
| 563 | 8005321885 | Rhizobium sp. R72 | Isolate | Nodule |
| 564 | 8005376324 | Rhizobium changzhiense WYCCWR 11279 | Isolate | Nodule |
| 565 | 8005382845 | Rhizobium sp. R634 | Isolate | Nodule |
| 566 | 8005395548 | Rhizobium sp. R339 | Isolate | Nodule |
| 567 | 8005430974 | Rhizobium phaseoli Y20 | Isolate | Nodule |
| 568 | 8005460587 | Rhizobium leguminosarum bv. viciae 248 | Isolate | Nodule |
| 569 | 8005484373 | Rhizobium tropici SARCC-755 | Isolate | Nodule |
| 570 | 8005497431 | Rhizobium phaseoli CCGM8 | Isolate | Unclassified |
| 571 | 8005542996 | Rhizobium grahamii CCGM3 | Isolate | Unclassified |
| 572 | 8005556819 | Rhizobium sp. WYCCWR 11128 | Isolate | Nodule |
| 573 | 8005563573 | Rhizobium sp. WYCCWR 11152 | Isolate | Nodule |
| 574 | 8005570704 | Rhizobium anhuiense bv. trifolii WYCCWR10015 | Isolate | Nodule |
| 575 | 8005619151 | Rhizobium phaseoli CCGM2 | Isolate | Unclassified |
| 576 | 8005626139 | Rhizobium phaseoli Y18 | Isolate | Nodule |
| 577 | 8005645114 | Rhizobium tropici IGFRI Rhizo-19 | Isolate | Rhizosphere |
| 578 | 8005668836 | Rhizobium phaseoli CCGM9 | Isolate | Unclassified |
| 579 | 8005682033 | Rhizobium dioscoreae S-93 | Isolate | Unclassified |
| 580 | 8005688590 | Rhizobium bangladeshense 1024 | Isolate | Nodule |
| 581 | 8005695170 | Rhizobium sp. RMa-01 | Isolate | Unclassified |
| 582 | 8018127388 | Rhizobium aegyptiacum 950 | Isolate | Nodule |
| 583 | 8018163183 | Rhizobium sp. WYCCWR 11146 | Isolate | Nodule |
| 584 | 8018176218 | Rhizobium sp. N122 | Isolate | Nodule |
| 585 | 8023680758 | Rhizobium leguminosarum SARCC-132 | Isolate | Nodule |
| 586 | 8024479707 | Rhizobium leguminosarum Tri-43 | Isolate | Nodule |
| 587 | 8024486573 | Rhizobium tubonense CCBAU 85046 | Isolate | Nodule |
| 588 | 8024501048 | Rhizobium sp. H4 | Isolate | Nodule |
| 589 | 8046767195 | Rhizobium calliandrae CCGE524 | Isolate | Unclassified |
| 590 | 8054460903 | Agrobacterium vaccinii B7.6 | Isolate | Unclassified |
| 591 | 8056375014 | Rhizobium redzepovicii 18T | Isolate | Nodule |
| 592 | 8056382006 | Rhizobium croatiense 13T | Isolate | Nodule |
| 593 | 8056875544 | Rhizobium halophilum TRM95001 | Isolate | Rhizosphere |
| 594 | 8057575449 | Rhizobium mayense CCGE526 | Isolate | Nodule |
| 595 | 8057874678 | Rhizobium acaciae 1AS12 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 64.32 |
| Metatranscriptomes | 0.44 |
| Isolates | 35.24 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.55 |
| Bulb | 0 |
| Endosphere | 23.02 |
| Nodule | 25.77 |
| Rhizoplane | 2.64 |
| Rhizosphere | 28.74 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0495633_0153696 | 3300046558 | Bacteria | 1062 |
| 2 | JGI25155J39150_1000006 | 3300002704 | Bacteria | 244109 |
| 3 | JGI25156J39149_1000019 | 3300002705 | Bacteria | 160845 |
| 4 | JGI25162J39368_1000278 | 3300002737 | Bacteria | 48633 |
| 5 | JGI25162J39368_1000363 | 3300002737 | Bacteria | 38689 |
| 6 | JGI25154J39366_1000055 | 3300002738 | Bacteria | 115597 |
| 7 | JGI25154J39366_1009214 | 3300002738 | Bacteria | 1227 |
| 8 | JGI25158J39367_1000089 | 3300002739 | Bacteria | 21244 |
| 9 | JGI25157J39369_1000024 | 3300002741 | Bacteria | 160844 |
| 10 | JGI25152J39213_1001153 | 3300002773 | Bacteria | 12258 |
| 11 | JGI25152J39213_1003495 | 3300002773 | Bacteria | 5337 |
| 12 | JGI25152J39213_1009407 | 3300002773 | Bacteria | 2325 |
| 13 | JGI25150J39212_1000256 | 3300002774 | Bacteria | 28172 |
| 14 | JGI25150J39212_1003725 | 3300002774 | Bacteria | 3518 |
| 15 | JGI25159J45721_1000250 | 3300002987 | Bacteria | 25349 |
| 16 | JGI25159J45721_1008535 | 3300002987 | Bacteria | 2803 |
| 17 | JGI25151J46595_10000307 | 3300003187 | Bacteria | 53542 |
| 18 | JGI25151J46595_10000916 | 3300003187 | Bacteria | 22974 |
| 19 | JGI25151J46595_10015292 | 3300003187 | Bacteria | 3388 |
| 20 | JGI25151J46595_10028356 | 3300003187 | Bacteria | 2230 |
| 21 | JGI25165J46597_1000482 | 3300003214 | Bacteria | 38683 |
| 22 | JGI25165J46597_1000763 | 3300003214 | Bacteria | 24679 |
| 23 | JGI25165J46597_1004441 | 3300003214 | Bacteria | 3010 |
| 24 | JGI25153J46596_10001761 | 3300003215 | Bacteria | 12834 |
| 25 | JGI25153J46596_10007522 | 3300003215 | Bacteria | 5337 |
| 26 | JGI25153J46596_10007663 | 3300003215 | Bacteria | 5264 |
| 27 | JGI25153J46596_10019683 | 3300003215 | Bacteria | 2576 |
| 28 | JGI25153J46596_10026654 | 3300003215 | Bacteria | 2042 |
| 29 | rootH1_10154698 | 3300003316 | Bacteria | 1046 |
| 30 | rootH2_10084723 | 3300003320 | Bacteria | 1744 |
| 31 | rootL2_10038546 | 3300003322 | Bacteria | 9502 |
| 32 | rootL2_10200840 | 3300003322 | Bacteria | 1811 |
| 33 | rootH1_10092503 | 3300003323 | Bacteria | 6769 |
| 34 | rootH1_10280632 | 3300003323 | Bacteria | 1296 |
| 35 | JGI25160J50197_1000053 | 3300003354 | Bacteria | 127632 |
| 36 | JGI25160J50197_1000632 | 3300003354 | Bacteria | 19645 |
| 37 | JGI25160J50197_1001540 | 3300003354 | Bacteria | 11407 |
| 38 | JGI25160J50197_1010159 | 3300003354 | Bacteria | 3424 |
| 39 | JGI25161J50226_1000039 | 3300003374 | Bacteria | 127632 |
| 40 | JGI25161J50226_1000448 | 3300003374 | Bacteria | 19136 |
| 41 | Ga0055526_1004767 | 3300003771 | Bacteria | 8035 |
| 42 | Ga0055526_1010140 | 3300003771 | Bacteria | 4422 |
| 43 | Ga0055526_1021928 | 3300003771 | Bacteria | 2197 |
| 44 | Ga0055524_1006703 | 3300003775 | Bacteria | 4972 |
| 45 | Ga0055524_1013459 | 3300003775 | Bacteria | 3083 |
| 46 | Ga0055524_1016049 | 3300003775 | Bacteria | 2704 |
| 47 | Ga0055524_1020064 | 3300003775 | Bacteria | 2264 |
| 48 | Ga0055524_1021844 | 3300003775 | Bacteria | 2108 |
| 49 | Ga0055536_1007405 | 3300003781 | Bacteria | 4923 |
| 50 | Ga0055536_1044355 | 3300003781 | Bacteria | 1026 |
| 51 | Ga0055528_1000353 | 3300003790 | Bacteria | 37432 |
| 52 | Ga0055528_1003604 | 3300003790 | Bacteria | 7702 |
| 53 | Ga0055528_1006094 | 3300003790 | Bacteria | 5510 |
| 54 | Ga0055528_1007796 | 3300003790 | Bacteria | 4682 |
| 55 | Ga0055528_1014790 | 3300003790 | Bacteria | 2862 |
| 56 | Ga0055528_1017262 | 3300003790 | Bacteria | 2511 |
| 57 | Ga0055530_10034502 | 3300003791 | Bacteria | 1292 |
| 58 | Ga0055540_1000534 | 3300003792 | Bacteria | 28656 |
| 59 | Ga0055540_1003328 | 3300003792 | Bacteria | 7828 |
| 60 | Ga0055540_1003638 | 3300003792 | Bacteria | 7345 |
| 61 | Ga0055540_1026490 | 3300003792 | Bacteria | 1403 |
| 62 | Ga0055531_10006103 | 3300003794 | Bacteria | 6899 |
| 63 | Ga0058692_1002893 | 3300003856 | Bacteria | 5559 |
| 64 | Ga0058692_1008969 | 3300003856 | Bacteria | 2553 |
| 65 | Ga0055543_1000015 | 3300004625 | Bacteria | 177197 |
| 66 | Ga0055543_1000033 | 3300004625 | Bacteria | 129476 |
| 67 | Ga0055543_1001045 | 3300004625 | Bacteria | 12287 |
| 68 | Ga0065165_1000361 | 3300005262 | Bacteria | 74514 |
| 69 | Ga0065165_1004004 | 3300005262 | Bacteria | 9631 |
| 70 | Ga0065165_1011832 | 3300005262 | Bacteria | 3595 |
| 71 | Ga0065165_1013597 | 3300005262 | Bacteria | 3224 |
| 72 | Ga0070670_100000542 | 3300005331 | Bacteria | 30025 |
| 73 | Ga0070668_100121389 | 3300005347 | Bacteria | 2089 |
| 74 | Ga0070671_100070799 | 3300005355 | Bacteria | 2910 |
| 75 | Ga0070667_100241085 | 3300005367 | Bacteria | 1614 |
| 76 | Ga0070709_10015360 | 3300005434 | Bacteria | 4355 |
| 77 | Ga0070714_100084386 | 3300005435 | Bacteria | 2771 |
| 78 | Ga0070713_100002604 | 3300005436 | Bacteria | 11787 |
| 79 | Ga0070711_100011309 | 3300005439 | Bacteria | 5539 |
| 80 | Ga0070711_100373304 | 3300005439 | Bacteria | 1151 |
| 81 | Ga0070663_100281924 | 3300005455 | Bacteria | 1324 |
| 82 | Ga0070665_100035023 | 3300005548 | Bacteria | 5050 |
| 83 | Ga0070665_100056705 | 3300005548 | Bacteria | 3928 |
| 84 | Ga0068855_100316761 | 3300005563 | Bacteria | 1725 |
| 85 | Ga0068854_100127565 | 3300005578 | Bacteria | 1939 |
| 86 | Ga0068854_100138051 | 3300005578 | Bacteria | 1868 |
| 87 | Ga0068856_100409853 | 3300005614 | Bacteria | 1375 |
| 88 | Ga0070717_10164656 | 3300006028 | Bacteria | 1926 |
| 89 | Ga0075365_10000502 | 3300006038 | Bacteria | 14879 |
| 90 | Ga0075365_10003106 | 3300006038 | Bacteria | 8447 |
| 91 | Ga0075365_10009424 | 3300006038 | Bacteria | 5613 |
| 92 | Ga0075365_10122642 | 3300006038 | Bacteria | 1794 |
| 93 | Ga0075368_10092370 | 3300006042 | Bacteria | 1238 |
| 94 | Ga0075363_100082888 | 3300006048 | Bacteria | 1756 |
| 95 | Ga0075364_10004999 | 3300006051 | Bacteria | 7691 |
| 96 | Ga0075364_10130398 | 3300006051 | Bacteria | 1687 |
| 97 | Ga0075364_10152013 | 3300006051 | Bacteria | 1560 |
| 98 | Ga0075364_10342114 | 3300006051 | Bacteria | 1019 |
| 99 | Ga0070715_10027251 | 3300006163 | Bacteria | 2281 |
| 100 | Ga0070712_100088949 | 3300006175 | Bacteria | 2258 |
| 101 | Ga0075362_10011778 | 3300006177 | Bacteria | 3453 |
| 102 | Ga0075362_10181715 | 3300006177 | Bacteria | 1019 |
| 103 | Ga0075367_10001356 | 3300006178 | Bacteria | 10425 |
| 104 | Ga0075367_10215714 | 3300006178 | Bacteria | 1200 |
| 105 | Ga0075369_10004564 | 3300006186 | Bacteria | 5130 |
| 106 | Ga0075369_10020670 | 3300006186 | Bacteria | 2697 |
| 107 | Ga0075369_10025041 | 3300006186 | Bacteria | 2478 |
| 108 | Ga0075369_10033787 | 3300006186 | Bacteria | 2169 |
| 109 | Ga0075369_10074351 | 3300006186 | Bacteria | 1499 |
| 110 | Ga0075369_10080549 | 3300006186 | Bacteria | 1443 |
| 111 | Ga0075369_10092861 | 3300006186 | Bacteria | 1348 |
| 112 | Ga0075366_10021161 | 3300006195 | Bacteria | 3781 |
| 113 | Ga0075366_10053594 | 3300006195 | Bacteria | 2396 |
| 114 | Ga0075370_10000964 | 3300006353 | Bacteria | 11874 |
| 115 | Ga0075370_10023914 | 3300006353 | Bacteria | 3370 |
| 116 | Ga0075370_10224756 | 3300006353 | Bacteria | 1110 |
| 117 | Ga0075370_10294882 | 3300006353 | Bacteria | 964 |
| 118 | Ga0075370_10302034 | 3300006353 | Bacteria | 952 |
| 119 | Ga0099825_1021094 | 3300006941 | Bacteria | 4492 |
| 120 | Ga0099825_1026021 | 3300006941 | Bacteria | 3175 |
| 121 | Ga0099824_1037221 | 3300006942 | Bacteria | 1364 |
| 122 | Ga0099822_1000065 | 3300006943 | Bacteria | 56217 |
| 123 | Ga0099822_1024033 | 3300006943 | Bacteria | 5517 |
| 124 | Ga0099823_1010048 | 3300006944 | Bacteria | 9616 |
| 125 | Ga0079104_1000210 | 3300006946 | Bacteria | 81817 |
| 126 | Ga0099826_10001594 | 3300006948 | Bacteria | 13827 |
| 127 | Ga0099826_10127939 | 3300006948 | Bacteria | 1486 |
| 128 | Ga0105244_10068388 | 3300009036 | Bacteria | 1775 |
| 129 | Ga0105240_10000027 | 3300009093 | Bacteria | 348486 |
| 130 | Ga0105243_10063806 | 3300009148 | Bacteria | 2953 |
| 131 | Ga0105242_10354548 | 3300009176 | Bacteria | 1356 |
| 132 | Ga0105237_10001405 | 3300009545 | Bacteria | 31816 |
| 133 | Ga0105249_11781244 | 3300009553 | Bacteria | 688 |
| 134 | Ga0123341_1000464 | 3300009765 | Bacteria | 24624 |
| 135 | Ga0123342_1010378 | 3300009766 | Bacteria | 10715 |
| 136 | Ga0123342_1039797 | 3300009766 | Bacteria | 1768 |
| 137 | Ga0105239_10001129 | 3300010375 | Bacteria | 36802 |
| 138 | Ga0105246_10110606 | 3300011119 | Bacteria | 2018 |
| 139 | Ga0157326_1010123 | 3300012513 | Bacteria | 1048 |
| 140 | Ga0157373_10014897 | 3300013100 | Bacteria | 5694 |
| 141 | Ga0157373_10206354 | 3300013100 | Bacteria | 1385 |
| 142 | Ga0157371_10000058 | 3300013102 | Bacteria | 171756 |
| 143 | Ga0157371_10022707 | 3300013102 | Bacteria | 4591 |
| 144 | Ga0157370_10000030 | 3300013104 | Bacteria | 145571 |
| 145 | Ga0157370_10000048 | 3300013104 | Bacteria | 124683 |
| 146 | Ga0157369_10326917 | 3300013105 | Bacteria | 1593 |
| 147 | Ga0157369_10773902 | 3300013105 | Bacteria | 987 |
| 148 | Ga0157378_10902129 | 3300013297 | Bacteria | 915 |
| 149 | Ga0182008_10006529 | 3300014497 | Bacteria | 6510 |
| 150 | Ga0182007_10000937 | 3300015262 | Bacteria | 16064 |
| 151 | Ga0182005_1001754 | 3300015265 | Bacteria | 8342 |
| 152 | Ga0209435_100011 | 3300025206 | Bacteria | 413027 |
| 153 | Ga0209436_100002 | 3300025208 | Bacteria | 222172 |
| 154 | Ga0209436_107046 | 3300025208 | Bacteria | 2398 |
| 155 | Ga0209437_100036 | 3300025233 | Bacteria | 469153 |
| 156 | Ga0209437_100086 | 3300025233 | Bacteria | 254578 |
| 157 | Ga0209437_121846 | 3300025233 | Bacteria | 761 |
| 158 | Ga0207425_1000497 | 3300025245 | Bacteria | 24648 |
| 159 | Ga0207425_1000964 | 3300025245 | Bacteria | 13525 |
| 160 | Ga0207425_1002513 | 3300025245 | Bacteria | 6419 |
| 161 | Ga0207425_1008591 | 3300025245 | Bacteria | 2600 |
| 162 | Ga0207425_1013561 | 3300025245 | Bacteria | 1879 |
| 163 | Ga0209646_1000024 | 3300025246 | Bacteria | 413027 |
| 164 | Ga0209646_1008262 | 3300025246 | Bacteria | 1678 |
| 165 | Ga0209026_1000030 | 3300025250 | Bacteria | 329811 |
| 166 | Ga0209677_100516 | 3300025253 | Bacteria | 21521 |
| 167 | Ga0209148_1027465 | 3300025254 | Bacteria | 876 |
| 168 | Ga0209759_1000011 | 3300025256 | Bacteria | 413027 |
| 169 | Ga0209129_1000658 | 3300025258 | Bacteria | 23033 |
| 170 | Ga0209129_1000890 | 3300025258 | Bacteria | 18372 |
| 171 | Ga0209129_1001153 | 3300025258 | Bacteria | 15295 |
| 172 | Ga0209129_1001378 | 3300025258 | Bacteria | 13625 |
| 173 | Ga0209129_1001657 | 3300025258 | Bacteria | 12048 |
| 174 | Ga0209129_1004287 | 3300025258 | Bacteria | 5671 |
| 175 | Ga0209129_1007173 | 3300025258 | Bacteria | 3390 |
| 176 | Ga0209233_1000056 | 3300025261 | Bacteria | 438104 |
| 177 | Ga0209233_1000110 | 3300025261 | Bacteria | 260825 |
| 178 | Ga0209233_1000298 | 3300025261 | Bacteria | 61008 |
| 179 | Ga0209673_1000091 | 3300025273 | Bacteria | 201875 |
| 180 | Ga0209673_1001285 | 3300025273 | Bacteria | 25734 |
| 181 | Ga0209673_1004117 | 3300025273 | Bacteria | 7981 |
| 182 | Ga0209673_1006399 | 3300025273 | Bacteria | 5694 |
| 183 | Ga0209673_1007139 | 3300025273 | Bacteria | 5225 |
| 184 | Ga0209673_1026900 | 3300025273 | Bacteria | 1880 |
| 185 | Ga0209130_1000015 | 3300025284 | Bacteria | 409631 |
| 186 | Ga0209130_1000038 | 3300025284 | Bacteria | 264226 |
| 187 | Ga0209130_1018765 | 3300025284 | Bacteria | 1618 |
| 188 | Ga0209676_1000019 | 3300025292 | Bacteria | 620012 |
| 189 | Ga0209676_1004595 | 3300025292 | Bacteria | 7621 |
| 190 | Ga0209676_1032015 | 3300025292 | Bacteria | 1587 |
| 191 | Ga0209025_1000575 | 3300025294 | Bacteria | 66684 |
| 192 | Ga0209025_1000664 | 3300025294 | Bacteria | 59562 |
| 193 | Ga0209025_1000880 | 3300025294 | Bacteria | 47017 |
| 194 | Ga0209025_1001375 | 3300025294 | Bacteria | 32637 |
| 195 | Ga0209025_1006816 | 3300025294 | Bacteria | 8721 |
| 196 | Ga0209025_1057108 | 3300025294 | Bacteria | 1494 |
| 197 | Ga0209025_1065679 | 3300025294 | Bacteria | 1323 |
| 198 | Ga0209564_1000398 | 3300025295 | Bacteria | 77724 |
| 199 | Ga0209564_1001741 | 3300025295 | Bacteria | 20415 |
| 200 | Ga0209564_1003865 | 3300025295 | Bacteria | 9650 |
| 201 | Ga0209564_1007416 | 3300025295 | Bacteria | 5672 |
| 202 | Ga0209758_1000191 | 3300025297 | Bacteria | 136984 |
| 203 | Ga0209758_1000549 | 3300025297 | Bacteria | 59562 |
| 204 | Ga0209758_1000740 | 3300025297 | Bacteria | 47623 |
| 205 | Ga0209758_1001295 | 3300025297 | Bacteria | 30719 |
| 206 | Ga0209758_1004280 | 3300025297 | Bacteria | 12051 |
| 207 | Ga0209758_1004315 | 3300025297 | Bacteria | 11975 |
| 208 | Ga0209758_1004324 | 3300025297 | Bacteria | 11934 |
| 209 | Ga0209758_1005815 | 3300025297 | Bacteria | 9239 |
| 210 | Ga0209758_1008829 | 3300025297 | Bacteria | 6416 |
| 211 | Ga0209050_1011433 | 3300025298 | Bacteria | 4210 |
| 212 | Ga0209050_1013123 | 3300025298 | Bacteria | 3716 |
| 213 | Ga0209256_1000870 | 3300025299 | Bacteria | 37394 |
| 214 | Ga0209256_1003603 | 3300025299 | Bacteria | 10650 |
| 215 | Ga0209256_1008014 | 3300025299 | Bacteria | 5017 |
| 216 | Ga0209256_1012400 | 3300025299 | Bacteria | 3272 |
| 217 | Ga0209256_1013008 | 3300025299 | Bacteria | 3122 |
| 218 | Ga0209256_1026173 | 3300025299 | Bacteria | 1685 |
| 219 | Ga0207426_1000063 | 3300025302 | Bacteria | 358920 |
| 220 | Ga0207426_1000081 | 3300025302 | Bacteria | 304502 |
| 221 | Ga0207426_1000144 | 3300025302 | Bacteria | 191590 |
| 222 | Ga0207426_1001195 | 3300025302 | Bacteria | 23072 |
| 223 | Ga0209051_1000205 | 3300025303 | Bacteria | 104781 |
| 224 | Ga0209051_1003436 | 3300025303 | Bacteria | 10383 |
| 225 | Ga0209051_1011156 | 3300025303 | Bacteria | 4464 |
| 226 | Ga0209051_1032300 | 3300025303 | Bacteria | 2000 |
| 227 | Ga0209051_1039676 | 3300025303 | Bacteria | 1697 |
| 228 | Ga0209257_1001929 | 3300025304 | Bacteria | 22391 |
| 229 | Ga0209257_1002628 | 3300025304 | Bacteria | 17336 |
| 230 | Ga0209257_1020482 | 3300025304 | Bacteria | 2443 |
| 231 | Ga0207655_1086908 | 3300025728 | Bacteria | 1111 |
| 232 | Ga0207680_10056809 | 3300025903 | Bacteria | 2366 |
| 233 | Ga0207685_10020520 | 3300025905 | Bacteria | 2198 |
| 234 | Ga0207699_10011314 | 3300025906 | Bacteria | 4501 |
| 235 | Ga0207695_10000024 | 3300025913 | Bacteria | 632311 |
| 236 | Ga0207671_10000463 | 3300025914 | Bacteria | 55685 |
| 237 | Ga0207693_10016133 | 3300025915 | Bacteria | 5975 |
| 238 | Ga0207693_10133692 | 3300025915 | Bacteria | 1950 |
| 239 | Ga0207663_10011390 | 3300025916 | Bacteria | 4775 |
| 240 | Ga0207663_10163492 | 3300025916 | Bacteria | 1574 |
| 241 | Ga0207650_10000769 | 3300025925 | Bacteria | 24619 |
| 242 | Ga0207664_10337136 | 3300025929 | Bacteria | 1333 |
| 243 | Ga0207644_10074801 | 3300025931 | Bacteria | 2487 |
| 244 | Ga0207644_10725520 | 3300025931 | Bacteria | 829 |
| 245 | Ga0207686_10299507 | 3300025934 | Bacteria | 1194 |
| 246 | Ga0207665_10013305 | 3300025939 | Bacteria | 5409 |
| 247 | Ga0207665_10034806 | 3300025939 | Bacteria | 3342 |
| 248 | Ga0207667_10269816 | 3300025949 | Bacteria | 1740 |
| 249 | Ga0207640_10607119 | 3300025981 | Bacteria | 927 |
| 250 | Ga0207678_10030783 | 3300026067 | Bacteria | 4685 |
| 251 | Ga0207702_10339042 | 3300026078 | Bacteria | 1436 |
| 252 | Ga0209281_1000253 | 3300027111 | Bacteria | 105600 |
| 253 | Ga0209389_1000003 | 3300027296 | Bacteria | 268927 |
| 254 | Ga0209371_1000009 | 3300027312 | Bacteria | 963030 |
| 255 | Ga0209371_1001069 | 3300027312 | Bacteria | 20494 |
| 256 | Ga0209371_1002375 | 3300027312 | Bacteria | 10648 |
| 257 | Ga0209371_1003235 | 3300027312 | Bacteria | 8124 |
| 258 | Ga0209371_1003293 | 3300027312 | Bacteria | 8001 |
| 259 | Ga0209589_1000001 | 3300027357 | Bacteria | 794224 |
| 260 | Ga0209589_1000008 | 3300027357 | Bacteria | 259970 |
| 261 | Ga0209489_100001 | 3300027361 | Bacteria | 794224 |
| 262 | Ga0209489_100022 | 3300027361 | Bacteria | 202016 |
| 263 | Ga0209700_100001 | 3300027363 | Bacteria | 794224 |
| 264 | Ga0209700_100023 | 3300027363 | Bacteria | 229662 |
| 265 | Ga0209282_1001731 | 3300027666 | Bacteria | 12202 |
| 266 | Ga0209282_1222231 | 3300027666 | Bacteria | 854 |
| 267 | Ga0268266_10023667 | 3300028379 | Bacteria | 5228 |
| 268 | Ga0268266_10062041 | 3300028379 | Bacteria | 3225 |
| 269 | Ga0268266_10560462 | 3300028379 | Bacteria | 1095 |
| 270 | Ga0307515_10049930 | 3300028794 | Bacteria | 6277 |
| 271 | Ga0307515_10584330 | 3300028794 | Bacteria | 727 |
| 272 | Ga0268256_1000010 | 3300030500 | Bacteria | 963034 |
| 273 | Ga0268256_1000882 | 3300030500 | Bacteria | 20778 |
| 274 | Ga0268256_1002814 | 3300030500 | Bacteria | 8429 |
| 275 | Ga0307513_10030733 | 3300031456 | Bacteria | 6097 |
| 276 | Ga0307513_10404383 | 3300031456 | Bacteria | 1099 |
| 277 | Ga0307516_10499464 | 3300031730 | Bacteria | 871 |
| 278 | Ga0307405_10004852 | 3300031731 | Bacteria | 6419 |
| 279 | Ga0307406_10013413 | 3300031901 | Bacteria | 4694 |
| 280 | Ga0307412_10001068 | 3300031911 | Bacteria | 15676 |
| 281 | Ga0307414_10934898 | 3300032004 | Bacteria | 796 |
| 282 | Ga0307414_11106635 | 3300032004 | Bacteria | 732 |
| 283 | Ga0307510_10285206 | 3300033180 | Bacteria | 1120 |
| 284 | Ga0439436_0045124 | 3300041404 | Bacteria | 1255 |
| 285 | Ga0439466_0062423 | 3300041411 | Bacteria | 1198 |
| 286 | Ga0439465_0006903 | 3300041413 | Bacteria | 3606 |
| 287 | Ga0439465_0011953 | 3300041413 | Bacteria | 2719 |
| 288 | Ga0439465_0028103 | 3300041413 | Bacteria | 1782 |
| 289 | Ga0439465_0057605 | 3300041413 | Bacteria | 1282 |
| 290 | Ga0451787_614361 | 3300041441 | Bacteria | 1089 |
| 291 | Ga0451793_0099162 | 3300041452 | Bacteria | 818 |
| 292 | Ga0451798_0691597 | 3300041458 | Bacteria | 1538 |
| 293 | Ga0451807_0010051 | 3300041486 | Bacteria | 1325 |
| 294 | Ga0451837_0002636 | 3300041494 | Bacteria | 3172 |
| 295 | Ga0451841_0129660 | 3300041498 | Bacteria | 3887 |
| 296 | Ga0451845_0353633 | 3300041501 | Bacteria | 1396 |
| 297 | Ga0451846_44944 | 3300041502 | Bacteria | 1036 |
| 298 | Ga0451849_0977170 | 3300041505 | Bacteria | 759 |
| 299 | Ga0451851_0555611 | 3300041507 | Bacteria | 778 |
| 300 | Ga0451855_0065115 | 3300041511 | Bacteria | 1874 |
| 301 | Ga0451853_1039407 | 3300041512 | Bacteria | 1746 |
| 302 | Ga0439445_0026045 | 3300042004 | Bacteria | 1495 |
| 303 | Ga0439432_025666 | 3300042006 | Bacteria | 1932 |
| 304 | Ga0439449_0017684 | 3300042007 | Bacteria | 2677 |
| 305 | Ga0439452_049582 | 3300042010 | Bacteria | 965 |
| 306 | Ga0439462_0052010 | 3300042015 | Bacteria | 1102 |
| 307 | Ga0466963_0016998 | 3300044694 | Bacteria | 4531 |
| 308 | Ga0466971_0124325 | 3300044719 | Bacteria | 1195 |
| 309 | Ga0466970_0002877 | 3300044765 | Bacteria | 8330 |
| 310 | Ga0466970_0189686 | 3300044765 | Bacteria | 1142 |
| 311 | Ga0466959_0188384 | 3300045049 | Bacteria | 1441 |
| 312 | Ga0466958_0030702 | 3300045836 | Bacteria | 3193 |
| 313 | Ga0466967_0053049 | 3300045976 | Bacteria | 3563 |
| 314 | Ga0466967_0114229 | 3300045976 | Bacteria | 2486 |
| 315 | Ga0495617_090111 | 3300046452 | Bacteria | 1001 |
| 316 | Ga0495590_0032876 | 3300046457 | Bacteria | 1814 |
| 317 | Ga0495590_0155949 | 3300046457 | Bacteria | 829 |
| 318 | Ga0495629_0064028 | 3300046459 | Bacteria | 2567 |
| 319 | Ga0495638_0001240 | 3300046460 | Bacteria | 24046 |
| 320 | Ga0495651_0058156 | 3300046462 | Bacteria | 2967 |
| 321 | Ga0495650_0042218 | 3300046471 | Bacteria | 1943 |
| 322 | Ga0495650_0196403 | 3300046471 | Bacteria | 703 |
| 323 | Ga0495605_0001485 | 3300046474 | Bacteria | 15300 |
| 324 | Ga0495662_0056244 | 3300046476 | Bacteria | 1900 |
| 325 | Ga0495664_0047959 | 3300046477 | Bacteria | 2536 |
| 326 | Ga0495585_0012481 | 3300046492 | Bacteria | 5005 |
| 327 | Ga0495585_0014204 | 3300046492 | Bacteria | 4646 |
| 328 | Ga0495585_0159006 | 3300046492 | Bacteria | 1173 |
| 329 | Ga0495585_0181081 | 3300046492 | Bacteria | 1083 |
| 330 | Ga0495607_0029512 | 3300046501 | Bacteria | 3374 |
| 331 | Ga0495607_0068146 | 3300046501 | Bacteria | 1997 |
| 332 | Ga0495607_0279184 | 3300046501 | Bacteria | 793 |
| 333 | Ga0495583_0010556 | 3300046506 | Bacteria | 5371 |
| 334 | Ga0495583_0029024 | 3300046506 | Bacteria | 2711 |
| 335 | Ga0495606_0000735 | 3300046507 | Bacteria | 50674 |
| 336 | Ga0495606_0023350 | 3300046507 | Bacteria | 4482 |
| 337 | Ga0495606_0140236 | 3300046507 | Bacteria | 1428 |
| 338 | Ga0495606_0203452 | 3300046507 | Bacteria | 1127 |
| 339 | Ga0495606_0233307 | 3300046507 | Bacteria | 1030 |
| 340 | Ga0495610_0002327 | 3300046512 | Bacteria | 16059 |
| 341 | Ga0495610_0019920 | 3300046512 | Bacteria | 3739 |
| 342 | Ga0495610_0055028 | 3300046512 | Bacteria | 1920 |
| 343 | Ga0495610_0138495 | 3300046512 | Bacteria | 1050 |
| 344 | Ga0495610_0157821 | 3300046512 | Bacteria | 962 |
| 345 | Ga0495616_0196504 | 3300046513 | Bacteria | 889 |
| 346 | Ga0495616_0251129 | 3300046513 | Bacteria | 760 |
| 347 | Ga0495620_0014366 | 3300046515 | Bacteria | 4026 |
| 348 | Ga0495620_0017434 | 3300046515 | Bacteria | 3580 |
| 349 | Ga0495631_0009069 | 3300046518 | Bacteria | 4983 |
| 350 | Ga0495631_0228153 | 3300046518 | Bacteria | 794 |
| 351 | Ga0495632_0009593 | 3300046519 | Bacteria | 5820 |
| 352 | Ga0495632_0010893 | 3300046519 | Bacteria | 5345 |
| 353 | Ga0495643_0036715 | 3300046522 | Bacteria | 2691 |
| 354 | Ga0495643_0051706 | 3300046522 | Bacteria | 2208 |
| 355 | Ga0495643_0078477 | 3300046522 | Bacteria | 1723 |
| 356 | Ga0495648_0102243 | 3300046524 | Bacteria | 1579 |
| 357 | Ga0495652_0123384 | 3300046529 | Bacteria | 2062 |
| 358 | Ga0495654_0000043 | 3300046530 | Bacteria | 161913 |
| 359 | Ga0495654_0050543 | 3300046530 | Bacteria | 2031 |
| 360 | Ga0495654_0293013 | 3300046530 | Bacteria | 666 |
| 361 | Ga0495609_0024551 | 3300046538 | Bacteria | 2765 |
| 362 | Ga0495633_0077541 | 3300046558 | Bacteria | 1547 |
| 363 | Ga0495633_0305152 | 3300046558 | Bacteria | 723 |
| 364 | Ga0495656_0082778 | 3300046615 | Bacteria | 1452 |
| 365 | Ga0495668_0014667 | 3300046616 | Bacteria | 4589 |
| 366 | Ga0495668_0052769 | 3300046616 | Bacteria | 2249 |
| 367 | Ga0495668_0144982 | 3300046616 | Bacteria | 1300 |
| 368 | Ga0495634_0103853 | 3300046642 | Bacteria | 1834 |
| 369 | Ga0495625_0001629 | 3300046660 | Bacteria | 26456 |
| 370 | Ga0495625_0071733 | 3300046660 | Bacteria | 2430 |
| 371 | Ga0495625_0281216 | 3300046660 | Bacteria | 1070 |
| 372 | Ga0495625_0430615 | 3300046660 | Bacteria | 818 |
| 373 | Ga0495661_0139054 | 3300046665 | Bacteria | 1323 |
| 374 | Ga0495661_0442303 | 3300046665 | Bacteria | 627 |
| 375 | Ga0495588_0003015 | 3300046674 | Bacteria | 7286 |
| 376 | Ga0495657_0096284 | 3300046675 | Bacteria | 1891 |
| 377 | Ga0495658_0108801 | 3300046683 | Bacteria | 1664 |
| 378 | Ga0495613_0154420 | 3300046689 | Bacteria | 1636 |
| 379 | Ga0495624_0495709 | 3300046690 | Bacteria | 731 |
| 380 | Ga0495670_0171046 | 3300046691 | Bacteria | 1144 |
| 381 | Ga0495670_0422402 | 3300046691 | Bacteria | 721 |
| 382 | Ga0495671_0016935 | 3300046692 | Bacteria | 3885 |
| 383 | Ga0495671_0149217 | 3300046692 | Bacteria | 1138 |
| 384 | Ga0495660_0026081 | 3300046810 | Bacteria | 3315 |
| 385 | Ga0495660_0074784 | 3300046810 | Bacteria | 1789 |
| 386 | Ga0495604_0009543 | 3300047317 | Bacteria | 7675 |
| 387 | Ga0495636_0057426 | 3300047318 | Bacteria | 1639 |
| 388 | Ga0495636_0130593 | 3300047318 | Bacteria | 1117 |
| 389 | Ga0495683_0059267 | 3300047323 | Bacteria | 1900 |
| 390 | Ga0495683_0286941 | 3300047323 | Bacteria | 711 |
| 391 | Ga0495687_029497 | 3300047443 | Bacteria | 2538 |
| 392 | Ga0495687_064212 | 3300047443 | Bacteria | 1500 |
| 393 | Ga0495687_102316 | 3300047443 | Bacteria | 1072 |
| 394 | Ga0495673_0098147 | 3300047469 | Bacteria | 1188 |
| 395 | Ga0495681_0003362 | 3300047470 | Bacteria | 11135 |
| 396 | Ga0495686_0000709 | 3300047472 | Bacteria | 44909 |
| 397 | Ga0495686_0014984 | 3300047472 | Bacteria | 5314 |
| 398 | Ga0495686_0035588 | 3300047472 | Bacteria | 3199 |
| 399 | Ga0495686_0052733 | 3300047472 | Bacteria | 2550 |
| 400 | Ga0495686_0144460 | 3300047472 | Bacteria | 1402 |
| 401 | Ga0495686_0183045 | 3300047472 | Bacteria | 1213 |
| 402 | Ga0495686_0272523 | 3300047472 | Bacteria | 943 |
| 403 | Ga0495686_0279763 | 3300047472 | Bacteria | 928 |
| 404 | Ga0495686_0284012 | 3300047472 | Bacteria | 919 |
| 405 | Ga0495602_0130352 | 3300048088 | Bacteria | 2007 |
| 406 | Ga0495615_0064244 | 3300048090 | Bacteria | 976 |
| 407 | Ga0495626_0092080 | 3300048091 | Bacteria | 1332 |
| 408 | Ga0495626_0138185 | 3300048091 | Bacteria | 1035 |
| 409 | Ga0496100_0072764 | 3300048903 | Bacteria | 2298 |
| 410 | Ga0496101_0074669 | 3300048904 | Bacteria | 2494 |
| 411 | Ga0496101_0080623 | 3300048904 | Bacteria | 2405 |
| 412 | Ga0496101_0088333 | 3300048904 | Bacteria | 2302 |
| 413 | Ga0496102_0059986 | 3300048905 | Bacteria | 3480 |
| 414 | Ga0496103_0051002 | 3300048906 | Bacteria | 2560 |
| 415 | Ga0496105_0105823 | 3300048908 | Bacteria | 2322 |
| 416 | Ga0496106_0003475 | 3300048909 | Bacteria | 11736 |
| 417 | Ga0496107_0194572 | 3300048910 | Bacteria | 1507 |
| 418 | Ga0496109_0778383 | 3300048912 | Bacteria | 895 |
| 419 | Ga0496113_0176237 | 3300048916 | Bacteria | 1694 |
| 420 | Ga0496113_0261938 | 3300048916 | Bacteria | 1381 |
| 421 | Ga0496114_0180005 | 3300048917 | Bacteria | 1846 |
| 422 | Ga0496116_0000080 | 3300048919 | Bacteria | 224530 |
| 423 | Ga0496116_0012346 | 3300048919 | Bacteria | 6983 |
| 424 | Ga0496116_0014972 | 3300048919 | Bacteria | 6154 |
| 425 | Ga0496116_0015287 | 3300048919 | Bacteria | 6071 |
| 426 | Ga0496116_0016190 | 3300048919 | Bacteria | 5851 |
| 427 | Ga0496116_0017971 | 3300048919 | Bacteria | 5468 |
| 428 | Ga0496116_0119207 | 3300048919 | Bacteria | 1531 |
| 429 | Ga0496116_0133015 | 3300048919 | Bacteria | 1414 |
| 430 | Ga0496116_0254781 | 3300048919 | Bacteria | 870 |
| 431 | Ga0496117_0000002 | 3300048920 | Bacteria | 2483758 |
| 432 | Ga0496117_0001662 | 3300048920 | Bacteria | 31159 |
| 433 | Ga0496117_0007726 | 3300048920 | Bacteria | 10396 |
| 434 | Ga0496117_0026756 | 3300048920 | Bacteria | 4506 |
| 435 | Ga0496117_0061498 | 3300048920 | Bacteria | 2581 |
| 436 | Ga0496117_0061747 | 3300048920 | Bacteria | 2573 |
| 437 | Ga0496117_0085619 | 3300048920 | Bacteria | 2051 |
| 438 | Ga0496117_0108157 | 3300048920 | Bacteria | 1740 |
| 439 | Ga0496117_0139005 | 3300048920 | Bacteria | 1458 |
| 440 | Ga0496117_0142915 | 3300048920 | Bacteria | 1430 |
| 441 | Ga0496118_0000483 | 3300048921 | Bacteria | 66119 |
| 442 | Ga0496118_0001307 | 3300048921 | Bacteria | 37899 |
| 443 | Ga0496118_0022314 | 3300048921 | Bacteria | 5540 |
| 444 | Ga0496118_0040214 | 3300048921 | Bacteria | 3720 |
| 445 | Ga0496118_0043655 | 3300048921 | Bacteria | 3520 |
| 446 | Ga0496118_0060165 | 3300048921 | Bacteria | 2822 |
| 447 | Ga0496118_0064309 | 3300048921 | Bacteria | 2693 |
| 448 | Ga0496119_0013327 | 3300048922 | Bacteria | 6568 |
| 449 | Ga0496119_0025048 | 3300048922 | Bacteria | 4177 |
| 450 | Ga0496119_0040211 | 3300048922 | Bacteria | 2994 |
| 451 | Ga0496119_0052702 | 3300048922 | Bacteria | 2490 |
| 452 | Ga0496119_0077573 | 3300048922 | Bacteria | 1924 |
| 453 | Ga0496119_0094460 | 3300048922 | Bacteria | 1691 |
| 454 | Ga0496119_0162549 | 3300048922 | Bacteria | 1185 |
| 455 | Ga0496119_0191074 | 3300048922 | Bacteria | 1067 |
| 456 | Ga0496120_0000971 | 3300048923 | Bacteria | 39060 |
| 457 | Ga0496120_0006732 | 3300048923 | Bacteria | 8735 |
| 458 | Ga0496120_0066508 | 3300048923 | Bacteria | 1993 |
| 459 | Ga0496121_0000001 | 3300048924 | Bacteria | 1830318 |
| 460 | Ga0496121_0002165 | 3300048924 | Bacteria | 30743 |
| 461 | Ga0496121_0018159 | 3300048924 | Bacteria | 7111 |
| 462 | Ga0496121_0067217 | 3300048924 | Bacteria | 2906 |
| 463 | Ga0496121_0076793 | 3300048924 | Bacteria | 2662 |
| 464 | Ga0496121_0082627 | 3300048924 | Bacteria | 2538 |
| 465 | Ga0496121_0086832 | 3300048924 | Bacteria | 2457 |
| 466 | Ga0496121_0093292 | 3300048924 | Bacteria | 2344 |
| 467 | Ga0496121_0285580 | 3300048924 | Bacteria | 1127 |
| 468 | Ga0496122_0000001 | 3300048925 | Bacteria | 1827766 |
| 469 | Ga0496122_0000009 | 3300048925 | Bacteria | 584024 |
| 470 | Ga0496122_0004617 | 3300048925 | Bacteria | 16949 |
| 471 | Ga0496122_0007697 | 3300048925 | Bacteria | 11876 |
| 472 | Ga0496122_0018033 | 3300048925 | Bacteria | 6547 |
| 473 | Ga0496122_0050249 | 3300048925 | Bacteria | 3182 |
| 474 | Ga0496122_0080521 | 3300048925 | Bacteria | 2270 |
| 475 | Ga0496122_0113305 | 3300048925 | Bacteria | 1772 |
| 476 | Ga0496123_0000001 | 3300048926 | Bacteria | 1831497 |
| 477 | Ga0496123_0000020 | 3300048926 | Bacteria | 388748 |
| 478 | Ga0496123_0004746 | 3300048926 | Bacteria | 14067 |
| 479 | Ga0496123_0022781 | 3300048926 | Bacteria | 4815 |
| 480 | Ga0496123_0034689 | 3300048926 | Bacteria | 3609 |
| 481 | Ga0496123_0045341 | 3300048926 | Bacteria | 2996 |
| 482 | Ga0496123_0058705 | 3300048926 | Bacteria | 2493 |
| 483 | Ga0496123_0067892 | 3300048926 | Bacteria | 2249 |
| 484 | Ga0496124_0000262 | 3300048927 | Bacteria | 101572 |
| 485 | Ga0496124_0007119 | 3300048927 | Bacteria | 11978 |
| 486 | Ga0496124_0013622 | 3300048927 | Bacteria | 7927 |
| 487 | Ga0496124_0018393 | 3300048927 | Bacteria | 6545 |
| 488 | Ga0496124_0023230 | 3300048927 | Bacteria | 5666 |
| 489 | Ga0496124_0043893 | 3300048927 | Bacteria | 3840 |
| 490 | Ga0496124_0046038 | 3300048927 | Bacteria | 3738 |
| 491 | Ga0496124_0053381 | 3300048927 | Bacteria | 3426 |
| 492 | Ga0496124_0074779 | 3300048927 | Bacteria | 2799 |
| 493 | Ga0496124_0096633 | 3300048927 | Bacteria | 2399 |
| 494 | Ga0496124_0136624 | 3300048927 | Bacteria | 1940 |
| 495 | Ga0496124_0411296 | 3300048927 | Bacteria | 935 |
| 496 | Ga0496124_0477709 | 3300048927 | Bacteria | 842 |
| 497 | Ga0496125_0000001 | 3300048928 | Bacteria | 1766138 |
| 498 | Ga0496125_0016520 | 3300048928 | Bacteria | 7083 |
| 499 | Ga0496125_0025331 | 3300048928 | Bacteria | 5435 |
| 500 | Ga0496125_0049495 | 3300048928 | Bacteria | 3492 |
| 501 | Ga0496125_0062822 | 3300048928 | Bacteria | 2966 |
| 502 | Ga0496125_0072436 | 3300048928 | Bacteria | 2684 |
| 503 | Ga0496125_0082734 | 3300048928 | Bacteria | 2445 |
| 504 | Ga0496125_0361205 | 3300048928 | Bacteria | 863 |
| 505 | Ga0496126_0000690 | 3300048929 | Bacteria | 61848 |
| 506 | Ga0496126_0111694 | 3300048929 | Bacteria | 2380 |
| 507 | Ga0496126_0147630 | 3300048929 | Bacteria | 2018 |
| 508 | Ga0496126_0148944 | 3300048929 | Bacteria | 2007 |
| 509 | Ga0496126_0183905 | 3300048929 | Bacteria | 1773 |
| 510 | Ga0496126_0289988 | 3300048929 | Bacteria | 1353 |
| 511 | Ga0496126_0352334 | 3300048929 | Bacteria | 1204 |
| 512 | Ga0495678_038514 | 3300049459 | Bacteria | 1934 |
| 513 | Ga0495678_109196 | 3300049459 | Bacteria | 946 |
| 514 | Ga0501031_0441072 | 3300049568 | Bacteria | 841 |
| 515 | Ga0501033_0196836 | 3300049570 | Bacteria | 1441 |
| 516 | Ga0501034_0976209 | 3300049571 | Bacteria | 732 |
| 517 | Ga0501036_0255306 | 3300049572 | Bacteria | 1469 |
| 518 | Ga0501036_0284127 | 3300049572 | Bacteria | 1385 |
| 519 | Ga0501038_0208423 | 3300049574 | Bacteria | 1565 |
| 520 | Ga0501038_0264297 | 3300049574 | Bacteria | 1359 |
| 521 | Ga0501043_0071995 | 3300049579 | Bacteria | 2715 |
| 522 | Ga0501046_0041285 | 3300049580 | Bacteria | 3682 |
| 523 | Ga0501047_0037789 | 3300049581 | Bacteria | 4669 |
| 524 | Ga0501047_0328419 | 3300049581 | Bacteria | 1368 |
| 525 | Ga0501067_0097078 | 3300049583 | Bacteria | 1637 |
| 526 | Ga0501068_0137844 | 3300049584 | Bacteria | 1529 |
| 527 | Ga0501070_0090792 | 3300049586 | Bacteria | 2528 |
| 528 | Ga0501080_0023253 | 3300049742 | Bacteria | 5747 |
| 529 | Ga0501083_0013991 | 3300049744 | Bacteria | 5606 |
| 530 | Ga0501083_0053730 | 3300049744 | Bacteria | 2704 |
| 531 | Ga0501035_0044052 | 3300049822 | Bacteria | 4020 |
| 532 | Ga0501035_0396818 | 3300049822 | Bacteria | 1148 |
| 533 | Ga0501044_0063679 | 3300049823 | Bacteria | 3766 |
| 534 | nmdc:mga03683_28724_c1 | 3300050489 | Bacteria | 2214 |
| 535 | nmdc:mga03683_50247_c1 | 3300050489 | Bacteria | 1738 |
| 536 | nmdc:mga00v17_127673_c1 | 3300050491 | Bacteria | 1624 |
| 537 | nmdc:mga00v17_30517_c1 | 3300050491 | Bacteria | 3173 |
| 538 | nmdc:mga00v17_371750_c1 | 3300050491 | Bacteria | 929 |
| 539 | nmdc:mga00v17_45280_c1 | 3300050491 | Bacteria | 2657 |
| 540 | nmdc:mga0yw44_223802_c1 | 3300050492 | Bacteria | 1248 |
| 541 | nmdc:mga0yw44_441_c1 | 3300050492 | Bacteria | 14578 |
| 542 | nmdc:mga0k408_69746_c1 | 3300050493 | Bacteria | 2052 |
| 543 | nmdc:mga0k408_83224_c1 | 3300050493 | Bacteria | 1876 |
| 544 | nmdc:mga06z11_109368_c1 | 3300050494 | Bacteria | 1528 |
| 545 | nmdc:mga06z11_12014_c1 | 3300050494 | Bacteria | 3754 |
| 546 | nmdc:mga07m45_14767_c1 | 3300050496 | Bacteria | 4169 |
| 547 | nmdc:mga07m45_324190_c1 | 3300050496 | Bacteria | 895 |
| 548 | nmdc:mga0sz30_16824_c1 | 3300050516 | Bacteria | 2909 |
| 549 | nmdc:mga0sz30_17862_c1 | 3300050516 | Bacteria | 2833 |
| 550 | nmdc:mga0sz30_41677_c1 | 3300050516 | Bacteria | 1930 |
| 551 | nmdc:mga0sz30_93509_c1 | 3300050516 | Bacteria | 743 |
| 552 | nmdc:mga0sz30_93702_c1 | 3300050516 | Bacteria | 1308 |
| 553 | Ga0495619_0069308 | 3300053085 | Bacteria | 2357 |
| 554 | Ga0500578_0043620 | 3300053086 | Bacteria | 2878 |
| 555 | Ga0500578_0057512 | 3300053086 | Bacteria | 2486 |
| 556 | Ga0500643_047498 | 3300053087 | Bacteria | 1237 |
| 557 | Ga0500651_0125666 | 3300053093 | Bacteria | 1554 |
| 558 | Ga0500560_004509 | 3300053107 | Bacteria | 2973 |
| 559 | Ga0500569_004752 | 3300053109 | Bacteria | 2878 |
| 560 | Ga0500594_0003638 | 3300053118 | Bacteria | 3399 |
| 561 | Ga0500594_0034381 | 3300053118 | Bacteria | 1354 |
| 562 | Ga0500594_0070082 | 3300053118 | Bacteria | 1029 |
| 563 | Ga0500618_000665 | 3300053125 | Bacteria | 20266 |
| 564 | Ga0500618_001239 | 3300053125 | Bacteria | 11938 |
| 565 | Ga0500618_006475 | 3300053125 | Bacteria | 3431 |
| 566 | Ga0500618_010149 | 3300053125 | Bacteria | 2535 |
| 567 | Ga0500658_0002853 | 3300053134 | Bacteria | 6630 |
| 568 | Ga0500658_0004815 | 3300053134 | Bacteria | 5034 |
| 569 | Ga0500559_0026508 | 3300053136 | Bacteria | 2470 |
| 570 | Ga0500568_0006681 | 3300053139 | Bacteria | 5765 |
| 571 | Ga0500568_0012248 | 3300053139 | Bacteria | 3950 |
| 572 | Ga0500590_021794 | 3300053148 | Bacteria | 3324 |
| 573 | Ga0500604_0019584 | 3300053151 | Bacteria | 1896 |
| 574 | Ga0500616_0000777 | 3300053153 | Bacteria | 36725 |
| 575 | Ga0500616_0001268 | 3300053153 | Bacteria | 25214 |
| 576 | Ga0500616_0004445 | 3300053153 | Bacteria | 9991 |
| 577 | Ga0500622_0003948 | 3300053156 | Bacteria | 9580 |
| 578 | Ga0500622_0157240 | 3300053156 | Bacteria | 1069 |
| 579 | Ga0500624_000965 | 3300053157 | Bacteria | 5901 |
| 580 | Ga0500627_0283195 | 3300053158 | Bacteria | 727 |
| 581 | Ga0500633_0022800 | 3300053160 | Bacteria | 1923 |
| 582 | Ga0500634_0142874 | 3300053161 | Bacteria | 1131 |
| 583 | Ga0500636_0000023 | 3300053177 | Bacteria | 89900 |
| 584 | Ga0500636_0008459 | 3300053177 | Bacteria | 5969 |
| 585 | Ga0587073_0125378 | 3300059492 | Bacteria | 698 |
| 586 | Ga0587069_016708 | 3300059642 | Bacteria | 1052 |
| 587 | Ga0587072_042288 | 3300059643 | Bacteria | 889 |
| 588 | Ga0501082_0452051 | 3300060353 | Bacteria | 1122 |
| 589 | 2509388204 | 2509276021 | Bacteria | 7634384 |
| 590 | 2509443796 | 2509276033 | Bacteria | 7180565 |
| 591 | 2510131688 | 2510065019 | Bacteria | 6903379 |
| 592 | 2510841433 | 2510461069 | Bacteria | 5505000 |
| 593 | 2510897981 | 2510461076 | Bacteria | 8618824 |
| 594 | 2511137395 | 2510917022 | Bacteria | 6504556 |
| 595 | 2511170421 | 2510917026 | Bacteria | 7046020 |
| 596 | 2511183626 | 2510917028 | Bacteria | 6185411 |
| 597 | 2511196147 | 2510917030 | Bacteria | 7460662 |
| 598 | 2513571265 | 2513237084 | Bacteria | 7231967 |
| 599 | 2513579202 | 2513237085 | Bacteria | 7695351 |
| 600 | 2513598715 | 2513237088 | Bacteria | 6927906 |
| 601 | 2513632360 | 2513237093 | Bacteria | 7545552 |
| 602 | 2513711686 | 2513237103 | Bacteria | 7647401 |
| 603 | 2513866292 | 2513237138 | Bacteria | 7368160 |
| 604 | 2513907912 | 2513237144 | Bacteria | 7530820 |
| 605 | 2513927571 | 2513237146 | Bacteria | 7166346 |
| 606 | 2514020818 | 2513237162 | Bacteria | 7468464 |
| 607 | 2515110624 | 2515075009 | Bacteria | 7288508 |
| 608 | 2515639080 | 2515154113 | Bacteria | 7807172 |
| 609 | 2515645930 | 2515154114 | Bacteria | 7848616 |
| 610 | 2515661501 | 2515154116 | Bacteria | 7552979 |
| 611 | 2515742894 | 2515154134 | Bacteria | 7220242 |
| 612 | 2517039326 | 2516653077 | Bacteria | 7555578 |
| 613 | 2517079546 | 2516653085 | Bacteria | 7346596 |
| 614 | 2517093496 | 2517093000 | Bacteria | 7412387 |
| 615 | 2517405197 | 2517287029 | Bacteria | 6905599 |
| 616 | 2520379956 | 2519899620 | Bacteria | 6499161 |
| 617 | 2524457693 | 2524023209 | Bacteria | 6679728 |
| 618 | 2530647610 | 2529292951 | Bacteria | 6916614 |
| 619 | 2535515268 | 2534681796 | Bacteria | 7146037 |
| 620 | 2537874404 | 2537561587 | Bacteria | 5425293 |
| 621 | 2554246775 | 2554235003 | Bacteria | 5877155 |
| 622 | 2559294002 | 2558860242 | Bacteria | 5568029 |
| 623 | 2561467265 | 2558860983 | Bacteria | 4133860 |
| 624 | 2585204049 | 2582581294 | Bacteria | 6626667 |
| 625 | 2585225686 | 2582581298 | Bacteria | 7315509 |
| 626 | 2585229161 | 2582581299 | Bacteria | 6518058 |
| 627 | 2585257007 | 2582581304 | Bacteria | 5831370 |
| 628 | 2585275264 | 2582581307 | Bacteria | 6597605 |
| 629 | 2585281992 | 2582581308 | Bacteria | 7413247 |
| 630 | 2585325805 | 2582581315 | Bacteria | 7318924 |
| 631 | 2585329973 | 2582581316 | Bacteria | 7774528 |
| 632 | 2585403900 | 2582581867 | Bacteria | 7184437 |
| 633 | 2585528492 | 2585427526 | Bacteria | 7258840 |
| 634 | 2585536357 | 2585427527 | Bacteria | 7273426 |
| 635 | 2585539891 | 2585427528 | Bacteria | 6842387 |
| 636 | 2585548039 | 2585427529 | Bacteria | 7395659 |
| 637 | 2585554230 | 2585427530 | Bacteria | 7383882 |
| 638 | 2585560293 | 2585427531 | Bacteria | 6992870 |
| 639 | 2585824393 | 2585427590 | Bacteria | 6824633 |
| 640 | 2585837872 | 2585427593 | Bacteria | 7141551 |
| 641 | 2585844446 | 2585427594 | Bacteria | 6180594 |
| 642 | 2585901439 | 2585427608 | Bacteria | 6544331 |
| 643 | 2585905522 | 2585427609 | Bacteria | 6667127 |
| 644 | 2585994660 | 2585427633 | Bacteria | 6413184 |
| 645 | 2585999144 | 2585427634 | Bacteria | 6455027 |
| 646 | 2587979363 | 2585428125 | Bacteria | 6662905 |
| 647 | 2599419001 | 2599185170 | Bacteria | 7295545 |
| 648 | 2599603674 | 2599185210 | Bacteria | 5624189 |
| 649 | 2599719383 | 2599185236 | Bacteria | 6875203 |
| 650 | 2600374881 | 2600254933 | Bacteria | 4750527 |
| 651 | 2601609021 | 2600255279 | Bacteria | 5605316 |
| 652 | 2601745796 | 2600255308 | Bacteria | 5611129 |
| 653 | 2616295859 | 2615840624 | Bacteria | 6557588 |
| 654 | 2616306149 | 2615840626 | Bacteria | 7921970 |
| 655 | 2616553594 | 2615840698 | Bacteria | 7319877 |
| 656 | 2617382645 | 2617270742 | Bacteria | 6808054 |
| 657 | 2643752701 | 2643221546 | Bacteria | 2910897 |
| 658 | 2643856203 | 2643221568 | Bacteria | 5187270 |
| 659 | 2643921007 | 2643221582 | Bacteria | 5804683 |
| 660 | 2644007522 | 2643221599 | Bacteria | 6292121 |
| 661 | 2644190777 | 2643221634 | Bacteria | 6705461 |
| 662 | 2644241378 | 2643221643 | Bacteria | 5749658 |
| 663 | 2644288041 | 2643221651 | Bacteria | 4798932 |
| 664 | 2644519083 | 2643221693 | Bacteria | 5513853 |
| 665 | 2671112544 | 2667528174 | Bacteria | 6435400 |
| 666 | 2719179758 | 2718217882 | Bacteria | 6556348 |
| 667 | 2719384368 | 2718217927 | Bacteria | 6972593 |
| 668 | 2719664112 | 2718217997 | Bacteria | 6740740 |
| 669 | 2719730428 | 2718218009 | Bacteria | 6478651 |
| 670 | 2720490531 | 2718218199 | Bacteria | 6740745 |
| 671 | 2720611911 | 2718218232 | Bacteria | 6720332 |
| 672 | 2720618765 | 2718218233 | Bacteria | 6662049 |
| 673 | 2720630165 | 2718218235 | Bacteria | 6630699 |
| 674 | 2720773860 | 2718218269 | Bacteria | 6906114 |
| 675 | 2721145851 | 2718218363 | Bacteria | 6524337 |
| 676 | 2721157388 | 2718218365 | Bacteria | 6274507 |
| 677 | 2721162730 | 2718218366 | Bacteria | 6425255 |
| 678 | 2721398082 | 2718218423 | Bacteria | 6438183 |
| 679 | 2722838900 | 2721755514 | Bacteria | 6424414 |
| 680 | 2723025530 | 2721755556 | Bacteria | 6745503 |
| 681 | 2723559115 | 2721755684 | Bacteria | 6859907 |
| 682 | 2723565720 | 2721755685 | Bacteria | 6704835 |
| 683 | 2724036892 | 2721755809 | Bacteria | 6438790 |
| 684 | 2724043184 | 2721755810 | Bacteria | 6479005 |
| 685 | 2724088467 | 2721755819 | Bacteria | 6906405 |
| 686 | 2724102985 | 2721755822 | Bacteria | 6726041 |
| 687 | 2724108843 | 2721755823 | Bacteria | 6752556 |
| 688 | 2725950738 | 2724679232 | Bacteria | 7646494 |
| 689 | 2728754793 | 2728368998 | Bacteria | 8720350 |
| 690 | 2730106466 | 2728369352 | Bacteria | 6745171 |
| 691 | 2730162995 | 2728369365 | Bacteria | 6555560 |
| 692 | 2730297020 | 2728369397 | Bacteria | 6274511 |
| 693 | 2738802378 | 2738541293 | Bacteria | 7065685 |
| 694 | 2738945791 | 2738541317 | Bacteria | 5340176 |
| 695 | 2739034750 | 2738541333 | Bacteria | 7106503 |
| 696 | 2753357000 | 2751185800 | Bacteria | 5467370 |
| 697 | 2758640522 | 2758568016 | Bacteria | 5645291 |
| 698 | 2766065027 | 2765235942 | Bacteria | 7445910 |
| 699 | 2778174347 | 2775507266 | Bacteria | 7392367 |
| 700 | 2793295026 | 2791355256 | Bacteria | 6798008 |
| 701 | 2793315238 | 2791355259 | Bacteria | 7254731 |
| 702 | 2793320093 | 2791355260 | Bacteria | 6598818 |
| 703 | 2793328280 | 2791355261 | Bacteria | 6661293 |
| 704 | 2793332623 | 2791355262 | Bacteria | 6774204 |
| 705 | 2793342921 | 2791355263 | Bacteria | 6872478 |
| 706 | 2793350593 | 2791355264 | Bacteria | 6429314 |
| 707 | 2793353191 | 2791355265 | Bacteria | 6539969 |
| 708 | 2793360996 | 2791355266 | Bacteria | 7116587 |
| 709 | 2793364879 | 2791355267 | Bacteria | 7222458 |
| 710 | 2805927390 | 2802429605 | Bacteria | 6875453 |
| 711 | 2805936430 | 2802429606 | Bacteria | 6346811 |
| 712 | 2806044047 | 2802429633 | Bacteria | 7341974 |
| 713 | 2806052136 | 2802429634 | Bacteria | 7083200 |
| 714 | 2806058437 | 2802429635 | Bacteria | 7650140 |
| 715 | 2806066934 | 2802429636 | Bacteria | 7597525 |
| 716 | 2806074677 | 2802429637 | Bacteria | 7067217 |
| 717 | 2808986222 | 2808606387 | Bacteria | 5697198 |
| 718 | 2819556352 | 2818991439 | Bacteria | 6907412 |
| 719 | 2819608226 | 2818991448 | Bacteria | 6772224 |
| 720 | 2819639578 | 2818991453 | Bacteria | 7181617 |
| 721 | 2819684529 | 2818991461 | Bacteria | 7026071 |
| 722 | 2821123815 | 2821123053 | Bacteria | 7836056 |
| 723 | 2838021798 | 2838016132 | Bacteria | 6577831 |
| 724 | 2838026505 | 2838022645 | Bacteria | 6494267 |
| 725 | 2838029119 | 2838029111 | Bacteria | 6603031 |
| 726 | 2838037311 | 2838035591 | Bacteria | 7166484 |
| 727 | 2838047282 | 2838042994 | Bacteria | 6046894 |
| 728 | 2838054589 | 2838048938 | Bacteria | 6044578 |
| 729 | 2838067521 | 2838061910 | Bacteria | 6794874 |
| 730 | 2838074060 | 2838068647 | Bacteria | 6208656 |
| 731 | 2838663502 | 2838661181 | Bacteria | 7385261 |
| 732 | 2838673257 | 2838668709 | Bacteria | 6671819 |
| 733 | 2838677079 | 2838675328 | Bacteria | 4909118 |
| 734 | 2838680789 | 2838680041 | Bacteria | 6545511 |
| 735 | 2838692550 | 2838686498 | Bacteria | 7807632 |
| 736 | 2838695178 | 2838694306 | Bacteria | 6853137 |
| 737 | 2838704059 | 2838701080 | Bacteria | 6669771 |
| 738 | 2838708554 | 2838707686 | Bacteria | 6619912 |
| 739 | 2838715966 | 2838714209 | Bacteria | 5525906 |
| 740 | 2838720232 | 2838719591 | Bacteria | 5523910 |
| 741 | 2838726719 | 2838724970 | Bacteria | 4908691 |
| 742 | 2838732622 | 2838729681 | Bacteria | 7400765 |
| 743 | 2838739155 | 2838736955 | Bacteria | 5760694 |
| 744 | 2838745517 | 2838742623 | Bacteria | 7396178 |
| 745 | 2841843053 | 2841840854 | Bacteria | 5761912 |
| 746 | 2841847166 | 2841846520 | Bacteria | 5345850 |
| 747 | 2841855161 | 2841851746 | Bacteria | 7532261 |
| 748 | 2841860301 | 2841859092 | Bacteria | 5436171 |
| 749 | 2841866613 | 2841864319 | Bacteria | 6742987 |
| 750 | 2841980674 | 2841974524 | Bacteria | 8931498 |
| 751 | 2842080212 | 2842077413 | Bacteria | 6508645 |
| 752 | 2842112413 | 2842110456 | Bacteria | 7656360 |
| 753 | 2842120831 | 2842118031 | Bacteria | 7033875 |
| 754 | 2842126804 | 2842124991 | Bacteria | 5346824 |
| 755 | 2842131972 | 2842130223 | Bacteria | 4909145 |
| 756 | 2842142835 | 2842140634 | Bacteria | 5759631 |
| 757 | 2842148149 | 2842146304 | Bacteria | 5957337 |
| 758 | 2842152858 | 2842152218 | Bacteria | 4908957 |
| 759 | 2842161809 | 2842156927 | Bacteria | 6894975 |
| 760 | 2842169184 | 2842163707 | Bacteria | 6916235 |
| 761 | 2842172211 | 2842170452 | Bacteria | 5525737 |
| 762 | 2842176477 | 2842175837 | Bacteria | 4908771 |
| 763 | 2842185426 | 2842180545 | Bacteria | 6888678 |
| 764 | 2842189075 | 2842187318 | Bacteria | 5524014 |
| 765 | 2842193098 | 2842192696 | Bacteria | 6147454 |
| 766 | 2842203163 | 2842198810 | Bacteria | 6608673 |
| 767 | 2842206740 | 2842205361 | Bacteria | 6340321 |
| 768 | 2842213388 | 2842211629 | Bacteria | 5523832 |
| 769 | 2842218584 | 2842217011 | Bacteria | 7497767 |
| 770 | 2842224994 | 2842224351 | Bacteria | 5524473 |
| 771 | 2842233364 | 2842229732 | Bacteria | 7475766 |
| 772 | 2842237966 | 2842237096 | Bacteria | 6620661 |
| 773 | 2842248632 | 2842243621 | Bacteria | 7421798 |
| 774 | 2842253215 | 2842250916 | Bacteria | 6579627 |
| 775 | 2842261775 | 2842257432 | Bacteria | 7401195 |
| 776 | 2842267249 | 2842264693 | Bacteria | 6472963 |
| 777 | 2842277161 | 2842271015 | Bacteria | 7807131 |
| 778 | 2842280567 | 2842278818 | Bacteria | 6340002 |
| 779 | 2842289518 | 2842285085 | Bacteria | 6011953 |
| 780 | 2842293871 | 2842291075 | Bacteria | 7076806 |
| 781 | 2842300692 | 2842298080 | Bacteria | 6123127 |
| 782 | 2842306281 | 2842304105 | Bacteria | 7023636 |
| 783 | 2842315960 | 2842311132 | Bacteria | 6616990 |
| 784 | 2842322323 | 2842317721 | Bacteria | 6793725 |
| 785 | 2842342865 | 2842341865 | Bacteria | 7003929 |
| 786 | 2842358190 | 2842357229 | Bacteria | 6485165 |
| 787 | 2842369491 | 2842363717 | Bacteria | 6844742 |
| 788 | 2842371252 | 2842370503 | Bacteria | 7038661 |
| 789 | 2842380267 | 2842377471 | Bacteria | 7140707 |
| 790 | 2842387339 | 2842384541 | Bacteria | 7057858 |
| 791 | 2842400755 | 2842395702 | Bacteria | 6780583 |
| 792 | 2842406866 | 2842402390 | Bacteria | 6681310 |
| 793 | 2842413637 | 2842409023 | Bacteria | 6687331 |
| 794 | 2842420400 | 2842415677 | Bacteria | 6596907 |
| 795 | 2842427688 | 2842422224 | Bacteria | 6239196 |
| 796 | 2842431499 | 2842428310 | Bacteria | 6767288 |
| 797 | 2842437834 | 2842434925 | Bacteria | 6502746 |
| 798 | 2842444649 | 2842441272 | Bacteria | 6769273 |
| 799 | 2842450406 | 2842447887 | Bacteria | 6754142 |
| 800 | 2842465523 | 2842462802 | Bacteria | 6588055 |
| 801 | 2842472333 | 2842469257 | Bacteria | 6752936 |
| 802 | 2842476451 | 2842475841 | Bacteria | 6603183 |
| 803 | 2842482528 | 2842482326 | Bacteria | 7212537 |
| 804 | 2842495093 | 2842489311 | Bacteria | 6620893 |
| 805 | 2842501013 | 2842495871 | Bacteria | 6820686 |
| 806 | 2842502647 | 2842502639 | Bacteria | 6604161 |
| 807 | 2842509379 | 2842509118 | Bacteria | 6850950 |
| 808 | 2842517086 | 2842515876 | Bacteria | 5436280 |
| 809 | 2844455776 | 2844454524 | Bacteria | 7952546 |
| 810 | 2847934152 | 2847930680 | Bacteria | 9342022 |
| 811 | 2852388700 | 2852387548 | Bacteria | 8025568 |
| 812 | 2854898456 | 2854896431 | Bacteria | 5869725 |
| 813 | 2854917768 | 2854916844 | Bacteria | 5725939 |
| 814 | 2857524060 | 2857516855 | Bacteria | 7787325 |
| 815 | 2857531377 | 2857531043 | Bacteria | 6754041 |
| 816 | 2899792366 | 2899792073 | Bacteria | 4926588 |
| 817 | 2899805964 | 2899803654 | Bacteria | 5577784 |
| 818 | 2899846639 | 2899845264 | Bacteria | 5672268 |
| 819 | 2906647309 | 2906643746 | Bacteria | 8722424 |
| 820 | 2913310526 | 2913308742 | Bacteria | 5350706 |
| 821 | 2919101162 | 2919100787 | Bacteria | 7710546 |
| 822 | 2919116170 | 2919114240 | Bacteria | 5700270 |
| 823 | 2919167030 | 2919166419 | Bacteria | 4952238 |
| 824 | 2919171881 | 2919171160 | Bacteria | 6499771 |
| 825 | 2919408976 | 2919408235 | Bacteria | 6149349 |
| 826 | 2919453107 | 2919450847 | Bacteria | 5631160 |
| 827 | 2923557374 | 2923556063 | Bacteria | 6793593 |
| 828 | 2926757124 | 2926754445 | Bacteria | 5964435 |
| 829 | 2926761345 | 2926760298 | Bacteria | 5505990 |
| 830 | 2929139116 | 2929138655 | Bacteria | 5810547 |
| 831 | 2933007503 | 2933006813 | Bacteria | 4912075 |
| 832 | 2933012271 | 2933011516 | Bacteria | 5439334 |
| 833 | 2933023279 | 2933016740 | Bacteria | 6355406 |
| 834 | 2933573350 | 2933570622 | Bacteria | 7023390 |
| 835 | 2933587742 | 2933586486 | Bacteria | 7667493 |
| 836 | 2933594716 | 2933594066 | Bacteria | 5594265 |
| 837 | 2933604428 | 2933599457 | Bacteria | 5858799 |
| 838 | 2935652554 | 2935648319 | Bacteria | 8801166 |
| 839 | 2935661136 | 2935656913 | Bacteria | 8965014 |
| 840 | 2935895701 | 2935894831 | Bacteria | 6620579 |
| 841 | 2935907342 | 2935901341 | Bacteria | 7341747 |
| 842 | 2936015193 | 2936011229 | Bacteria | 8801034 |
| 843 | 2936023338 | 2936019824 | Bacteria | 8804134 |
| 844 | 2936032209 | 2936028420 | Bacteria | 8965941 |
| 845 | 2936050070 | 2936046547 | Bacteria | 8903709 |
| 846 | 2936061828 | 2936055302 | Bacteria | 8785755 |
| 847 | 2936368726 | 2936367885 | Bacteria | 7324495 |
| 848 | 2936377197 | 2936375103 | Bacteria | 6652732 |
| 849 | 2936383844 | 2936381700 | Bacteria | 7006523 |
| 850 | 2978973445 | 2978969890 | Bacteria | 5400756 |
| 851 | 2979093373 | 2979089926 | Bacteria | 5670289 |
| 852 | 2979099242 | 2979095461 | Bacteria | 5669583 |
| 853 | 2979105344 | 2979100975 | Bacteria | 5423623 |
| 854 | 2984512800 | 2984509177 | Bacteria | 5274802 |
| 855 | 2984520837 | 2984518228 | Bacteria | 5277463 |
| 856 | 2984540131 | 2984537506 | Bacteria | 5277481 |
| 857 | 2984591728 | 2984587000 | Bacteria | 5263363 |
| 858 | 2984602324 | 2984601300 | Bacteria | 5455244 |
| 859 | 2996338219 | 2996336353 | Bacteria | 5511628 |
| 860 | 2996892008 | 2996887358 | Bacteria | 5795980 |
| 861 | 2996893642 | 2996893221 | Bacteria | 5823108 |
| 862 | 3005411401 | 3005409236 | Bacteria | 7188837 |
| 863 | 3005422634 | 3005416602 | Bacteria | 7064308 |
| 864 | 3005446352 | 3005445848 | Bacteria | 6906074 |
| 865 | 3005453022 | 3005452660 | Bacteria | 5889319 |
| 866 | 639646883 | 639633055 | Bacteria | 7751309 |
| 867 | 8001850517 | 8001845381 | Bacteria | 5804942 |
| 868 | 8003570201 | 8003570095 | Bacteria | 5747666 |
| 869 | 8005263669 | 8005258706 | Bacteria | 6184835 |
| 870 | 8005279083 | 8005275841 | Bacteria | 6929066 |
| 871 | 8005283830 | 8005282627 | Bacteria | 6675747 |
| 872 | 8005291904 | 8005289223 | Bacteria | 6634003 |
| 873 | 8005304035 | 8005301065 | Bacteria | 6614431 |
| 874 | 8005308860 | 8005307578 | Bacteria | 7395396 |
| 875 | 8005321829 | 8005314921 | Bacteria | 7072929 |
| 876 | 8005326535 | 8005321885 | Bacteria | 5795980 |
| 877 | 8005377233 | 8005376324 | Bacteria | 6590079 |
| 878 | 8005387098 | 8005382845 | Bacteria | 6732062 |
| 879 | 8005401859 | 8005395548 | Bacteria | 6806915 |
| 880 | 8005433125 | 8005430974 | Bacteria | 6689030 |
| 881 | 8005461266 | 8005460587 | Bacteria | 7157962 |
| 882 | 8005485966 | 8005484373 | Bacteria | 6297373 |
| 883 | 8005498857 | 8005497431 | Bacteria | 6477605 |
| 884 | 8005543950 | 8005542996 | Bacteria | 7077758 |
| 885 | 8005559261 | 8005556819 | Bacteria | 6908598 |
| 886 | 8005569824 | 8005563573 | Bacteria | 7153261 |
| 887 | 8005577126 | 8005570704 | Bacteria | 6957481 |
| 888 | 8005620044 | 8005619151 | Bacteria | 7030230 |
| 889 | 8005628649 | 8005626139 | Bacteria | 6534237 |
| 890 | 8005646654 | 8005645114 | Bacteria | 6950293 |
| 891 | 8005670269 | 8005668836 | Bacteria | 6953162 |
| 892 | 8005684934 | 8005682033 | Bacteria | 6726518 |
| 893 | 8005690460 | 8005688590 | Bacteria | 6610080 |
| 894 | 8005698000 | 8005695170 | Bacteria | 6912330 |
| 895 | 8018133316 | 8018127388 | Bacteria | 7351159 |
| 896 | 8018167886 | 8018163183 | Bacteria | 7277977 |
| 897 | 8018180454 | 8018176218 | Bacteria | 6896178 |
| 898 | 8023684017 | 8023680758 | Bacteria | 7729763 |
| 899 | 8024480498 | 8024479707 | Bacteria | 6954785 |
| 900 | 8024487730 | 8024486573 | Bacteria | 6540512 |
| 901 | 8024502549 | 8024501048 | Bacteria | 6427847 |
| 902 | 8046769806 | 8046767195 | Bacteria | 7547379 |
| 903 | 8054461448 | 8054460903 | Bacteria | 4872905 |
| 904 | 8056379077 | 8056375014 | Bacteria | 7006639 |
| 905 | 8056386153 | 8056382006 | Bacteria | 6408074 |
| 906 | 8056879288 | 8056875544 | Bacteria | 4355797 |
| 907 | 8057577428 | 8057575449 | Bacteria | 7367519 |
| 908 | 8057881154 | 8057874678 | Bacteria | 7494653 |
| 909 | Ga0495633_0153696 | |||
| 910 | JGI25155J39150_1000006 | |||
| 911 | JGI25156J39149_1000019 | |||
| 912 | JGI25162J39368_1000278 | |||
| 913 | JGI25162J39368_1000363 | |||
| 914 | JGI25154J39366_1000055 | |||
| 915 | JGI25154J39366_1009214 | |||
| 916 | JGI25158J39367_1000089 | |||
| 917 | JGI25157J39369_1000024 | |||
| 918 | JGI25152J39213_1001153 | |||
| 919 | JGI25152J39213_1003495 | |||
| 920 | JGI25152J39213_1009407 | |||
| 921 | JGI25150J39212_1000256 | |||
| 922 | JGI25150J39212_1003725 | |||
| 923 | JGI25159J45721_1000250 | |||
| 924 | JGI25159J45721_1008535 | |||
| 925 | JGI25151J46595_10000307 | |||
| 926 | JGI25151J46595_10000916 | |||
| 927 | JGI25151J46595_10015292 | |||
| 928 | JGI25151J46595_10028356 | |||
| 929 | JGI25165J46597_1000482 | |||
| 930 | JGI25165J46597_1000763 | |||
| 931 | JGI25165J46597_1004441 | |||
| 932 | JGI25153J46596_10001761 | |||
| 933 | JGI25153J46596_10007522 | |||
| 934 | JGI25153J46596_10007663 | |||
| 935 | JGI25153J46596_10019683 | |||
| 936 | JGI25153J46596_10026654 | |||
| 937 | rootH1_10154698 | |||
| 938 | rootH2_10084723 | |||
| 939 | rootL2_10038546 | |||
| 940 | rootL2_10200840 | |||
| 941 | rootH1_10092503 | |||
| 942 | rootH1_10280632 | |||
| 943 | JGI25160J50197_1000053 | |||
| 944 | JGI25160J50197_1000632 | |||
| 945 | JGI25160J50197_1001540 | |||
| 946 | JGI25160J50197_1010159 | |||
| 947 | JGI25161J50226_1000039 | |||
| 948 | JGI25161J50226_1000448 | |||
| 949 | Ga0055526_1004767 | |||
| 950 | Ga0055526_1010140 | |||
| 951 | Ga0055526_1021928 | |||
| 952 | Ga0055524_1006703 | |||
| 953 | Ga0055524_1013459 | |||
| 954 | Ga0055524_1016049 | |||
| 955 | Ga0055524_1020064 | |||
| 956 | Ga0055524_1021844 | |||
| 957 | Ga0055536_1007405 | |||
| 958 | Ga0055536_1044355 | |||
| 959 | Ga0055528_1000353 | |||
| 960 | Ga0055528_1003604 | |||
| 961 | Ga0055528_1006094 | |||
| 962 | Ga0055528_1007796 | |||
| 963 | Ga0055528_1014790 | |||
| 964 | Ga0055528_1017262 | |||
| 965 | Ga0055530_10034502 | |||
| 966 | Ga0055540_1000534 | |||
| 967 | Ga0055540_1003328 | |||
| 968 | Ga0055540_1003638 | |||
| 969 | Ga0055540_1026490 | |||
| 970 | Ga0055531_10006103 | |||
| 971 | Ga0058692_1002893 | |||
| 972 | Ga0058692_1008969 | |||
| 973 | Ga0055543_1000015 | |||
| 974 | Ga0055543_1000033 | |||
| 975 | Ga0055543_1001045 | |||
| 976 | Ga0065165_1000361 | |||
| 977 | Ga0065165_1004004 | |||
| 978 | Ga0065165_1011832 | |||
| 979 | Ga0065165_1013597 | |||
| 980 | Ga0070670_100000542 | |||
| 981 | Ga0070668_100121389 | |||
| 982 | Ga0070671_100070799 | |||
| 983 | Ga0070667_100241085 | |||
| 984 | Ga0070709_10015360 | |||
| 985 | Ga0070714_100084386 | |||
| 986 | Ga0070713_100002604 | |||
| 987 | Ga0070711_100011309 | |||
| 988 | Ga0070711_100373304 | |||
| 989 | Ga0070663_100281924 | |||
| 990 | Ga0070665_100035023 | |||
| 991 | Ga0070665_100056705 | |||
| 992 | Ga0068855_100316761 | |||
| 993 | Ga0068854_100127565 | |||
| 994 | Ga0068854_100138051 | |||
| 995 | Ga0068856_100409853 | |||
| 996 | Ga0070717_10164656 | |||
| 997 | Ga0075365_10000502 | |||
| 998 | Ga0075365_10003106 | |||
| 999 | Ga0075365_10009424 | |||
| 1000 | Ga0075365_10122642 | |||
| 1001 | Ga0075368_10092370 | |||
| 1002 | Ga0075363_100082888 | |||
| 1003 | Ga0075364_10004999 | |||
| 1004 | Ga0075364_10130398 | |||
| 1005 | Ga0075364_10152013 | |||
| 1006 | Ga0075364_10342114 | |||
| 1007 | Ga0070715_10027251 | |||
| 1008 | Ga0070712_100088949 | |||
| 1009 | Ga0075362_10011778 | |||
| 1010 | Ga0075362_10181715 | |||
| 1011 | Ga0075367_10001356 | |||
| 1012 | Ga0075367_10215714 | |||
| 1013 | Ga0075369_10004564 | |||
| 1014 | Ga0075369_10020670 | |||
| 1015 | Ga0075369_10025041 | |||
| 1016 | Ga0075369_10033787 | |||
| 1017 | Ga0075369_10074351 | |||
| 1018 | Ga0075369_10080549 | |||
| 1019 | Ga0075369_10092861 | |||
| 1020 | Ga0075366_10021161 | |||
| 1021 | Ga0075366_10053594 | |||
| 1022 | Ga0075370_10000964 | |||
| 1023 | Ga0075370_10023914 | |||
| 1024 | Ga0075370_10224756 | |||
| 1025 | Ga0075370_10294882 | |||
| 1026 | Ga0075370_10302034 | |||
| 1027 | Ga0099825_1021094 | |||
| 1028 | Ga0099825_1026021 | |||
| 1029 | Ga0099824_1037221 | |||
| 1030 | Ga0099822_1000065 | |||
| 1031 | Ga0099822_1024033 | |||
| 1032 | Ga0099823_1010048 | |||
| 1033 | Ga0079104_1000210 | |||
| 1034 | Ga0099826_10001594 | |||
| 1035 | Ga0099826_10127939 | |||
| 1036 | Ga0105244_10068388 | |||
| 1037 | Ga0105240_10000027 | |||
| 1038 | Ga0105243_10063806 | |||
| 1039 | Ga0105242_10354548 | |||
| 1040 | Ga0105237_10001405 | |||
| 1041 | Ga0105249_11781244 | |||
| 1042 | Ga0123341_1000464 | |||
| 1043 | Ga0123342_1010378 | |||
| 1044 | Ga0123342_1039797 | |||
| 1045 | Ga0105239_10001129 | |||
| 1046 | Ga0105246_10110606 | |||
| 1047 | Ga0157326_1010123 | |||
| 1048 | Ga0157373_10014897 | |||
| 1049 | Ga0157373_10206354 | |||
| 1050 | Ga0157371_10000058 | |||
| 1051 | Ga0157371_10022707 | |||
| 1052 | Ga0157370_10000030 | |||
| 1053 | Ga0157370_10000048 | |||
| 1054 | Ga0157369_10326917 | |||
| 1055 | Ga0157369_10773902 | |||
| 1056 | Ga0157378_10902129 | |||
| 1057 | Ga0182008_10006529 | |||
| 1058 | Ga0182007_10000937 | |||
| 1059 | Ga0182005_1001754 | |||
| 1060 | Ga0209435_100011 | |||
| 1061 | Ga0209436_100002 | |||
| 1062 | Ga0209436_107046 | |||
| 1063 | Ga0209437_100036 | |||
| 1064 | Ga0209437_100086 | |||
| 1065 | Ga0209437_121846 | |||
| 1066 | Ga0207425_1000497 | |||
| 1067 | Ga0207425_1000964 | |||
| 1068 | Ga0207425_1002513 | |||
| 1069 | Ga0207425_1008591 | |||
| 1070 | Ga0207425_1013561 | |||
| 1071 | Ga0209646_1000024 | |||
| 1072 | Ga0209646_1008262 | |||
| 1073 | Ga0209026_1000030 | |||
| 1074 | Ga0209677_100516 | |||
| 1075 | Ga0209148_1027465 | |||
| 1076 | Ga0209759_1000011 | |||
| 1077 | Ga0209129_1000658 | |||
| 1078 | Ga0209129_1000890 | |||
| 1079 | Ga0209129_1001153 | |||
| 1080 | Ga0209129_1001378 | |||
| 1081 | Ga0209129_1001657 | |||
| 1082 | Ga0209129_1004287 | |||
| 1083 | Ga0209129_1007173 | |||
| 1084 | Ga0209233_1000056 | |||
| 1085 | Ga0209233_1000110 | |||
| 1086 | Ga0209233_1000298 | |||
| 1087 | Ga0209673_1000091 | |||
| 1088 | Ga0209673_1001285 | |||
| 1089 | Ga0209673_1004117 | |||
| 1090 | Ga0209673_1006399 | |||
| 1091 | Ga0209673_1007139 | |||
| 1092 | Ga0209673_1026900 | |||
| 1093 | Ga0209130_1000015 | |||
| 1094 | Ga0209130_1000038 | |||
| 1095 | Ga0209130_1018765 | |||
| 1096 | Ga0209676_1000019 | |||
| 1097 | Ga0209676_1004595 | |||
| 1098 | Ga0209676_1032015 | |||
| 1099 | Ga0209025_1000575 | |||
| 1100 | Ga0209025_1000664 | |||
| 1101 | Ga0209025_1000880 | |||
| 1102 | Ga0209025_1001375 | |||
| 1103 | Ga0209025_1006816 | |||
| 1104 | Ga0209025_1057108 | |||
| 1105 | Ga0209025_1065679 | |||
| 1106 | Ga0209564_1000398 | |||
| 1107 | Ga0209564_1001741 | |||
| 1108 | Ga0209564_1003865 | |||
| 1109 | Ga0209564_1007416 | |||
| 1110 | Ga0209758_1000191 | |||
| 1111 | Ga0209758_1000549 | |||
| 1112 | Ga0209758_1000740 | |||
| 1113 | Ga0209758_1001295 | |||
| 1114 | Ga0209758_1004280 | |||
| 1115 | Ga0209758_1004315 | |||
| 1116 | Ga0209758_1004324 | |||
| 1117 | Ga0209758_1005815 | |||
| 1118 | Ga0209758_1008829 | |||
| 1119 | Ga0209050_1011433 | |||
| 1120 | Ga0209050_1013123 | |||
| 1121 | Ga0209256_1000870 | |||
| 1122 | Ga0209256_1003603 | |||
| 1123 | Ga0209256_1008014 | |||
| 1124 | Ga0209256_1012400 | |||
| 1125 | Ga0209256_1013008 | |||
| 1126 | Ga0209256_1026173 | |||
| 1127 | Ga0207426_1000063 | |||
| 1128 | Ga0207426_1000081 | |||
| 1129 | Ga0207426_1000144 | |||
| 1130 | Ga0207426_1001195 | |||
| 1131 | Ga0209051_1000205 | |||
| 1132 | Ga0209051_1003436 | |||
| 1133 | Ga0209051_1011156 | |||
| 1134 | Ga0209051_1032300 | |||
| 1135 | Ga0209051_1039676 | |||
| 1136 | Ga0209257_1001929 | |||
| 1137 | Ga0209257_1002628 | |||
| 1138 | Ga0209257_1020482 | |||
| 1139 | Ga0207655_1086908 | |||
| 1140 | Ga0207680_10056809 | |||
| 1141 | Ga0207685_10020520 | |||
| 1142 | Ga0207699_10011314 | |||
| 1143 | Ga0207695_10000024 | |||
| 1144 | Ga0207671_10000463 | |||
| 1145 | Ga0207693_10016133 | |||
| 1146 | Ga0207693_10133692 | |||
| 1147 | Ga0207663_10011390 | |||
| 1148 | Ga0207663_10163492 | |||
| 1149 | Ga0207650_10000769 | |||
| 1150 | Ga0207664_10337136 | |||
| 1151 | Ga0207644_10074801 | |||
| 1152 | Ga0207644_10725520 | |||
| 1153 | Ga0207686_10299507 | |||
| 1154 | Ga0207665_10013305 | |||
| 1155 | Ga0207665_10034806 | |||
| 1156 | Ga0207667_10269816 | |||
| 1157 | Ga0207640_10607119 | |||
| 1158 | Ga0207678_10030783 | |||
| 1159 | Ga0207702_10339042 | |||
| 1160 | Ga0209281_1000253 | |||
| 1161 | Ga0209389_1000003 | |||
| 1162 | Ga0209371_1000009 | |||
| 1163 | Ga0209371_1001069 | |||
| 1164 | Ga0209371_1002375 | |||
| 1165 | Ga0209371_1003235 | |||
| 1166 | Ga0209371_1003293 | |||
| 1167 | Ga0209589_1000001 | |||
| 1168 | Ga0209589_1000008 | |||
| 1169 | Ga0209489_100001 | |||
| 1170 | Ga0209489_100022 | |||
| 1171 | Ga0209700_100001 | |||
| 1172 | Ga0209700_100023 | |||
| 1173 | Ga0209282_1001731 | |||
| 1174 | Ga0209282_1222231 | |||
| 1175 | Ga0268266_10023667 | |||
| 1176 | Ga0268266_10062041 | |||
| 1177 | Ga0268266_10560462 | |||
| 1178 | Ga0307515_10049930 | |||
| 1179 | Ga0307515_10584330 | |||
| 1180 | Ga0268256_1000010 | |||
| 1181 | Ga0268256_1000882 | |||
| 1182 | Ga0268256_1002814 | |||
| 1183 | Ga0307513_10030733 | |||
| 1184 | Ga0307513_10404383 | |||
| 1185 | Ga0307516_10499464 | |||
| 1186 | Ga0307405_10004852 | |||
| 1187 | Ga0307406_10013413 | |||
| 1188 | Ga0307412_10001068 | |||
| 1189 | Ga0307414_10934898 | |||
| 1190 | Ga0307414_11106635 | |||
| 1191 | Ga0307510_10285206 | |||
| 1192 | Ga0439436_0045124 | |||
| 1193 | Ga0439466_0062423 | |||
| 1194 | Ga0439465_0006903 | |||
| 1195 | Ga0439465_0011953 | |||
| 1196 | Ga0439465_0028103 | |||
| 1197 | Ga0439465_0057605 | |||
| 1198 | Ga0451787_614361 | |||
| 1199 | Ga0451793_0099162 | |||
| 1200 | Ga0451798_0691597 | |||
| 1201 | Ga0451807_0010051 | |||
| 1202 | Ga0451837_0002636 | |||
| 1203 | Ga0451841_0129660 | |||
| 1204 | Ga0451845_0353633 | |||
| 1205 | Ga0451846_44944 | |||
| 1206 | Ga0451849_0977170 | |||
| 1207 | Ga0451851_0555611 | |||
| 1208 | Ga0451855_0065115 | |||
| 1209 | Ga0451853_1039407 | |||
| 1210 | Ga0439445_0026045 | |||
| 1211 | Ga0439432_025666 | |||
| 1212 | Ga0439449_0017684 | |||
| 1213 | Ga0439452_049582 | |||
| 1214 | Ga0439462_0052010 | |||
| 1215 | Ga0466963_0016998 | |||
| 1216 | Ga0466971_0124325 | |||
| 1217 | Ga0466970_0002877 | |||
| 1218 | Ga0466970_0189686 | |||
| 1219 | Ga0466959_0188384 | |||
| 1220 | Ga0466958_0030702 | |||
| 1221 | Ga0466967_0053049 | |||
| 1222 | Ga0466967_0114229 | |||
| 1223 | Ga0495617_090111 | |||
| 1224 | Ga0495590_0032876 | |||
| 1225 | Ga0495590_0155949 | |||
| 1226 | Ga0495629_0064028 | |||
| 1227 | Ga0495638_0001240 | |||
| 1228 | Ga0495651_0058156 | |||
| 1229 | Ga0495650_0042218 | |||
| 1230 | Ga0495650_0196403 | |||
| 1231 | Ga0495605_0001485 | |||
| 1232 | Ga0495662_0056244 | |||
| 1233 | Ga0495664_0047959 | |||
| 1234 | Ga0495585_0012481 | |||
| 1235 | Ga0495585_0014204 | |||
| 1236 | Ga0495585_0159006 | |||
| 1237 | Ga0495585_0181081 | |||
| 1238 | Ga0495607_0029512 | |||
| 1239 | Ga0495607_0068146 | |||
| 1240 | Ga0495607_0279184 | |||
| 1241 | Ga0495583_0010556 | |||
| 1242 | Ga0495583_0029024 | |||
| 1243 | Ga0495606_0000735 | |||
| 1244 | Ga0495606_0023350 | |||
| 1245 | Ga0495606_0140236 | |||
| 1246 | Ga0495606_0203452 | |||
| 1247 | Ga0495606_0233307 | |||
| 1248 | Ga0495610_0002327 | |||
| 1249 | Ga0495610_0019920 | |||
| 1250 | Ga0495610_0055028 | |||
| 1251 | Ga0495610_0138495 | |||
| 1252 | Ga0495610_0157821 | |||
| 1253 | Ga0495616_0196504 | |||
| 1254 | Ga0495616_0251129 | |||
| 1255 | Ga0495620_0014366 | |||
| 1256 | Ga0495620_0017434 | |||
| 1257 | Ga0495631_0009069 | |||
| 1258 | Ga0495631_0228153 | |||
| 1259 | Ga0495632_0009593 | |||
| 1260 | Ga0495632_0010893 | |||
| 1261 | Ga0495643_0036715 | |||
| 1262 | Ga0495643_0051706 | |||
| 1263 | Ga0495643_0078477 | |||
| 1264 | Ga0495648_0102243 | |||
| 1265 | Ga0495652_0123384 | |||
| 1266 | Ga0495654_0000043 | |||
| 1267 | Ga0495654_0050543 | |||
| 1268 | Ga0495654_0293013 | |||
| 1269 | Ga0495609_0024551 | |||
| 1270 | Ga0495633_0077541 | |||
| 1271 | Ga0495633_0305152 | |||
| 1272 | Ga0495656_0082778 | |||
| 1273 | Ga0495668_0014667 | |||
| 1274 | Ga0495668_0052769 | |||
| 1275 | Ga0495668_0144982 | |||
| 1276 | Ga0495634_0103853 | |||
| 1277 | Ga0495625_0001629 | |||
| 1278 | Ga0495625_0071733 | |||
| 1279 | Ga0495625_0281216 | |||
| 1280 | Ga0495625_0430615 | |||
| 1281 | Ga0495661_0139054 | |||
| 1282 | Ga0495661_0442303 | |||
| 1283 | Ga0495588_0003015 | |||
| 1284 | Ga0495657_0096284 | |||
| 1285 | Ga0495658_0108801 | |||
| 1286 | Ga0495613_0154420 | |||
| 1287 | Ga0495624_0495709 | |||
| 1288 | Ga0495670_0171046 | |||
| 1289 | Ga0495670_0422402 | |||
| 1290 | Ga0495671_0016935 | |||
| 1291 | Ga0495671_0149217 | |||
| 1292 | Ga0495660_0026081 | |||
| 1293 | Ga0495660_0074784 | |||
| 1294 | Ga0495604_0009543 | |||
| 1295 | Ga0495636_0057426 | |||
| 1296 | Ga0495636_0130593 | |||
| 1297 | Ga0495683_0059267 | |||
| 1298 | Ga0495683_0286941 | |||
| 1299 | Ga0495687_029497 | |||
| 1300 | Ga0495687_064212 | |||
| 1301 | Ga0495687_102316 | |||
| 1302 | Ga0495673_0098147 | |||
| 1303 | Ga0495681_0003362 | |||
| 1304 | Ga0495686_0000709 | |||
| 1305 | Ga0495686_0014984 | |||
| 1306 | Ga0495686_0035588 | |||
| 1307 | Ga0495686_0052733 | |||
| 1308 | Ga0495686_0144460 | |||
| 1309 | Ga0495686_0183045 | |||
| 1310 | Ga0495686_0272523 | |||
| 1311 | Ga0495686_0279763 | |||
| 1312 | Ga0495686_0284012 | |||
| 1313 | Ga0495602_0130352 | |||
| 1314 | Ga0495615_0064244 | |||
| 1315 | Ga0495626_0092080 | |||
| 1316 | Ga0495626_0138185 | |||
| 1317 | Ga0496100_0072764 | |||
| 1318 | Ga0496101_0074669 | |||
| 1319 | Ga0496101_0080623 | |||
| 1320 | Ga0496101_0088333 | |||
| 1321 | Ga0496102_0059986 | |||
| 1322 | Ga0496103_0051002 | |||
| 1323 | Ga0496105_0105823 | |||
| 1324 | Ga0496106_0003475 | |||
| 1325 | Ga0496107_0194572 | |||
| 1326 | Ga0496109_0778383 | |||
| 1327 | Ga0496113_0176237 | |||
| 1328 | Ga0496113_0261938 | |||
| 1329 | Ga0496114_0180005 | |||
| 1330 | Ga0496116_0000080 | |||
| 1331 | Ga0496116_0012346 | |||
| 1332 | Ga0496116_0014972 | |||
| 1333 | Ga0496116_0015287 | |||
| 1334 | Ga0496116_0016190 | |||
| 1335 | Ga0496116_0017971 | |||
| 1336 | Ga0496116_0119207 | |||
| 1337 | Ga0496116_0133015 | |||
| 1338 | Ga0496116_0254781 | |||
| 1339 | Ga0496117_0000002 | |||
| 1340 | Ga0496117_0001662 | |||
| 1341 | Ga0496117_0007726 | |||
| 1342 | Ga0496117_0026756 | |||
| 1343 | Ga0496117_0061498 | |||
| 1344 | Ga0496117_0061747 | |||
| 1345 | Ga0496117_0085619 | |||
| 1346 | Ga0496117_0108157 | |||
| 1347 | Ga0496117_0139005 | |||
| 1348 | Ga0496117_0142915 | |||
| 1349 | Ga0496118_0000483 | |||
| 1350 | Ga0496118_0001307 | |||
| 1351 | Ga0496118_0022314 | |||
| 1352 | Ga0496118_0040214 | |||
| 1353 | Ga0496118_0043655 | |||
| 1354 | Ga0496118_0060165 | |||
| 1355 | Ga0496118_0064309 | |||
| 1356 | Ga0496119_0013327 | |||
| 1357 | Ga0496119_0025048 | |||
| 1358 | Ga0496119_0040211 | |||
| 1359 | Ga0496119_0052702 | |||
| 1360 | Ga0496119_0077573 | |||
| 1361 | Ga0496119_0094460 | |||
| 1362 | Ga0496119_0162549 | |||
| 1363 | Ga0496119_0191074 | |||
| 1364 | Ga0496120_0000971 | |||
| 1365 | Ga0496120_0006732 | |||
| 1366 | Ga0496120_0066508 | |||
| 1367 | Ga0496121_0000001 | |||
| 1368 | Ga0496121_0002165 | |||
| 1369 | Ga0496121_0018159 | |||
| 1370 | Ga0496121_0067217 | |||
| 1371 | Ga0496121_0076793 | |||
| 1372 | Ga0496121_0082627 | |||
| 1373 | Ga0496121_0086832 | |||
| 1374 | Ga0496121_0093292 | |||
| 1375 | Ga0496121_0285580 | |||
| 1376 | Ga0496122_0000001 | |||
| 1377 | Ga0496122_0000009 | |||
| 1378 | Ga0496122_0004617 | |||
| 1379 | Ga0496122_0007697 | |||
| 1380 | Ga0496122_0018033 | |||
| 1381 | Ga0496122_0050249 | |||
| 1382 | Ga0496122_0080521 | |||
| 1383 | Ga0496122_0113305 | |||
| 1384 | Ga0496123_0000001 | |||
| 1385 | Ga0496123_0000020 | |||
| 1386 | Ga0496123_0004746 | |||
| 1387 | Ga0496123_0022781 | |||
| 1388 | Ga0496123_0034689 | |||
| 1389 | Ga0496123_0045341 | |||
| 1390 | Ga0496123_0058705 | |||
| 1391 | Ga0496123_0067892 | |||
| 1392 | Ga0496124_0000262 | |||
| 1393 | Ga0496124_0007119 | |||
| 1394 | Ga0496124_0013622 | |||
| 1395 | Ga0496124_0018393 | |||
| 1396 | Ga0496124_0023230 | |||
| 1397 | Ga0496124_0043893 | |||
| 1398 | Ga0496124_0046038 | |||
| 1399 | Ga0496124_0053381 | |||
| 1400 | Ga0496124_0074779 | |||
| 1401 | Ga0496124_0096633 | |||
| 1402 | Ga0496124_0136624 | |||
| 1403 | Ga0496124_0411296 | |||
| 1404 | Ga0496124_0477709 | |||
| 1405 | Ga0496125_0000001 | |||
| 1406 | Ga0496125_0016520 | |||
| 1407 | Ga0496125_0025331 | |||
| 1408 | Ga0496125_0049495 | |||
| 1409 | Ga0496125_0062822 | |||
| 1410 | Ga0496125_0072436 | |||
| 1411 | Ga0496125_0082734 | |||
| 1412 | Ga0496125_0361205 | |||
| 1413 | Ga0496126_0000690 | |||
| 1414 | Ga0496126_0111694 | |||
| 1415 | Ga0496126_0147630 | |||
| 1416 | Ga0496126_0148944 | |||
| 1417 | Ga0496126_0183905 | |||
| 1418 | Ga0496126_0289988 | |||
| 1419 | Ga0496126_0352334 | |||
| 1420 | Ga0495678_038514 | |||
| 1421 | Ga0495678_109196 | |||
| 1422 | Ga0501031_0441072 | |||
| 1423 | Ga0501033_0196836 | |||
| 1424 | Ga0501034_0976209 | |||
| 1425 | Ga0501036_0255306 | |||
| 1426 | Ga0501036_0284127 | |||
| 1427 | Ga0501038_0208423 | |||
| 1428 | Ga0501038_0264297 | |||
| 1429 | Ga0501043_0071995 | |||
| 1430 | Ga0501046_0041285 | |||
| 1431 | Ga0501047_0037789 | |||
| 1432 | Ga0501047_0328419 | |||
| 1433 | Ga0501067_0097078 | |||
| 1434 | Ga0501068_0137844 | |||
| 1435 | Ga0501070_0090792 | |||
| 1436 | Ga0501080_0023253 | |||
| 1437 | Ga0501083_0013991 | |||
| 1438 | Ga0501083_0053730 | |||
| 1439 | Ga0501035_0044052 | |||
| 1440 | Ga0501035_0396818 | |||
| 1441 | Ga0501044_0063679 | |||
| 1442 | nmdc:mga03683_28724_c1 | |||
| 1443 | nmdc:mga03683_50247_c1 | |||
| 1444 | nmdc:mga00v17_127673_c1 | |||
| 1445 | nmdc:mga00v17_30517_c1 | |||
| 1446 | nmdc:mga00v17_371750_c1 | |||
| 1447 | nmdc:mga00v17_45280_c1 | |||
| 1448 | nmdc:mga0yw44_223802_c1 | |||
| 1449 | nmdc:mga0yw44_441_c1 | |||
| 1450 | nmdc:mga0k408_69746_c1 | |||
| 1451 | nmdc:mga0k408_83224_c1 | |||
| 1452 | nmdc:mga06z11_109368_c1 | |||
| 1453 | nmdc:mga06z11_12014_c1 | |||
| 1454 | nmdc:mga07m45_14767_c1 | |||
| 1455 | nmdc:mga07m45_324190_c1 | |||
| 1456 | nmdc:mga0sz30_16824_c1 | |||
| 1457 | nmdc:mga0sz30_17862_c1 | |||
| 1458 | nmdc:mga0sz30_41677_c1 | |||
| 1459 | nmdc:mga0sz30_93509_c1 | |||
| 1460 | nmdc:mga0sz30_93702_c1 | |||
| 1461 | Ga0495619_0069308 | |||
| 1462 | Ga0500578_0043620 | |||
| 1463 | Ga0500578_0057512 | |||
| 1464 | Ga0500643_047498 | |||
| 1465 | Ga0500651_0125666 | |||
| 1466 | Ga0500560_004509 | |||
| 1467 | Ga0500569_004752 | |||
| 1468 | Ga0500594_0003638 | |||
| 1469 | Ga0500594_0034381 | |||
| 1470 | Ga0500594_0070082 | |||
| 1471 | Ga0500618_000665 | |||
| 1472 | Ga0500618_001239 | |||
| 1473 | Ga0500618_006475 | |||
| 1474 | Ga0500618_010149 | |||
| 1475 | Ga0500658_0002853 | |||
| 1476 | Ga0500658_0004815 | |||
| 1477 | Ga0500559_0026508 | |||
| 1478 | Ga0500568_0006681 | |||
| 1479 | Ga0500568_0012248 | |||
| 1480 | Ga0500590_021794 | |||
| 1481 | Ga0500604_0019584 | |||
| 1482 | Ga0500616_0000777 | |||
| 1483 | Ga0500616_0001268 | |||
| 1484 | Ga0500616_0004445 | |||
| 1485 | Ga0500622_0003948 | |||
| 1486 | Ga0500622_0157240 | |||
| 1487 | Ga0500624_000965 | |||
| 1488 | Ga0500627_0283195 | |||
| 1489 | Ga0500633_0022800 | |||
| 1490 | Ga0500634_0142874 | |||
| 1491 | Ga0500636_0000023 | |||
| 1492 | Ga0500636_0008459 | |||
| 1493 | Ga0587073_0125378 | |||
| 1494 | Ga0587069_016708 | |||
| 1495 | Ga0587072_042288 | |||
| 1496 | Ga0501082_0452051 | |||
| 1497 | 2509388204 | |||
| 1498 | 2509443796 | |||
| 1499 | 2510131688 | |||
| 1500 | 2510841433 | |||
| 1501 | 2510897981 | |||
| 1502 | 2511137395 | |||
| 1503 | 2511170421 | |||
| 1504 | 2511183626 | |||
| 1505 | 2511196147 | |||
| 1506 | 2513571265 | |||
| 1507 | 2513579202 | |||
| 1508 | 2513598715 | |||
| 1509 | 2513632360 | |||
| 1510 | 2513711686 | |||
| 1511 | 2513866292 | |||
| 1512 | 2513907912 | |||
| 1513 | 2513927571 | |||
| 1514 | 2514020818 | |||
| 1515 | 2515110624 | |||
| 1516 | 2515639080 | |||
| 1517 | 2515645930 | |||
| 1518 | 2515661501 | |||
| 1519 | 2515742894 | |||
| 1520 | 2517039326 | |||
| 1521 | 2517079546 | |||
| 1522 | 2517093496 | |||
| 1523 | 2517405197 | |||
| 1524 | 2520379956 | |||
| 1525 | 2524457693 | |||
| 1526 | 2530647610 | |||
| 1527 | 2535515268 | |||
| 1528 | 2537874404 | |||
| 1529 | 2554246775 | |||
| 1530 | 2559294002 | |||
| 1531 | 2561467265 | |||
| 1532 | 2585204049 | |||
| 1533 | 2585225686 | |||
| 1534 | 2585229161 | |||
| 1535 | 2585257007 | |||
| 1536 | 2585275264 | |||
| 1537 | 2585281992 | |||
| 1538 | 2585325805 | |||
| 1539 | 2585329973 | |||
| 1540 | 2585403900 | |||
| 1541 | 2585528492 | |||
| 1542 | 2585536357 | |||
| 1543 | 2585539891 | |||
| 1544 | 2585548039 | |||
| 1545 | 2585554230 | |||
| 1546 | 2585560293 | |||
| 1547 | 2585824393 | |||
| 1548 | 2585837872 | |||
| 1549 | 2585844446 | |||
| 1550 | 2585901439 | |||
| 1551 | 2585905522 | |||
| 1552 | 2585994660 | |||
| 1553 | 2585999144 | |||
| 1554 | 2587979363 | |||
| 1555 | 2599419001 | |||
| 1556 | 2599603674 | |||
| 1557 | 2599719383 | |||
| 1558 | 2600374881 | |||
| 1559 | 2601609021 | |||
| 1560 | 2601745796 | |||
| 1561 | 2616295859 | |||
| 1562 | 2616306149 | |||
| 1563 | 2616553594 | |||
| 1564 | 2617382645 | |||
| 1565 | 2643752701 | |||
| 1566 | 2643856203 | |||
| 1567 | 2643921007 | |||
| 1568 | 2644007522 | |||
| 1569 | 2644190777 | |||
| 1570 | 2644241378 | |||
| 1571 | 2644288041 | |||
| 1572 | 2644519083 | |||
| 1573 | 2671112544 | |||
| 1574 | 2719179758 | |||
| 1575 | 2719384368 | |||
| 1576 | 2719664112 | |||
| 1577 | 2719730428 | |||
| 1578 | 2720490531 | |||
| 1579 | 2720611911 | |||
| 1580 | 2720618765 | |||
| 1581 | 2720630165 | |||
| 1582 | 2720773860 | |||
| 1583 | 2721145851 | |||
| 1584 | 2721157388 | |||
| 1585 | 2721162730 | |||
| 1586 | 2721398082 | |||
| 1587 | 2722838900 | |||
| 1588 | 2723025530 | |||
| 1589 | 2723559115 | |||
| 1590 | 2723565720 | |||
| 1591 | 2724036892 | |||
| 1592 | 2724043184 | |||
| 1593 | 2724088467 | |||
| 1594 | 2724102985 | |||
| 1595 | 2724108843 | |||
| 1596 | 2725950738 | |||
| 1597 | 2728754793 | |||
| 1598 | 2730106466 | |||
| 1599 | 2730162995 | |||
| 1600 | 2730297020 | |||
| 1601 | 2738802378 | |||
| 1602 | 2738945791 | |||
| 1603 | 2739034750 | |||
| 1604 | 2753357000 | |||
| 1605 | 2758640522 | |||
| 1606 | 2766065027 | |||
| 1607 | 2778174347 | |||
| 1608 | 2793295026 | |||
| 1609 | 2793315238 | |||
| 1610 | 2793320093 | |||
| 1611 | 2793328280 | |||
| 1612 | 2793332623 | |||
| 1613 | 2793342921 | |||
| 1614 | 2793350593 | |||
| 1615 | 2793353191 | |||
| 1616 | 2793360996 | |||
| 1617 | 2793364879 | |||
| 1618 | 2805927390 | |||
| 1619 | 2805936430 | |||
| 1620 | 2806044047 | |||
| 1621 | 2806052136 | |||
| 1622 | 2806058437 | |||
| 1623 | 2806066934 | |||
| 1624 | 2806074677 | |||
| 1625 | 2808986222 | |||
| 1626 | 2819556352 | |||
| 1627 | 2819608226 | |||
| 1628 | 2819639578 | |||
| 1629 | 2819684529 | |||
| 1630 | 2821123815 | |||
| 1631 | 2838021798 | |||
| 1632 | 2838026505 | |||
| 1633 | 2838029119 | |||
| 1634 | 2838037311 | |||
| 1635 | 2838047282 | |||
| 1636 | 2838054589 | |||
| 1637 | 2838067521 | |||
| 1638 | 2838074060 | |||
| 1639 | 2838663502 | |||
| 1640 | 2838673257 | |||
| 1641 | 2838677079 | |||
| 1642 | 2838680789 | |||
| 1643 | 2838692550 | |||
| 1644 | 2838695178 | |||
| 1645 | 2838704059 | |||
| 1646 | 2838708554 | |||
| 1647 | 2838715966 | |||
| 1648 | 2838720232 | |||
| 1649 | 2838726719 | |||
| 1650 | 2838732622 | |||
| 1651 | 2838739155 | |||
| 1652 | 2838745517 | |||
| 1653 | 2841843053 | |||
| 1654 | 2841847166 | |||
| 1655 | 2841855161 | |||
| 1656 | 2841860301 | |||
| 1657 | 2841866613 | |||
| 1658 | 2841980674 | |||
| 1659 | 2842080212 | |||
| 1660 | 2842112413 | |||
| 1661 | 2842120831 | |||
| 1662 | 2842126804 | |||
| 1663 | 2842131972 | |||
| 1664 | 2842142835 | |||
| 1665 | 2842148149 | |||
| 1666 | 2842152858 | |||
| 1667 | 2842161809 | |||
| 1668 | 2842169184 | |||
| 1669 | 2842172211 | |||
| 1670 | 2842176477 | |||
| 1671 | 2842185426 | |||
| 1672 | 2842189075 | |||
| 1673 | 2842193098 | |||
| 1674 | 2842203163 | |||
| 1675 | 2842206740 | |||
| 1676 | 2842213388 | |||
| 1677 | 2842218584 | |||
| 1678 | 2842224994 | |||
| 1679 | 2842233364 | |||
| 1680 | 2842237966 | |||
| 1681 | 2842248632 | |||
| 1682 | 2842253215 | |||
| 1683 | 2842261775 | |||
| 1684 | 2842267249 | |||
| 1685 | 2842277161 | |||
| 1686 | 2842280567 | |||
| 1687 | 2842289518 | |||
| 1688 | 2842293871 | |||
| 1689 | 2842300692 | |||
| 1690 | 2842306281 | |||
| 1691 | 2842315960 | |||
| 1692 | 2842322323 | |||
| 1693 | 2842342865 | |||
| 1694 | 2842358190 | |||
| 1695 | 2842369491 | |||
| 1696 | 2842371252 | |||
| 1697 | 2842380267 | |||
| 1698 | 2842387339 | |||
| 1699 | 2842400755 | |||
| 1700 | 2842406866 | |||
| 1701 | 2842413637 | |||
| 1702 | 2842420400 | |||
| 1703 | 2842427688 | |||
| 1704 | 2842431499 | |||
| 1705 | 2842437834 | |||
| 1706 | 2842444649 | |||
| 1707 | 2842450406 | |||
| 1708 | 2842465523 | |||
| 1709 | 2842472333 | |||
| 1710 | 2842476451 | |||
| 1711 | 2842482528 | |||
| 1712 | 2842495093 | |||
| 1713 | 2842501013 | |||
| 1714 | 2842502647 | |||
| 1715 | 2842509379 | |||
| 1716 | 2842517086 | |||
| 1717 | 2844455776 | |||
| 1718 | 2847934152 | |||
| 1719 | 2852388700 | |||
| 1720 | 2854898456 | |||
| 1721 | 2854917768 | |||
| 1722 | 2857524060 | |||
| 1723 | 2857531377 | |||
| 1724 | 2899792366 | |||
| 1725 | 2899805964 | |||
| 1726 | 2899846639 | |||
| 1727 | 2906647309 | |||
| 1728 | 2913310526 | |||
| 1729 | 2919101162 | |||
| 1730 | 2919116170 | |||
| 1731 | 2919167030 | |||
| 1732 | 2919171881 | |||
| 1733 | 2919408976 | |||
| 1734 | 2919453107 | |||
| 1735 | 2923557374 | |||
| 1736 | 2926757124 | |||
| 1737 | 2926761345 | |||
| 1738 | 2929139116 | |||
| 1739 | 2933007503 | |||
| 1740 | 2933012271 | |||
| 1741 | 2933023279 | |||
| 1742 | 2933573350 | |||
| 1743 | 2933587742 | |||
| 1744 | 2933594716 | |||
| 1745 | 2933604428 | |||
| 1746 | 2935652554 | |||
| 1747 | 2935661136 | |||
| 1748 | 2935895701 | |||
| 1749 | 2935907342 | |||
| 1750 | 2936015193 | |||
| 1751 | 2936023338 | |||
| 1752 | 2936032209 | |||
| 1753 | 2936050070 | |||
| 1754 | 2936061828 | |||
| 1755 | 2936368726 | |||
| 1756 | 2936377197 | |||
| 1757 | 2936383844 | |||
| 1758 | 2978973445 | |||
| 1759 | 2979093373 | |||
| 1760 | 2979099242 | |||
| 1761 | 2979105344 | |||
| 1762 | 2984512800 | |||
| 1763 | 2984520837 | |||
| 1764 | 2984540131 | |||
| 1765 | 2984591728 | |||
| 1766 | 2984602324 | |||
| 1767 | 2996338219 | |||
| 1768 | 2996892008 | |||
| 1769 | 2996893642 | |||
| 1770 | 3005411401 | |||
| 1771 | 3005422634 | |||
| 1772 | 3005446352 | |||
| 1773 | 3005453022 | |||
| 1774 | 639646883 | |||
| 1775 | 8001850517 | |||
| 1776 | 8003570201 | |||
| 1777 | 8005263669 | |||
| 1778 | 8005279083 | |||
| 1779 | 8005283830 | |||
| 1780 | 8005291904 | |||
| 1781 | 8005304035 | |||
| 1782 | 8005308860 | |||
| 1783 | 8005321829 | |||
| 1784 | 8005326535 | |||
| 1785 | 8005377233 | |||
| 1786 | 8005387098 | |||
| 1787 | 8005401859 | |||
| 1788 | 8005433125 | |||
| 1789 | 8005461266 | |||
| 1790 | 8005485966 | |||
| 1791 | 8005498857 | |||
| 1792 | 8005543950 | |||
| 1793 | 8005559261 | |||
| 1794 | 8005569824 | |||
| 1795 | 8005577126 | |||
| 1796 | 8005620044 | |||
| 1797 | 8005628649 | |||
| 1798 | 8005646654 | |||
| 1799 | 8005670269 | |||
| 1800 | 8005684934 | |||
| 1801 | 8005690460 | |||
| 1802 | 8005698000 | |||
| 1803 | 8018133316 | |||
| 1804 | 8018167886 | |||
| 1805 | 8018180454 | |||
| 1806 | 8023684017 | |||
| 1807 | 8024480498 | |||
| 1808 | 8024487730 | |||
| 1809 | 8024502549 | |||
| 1810 | 8046769806 | |||
| 1811 | 8054461448 | |||
| 1812 | 8056379077 | |||
| 1813 | 8056386153 | |||
| 1814 | 8056879288 | |||
| 1815 | 8057577428 | |||
| 1816 | 8057881154 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4dve-assembly1.cif.gz_A | crystal structure at 2.1 a of the s-component for biotin from an ecf-type abc transporter | 0.8585 | 1 | 176 |
| 4dve-assembly1.cif.gz_A | crystal structure at 2.1 a of the s-component for biotin from an ecf-type abc transporter | 0.8148 | 1 | 176 |
| 7nnt-assembly1.cif.gz_C | cryo-em structure of the folate-specific ecf transporter complex in ddm micelles | 0.688 | 1 | 179 |
| 4hzu-assembly1.cif.gz_S | structure of a bacterial energy-coupling factor transporter | 0.6542 | 1 | 185 |
| 4m5c-assembly1.cif.gz_A | crystal structure of an truncated transition metal transporter | 0.6504 | 1 | 176 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q2FVX1_1_181_1.10.1760.20 | Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; | 0.8949 | 1 | 179 | 1.10.1760.20 |
| af_Q2FVX1_1_181_1.10.1760.20 | Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; | 0.8665 | 1 | 179 | 1.10.1760.20 |
| 4dveA00 | Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; | 0.8597 | 4 | 176 | 1.10.1760.20 |
| af_Q54D94_113_302_1.10.1760.20 | Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; | 0.8072 | 4 | 176 | 1.10.1760.20 |
| 4dveA00 | Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; | 0.7851 | 4 | 176 | 1.10.1760.20 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-F0L7A8-F1-model_v4 | deleted | 0.9639 | 48 | 185 |
|
| AF-F0L7A8-F1-model_v4 | deleted | 0.9373 | 48 | 185 |
|
| AF-A0A182CYW8-F1-model_v4 | Substrate-specific component BioY of biotin ECF transporter | 0.9359 | 1 | 179 |
GO:0005886
GO:0015225 |
| AF-A0A7X6EK39-F1-model_v4 | deleted | 0.9346 | 5 | 136 |
|
| AF-A0A3S4MVE2-F1-model_v4 | deleted | 0.9317 | 1 | 181 |
|