F485406

General Info

Members Datasets Scaffolds Average Seq Length
909 330 908 194

Family's Representative Sequence

Representative Sequence 3300005436|Ga0070713_100073793|Ga0070713_1000737933
Length 235
Sequence MYSKICAIKGGACNDKPQFEMNETEKRNSFVFSIIIHPTTQLTMKKNRLEAFSDGVFAIIITIMVLDLKIPKDDHVSALVPLLPTFVSYILSFIYLGIYWNNHHHLWHIATHVDGKLLWANLHLLFWLSLLPFATGWMGENHFSTWPVACYGFILLMAGVAYYVMSRMLIGVHGKDSDLARAYGKDFKGRISIVIYLVAIFISLYSSWLSFSMYTVVALIWLPPDPRIERLLNKN

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2738541278 Niastella sp. CF465 Isolate Unclassified
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
6 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
7 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
11 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
12 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
15 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
16 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
17 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
18 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
19 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
20 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
21 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
22 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
23 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
24 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
25 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
26 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
27 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
28 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
29 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
30 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
31 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
32 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
33 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
34 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
35 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
36 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
37 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
38 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
39 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
40 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
41 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
42 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
43 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
44 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
45 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
46 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
47 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
48 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
49 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
50 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
51 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
52 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
53 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
54 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
55 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
56 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
57 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
58 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
59 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
60 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
61 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
62 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
63 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
64 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
65 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
66 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
67 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
68 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
69 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
70 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
71 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
72 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
73 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
74 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
75 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
76 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
77 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
78 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
79 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
80 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
81 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
82 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
83 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
84 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
85 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
86 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
87 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
88 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
89 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
90 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
91 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
92 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
93 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
94 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
95 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
96 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
97 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
98 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
99 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
100 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
101 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
102 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
103 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
104 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
105 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
106 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
107 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
108 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
109 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
110 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
111 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
112 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
113 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
114 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
115 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
116 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
117 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
118 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
119 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
120 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
121 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
122 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
123 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
124 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
185 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
188 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
192 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
193 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
194 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
195 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
196 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
197 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
198 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
199 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
200 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
201 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
202 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
203 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
204 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
205 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
206 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
207 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
208 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
209 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
210 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
211 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
212 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
213 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
214 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
215 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
216 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
217 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
218 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
219 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
220 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
221 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
222 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
223 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
224 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
225 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
226 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
227 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
228 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
229 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
230 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
231 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
232 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
233 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
234 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
235 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
236 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
237 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
238 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
239 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
240 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
241 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
242 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
243 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
244 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
245 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
246 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
247 3300042128 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123 Metagenome Rhizosphere
248 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
249 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
250 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
251 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
252 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
253 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
254 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
255 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
256 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
257 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
258 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
259 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
260 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
261 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
262 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
263 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
264 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
265 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
266 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
267 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
268 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
269 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
270 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
271 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
272 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
273 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
274 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
275 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
276 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
277 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
278 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
279 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
280 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
281 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
282 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
283 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
284 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
285 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
286 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
287 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
288 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
289 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
290 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
291 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
292 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
293 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
294 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
295 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
296 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
297 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
298 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
299 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
300 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
301 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
302 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
303 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
304 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
305 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
306 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
307 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
308 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
309 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
310 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
311 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
312 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
313 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
314 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
315 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
316 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
317 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
318 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
319 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
320 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
321 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
322 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
323 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
324 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
325 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
326 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
327 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
328 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
329 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
330 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.67
Metatranscriptomes 0.22
Isolates 0.11

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.1
Nodule 0
Rhizoplane 2.31
Rhizosphere 94.83
Stem 0
Stem Tuber 0
Unclassified 1.76

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_206548 2162886007 Bacteria 1065
2 rootH1_10222734 3300003323 Bacteria 2613
3 Ga0065714_10065170 3300005288 Bacteria 12256
4 Ga0065704_10103385 3300005289 Bacteria 2173
5 Ga0065704_10197256 3300005289 Bacteria 1162
6 Ga0065704_10493982 3300005289 Bacteria 672
7 Ga0065712_10000127 3300005290 Bacteria 117106
8 Ga0065712_10007240 3300005290 Bacteria 3685
9 Ga0065712_10013797 3300005290 Bacteria 1835
10 Ga0065712_10148837 3300005290 Bacteria 1386
11 Ga0065715_10000791 3300005293 Bacteria 11349
12 Ga0065715_10027705 3300005293 Bacteria 1889
13 Ga0065715_10092022 3300005293 Bacteria 5380
14 Ga0065715_10250886 3300005293 Bacteria 1167
15 Ga0065707_10008733 3300005295 Bacteria 3166
16 Ga0065707_10033347 3300005295 Bacteria 1113
17 Ga0065707_10122006 3300005295 Bacteria 2077
18 Ga0065707_10126451 3300005295 Bacteria 2002
19 Ga0065707_10129106 3300005295 Bacteria 1953
20 Ga0065707_10232992 3300005295 Bacteria 1182
21 Ga0065707_10354834 3300005295 Unclassified 913
22 Ga0070658_10000394 3300005327 Bacteria 37936
23 Ga0070658_10028202 3300005327 Bacteria 4506
24 Ga0070658_10763219 3300005327 Bacteria 840
25 Ga0070676_10083094 3300005328 Bacteria 1947
26 Ga0070683_100046502 3300005329 Bacteria 4010
27 Ga0070683_100147147 3300005329 Bacteria 2232
28 Ga0070683_100734650 3300005329 Bacteria 946
29 Ga0070683_101068697 3300005329 Bacteria 775
30 Ga0070690_100065953 3300005330 Bacteria 2342
31 Ga0070690_100205328 3300005330 Bacteria 1373
32 Ga0070690_100800069 3300005330 Bacteria 731
33 Ga0070670_100010264 3300005331 Bacteria 7991
34 Ga0070670_100015904 3300005331 Bacteria 6456
35 Ga0070670_100037379 3300005331 Bacteria 4178
36 Ga0068869_100016011 3300005334 Bacteria 5046
37 Ga0068869_100022098 3300005334 Bacteria 4381
38 Ga0068869_100038528 3300005334 Bacteria 3408
39 Ga0068869_100041468 3300005334 Bacteria 3297
40 Ga0068869_100045784 3300005334 Bacteria 3151
41 Ga0068869_100071543 3300005334 Bacteria 2568
42 Ga0068869_100129612 3300005334 Bacteria 1937
43 Ga0068869_100659467 3300005334 Bacteria 889
44 Ga0070666_10000024 3300005335 Bacteria 161355
45 Ga0070666_10085791 3300005335 Bacteria 2157
46 Ga0070680_100001860 3300005336 Bacteria 15472
47 Ga0070680_100015415 3300005336 Bacteria 5992
48 Ga0070682_100000160 3300005337 Bacteria 51653
49 Ga0070682_100505804 3300005337 Bacteria 937
50 Ga0070682_100627615 3300005337 Bacteria 852
51 Ga0068868_100097815 3300005338 Bacteria 2372
52 Ga0068868_100108577 3300005338 Bacteria 2252
53 Ga0068868_100119142 3300005338 Unclassified 2152
54 Ga0068868_100239575 3300005338 Bacteria 1524
55 Ga0068868_100269867 3300005338 Bacteria 1437
56 Ga0070660_100323309 3300005339 Bacteria 1267
57 Ga0070689_100071874 3300005340 Bacteria 2703
58 Ga0070689_100112194 3300005340 Bacteria 2170
59 Ga0070689_100164110 3300005340 Bacteria 1797
60 Ga0070668_100006022 3300005347 Bacteria 8995
61 Ga0070668_100039038 3300005347 Bacteria 3632
62 Ga0070668_100943159 3300005347 Bacteria 773
63 Ga0070669_100006440 3300005353 Bacteria 8453
64 Ga0070669_100017708 3300005353 Bacteria 5083
65 Ga0070669_100105122 3300005353 Bacteria 2135
66 Ga0070669_100637256 3300005353 Bacteria 896
67 Ga0070675_100015874 3300005354 Bacteria 5963
68 Ga0070671_100002104 3300005355 Bacteria 15361
69 Ga0070671_100026730 3300005355 Bacteria 4746
70 Ga0070671_100058436 3300005355 Bacteria 3210
71 Ga0070671_100151903 3300005355 Bacteria 1955
72 Ga0070671_100198146 3300005355 Bacteria 1702
73 Ga0070671_100518110 3300005355 Bacteria 1027
74 Ga0070674_100106641 3300005356 Bacteria 2051
75 Ga0070673_100003495 3300005364 Bacteria 9790
76 Ga0070673_100021741 3300005364 Bacteria 4659
77 Ga0070673_100069550 3300005364 Bacteria 2822
78 Ga0070673_100078564 3300005364 Bacteria 2670
79 Ga0070673_100211440 3300005364 Bacteria 1675
80 Ga0070673_100259750 3300005364 Bacteria 1517
81 Ga0070673_100707300 3300005364 Bacteria 925
82 Ga0070688_100048696 3300005365 Bacteria 2634
83 Ga0070688_100269138 3300005365 Bacteria 1220
84 Ga0070667_100001961 3300005367 Bacteria 18259
85 Ga0070667_100023350 3300005367 Bacteria 5129
86 Ga0070667_100110693 3300005367 Bacteria 2381
87 Ga0070667_100202286 3300005367 Bacteria 1763
88 Ga0070667_100870179 3300005367 Bacteria 838
89 Ga0070709_10169766 3300005434 Bacteria 1523
90 Ga0070709_10375209 3300005434 Bacteria 1056
91 Ga0070713_100073793 3300005436 Bacteria 2889
92 Ga0070701_10034183 3300005438 Bacteria 2546
93 Ga0070711_100008085 3300005439 Bacteria 6427
94 Ga0070711_100205937 3300005439 Bacteria 1521
95 Ga0070711_100478678 3300005439 Unclassified 1023
96 Ga0070705_100048297 3300005440 Bacteria 2465
97 Ga0070705_100069962 3300005440 Bacteria 2118
98 Ga0070705_100140429 3300005440 Bacteria 1589
99 Ga0070700_100041146 3300005441 Bacteria 2832
100 Ga0070700_100193777 3300005441 Bacteria 1423
101 Ga0070694_100273709 3300005444 Bacteria 1285
102 Ga0070694_100776443 3300005444 Bacteria 784
103 Ga0070662_100031884 3300005457 Bacteria 3702
104 Ga0070662_100109667 3300005457 Unclassified 2101
105 Ga0070662_100109970 3300005457 Bacteria 2098
106 Ga0070662_100244067 3300005457 Bacteria 1441
107 Ga0070662_100458741 3300005457 Bacteria 1059
108 Ga0070662_100476284 3300005457 Bacteria 1039
109 Ga0070681_10000089 3300005458 Bacteria 68795
110 Ga0068867_100028048 3300005459 Bacteria 4052
111 Ga0068867_100042773 3300005459 Bacteria 3316
112 Ga0068867_100078136 3300005459 Bacteria 2489
113 Ga0068867_100263749 3300005459 Bacteria 1405
114 Ga0068867_101156245 3300005459 Bacteria 709
115 Ga0070685_10047580 3300005466 Bacteria 2467
116 Ga0070685_10088724 3300005466 Bacteria 1868
117 Ga0070706_100070395 3300005467 Bacteria 3235
118 Ga0070707_100005228 3300005468 Bacteria 12150
119 Ga0070707_100106737 3300005468 Bacteria 2716
120 Ga0070707_100213597 3300005468 Bacteria 1880
121 Ga0070707_100334705 3300005468 Bacteria 1471
122 Ga0070707_101377340 3300005468 Bacteria 672
123 Ga0070698_100007009 3300005471 Bacteria 12208
124 Ga0070698_100026474 3300005471 Bacteria 6038
125 Ga0070698_100079633 3300005471 Bacteria 3273
126 Ga0070698_100326848 3300005471 Bacteria 1464
127 Ga0070698_100468397 3300005471 Bacteria 1196
128 Ga0070698_100526049 3300005471 Bacteria 1121
129 Ga0070699_100001719 3300005518 Bacteria 19966
130 Ga0070699_100002144 3300005518 Bacteria 17881
131 Ga0070699_100524633 3300005518 Bacteria 1077
132 Ga0070699_100852944 3300005518 Bacteria 834
133 Ga0070679_100000014 3300005530 Bacteria 150481
134 Ga0070679_100000987 3300005530 Bacteria 24762
135 Ga0070679_100001843 3300005530 Bacteria 19045
136 Ga0070684_100008223 3300005535 Bacteria 8152
137 Ga0070684_100028066 3300005535 Bacteria 4758
138 Ga0070684_100153616 3300005535 Bacteria 2086
139 Ga0070684_100738581 3300005535 Bacteria 919
140 Ga0070697_100013804 3300005536 Bacteria 6337
141 Ga0070697_100152570 3300005536 Bacteria 1948
142 Ga0068853_100238053 3300005539 Bacteria 1667
143 Ga0070672_100007925 3300005543 Bacteria 7255
144 Ga0070672_100011852 3300005543 Bacteria 6092
145 Ga0070672_100055053 3300005543 Bacteria 3115
146 Ga0070672_100076019 3300005543 Bacteria 2682
147 Ga0070672_100123188 3300005543 Bacteria 2124
148 Ga0070672_100145879 3300005543 Unclassified 1956
149 Ga0070686_100016694 3300005544 Unclassified 4274
150 Ga0070686_100031400 3300005544 Bacteria 3247
151 Ga0070686_100255781 3300005544 Bacteria 1281
152 Ga0070695_100091742 3300005545 Bacteria 2029
153 Ga0070695_100118556 3300005545 Bacteria 1807
154 Ga0070695_100342211 3300005545 Bacteria 1118
155 Ga0070696_100129364 3300005546 Bacteria 1836
156 Ga0070696_100202525 3300005546 Bacteria 1482
157 Ga0070696_100218126 3300005546 Bacteria 1430
158 Ga0070693_100116852 3300005547 Bacteria 1649
159 Ga0070665_100118546 3300005548 Bacteria 2649
160 Ga0070704_100012361 3300005549 Bacteria 5272
161 Ga0070704_100163261 3300005549 Bacteria 1764
162 Ga0070704_100164409 3300005549 Bacteria 1758
163 Ga0070704_100366317 3300005549 Bacteria 1221
164 Ga0070704_100656777 3300005549 Bacteria 926
165 Ga0070704_101314093 3300005549 Bacteria 662
166 Ga0068855_100004734 3300005563 Bacteria 16618
167 Ga0068855_100868491 3300005563 Bacteria 955
168 Ga0068855_101155434 3300005563 Bacteria 807
169 Ga0070664_100070619 3300005564 Unclassified 2991
170 Ga0068857_100335011 3300005577 Bacteria 1399
171 Ga0068857_100395436 3300005577 Bacteria 1285
172 Ga0068857_100424577 3300005577 Bacteria 1240
173 Ga0068854_100038325 3300005578 Bacteria 3370
174 Ga0068854_100041870 3300005578 Plasmid 3238
175 Ga0068854_100625077 3300005578 Bacteria 922
176 Ga0068854_100659138 3300005578 Bacteria 899
177 Ga0068856_100045446 3300005614 Bacteria 4324
178 Ga0068856_100066952 3300005614 Bacteria 3549
179 Ga0068856_101010529 3300005614 Unclassified 850
180 Ga0070702_100121139 3300005615 Bacteria 1638
181 Ga0070702_100193869 3300005615 Bacteria 1339
182 Ga0070702_100217257 3300005615 Bacteria 1276
183 Ga0070702_100386709 3300005615 Unclassified 996
184 Ga0070702_100518976 3300005615 Bacteria 878
185 Ga0068852_100000563 3300005616 Bacteria 24454
186 Ga0068852_100063061 3300005616 Bacteria 3226
187 Ga0068852_100088798 3300005616 Bacteria 2761
188 Ga0068852_100444429 3300005616 Bacteria 1282
189 Ga0068852_100458459 3300005616 Bacteria 1263
190 Ga0068852_101226527 3300005616 Bacteria 771
191 Ga0068859_100000018 3300005617 Bacteria 248813
192 Ga0068859_100009873 3300005617 Bacteria 9638
193 Ga0068859_100031927 3300005617 Bacteria 5290
194 Ga0068859_100061244 3300005617 Bacteria 3792
195 Ga0068859_100094970 3300005617 Bacteria 3034
196 Ga0068859_100126891 3300005617 Bacteria 2621
197 Ga0068859_100159845 3300005617 Unclassified 2332
198 Ga0068859_100225436 3300005617 Bacteria 1962
199 Ga0068859_100267365 3300005617 Bacteria 1802
200 Ga0068859_100362650 3300005617 Bacteria 1544
201 Ga0068859_100393141 3300005617 Bacteria 1482
202 Ga0068859_100849020 3300005617 Bacteria 999
203 Ga0068859_100952615 3300005617 Bacteria 941
204 Ga0068864_100004484 3300005618 Bacteria 11479
205 Ga0068864_100005259 3300005618 Bacteria 10611
206 Ga0068864_100025295 3300005618 Bacteria 4998
207 Ga0068864_100139613 3300005618 Bacteria 2185
208 Ga0068864_100357887 3300005618 Bacteria 1379
209 Ga0068864_100726306 3300005618 Bacteria 972
210 Ga0068866_10027331 3300005718 Bacteria 2704
211 Ga0068866_10292742 3300005718 Bacteria 1013
212 Ga0068866_10303026 3300005718 Unclassified 999
213 Ga0068861_100004851 3300005719 Bacteria 9047
214 Ga0068861_100027390 3300005719 Bacteria 4150
215 Ga0068861_100125526 3300005719 Bacteria 2076
216 Ga0068861_100143536 3300005719 Unclassified 1951
217 Ga0068861_100196601 3300005719 Bacteria 1690
218 Ga0068851_10008388 3300005834 Bacteria 4776
219 Ga0068870_10010801 3300005840 Bacteria 4209
220 Ga0068870_10017559 3300005840 Unclassified 3438
221 Ga0068870_10040937 3300005840 Unclassified 2405
222 Ga0068870_10046150 3300005840 Bacteria 2283
223 Ga0068870_10632273 3300005840 Bacteria 731
224 Ga0068863_100037369 3300005841 Bacteria 4623
225 Ga0068863_100081038 3300005841 Bacteria 3075
226 Ga0068863_100134234 3300005841 Bacteria 2364
227 Ga0068863_100345488 3300005841 Bacteria 1448
228 Ga0068863_100729072 3300005841 Bacteria 986
229 Ga0068863_100959271 3300005841 Bacteria 857
230 Ga0068858_100010503 3300005842 Bacteria 8772
231 Ga0068858_100026860 3300005842 Bacteria 5348
232 Ga0068858_100100704 3300005842 Bacteria 2694
233 Ga0068858_100105236 3300005842 Bacteria 2633
234 Ga0068858_100416513 3300005842 Bacteria 1292
235 Ga0068858_100812407 3300005842 Bacteria 912
236 Ga0068858_101107367 3300005842 Bacteria 777
237 Ga0068860_100008446 3300005843 Bacteria 10257
238 Ga0068860_100012313 3300005843 Bacteria 8428
239 Ga0068860_100014941 3300005843 Bacteria 7590
240 Ga0068860_100053026 3300005843 Bacteria 3856
241 Ga0068860_100054834 3300005843 Unclassified 3788
242 Ga0068860_100154342 3300005843 Bacteria 2212
243 Ga0068860_100156698 3300005843 Bacteria 2195
244 Ga0068860_100161290 3300005843 Bacteria 2162
245 Ga0068860_100219257 3300005843 Bacteria 1847
246 Ga0068860_100574972 3300005843 Bacteria 1130
247 Ga0068860_100643878 3300005843 Bacteria 1067
248 Ga0068862_100001370 3300005844 Bacteria 22653
249 Ga0068862_100014339 3300005844 Bacteria 6573
250 Ga0068862_100023492 3300005844 Bacteria 5167
251 Ga0068862_100090826 3300005844 Bacteria 2659
252 Ga0070717_10000960 3300006028 Bacteria 19222
253 Ga0070717_10619163 3300006028 Bacteria 982
254 Ga0075363_100347233 3300006048 Bacteria 866
255 Ga0070715_10000028 3300006163 Bacteria 89406
256 Ga0070716_100000005 3300006173 Bacteria 273485
257 Ga0070716_100033133 3300006173 Bacteria 2824
258 Ga0070716_100161723 3300006173 Bacteria 1451
259 Ga0070712_100267126 3300006175 Bacteria 1373
260 Ga0075367_10030751 3300006178 Bacteria 3080
261 Ga0075366_10032848 3300006195 Bacteria 3056
262 Ga0097621_100007931 3300006237 Bacteria 7619
263 Ga0097621_100091812 3300006237 Bacteria 2542
264 Ga0097621_100136761 3300006237 Bacteria 2090
265 Ga0097621_100342691 3300006237 Bacteria 1327
266 Ga0068871_100004123 3300006358 Bacteria 10050
267 Ga0068871_100090910 3300006358 Bacteria 2543
268 Ga0068871_100101168 3300006358 Unclassified 2415
269 Ga0075428_100007407 3300006844 Bacteria 12166
270 Ga0075428_100129758 3300006844 Bacteria 2742
271 Ga0075428_100141687 3300006844 Bacteria 2614
272 Ga0075428_100582134 3300006844 Bacteria 1196
273 Ga0075430_100099666 3300006846 Bacteria 2426
274 Ga0075431_100012603 3300006847 Bacteria 8536
275 Ga0075433_10048333 3300006852 Bacteria 3699
276 Ga0075433_10489102 3300006852 Bacteria 1084
277 Ga0075433_10853391 3300006852 Bacteria 795
278 Ga0075434_100268818 3300006871 Bacteria 1724
279 Ga0075434_100656763 3300006871 Bacteria 1067
280 Ga0075434_100884959 3300006871 Bacteria 908
281 Ga0075429_100000099 3300006880 Bacteria 47825
282 Ga0075429_100043066 3300006880 Bacteria 3928
283 Ga0075429_100059318 3300006880 Bacteria 3333
284 Ga0075429_100117391 3300006880 Bacteria 2325
285 Ga0068865_100008550 3300006881 Bacteria 6328
286 Ga0068865_100013758 3300006881 Bacteria 5126
287 Ga0068865_100100995 3300006881 Bacteria 2112
288 Ga0068865_100617393 3300006881 Bacteria 918
289 Ga0075436_100000009 3300006914 Bacteria 256132
290 Ga0075436_100008218 3300006914 Bacteria 7140
291 Ga0075436_100088294 3300006914 Bacteria 2154
292 Ga0097620_100000018 3300006931 Bacteria 248813
293 Ga0097620_100009873 3300006931 Bacteria 9638
294 Ga0097620_100031929 3300006931 Bacteria 5290
295 Ga0097620_100061249 3300006931 Bacteria 3792
296 Ga0097620_100094968 3300006931 Bacteria 3034
297 Ga0097620_100126891 3300006931 Bacteria 2621
298 Ga0097620_100159852 3300006931 Unclassified 2332
299 Ga0097620_100225430 3300006931 Bacteria 1962
300 Ga0097620_100267358 3300006931 Bacteria 1802
301 Ga0097620_100362629 3300006931 Bacteria 1544
302 Ga0097620_100393140 3300006931 Bacteria 1482
303 Ga0097620_100849054 3300006931 Bacteria 999
304 Ga0097620_100952649 3300006931 Bacteria 941
305 Ga0099794_10007400 3300007265 Bacteria 4509
306 Ga0099794_10024770 3300007265 Bacteria 2758
307 Ga0099795_10000032 3300007788 Bacteria 37057
308 Ga0105240_10046485 3300009093 Bacteria 5500
309 Ga0105240_10391872 3300009093 Bacteria 1566
310 Ga0105240_10991685 3300009093 Bacteria 899
311 Ga0111539_10001405 3300009094 Bacteria 32059
312 Ga0111539_10012287 3300009094 Bacteria 10733
313 Ga0111539_10022883 3300009094 Bacteria 7674
314 Ga0111539_10153083 3300009094 Bacteria 2699
315 Ga0111539_10738163 3300009094 Bacteria 1146
316 Ga0105245_10015777 3300009098 Bacteria 6587
317 Ga0105245_10030971 3300009098 Bacteria 4732
318 Ga0105245_10181432 3300009098 Bacteria 2011
319 Ga0105245_10199308 3300009098 Bacteria 1922
320 Ga0105245_10249468 3300009098 Bacteria 1724
321 Ga0105245_10462533 3300009098 Bacteria 1279
322 Ga0105245_10595234 3300009098 Bacteria 1132
323 Ga0105247_10003256 3300009101 Bacteria 10648
324 Ga0105247_10164183 3300009101 Bacteria 1472
325 Ga0114129_10021342 3300009147 Bacteria 9194
326 Ga0114129_10042905 3300009147 Bacteria 6366
327 Ga0114129_10119091 3300009147 Bacteria 3637
328 Ga0114129_10354293 3300009147 Bacteria 1943
329 Ga0114129_10356777 3300009147 Bacteria 1935
330 Ga0114129_10374980 3300009147 Bacteria 1880
331 Ga0114129_10396784 3300009147 Bacteria 1819
332 Ga0114129_10693730 3300009147 Bacteria 1309
333 Ga0105243_10007346 3300009148 Bacteria 8471
334 Ga0105243_10069470 3300009148 Bacteria 2842
335 Ga0105243_10363846 3300009148 Bacteria 1332
336 Ga0105243_10990641 3300009148 Bacteria 842
337 Ga0105241_10083558 3300009174 Bacteria 2505
338 Ga0105241_10102449 3300009174 Unclassified 2278
339 Ga0105241_10593789 3300009174 Bacteria 999
340 Ga0105241_10715034 3300009174 Bacteria 916
341 Ga0105242_10411750 3300009176 Bacteria 1264
342 Ga0105242_10460870 3300009176 Bacteria 1200
343 Ga0105248_10005870 3300009177 Bacteria 13491
344 Ga0105248_10018915 3300009177 Bacteria 7617
345 Ga0105248_10141453 3300009177 Bacteria 2715
346 Ga0105248_10158725 3300009177 Bacteria 2551
347 Ga0105248_10242162 3300009177 Bacteria 2030
348 Ga0105248_10267197 3300009177 Bacteria 1926
349 Ga0105248_10307787 3300009177 Bacteria 1784
350 Ga0105248_11023297 3300009177 Bacteria 933
351 Ga0105237_10071421 3300009545 Bacteria 3466
352 Ga0105237_10089716 3300009545 Bacteria 3063
353 Ga0105237_10210845 3300009545 Bacteria 1943
354 Ga0105237_10789816 3300009545 Bacteria 956
355 Ga0105238_10006886 3300009551 Bacteria 11353
356 Ga0105238_10118922 3300009551 Bacteria 2622
357 Ga0105249_10013548 3300009553 Bacteria 7202
358 Ga0105249_10039020 3300009553 Bacteria 4310
359 Ga0105249_10045782 3300009553 Bacteria 3980
360 Ga0105249_10049971 3300009553 Bacteria 3813
361 Ga0105249_10114617 3300009553 Bacteria 2552
362 Ga0105249_10203924 3300009553 Bacteria 1936
363 Ga0099796_10000020 3300010159 Bacteria 41259
364 Ga0105239_10000469 3300010375 Bacteria 59012
365 Ga0105239_10368613 3300010375 Bacteria 1623
366 Ga0105239_10443836 3300010375 Bacteria 1471
367 Ga0105239_10547953 3300010375 Bacteria 1317
368 Ga0105239_12012040 3300010375 Bacteria 671
369 Ga0105246_10003450 3300011119 Bacteria 9585
370 Ga0105246_10021665 3300011119 Bacteria 4138
371 Ga0105246_10038224 3300011119 Bacteria 3225
372 Ga0105246_10430279 3300011119 Bacteria 1104
373 Ga0105246_10517681 3300011119 Bacteria 1016
374 Ga0105246_10559770 3300011119 Bacteria 981
375 Ga0105246_10748498 3300011119 Bacteria 862
376 Ga0157373_10083678 3300013100 Bacteria 2249
377 Ga0157373_10128242 3300013100 Bacteria 1784
378 Ga0157373_10368110 3300013100 Bacteria 1027
379 Ga0157373_10372965 3300013100 Bacteria 1020
380 Ga0157373_10527167 3300013100 Bacteria 855
381 Ga0157371_10002120 3300013102 Bacteria 19316
382 Ga0157371_10040887 3300013102 Bacteria 3310
383 Ga0157370_10040765 3300013104 Bacteria 4482
384 Ga0157370_10280425 3300013104 Unclassified 1540
385 Ga0157369_10015970 3300013105 Bacteria 8448
386 Ga0157374_10041032 3300013296 Bacteria 4262
387 Ga0157374_10393475 3300013296 Bacteria 1382
388 Ga0157374_10499916 3300013296 Bacteria 1220
389 Ga0157374_10538585 3300013296 Bacteria 1175
390 Ga0157374_10817194 3300013296 Bacteria 948
391 Ga0157378_10004869 3300013297 Bacteria 11775
392 Ga0157378_10005934 3300013297 Bacteria 10702
393 Ga0157378_10021654 3300013297 Bacteria 5652
394 Ga0157378_10024057 3300013297 Bacteria 5358
395 Ga0157378_10196841 3300013297 Bacteria 1904
396 Ga0157378_10307030 3300013297 Bacteria 1537
397 Ga0163162_10001448 3300013306 Bacteria 22080
398 Ga0163162_10006632 3300013306 Bacteria 11220
399 Ga0163162_10125034 3300013306 Bacteria 2677
400 Ga0163162_10213745 3300013306 Bacteria 2058
401 Ga0163162_10233792 3300013306 Bacteria 1969
402 Ga0163162_10442933 3300013306 Bacteria 1431
403 Ga0163162_10586084 3300013306 Bacteria 1242
404 Ga0163162_10862695 3300013306 Bacteria 1020
405 Ga0157372_10011389 3300013307 Bacteria 9460
406 Ga0157372_10104328 3300013307 Unclassified 3240
407 Ga0157372_10123962 3300013307 Bacteria 2970
408 Ga0157372_10147935 3300013307 Unclassified 2709
409 Ga0157372_11259607 3300013307 Bacteria 854
410 Ga0157375_10000277 3300013308 Bacteria 46526
411 Ga0157375_10003915 3300013308 Bacteria 12913
412 Ga0157375_10014916 3300013308 Bacteria 6946
413 Ga0157375_10033271 3300013308 Bacteria 4897
414 Ga0157375_10049252 3300013308 Bacteria 4127
415 Ga0157375_10523581 3300013308 Bacteria 1349
416 Ga0157375_10705309 3300013308 Bacteria 1162
417 Ga0157375_11448910 3300013308 Bacteria 810
418 Ga0163163_10006562 3300014325 Bacteria 10191
419 Ga0163163_10008538 3300014325 Bacteria 9103
420 Ga0163163_10039293 3300014325 Bacteria 4618
421 Ga0163163_10092286 3300014325 Bacteria 3043
422 Ga0163163_10207609 3300014325 Bacteria 2007
423 Ga0163163_10319854 3300014325 Bacteria 1605
424 Ga0163163_10403009 3300014325 Bacteria 1426
425 Ga0163163_10948460 3300014325 Bacteria 924
426 Ga0163163_11055166 3300014325 Bacteria 876
427 Ga0157380_10004791 3300014326 Bacteria 9428
428 Ga0157380_10007392 3300014326 Bacteria 7801
429 Ga0157380_10018186 3300014326 Bacteria 5215
430 Ga0157380_10018458 3300014326 Bacteria 5179
431 Ga0157380_10379855 3300014326 Bacteria 1333
432 Ga0157377_10226927 3300014745 Bacteria 1199
433 Ga0157379_10021797 3300014968 Bacteria 5675
434 Ga0157379_10083800 3300014968 Bacteria 2857
435 Ga0157379_10437484 3300014968 Bacteria 1206
436 Ga0157379_11092679 3300014968 Unclassified 764
437 Ga0157376_10005294 3300014969 Bacteria 9013
438 Ga0157376_10057141 3300014969 Unclassified 3263
439 Ga0157376_10317663 3300014969 Bacteria 1480
440 Ga0157376_10431311 3300014969 Bacteria 1281
441 Ga0157376_11328655 3300014969 Bacteria 749
442 Ga0163161_10024589 3300017792 Bacteria 4257
443 Ga0163161_10123774 3300017792 Bacteria 1945
444 Ga0213875_10000066 3300021388 Bacteria 127864
445 Ga0224572_1027221 3300024225 Unclassified 1096
446 Ga0207666_1013846 3300025271 Bacteria 1135
447 Ga0207697_10015842 3300025315 Bacteria 3110
448 Ga0207697_10051119 3300025315 Bacteria 1707
449 Ga0207697_10119867 3300025315 Bacteria 1131
450 Ga0207692_10257140 3300025898 Bacteria 1048
451 Ga0207642_10009995 3300025899 Bacteria 3324
452 Ga0207710_10012977 3300025900 Bacteria 3510
453 Ga0207680_10000026 3300025903 Bacteria 79960
454 Ga0207680_10080291 3300025903 Bacteria 2048
455 Ga0207685_10000023 3300025905 Bacteria 115280
456 Ga0207685_10159805 3300025905 Bacteria 1028
457 Ga0207645_10033456 3300025907 Bacteria 3303
458 Ga0207645_10045536 3300025907 Bacteria 2803
459 Ga0207645_10113813 3300025907 Bacteria 1753
460 Ga0207643_10007761 3300025908 Bacteria 5762
461 Ga0207643_10015988 3300025908 Bacteria 4087
462 Ga0207643_10024274 3300025908 Bacteria 3345
463 Ga0207705_10018748 3300025909 Bacteria 4950
464 Ga0207705_10058112 3300025909 Bacteria 2790
465 Ga0207705_10103501 3300025909 Bacteria 2097
466 Ga0207684_10184370 3300025910 Bacteria 1800
467 Ga0207654_10017779 3300025911 Bacteria 3722
468 Ga0207654_10204747 3300025911 Bacteria 1301
469 Ga0207707_10000016 3300025912 Bacteria 256002
470 Ga0207707_10043354 3300025912 Bacteria 3925
471 Ga0207695_10002632 3300025913 Bacteria 26269
472 Ga0207695_10007786 3300025913 Bacteria 13565
473 Ga0207695_10036125 3300025913 Bacteria 5345
474 Ga0207695_10046004 3300025913 Bacteria 4627
475 Ga0207695_10254956 3300025913 Bacteria 1653
476 Ga0207695_10332193 3300025913 Bacteria 1408
477 Ga0207671_10016462 3300025914 Bacteria 5745
478 Ga0207671_10132108 3300025914 Bacteria 1917
479 Ga0207671_10264501 3300025914 Bacteria 1354
480 Ga0207663_10019437 3300025916 Bacteria 3826
481 Ga0207663_10197483 3300025916 Bacteria 1449
482 Ga0207660_10000079 3300025917 Bacteria 51036
483 Ga0207660_10017505 3300025917 Bacteria 4762
484 Ga0207660_10050450 3300025917 Bacteria 2955
485 Ga0207660_10157918 3300025917 Bacteria 1747
486 Ga0207662_10020201 3300025918 Bacteria 3799
487 Ga0207662_10029348 3300025918 Bacteria 3186
488 Ga0207662_10051449 3300025918 Bacteria 2451
489 Ga0207662_10093187 3300025918 Bacteria 1856
490 Ga0207657_10501511 3300025919 Bacteria 951
491 Ga0207649_10221292 3300025920 Bacteria 1348
492 Ga0207649_10718163 3300025920 Bacteria 776
493 Ga0207649_10806423 3300025920 Bacteria 733
494 Ga0207652_10000126 3300025921 Bacteria 82522
495 Ga0207652_10001189 3300025921 Bacteria 23425
496 Ga0207652_10001467 3300025921 Bacteria 20866
497 Ga0207652_10078720 3300025921 Bacteria 2879
498 Ga0207646_10001755 3300025922 Bacteria 26294
499 Ga0207646_10641288 3300025922 Bacteria 952
500 Ga0207681_10007311 3300025923 Bacteria 6768
501 Ga0207681_10016199 3300025923 Bacteria 4658
502 Ga0207681_10095493 3300025923 Bacteria 2132
503 Ga0207681_10099304 3300025923 Unclassified 2096
504 Ga0207681_10573224 3300025923 Unclassified 930
505 Ga0207694_10003533 3300025924 Bacteria 12412
506 Ga0207694_10087008 3300025924 Bacteria 2461
507 Ga0207694_10135101 3300025924 Bacteria 1980
508 Ga0207650_10009261 3300025925 Bacteria 6729
509 Ga0207650_10028897 3300025925 Bacteria 3980
510 Ga0207650_10077348 3300025925 Bacteria 2515
511 Ga0207650_10561972 3300025925 Bacteria 957
512 Ga0207659_10015083 3300025926 Bacteria 4997
513 Ga0207659_10099913 3300025926 Bacteria 2185
514 Ga0207659_10198842 3300025926 Bacteria 1599
515 Ga0207687_10003331 3300025927 Bacteria 10852
516 Ga0207687_10137164 3300025927 Bacteria 1851
517 Ga0207687_10384391 3300025927 Bacteria 1151
518 Ga0207687_10390981 3300025927 Bacteria 1142
519 Ga0207687_10527064 3300025927 Bacteria 989
520 Ga0207700_10148785 3300025928 Bacteria 1933
521 Ga0207664_10065302 3300025929 Bacteria 2913
522 Ga0207644_10003034 3300025931 Bacteria 10801
523 Ga0207644_10059615 3300025931 Bacteria 2760
524 Ga0207644_10199918 3300025931 Bacteria 1576
525 Ga0207644_10428572 3300025931 Bacteria 1084
526 Ga0207644_10517637 3300025931 Bacteria 985
527 Ga0207706_10099379 3300025933 Unclassified 2560
528 Ga0207706_10136534 3300025933 Bacteria 2157
529 Ga0207706_10266770 3300025933 Bacteria 1494
530 Ga0207706_10298137 3300025933 Bacteria 1405
531 Ga0207686_10117237 3300025934 Bacteria 1806
532 Ga0207709_10081600 3300025935 Unclassified 2086
533 Ga0207709_10470568 3300025935 Bacteria 975
534 Ga0207670_10008737 3300025936 Bacteria 5736
535 Ga0207670_10195508 3300025936 Bacteria 1533
536 Ga0207670_10259357 3300025936 Bacteria 1347
537 Ga0207670_10331897 3300025936 Bacteria 1199
538 Ga0207669_10917376 3300025937 Bacteria 732
539 Ga0207704_10037543 3300025938 Bacteria 2799
540 Ga0207704_10186020 3300025938 Bacteria 1506
541 Ga0207704_10294051 3300025938 Bacteria 1241
542 Ga0207665_10000017 3300025939 Bacteria 130585
543 Ga0207665_10041949 3300025939 Bacteria 3057
544 Ga0207691_10000594 3300025940 Bacteria 36084
545 Ga0207691_10003897 3300025940 Bacteria 14494
546 Ga0207691_10049987 3300025940 Bacteria 3829
547 Ga0207691_10051610 3300025940 Bacteria 3759
548 Ga0207691_10074874 3300025940 Bacteria 3053
549 Ga0207691_10138386 3300025940 Bacteria 2146
550 Ga0207691_10382880 3300025940 Bacteria 1201
551 Ga0207711_10000721 3300025941 Bacteria 32580
552 Ga0207711_10001193 3300025941 Bacteria 24619
553 Ga0207711_10051610 3300025941 Bacteria 3523
554 Ga0207711_10091975 3300025941 Bacteria 2669
555 Ga0207711_10098208 3300025941 Plasmid 2587
556 Ga0207711_10359143 3300025941 Bacteria 1349
557 Ga0207711_10529258 3300025941 Bacteria 1099
558 Ga0207711_10562419 3300025941 Bacteria 1064
559 Ga0207689_10001176 3300025942 Bacteria 25213
560 Ga0207689_10013959 3300025942 Bacteria 6842
561 Ga0207689_10045396 3300025942 Bacteria 3633
562 Ga0207689_10057302 3300025942 Bacteria 3205
563 Ga0207689_10410248 3300025942 Bacteria 1130
564 Ga0207661_10070344 3300025944 Bacteria 2857
565 Ga0207661_10157316 3300025944 Bacteria 1969
566 Ga0207661_10229512 3300025944 Bacteria 1643
567 Ga0207661_10521957 3300025944 Bacteria 1086
568 Ga0207679_10104137 3300025945 Unclassified 2226
569 Ga0207679_11138643 3300025945 Bacteria 716
570 Ga0207667_10207773 3300025949 Bacteria 2007
571 Ga0207651_10023087 3300025960 Bacteria 3818
572 Ga0207651_10024485 3300025960 Bacteria 3735
573 Ga0207651_10053646 3300025960 Bacteria 2757
574 Ga0207651_10089104 3300025960 Bacteria 2251
575 Ga0207651_10167274 3300025960 Bacteria 1730
576 Ga0207651_10208490 3300025960 Bacteria 1571
577 Ga0207651_10534800 3300025960 Bacteria 1017
578 Ga0207651_10617164 3300025960 Bacteria 949
579 Ga0207651_10921762 3300025960 Bacteria 779
580 Ga0207712_10015915 3300025961 Bacteria 4860
581 Ga0207712_10063517 3300025961 Bacteria 2629
582 Ga0207712_10086455 3300025961 Bacteria 2297
583 Ga0207712_10120984 3300025961 Bacteria 1981
584 Ga0207712_10124954 3300025961 Bacteria 1952
585 Ga0207668_10027609 3300025972 Bacteria 3699
586 Ga0207668_10250477 3300025972 Bacteria 1438
587 Ga0207668_10285306 3300025972 Bacteria 1356
588 Ga0207640_10022067 3300025981 Bacteria 3804
589 Ga0207640_10197829 3300025981 Bacteria 1520
590 Ga0207640_10212509 3300025981 Bacteria 1475
591 Ga0207640_10344166 3300025981 Bacteria 1195
592 Ga0207658_10008660 3300025986 Bacteria 6913
593 Ga0207658_10193385 3300025986 Bacteria 1693
594 Ga0207658_10264806 3300025986 Bacteria 1466
595 Ga0207677_10035821 3300026023 Bacteria 3227
596 Ga0207677_10052878 3300026023 Bacteria 2762
597 Ga0207677_10100828 3300026023 Bacteria 2124
598 Ga0207677_10122851 3300026023 Bacteria 1956
599 Ga0207677_10219234 3300026023 Bacteria 1525
600 Ga0207677_10329699 3300026023 Bacteria 1271
601 Ga0207677_10971601 3300026023 Bacteria 769
602 Ga0207703_10004551 3300026035 Bacteria 11366
603 Ga0207703_10008595 3300026035 Bacteria 8059
604 Ga0207703_10019889 3300026035 Bacteria 5247
605 Ga0207703_10245381 3300026035 Bacteria 1612
606 Ga0207703_11568638 3300026035 Bacteria 633
607 Ga0207639_10027552 3300026041 Bacteria 4141
608 Ga0207639_10061339 3300026041 Bacteria 2904
609 Ga0207639_11346662 3300026041 Bacteria 670
610 Ga0207708_10099654 3300026075 Unclassified 2248
611 Ga0207708_10120090 3300026075 Bacteria 2047
612 Ga0207702_10102609 3300026078 Bacteria 2528
613 Ga0207702_10161665 3300026078 Bacteria 2045
614 Ga0207641_10000167 3300026088 Bacteria 92790
615 Ga0207641_10028444 3300026088 Bacteria 4619
616 Ga0207641_10038609 3300026088 Bacteria 3992
617 Ga0207641_10049850 3300026088 Bacteria 3540
618 Ga0207641_10231802 3300026088 Bacteria 1716
619 Ga0207648_10009103 3300026089 Bacteria 9543
620 Ga0207648_10010832 3300026089 Bacteria 8618
621 Ga0207648_10054277 3300026089 Bacteria 3501
622 Ga0207648_10131333 3300026089 Bacteria 2204
623 Ga0207676_10000992 3300026095 Bacteria 21875
624 Ga0207676_10006875 3300026095 Bacteria 8059
625 Ga0207676_10007550 3300026095 Bacteria 7715
626 Ga0207676_10071490 3300026095 Bacteria 2786
627 Ga0207676_10074099 3300026095 Bacteria 2741
628 Ga0207676_10114610 3300026095 Bacteria 2261
629 Ga0207676_10352948 3300026095 Unclassified 1360
630 Ga0207674_10000454 3300026116 Bacteria 53564
631 Ga0207674_10013502 3300026116 Bacteria 9057
632 Ga0207674_10194377 3300026116 Bacteria 1979
633 Ga0207674_10224884 3300026116 Bacteria 1825
634 Ga0207675_100000594 3300026118 Bacteria 35413
635 Ga0207675_100008267 3300026118 Bacteria 9801
636 Ga0207675_100046173 3300026118 Bacteria 4068
637 Ga0207675_100087097 3300026118 Bacteria 2933
638 Ga0207675_100719580 3300026118 Bacteria 1008
639 Ga0207675_100962859 3300026118 Bacteria 871
640 Ga0207683_10203262 3300026121 Bacteria 1801
641 Ga0207683_10269912 3300026121 Bacteria 1554
642 Ga0207683_10306134 3300026121 Bacteria 1454
643 Ga0207698_10041298 3300026142 Plasmid 3436
644 Ga0207698_10167275 3300026142 Bacteria 1931
645 Ga0207698_10210632 3300026142 Bacteria 1748
646 Ga0207698_10677490 3300026142 Bacteria 1024
647 Ga0207698_10695059 3300026142 Bacteria 1011
648 Ga0209981_1029963 3300027378 Bacteria 796
649 Ga0209179_1000063 3300027512 Bacteria 19219
650 Ga0209588_1001752 3300027671 Bacteria 5750
651 Ga0207428_10158543 3300027907 Bacteria 1719
652 Ga0268266_10000088 3300028379 Bacteria 199029
653 Ga0268265_10034020 3300028380 Bacteria 3711
654 Ga0268265_10046160 3300028380 Unclassified 3255
655 Ga0268265_10521294 3300028380 Bacteria 1123
656 Ga0268265_10532441 3300028380 Bacteria 1112
657 Ga0268264_10007287 3300028381 Bacteria 9257
658 Ga0268264_10013625 3300028381 Bacteria 6692
659 Ga0268264_10014801 3300028381 Bacteria 6407
660 Ga0268264_10024262 3300028381 Bacteria 4951
661 Ga0268264_10061513 3300028381 Bacteria 3150
662 Ga0268264_10061901 3300028381 Bacteria 3141
663 Ga0268264_10064096 3300028381 Bacteria 3092
664 Ga0268264_10119274 3300028381 Bacteria 2323
665 Ga0268264_10120617 3300028381 Bacteria 2310
666 Ga0265337_1004481 3300028556 Bacteria 5786
667 Ga0265337_1014316 3300028556 Unclassified 2632
668 Ga0265337_1073910 3300028556 Bacteria 935
669 Ga0265319_1000297 3300028563 Bacteria 36855
670 Ga0265334_10001759 3300028573 Bacteria 10350
671 Ga0265334_10072004 3300028573 Bacteria 1286
672 Ga0265318_10000045 3300028577 Bacteria 127051
673 Ga0265318_10006110 3300028577 Bacteria 5582
674 Ga0265336_10000194 3300028666 Bacteria 42728
675 Ga0265336_10136161 3300028666 Bacteria 731
676 Ga0307515_10088846 3300028794 Bacteria 3899
677 Ga0265338_10000273 3300028800 Bacteria 94209
678 Ga0265338_10002518 3300028800 Bacteria 27237
679 Ga0265338_10053985 3300028800 Bacteria 3588
680 Ga0265338_10070056 3300028800 Bacteria 3009
681 Ga0265324_10000013 3300029957 Bacteria 195334
682 Ga0265324_10000399 3300029957 Bacteria 31271
683 Ga0265324_10011238 3300029957 Bacteria 3417
684 Ga0265324_10022786 3300029957 Bacteria 2236
685 Ga0265760_10005102 3300031090 Bacteria 3760
686 Ga0265330_10000023 3300031235 Bacteria 150143
687 Ga0265332_10000040 3300031238 Bacteria 126865
688 Ga0265332_10026189 3300031238 Bacteria 2558
689 Ga0265332_10092026 3300031238 Bacteria 1282
690 Ga0265328_10015993 3300031239 Bacteria 2928
691 Ga0265320_10000022 3300031240 Bacteria 172278
692 Ga0265320_10000494 3300031240 Bacteria 30746
693 Ga0265320_10364122 3300031240 Bacteria 639
694 Ga0265325_10016374 3300031241 Bacteria 4146
695 Ga0265325_10042944 3300031241 Bacteria 2361
696 Ga0265329_10026242 3300031242 Bacteria 1921
697 Ga0265340_10023753 3300031247 Bacteria 3123
698 Ga0265339_10000022 3300031249 Bacteria 171562
699 Ga0265339_10058958 3300031249 Bacteria 2071
700 Ga0265339_10173091 3300031249 Bacteria 1079
701 Ga0265331_10000001 3300031250 Bacteria 798836
702 Ga0265331_10064464 3300031250 Bacteria 1725
703 Ga0265331_10108435 3300031250 Bacteria 1274
704 Ga0265327_10000426 3300031251 Bacteria 76984
705 Ga0265316_10001556 3300031344 Bacteria 24596
706 Ga0265316_10024131 3300031344 Bacteria 5103
707 Ga0265316_10214381 3300031344 Bacteria 1423
708 Ga0265316_10291342 3300031344 Bacteria 1191
709 Ga0307408_100015226 3300031548 Bacteria 5120
710 Ga0265313_10000018 3300031595 Bacteria 151941
711 Ga0265313_10002159 3300031595 Bacteria 17467
712 Ga0265313_10003735 3300031595 Bacteria 12111
713 Ga0316575_10011634 3300031665 Bacteria 3259
714 Ga0316579_10012325 3300031691 Bacteria 3655
715 Ga0265314_10000006 3300031711 Bacteria 540431
716 Ga0265314_10008212 3300031711 Bacteria 8970
717 Ga0265314_10093905 3300031711 Bacteria 1946
718 Ga0265314_10128497 3300031711 Bacteria 1584
719 Ga0265342_10007381 3300031712 Bacteria 8057
720 Ga0265342_10014422 3300031712 Bacteria 5245
721 Ga0265342_10034447 3300031712 Bacteria 3107
722 Ga0316576_10024142 3300031727 Bacteria 4243
723 Ga0316578_10005251 3300031728 Bacteria 6251
724 Ga0316577_10009514 3300031733 Bacteria 5230
725 Ga0307409_100118493 3300031995 Bacteria 2236
726 Ga0307416_100181409 3300032002 Bacteria 1974
727 Ga0307416_100578416 3300032002 Bacteria 1200
728 Ga0307414_10025626 3300032004 Unclassified 3782
729 Ga0307414_10031339 3300032004 Bacteria 3487
730 Ga0307411_10326559 3300032005 Bacteria 1241
731 Ga0316580_10000633 3300032139 Bacteria 8287
732 Ga0316592_1105039 3300033524 Bacteria 651
733 Ga0373956_0021341 3300035119 Bacteria 2763
734 Ga0373943_0431794 3300035170 Bacteria 763
735 Ga0373946_0030639 3300035171 Bacteria 2149
736 Ga0373955_0020220 3300035172 Bacteria 3343
737 Ga0373955_0189735 3300035172 Bacteria 1222
738 Ga0316574_0033312 3300035398 Bacteria 3135
739 Ga0373931_0065013 3300035691 Bacteria 1976
740 Ga0373931_0076780 3300035691 Bacteria 1836
741 Ga0373933_0216268 3300035724 Bacteria 1229
742 Ga0373937_0129582 3300036401 Bacteria 2356
743 Ga0373937_0346860 3300036401 Bacteria 1406
744 Ga0373937_0651921 3300036401 Bacteria 998
745 Ga0316582_0011550 3300036647 Bacteria 4887
746 Ga0316584_0101297 3300036712 Bacteria 2156
747 Ga0373925_0015234 3300037068 Bacteria 5559
748 Ga0395898_0544070 3300037466 Bacteria 1103
749 Ga0395905_0107621 3300037471 Bacteria 2617
750 Ga0395905_0493689 3300037471 Bacteria 1124
751 Ga0316581_0000048 3300037588 Bacteria 13503
752 Ga0436364_0079644 3300037853 Bacteria 315114
753 Ga0436364_0354394 3300037853 Bacteria 1016
754 Ga0436364_0764741 3300037853 Bacteria 2601
755 Ga0436364_0815975 3300037853 Bacteria 1830
756 Ga0436364_1367354 3300037853 Bacteria 1997
757 Ga0436364_1506799 3300037853 Bacteria 3052
758 Ga0436365_0861631 3300039437 Bacteria 6867
759 Ga0436363_0543025 3300039450 Bacteria 837
760 Ga0436363_0549965 3300039450 Bacteria 952
761 Ga0436363_0589199 3300039450 Bacteria 1027
762 Ga0439466_0068944 3300041411 Bacteria 1129
763 Ga0451807_0610239 3300041486 Bacteria 1994
764 Ga0451845_0935863 3300041501 Bacteria 992
765 Ga0439449_0018604 3300042007 Bacteria 2607
766 Ga0450897_007139 3300042128 Bacteria 1014
767 Ga0439434_0015100 3300042435 Bacteria 2301
768 Ga0451577_0050866 3300042876 Bacteria 3699
769 Ga0451577_0118834 3300042876 Bacteria 2367
770 Ga0453683_0105437 3300044673 Bacteria 1771
771 Ga0466963_0300837 3300044694 Bacteria 1128
772 Ga0466964_0080747 3300044706 Bacteria 1395
773 Ga0453684_0014309 3300044712 Bacteria 12714
774 Ga0453684_0037782 3300044712 Bacteria 6621
775 Ga0453684_0078632 3300044712 Bacteria 4126
776 Ga0453684_0112732 3300044712 Bacteria 3300
777 Ga0453684_0212442 3300044712 Bacteria 2248
778 Ga0453684_0438993 3300044712 Bacteria 1455
779 Ga0453684_0561261 3300044712 Bacteria 1256
780 Ga0453684_0614798 3300044712 Bacteria 1189
781 Ga0466957_0556086 3300044842 Bacteria 800
782 Ga0466959_0021949 3300045049 Bacteria 4715
783 Ga0451576_0023531 3300045051 Bacteria 6669
784 Ga0451576_0631538 3300045051 Bacteria 1125
785 Ga0451576_0775211 3300045051 Bacteria 1007
786 Ga0451576_0812589 3300045051 Bacteria 982
787 Ga0466967_0729660 3300045976 Bacteria 982
788 Ga0495592_0040018 3300046454 Bacteria 3519
789 Ga0495653_0000035 3300046463 Bacteria 129875
790 Ga0495653_0223216 3300046463 Bacteria 1266
791 Ga0495650_0014587 3300046471 Bacteria 4075
792 Ga0495580_0081182 3300046472 Bacteria 2260
793 Ga0495662_0013922 3300046476 Unclassified 3916
794 Ga0495594_0027028 3300046499 Bacteria 3091
795 Ga0495594_0229656 3300046499 Bacteria 1058
796 Ga0495606_0000512 3300046507 Bacteria 63012
797 Ga0495610_0324939 3300046512 Bacteria 586
798 Ga0495618_0056940 3300046514 Bacteria 2475
799 Ga0495630_0886623 3300046517 Bacteria 680
800 Ga0495652_0393246 3300046529 Bacteria 983
801 Ga0495634_0096519 3300046642 Unclassified 1914
802 Ga0495588_0046713 3300046674 Bacteria 2221
803 Ga0495599_0008979 3300046678 Bacteria 6089
804 Ga0495613_0044931 3300046689 Unclassified 3267
805 Ga0495624_0284016 3300046690 Bacteria 999
806 Ga0495671_0000005 3300046692 Bacteria 509397
807 Ga0495604_0130923 3300047317 Bacteria 1803
808 Ga0495674_0023447 3300047319 Bacteria 5687
809 Ga0495674_0116362 3300047319 Bacteria 2262
810 Ga0495674_0147007 3300047319 Bacteria 1978
811 Ga0495680_0584244 3300047322 Bacteria 749
812 Ga0495675_0084671 3300047444 Bacteria 1995
813 Ga0495673_0000012 3300047469 Bacteria 656908
814 Ga0495684_0062255 3300047471 Unclassified 2838
815 Ga0495684_0062389 3300047471 Bacteria 2835
816 Ga0495686_0161910 3300047472 Bacteria 1307
817 Ga0496100_0286203 3300048903 Bacteria 1230
818 Ga0496103_0070932 3300048906 Bacteria 2180
819 Ga0496104_0003103 3300048907 Bacteria 14325
820 Ga0496104_0025034 3300048907 Bacteria 5498
821 Ga0496104_0597651 3300048907 Bacteria 1014
822 Ga0496105_0005857 3300048908 Bacteria 9375
823 Ga0496106_0111339 3300048909 Bacteria 2132
824 Ga0496106_0317353 3300048909 Bacteria 1251
825 Ga0496106_0911339 3300048909 Bacteria 694
826 Ga0496108_0019732 3300048911 Bacteria 5537
827 Ga0496109_0481941 3300048912 Bacteria 1171
828 Ga0496110_0008210 3300048913 Bacteria 8391
829 Ga0496110_0551343 3300048913 Bacteria 1048
830 Ga0496110_0890432 3300048913 Bacteria 796
831 Ga0496111_0058388 3300048914 Bacteria 2793
832 Ga0496112_0058302 3300048915 Bacteria 3802
833 Ga0496112_0094967 3300048915 Bacteria 2953
834 Ga0496112_0873277 3300048915 Bacteria 822
835 Ga0496114_0074194 3300048917 Bacteria 2864
836 Ga0496114_0081551 3300048917 Bacteria 2733
837 Ga0496126_0012839 3300048929 Bacteria 8560
838 Ga0501033_0000264 3300049570 Bacteria 50307
839 Ga0501033_0297342 3300049570 Bacteria 1137
840 Ga0501034_0000572 3300049571 Bacteria 58406
841 Ga0501036_0033995 3300049572 Bacteria 4312
842 Ga0501036_0034780 3300049572 Bacteria 4263
843 Ga0501036_0259485 3300049572 Bacteria 1456
844 Ga0501037_0059323 3300049573 Bacteria 2792
845 Ga0501037_0095488 3300049573 Bacteria 2149
846 Ga0501038_0304412 3300049574 Bacteria 1250
847 Ga0501042_0079935 3300049578 Bacteria 2343
848 Ga0501043_0026599 3300049579 Bacteria 4539
849 Ga0501047_0010345 3300049581 Bacteria 8824
850 Ga0501047_0266255 3300049581 Bacteria 1561
851 Ga0501070_0011014 3300049586 Bacteria 7633
852 Ga0501070_0035279 3300049586 Bacteria 4180
853 Ga0501070_0289198 3300049586 Bacteria 1336
854 Ga0501073_0060831 3300049589 Bacteria 2636
855 Ga0501075_0113250 3300049591 Bacteria 2062
856 Ga0501242_001168 3300049674 Bacteria 2578
857 Ga0501249_091320 3300049679 Bacteria 722
858 Ga0501259_004679 3300049688 Bacteria 2170
859 Ga0501245_017126 3300049708 Bacteria 1105
860 Ga0501079_0070256 3300049741 Bacteria 2704
861 Ga0501080_0101414 3300049742 Bacteria 2670
862 Ga0501080_0506903 3300049742 Bacteria 1078
863 Ga0501080_0758658 3300049742 Bacteria 853
864 Ga0501268_054545 3300049765 Bacteria 780
865 Ga0501035_0010184 3300049822 Bacteria 8726
866 Ga0501035_0182250 3300049822 Bacteria 1809
867 Ga0501044_0004459 3300049823 Bacteria 15661
868 Ga0501044_0048547 3300049823 Bacteria 4384
869 nmdc:mga0k408_24387_c1 3300050493 Bacteria 3418
870 nmdc:mga05p37_102095_c1 3300050507 Bacteria 3532
871 nmdc:mga05p37_198967_c2 3300050507 Bacteria 1736
872 nmdc:mga05p37_203516_c1 3300050507 Bacteria 2396
873 nmdc:mga05p37_33027_c1 3300050507 Bacteria 6336
874 nmdc:mga05p37_627909_c1 3300050507 Bacteria 1208
875 nmdc:mga05p37_657753_c1 3300050507 Bacteria 1172
876 nmdc:mga05p37_737532_c1 3300050507 Bacteria 1088
877 nmdc:mga09592_178409_c1 3300050508 Bacteria 1837
878 nmdc:mga09592_222184_c1 3300050508 Bacteria 1636
879 nmdc:mga09592_235355_c1 3300050508 Bacteria 1587
880 nmdc:mga09592_2772_c1 3300050508 Bacteria 14182
881 nmdc:mga0qj67_117716_c1 3300050509 Bacteria 2147
882 nmdc:mga0qj67_131778_c1 3300050509 Bacteria 2025
883 nmdc:mga06r32_19954_c1 3300050510 Bacteria 6162
884 nmdc:mga08y16_134086_c1 3300050511 Bacteria 2574
885 nmdc:mga08y16_531580_c1 3300050511 Bacteria 1192
886 nmdc:mga08y16_96242_c1 3300050511 Bacteria 3083
887 nmdc:mga0n895_157271_c1 3300050512 Bacteria 2303
888 nmdc:mga0n895_193524_c1 3300050512 Bacteria 2065
889 nmdc:mga0n895_392230_c1 3300050512 Bacteria 1404
890 nmdc:mga0n895_522486_c1 3300050512 Bacteria 1194
891 nmdc:mga0n895_671925_c1 3300050512 Bacteria 1033
892 nmdc:mga0n895_796916_c1 3300050512 Bacteria 935
893 nmdc:mga0n895_984857_c1 3300050512 Bacteria 825
894 nmdc:mga0rr50_158622_c1 3300050513 Bacteria 1834
895 nmdc:mga0rr50_236_c1 3300050513 Bacteria 29962
896 nmdc:mga08x19_167633_c1 3300050514 Bacteria 1494
897 nmdc:mga08x19_31_c1 3300050514 Bacteria 209591
898 nmdc:mga0a205_210616_c1 3300050515 Bacteria 1832
899 nmdc:mga0a205_215431_c1 3300050515 Bacteria 1807
900 nmdc:mga0a205_2951_c1 3300050515 Bacteria 12795
901 Ga0500644_0046920 3300053088 Bacteria 1463
902 Ga0500650_0048643 3300053098 Bacteria 1967
903 Ga0500652_224155 3300053131 Bacteria 755
904 Ga0500658_0089637 3300053134 Bacteria 1328
905 Ga0500568_0087435 3300053139 Bacteria 1178
906 Ga0500616_0107781 3300053153 Bacteria 1351
907 Ga0501082_0145025 3300060353 Bacteria 2061
908 Ga0501082_1039041 3300060353 Bacteria 716

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046512 Ga0495610_0324939 Ga0495610_0324939_61_576 171
2 3300046517 Ga0495630_0886623 Ga0495630_0886623_144_665 171
3 3300005338 Ga0068868_100097815 Ga0068868_1000978153 178
4 3300005548 Ga0070665_100118546 Ga0070665_1001185463 178
5 3300049570 Ga0501033_0297342 Ga0501033_0297342_394_969 179
6 3300049823 Ga0501044_0048547 Ga0501044_0048547_972_1547 179
7 3300005842 Ga0068858_100026860 Ga0068858_1000268604 181
8 3300009098 Ga0105245_10015777 Ga0105245_100157774 181
9 3300009177 Ga0105248_10018915 Ga0105248_100189154 181
10 3300009545 Ga0105237_10071421 Ga0105237_100714213 181
11 3300009551 Ga0105238_10006886 Ga0105238_100068865 181
12 3300009553 Ga0105249_10039020 Ga0105249_100390204 181
13 3300011119 Ga0105246_10003450 Ga0105246_100034504 181
14 3300013306 Ga0163162_10862695 Ga0163162_108626952 181
15 3300013308 Ga0157375_10003915 Ga0157375_100039158 181
16 3300025924 Ga0207694_10003533 Ga0207694_100035336 181
17 3300025927 Ga0207687_10003331 Ga0207687_100033316 181
18 3300025941 Ga0207711_10001193 Ga0207711_1000119318 181
19 3300025961 Ga0207712_10015915 Ga0207712_100159152 181
20 3300026035 Ga0207703_10008595 Ga0207703_100085954 181
21 3300006048 Ga0075363_100347233 Ga0075363_1003472332 183
22 3300006178 Ga0075367_10030751 Ga0075367_100307512 183
23 3300009093 Ga0105240_10046485 Ga0105240_100464857 183
24 3300025913 Ga0207695_10036125 Ga0207695_100361256 183
25 3300005293 Ga0065715_10000791 Ga0065715_100007917 186
26 3300005616 Ga0068852_100458459 Ga0068852_1004584592 186
27 3300005841 Ga0068863_100729072 Ga0068863_1007290722 186
28 3300013308 Ga0157375_10705309 Ga0157375_107053092 186
29 3300014325 Ga0163163_10039293 Ga0163163_100392938 186
30 3300025925 Ga0207650_10561972 Ga0207650_105619721 186
31 3300025931 Ga0207644_10517637 Ga0207644_105176372 186
32 3300025935 Ga0207709_10470568 Ga0207709_104705682 186
33 3300026142 Ga0207698_10695059 Ga0207698_106950591 186
34 3300035172 Ga0373955_0189735 Ga0373955_0189735_533_1093 186
35 3300036401 Ga0373937_0346860 Ga0373937_0346860_233_793 186
36 3300046529 Ga0495652_0393246 Ga0495652_0393246_104_664 186
37 3300047322 Ga0495680_0584244 Ga0495680_0584244_100_660 186
38 iso_pu_bacteria 2738541278 2738730663 187
39 3300005457 Ga0070662_100458741 Ga0070662_1004587411 188
40 3300013100 Ga0157373_10372965 Ga0157373_103729652 188
41 3300005288 Ga0065714_10065170 Ga0065714_100651702 189
42 3300005290 Ga0065712_10000127 Ga0065712_10000127111 189
43 3300005293 Ga0065715_10250886 Ga0065715_102508861 189
44 3300009098 Ga0105245_10462533 Ga0105245_104625331 189
45 3300025945 Ga0207679_11138643 Ga0207679_111386431 189
46 3300028556 Ga0265337_1073910 Ga0265337_10739102 189
47 3300044712 Ga0453684_0112732 Ga0453684_0112732_10_579 189
48 3300050509 nmdc:mga0qj67_117716_c1 nmdc:mga0qj67_117716_c1_688_1257 189
49 3300005290 Ga0065712_10148837 Ga0065712_101488371 190
50 3300005293 Ga0065715_10092022 Ga0065715_100920222 190
51 3300005327 Ga0070658_10000394 Ga0070658_1000039430 190
52 3300005329 Ga0070683_101068697 Ga0070683_1010686971 190
53 3300005330 Ga0070690_100800069 Ga0070690_1008000691 190
54 3300005331 Ga0070670_100037379 Ga0070670_1000373791 190
55 3300005334 Ga0068869_100022098 Ga0068869_1000220983 190
56 3300005334 Ga0068869_100071543 Ga0068869_1000715432 190
57 3300005340 Ga0070689_100164110 Ga0070689_1001641102 190
58 3300005355 Ga0070671_100002104 Ga0070671_1000021047 190
59 3300005355 Ga0070671_100026730 Ga0070671_1000267303 190
60 3300005365 Ga0070688_100048696 Ga0070688_1000486962 190
61 3300005367 Ga0070667_100023350 Ga0070667_1000233502 190
62 3300005459 Ga0068867_100042773 Ga0068867_1000427733 190
63 3300005468 Ga0070707_100106737 Ga0070707_1001067372 190
64 3300005471 Ga0070698_100026474 Ga0070698_1000264744 190
65 3300005471 Ga0070698_100326848 Ga0070698_1003268483 190
66 3300005518 Ga0070699_100001719 Ga0070699_1000017198 190
67 3300005545 Ga0070695_100118556 Ga0070695_1001185562 190
68 3300005547 Ga0070693_100116852 Ga0070693_1001168521 190
69 3300005578 Ga0068854_100659138 Ga0068854_1006591381 190
70 3300005615 Ga0070702_100121139 Ga0070702_1001211392 190
71 3300005616 Ga0068852_100063061 Ga0068852_1000630612 190
72 3300005617 Ga0068859_100009873 Ga0068859_1000098735 190
73 3300005617 Ga0068859_100126891 Ga0068859_1001268912 190
74 3300005618 Ga0068864_100025295 Ga0068864_1000252952 190
75 3300005718 Ga0068866_10027331 Ga0068866_100273313 190
76 3300005719 Ga0068861_100027390 Ga0068861_1000273902 190
77 3300005843 Ga0068860_100156698 Ga0068860_1001566983 190
78 3300006028 Ga0070717_10000960 Ga0070717_1000096019 190
79 3300006173 Ga0070716_100033133 Ga0070716_1000331332 190
80 3300006237 Ga0097621_100007931 Ga0097621_1000079315 190
81 3300006880 Ga0075429_100043066 Ga0075429_1000430666 190
82 3300006931 Ga0097620_100009873 Ga0097620_1000098735 190
83 3300006931 Ga0097620_100126891 Ga0097620_1001268912 190
84 3300007788 Ga0099795_10000032 Ga0099795_1000003220 190
85 3300009147 Ga0114129_10356777 Ga0114129_103567772 190
86 3300009176 Ga0105242_10411750 Ga0105242_104117501 190
87 3300009177 Ga0105248_10005870 Ga0105248_100058709 190
88 3300009177 Ga0105248_11023297 Ga0105248_110232971 190
89 3300010159 Ga0099796_10000020 Ga0099796_1000002019 190
90 3300010375 Ga0105239_10443836 Ga0105239_104438362 190
91 3300013100 Ga0157373_10083678 Ga0157373_100836782 190
92 3300013296 Ga0157374_10041032 Ga0157374_100410324 190
93 3300013297 Ga0157378_10005934 Ga0157378_100059344 190
94 3300013297 Ga0157378_10024057 Ga0157378_100240574 190
95 3300013297 Ga0157378_10196841 Ga0157378_101968411 190
96 3300013306 Ga0163162_10001448 Ga0163162_1000144811 190
97 3300013307 Ga0157372_10104328 Ga0157372_101043283 190
98 3300014325 Ga0163163_10006562 Ga0163163_100065622 190
99 3300014325 Ga0163163_10008538 Ga0163163_100085382 190
100 3300014969 Ga0157376_11328655 Ga0157376_113286551 190
101 3300025931 Ga0207644_10003034 Ga0207644_100030347 190
102 3300025939 Ga0207665_10041949 Ga0207665_100419493 190
103 3300027512 Ga0209179_1000063 Ga0209179_100006319 190
104 3300028800 Ga0265338_10053985 Ga0265338_100539853 190
105 3300029957 Ga0265324_10000399 Ga0265324_100003996 190
106 3300031241 Ga0265325_10016374 Ga0265325_100163744 190
107 3300031249 Ga0265339_10000022 Ga0265339_100000228 190
108 3300031595 Ga0265313_10003735 Ga0265313_100037357 190
109 3300031712 Ga0265342_10034447 Ga0265342_100344472 190
110 3300042876 Ga0451577_0050866 Ga0451577_0050866_341_913 190
111 3300044712 Ga0453684_0561261 Ga0453684_0561261_535_1107 190
112 3300045051 Ga0451576_0631538 Ga0451576_0631538_203_775 190
113 3300045976 Ga0466967_0729660 Ga0466967_0729660_293_886 190
114 2162886007 SwRhRL2b_contig_206548 SwRhRL2b_0273.00001530 191
115 3300003323 rootH1_10222734 rootH1_102227343 191
116 3300005289 Ga0065704_10103385 Ga0065704_101033852 191
117 3300005289 Ga0065704_10197256 Ga0065704_101972562 191
118 3300005289 Ga0065704_10493982 Ga0065704_104939821 191
119 3300005290 Ga0065712_10007240 Ga0065712_100072403 191
120 3300005290 Ga0065712_10013797 Ga0065712_100137972 191
121 3300005293 Ga0065715_10027705 Ga0065715_100277051 191
122 3300005295 Ga0065707_10008733 Ga0065707_100087333 191
123 3300005295 Ga0065707_10033347 Ga0065707_100333472 191
124 3300005295 Ga0065707_10122006 Ga0065707_101220062 191
125 3300005295 Ga0065707_10126451 Ga0065707_101264513 191
126 3300005295 Ga0065707_10129106 Ga0065707_101291062 191
127 3300005295 Ga0065707_10232992 Ga0065707_102329921 191
128 3300005295 Ga0065707_10354834 Ga0065707_103548342 191
129 3300005327 Ga0070658_10028202 Ga0070658_100282024 191
130 3300005327 Ga0070658_10763219 Ga0070658_107632191 191
131 3300005328 Ga0070676_10083094 Ga0070676_100830943 191
132 3300005329 Ga0070683_100046502 Ga0070683_1000465023 191
133 3300005329 Ga0070683_100147147 Ga0070683_1001471471 191
134 3300005329 Ga0070683_100734650 Ga0070683_1007346501 191
135 3300005330 Ga0070690_100065953 Ga0070690_1000659533 191
136 3300005330 Ga0070690_100205328 Ga0070690_1002053283 191
137 3300005331 Ga0070670_100010264 Ga0070670_1000102646 191
138 3300005331 Ga0070670_100015904 Ga0070670_10001590412 191
139 3300005334 Ga0068869_100016011 Ga0068869_1000160114 191
140 3300005334 Ga0068869_100038528 Ga0068869_1000385282 191
141 3300005334 Ga0068869_100041468 Ga0068869_1000414682 191
142 3300005334 Ga0068869_100045784 Ga0068869_1000457842 191
143 3300005334 Ga0068869_100129612 Ga0068869_1001296122 191
144 3300005334 Ga0068869_100659467 Ga0068869_1006594671 191
145 3300005335 Ga0070666_10000024 Ga0070666_1000002466 191
146 3300005335 Ga0070666_10085791 Ga0070666_100857912 191
147 3300005336 Ga0070680_100001860 Ga0070680_1000018603 191
148 3300005336 Ga0070680_100015415 Ga0070680_1000154154 191
149 3300005337 Ga0070682_100000160 Ga0070682_1000001606 191
150 3300005337 Ga0070682_100505804 Ga0070682_1005058042 191
151 3300005337 Ga0070682_100627615 Ga0070682_1006276152 191
152 3300005338 Ga0068868_100108577 Ga0068868_1001085772 191
153 3300005338 Ga0068868_100119142 Ga0068868_1001191422 191
154 3300005338 Ga0068868_100239575 Ga0068868_1002395752 191
155 3300005338 Ga0068868_100269867 Ga0068868_1002698672 191
156 3300005339 Ga0070660_100323309 Ga0070660_1003233091 191
157 3300005340 Ga0070689_100071874 Ga0070689_1000718744 191
158 3300005340 Ga0070689_100112194 Ga0070689_1001121942 191
159 3300005347 Ga0070668_100006022 Ga0070668_10000602215 191
160 3300005347 Ga0070668_100039038 Ga0070668_1000390381 191
161 3300005347 Ga0070668_100943159 Ga0070668_1009431591 191
162 3300005353 Ga0070669_100006440 Ga0070669_1000064408 191
163 3300005353 Ga0070669_100017708 Ga0070669_1000177086 191
164 3300005353 Ga0070669_100105122 Ga0070669_1001051222 191
165 3300005353 Ga0070669_100637256 Ga0070669_1006372561 191
166 3300005354 Ga0070675_100015874 Ga0070675_1000158743 191
167 3300005355 Ga0070671_100058436 Ga0070671_1000584362 191
168 3300005355 Ga0070671_100151903 Ga0070671_1001519034 191
169 3300005355 Ga0070671_100198146 Ga0070671_1001981462 191
170 3300005355 Ga0070671_100518110 Ga0070671_1005181101 191
171 3300005356 Ga0070674_100106641 Ga0070674_1001066412 191
172 3300005364 Ga0070673_100003495 Ga0070673_1000034958 191
173 3300005364 Ga0070673_100021741 Ga0070673_1000217417 191
174 3300005364 Ga0070673_100069550 Ga0070673_1000695504 191
175 3300005364 Ga0070673_100078564 Ga0070673_1000785642 191
176 3300005364 Ga0070673_100211440 Ga0070673_1002114402 191
177 3300005364 Ga0070673_100259750 Ga0070673_1002597501 191
178 3300005364 Ga0070673_100707300 Ga0070673_1007073002 191
179 3300005365 Ga0070688_100269138 Ga0070688_1002691382 191
180 3300005367 Ga0070667_100001961 Ga0070667_10000196114 191
181 3300005367 Ga0070667_100110693 Ga0070667_1001106932 191
182 3300005367 Ga0070667_100202286 Ga0070667_1002022862 191
183 3300005367 Ga0070667_100870179 Ga0070667_1008701792 191
184 3300005434 Ga0070709_10169766 Ga0070709_101697662 191
185 3300005434 Ga0070709_10375209 Ga0070709_103752091 191
186 3300005436 Ga0070713_100073793 Ga0070713_1000737933 191
187 3300005438 Ga0070701_10034183 Ga0070701_100341832 191
188 3300005439 Ga0070711_100008085 Ga0070711_10000808510 191
189 3300005439 Ga0070711_100205937 Ga0070711_1002059373 191
190 3300005439 Ga0070711_100478678 Ga0070711_1004786781 191
191 3300005440 Ga0070705_100048297 Ga0070705_1000482972 191
192 3300005440 Ga0070705_100069962 Ga0070705_1000699622 191
193 3300005440 Ga0070705_100140429 Ga0070705_1001404293 191
194 3300005441 Ga0070700_100041146 Ga0070700_1000411464 191
195 3300005441 Ga0070700_100193777 Ga0070700_1001937772 191
196 3300005444 Ga0070694_100273709 Ga0070694_1002737092 191
197 3300005444 Ga0070694_100776443 Ga0070694_1007764431 191
198 3300005457 Ga0070662_100031884 Ga0070662_1000318843 191
199 3300005457 Ga0070662_100109667 Ga0070662_1001096672 191
200 3300005457 Ga0070662_100109970 Ga0070662_1001099702 191
201 3300005457 Ga0070662_100244067 Ga0070662_1002440672 191
202 3300005457 Ga0070662_100476284 Ga0070662_1004762841 191
203 3300005458 Ga0070681_10000089 Ga0070681_100000894 191
204 3300005459 Ga0068867_100028048 Ga0068867_1000280484 191
205 3300005459 Ga0068867_100078136 Ga0068867_1000781362 191
206 3300005459 Ga0068867_100263749 Ga0068867_1002637492 191
207 3300005459 Ga0068867_101156245 Ga0068867_1011562451 191
208 3300005466 Ga0070685_10047580 Ga0070685_100475803 191
209 3300005466 Ga0070685_10088724 Ga0070685_100887242 191
210 3300005467 Ga0070706_100070395 Ga0070706_1000703955 191
211 3300005468 Ga0070707_100005228 Ga0070707_1000052289 191
212 3300005468 Ga0070707_100213597 Ga0070707_1002135973 191
213 3300005468 Ga0070707_100334705 Ga0070707_1003347052 191
214 3300005468 Ga0070707_101377340 Ga0070707_1013773401 191
215 3300005471 Ga0070698_100007009 Ga0070698_10000700911 191
216 3300005471 Ga0070698_100079633 Ga0070698_1000796333 191
217 3300005471 Ga0070698_100468397 Ga0070698_1004683972 191
218 3300005471 Ga0070698_100526049 Ga0070698_1005260492 191
219 3300005518 Ga0070699_100002144 Ga0070699_1000021445 191
220 3300005518 Ga0070699_100524633 Ga0070699_1005246331 191
221 3300005518 Ga0070699_100852944 Ga0070699_1008529442 191
222 3300005530 Ga0070679_100000014 Ga0070679_10000001470 191
223 3300005530 Ga0070679_100000987 Ga0070679_1000009872 191
224 3300005530 Ga0070679_100001843 Ga0070679_1000018434 191
225 3300005535 Ga0070684_100008223 Ga0070684_1000082238 191
226 3300005535 Ga0070684_100028066 Ga0070684_1000280666 191
227 3300005535 Ga0070684_100153616 Ga0070684_1001536162 191
228 3300005535 Ga0070684_100738581 Ga0070684_1007385811 191
229 3300005536 Ga0070697_100013804 Ga0070697_1000138044 191
230 3300005536 Ga0070697_100152570 Ga0070697_1001525703 191
231 3300005539 Ga0068853_100238053 Ga0068853_1002380532 191
232 3300005543 Ga0070672_100007925 Ga0070672_1000079255 191
233 3300005543 Ga0070672_100011852 Ga0070672_1000118522 191
234 3300005543 Ga0070672_100055053 Ga0070672_1000550534 191
235 3300005543 Ga0070672_100076019 Ga0070672_1000760192 191
236 3300005543 Ga0070672_100123188 Ga0070672_1001231882 191
237 3300005543 Ga0070672_100145879 Ga0070672_1001458793 191
238 3300005544 Ga0070686_100016694 Ga0070686_1000166944 191
239 3300005544 Ga0070686_100031400 Ga0070686_1000314002 191
240 3300005544 Ga0070686_100255781 Ga0070686_1002557812 191
241 3300005545 Ga0070695_100091742 Ga0070695_1000917422 191
242 3300005545 Ga0070695_100342211 Ga0070695_1003422112 191
243 3300005546 Ga0070696_100129364 Ga0070696_1001293643 191
244 3300005546 Ga0070696_100202525 Ga0070696_1002025251 191
245 3300005546 Ga0070696_100218126 Ga0070696_1002181262 191
246 3300005549 Ga0070704_100012361 Ga0070704_1000123618 191
247 3300005549 Ga0070704_100163261 Ga0070704_1001632613 191
248 3300005549 Ga0070704_100164409 Ga0070704_1001644091 191
249 3300005549 Ga0070704_100366317 Ga0070704_1003663172 191
250 3300005549 Ga0070704_100656777 Ga0070704_1006567772 191
251 3300005549 Ga0070704_101314093 Ga0070704_1013140931 191
252 3300005563 Ga0068855_100004734 Ga0068855_10000473416 191
253 3300005563 Ga0068855_100868491 Ga0068855_1008684911 191
254 3300005563 Ga0068855_101155434 Ga0068855_1011554341 191
255 3300005564 Ga0070664_100070619 Ga0070664_1000706193 191
256 3300005577 Ga0068857_100335011 Ga0068857_1003350112 191
257 3300005577 Ga0068857_100395436 Ga0068857_1003954362 191
258 3300005577 Ga0068857_100424577 Ga0068857_1004245771 191
259 3300005578 Ga0068854_100038325 Ga0068854_1000383252 191
260 3300005578 Ga0068854_100041870 Ga0068854_1000418704 191
261 3300005578 Ga0068854_100625077 Ga0068854_1006250771 191
262 3300005614 Ga0068856_100045446 Ga0068856_1000454462 191
263 3300005614 Ga0068856_100066952 Ga0068856_1000669526 191
264 3300005614 Ga0068856_101010529 Ga0068856_1010105291 191
265 3300005615 Ga0070702_100193869 Ga0070702_1001938692 191
266 3300005615 Ga0070702_100217257 Ga0070702_1002172572 191
267 3300005615 Ga0070702_100386709 Ga0070702_1003867091 191
268 3300005615 Ga0070702_100518976 Ga0070702_1005189761 191
269 3300005616 Ga0068852_100000563 Ga0068852_10000056328 191
270 3300005616 Ga0068852_100088798 Ga0068852_1000887981 191
271 3300005616 Ga0068852_100444429 Ga0068852_1004444292 191
272 3300005616 Ga0068852_101226527 Ga0068852_1012265271 191
273 3300005617 Ga0068859_100000018 Ga0068859_100000018211 191
274 3300005617 Ga0068859_100031927 Ga0068859_1000319278 191
275 3300005617 Ga0068859_100061244 Ga0068859_1000612445 191
276 3300005617 Ga0068859_100094970 Ga0068859_1000949702 191
277 3300005617 Ga0068859_100159845 Ga0068859_1001598452 191
278 3300005617 Ga0068859_100225436 Ga0068859_1002254362 191
279 3300005617 Ga0068859_100267365 Ga0068859_1002673652 191
280 3300005617 Ga0068859_100362650 Ga0068859_1003626502 191
281 3300005617 Ga0068859_100393141 Ga0068859_1003931412 191
282 3300005617 Ga0068859_100849020 Ga0068859_1008490201 191
283 3300005617 Ga0068859_100952615 Ga0068859_1009526152 191
284 3300005618 Ga0068864_100004484 Ga0068864_1000044847 191
285 3300005618 Ga0068864_100005259 Ga0068864_1000052598 191
286 3300005618 Ga0068864_100139613 Ga0068864_1001396133 191
287 3300005618 Ga0068864_100357887 Ga0068864_1003578872 191
288 3300005618 Ga0068864_100726306 Ga0068864_1007263061 191
289 3300005718 Ga0068866_10292742 Ga0068866_102927422 191
290 3300005718 Ga0068866_10303026 Ga0068866_103030262 191
291 3300005719 Ga0068861_100004851 Ga0068861_1000048513 191
292 3300005719 Ga0068861_100125526 Ga0068861_1001255262 191
293 3300005719 Ga0068861_100143536 Ga0068861_1001435361 191
294 3300005719 Ga0068861_100196601 Ga0068861_1001966012 191
295 3300005834 Ga0068851_10008388 Ga0068851_100083885 191
296 3300005840 Ga0068870_10010801 Ga0068870_100108012 191
297 3300005840 Ga0068870_10017559 Ga0068870_100175594 191
298 3300005840 Ga0068870_10040937 Ga0068870_100409374 191
299 3300005840 Ga0068870_10046150 Ga0068870_100461502 191
300 3300005840 Ga0068870_10632273 Ga0068870_106322732 191
301 3300005841 Ga0068863_100037369 Ga0068863_1000373692 191
302 3300005841 Ga0068863_100081038 Ga0068863_1000810386 191
303 3300005841 Ga0068863_100134234 Ga0068863_1001342342 191
304 3300005841 Ga0068863_100345488 Ga0068863_1003454881 191
305 3300005841 Ga0068863_100959271 Ga0068863_1009592711 191
306 3300005842 Ga0068858_100010503 Ga0068858_1000105031 191
307 3300005842 Ga0068858_100100704 Ga0068858_1001007042 191
308 3300005842 Ga0068858_100105236 Ga0068858_1001052362 191
309 3300005842 Ga0068858_100416513 Ga0068858_1004165132 191
310 3300005842 Ga0068858_100812407 Ga0068858_1008124072 191
311 3300005842 Ga0068858_101107367 Ga0068858_1011073671 191
312 3300005843 Ga0068860_100008446 Ga0068860_1000084468 191
313 3300005843 Ga0068860_100012313 Ga0068860_1000123132 191
314 3300005843 Ga0068860_100014941 Ga0068860_1000149417 191
315 3300005843 Ga0068860_100053026 Ga0068860_1000530262 191
316 3300005843 Ga0068860_100054834 Ga0068860_1000548342 191
317 3300005843 Ga0068860_100154342 Ga0068860_1001543422 191
318 3300005843 Ga0068860_100161290 Ga0068860_1001612903 191
319 3300005843 Ga0068860_100219257 Ga0068860_1002192572 191
320 3300005843 Ga0068860_100574972 Ga0068860_1005749721 191
321 3300005843 Ga0068860_100643878 Ga0068860_1006438781 191
322 3300005844 Ga0068862_100001370 Ga0068862_1000013701 191
323 3300005844 Ga0068862_100014339 Ga0068862_1000143392 191
324 3300005844 Ga0068862_100023492 Ga0068862_1000234923 191
325 3300005844 Ga0068862_100090826 Ga0068862_1000908263 191
326 3300006028 Ga0070717_10619163 Ga0070717_106191632 191
327 3300006163 Ga0070715_10000028 Ga0070715_1000002835 191
328 3300006173 Ga0070716_100000005 Ga0070716_100000005194 191
329 3300006173 Ga0070716_100161723 Ga0070716_1001617232 191
330 3300006175 Ga0070712_100267126 Ga0070712_1002671262 191
331 3300006195 Ga0075366_10032848 Ga0075366_100328482 191
332 3300006237 Ga0097621_100091812 Ga0097621_1000918122 191
333 3300006237 Ga0097621_100136761 Ga0097621_1001367612 191
334 3300006237 Ga0097621_100342691 Ga0097621_1003426911 191
335 3300006358 Ga0068871_100004123 Ga0068871_1000041236 191
336 3300006358 Ga0068871_100090910 Ga0068871_1000909102 191
337 3300006358 Ga0068871_100101168 Ga0068871_1001011682 191
338 3300006844 Ga0075428_100007407 Ga0075428_10000740711 191
339 3300006844 Ga0075428_100129758 Ga0075428_1001297583 191
340 3300006844 Ga0075428_100141687 Ga0075428_1001416872 191
341 3300006844 Ga0075428_100582134 Ga0075428_1005821341 191
342 3300006846 Ga0075430_100099666 Ga0075430_1000996662 191
343 3300006847 Ga0075431_100012603 Ga0075431_1000126033 191
344 3300006852 Ga0075433_10048333 Ga0075433_100483334 191
345 3300006852 Ga0075433_10489102 Ga0075433_104891021 191
346 3300006852 Ga0075433_10853391 Ga0075433_108533912 191
347 3300006871 Ga0075434_100268818 Ga0075434_1002688181 191
348 3300006871 Ga0075434_100656763 Ga0075434_1006567631 191
349 3300006871 Ga0075434_100884959 Ga0075434_1008849591 191
350 3300006880 Ga0075429_100000099 Ga0075429_10000009930 191
351 3300006880 Ga0075429_100059318 Ga0075429_1000593182 191
352 3300006880 Ga0075429_100117391 Ga0075429_1001173912 191
353 3300006881 Ga0068865_100008550 Ga0068865_1000085504 191
354 3300006881 Ga0068865_100013758 Ga0068865_1000137582 191
355 3300006881 Ga0068865_100100995 Ga0068865_1001009953 191
356 3300006881 Ga0068865_100617393 Ga0068865_1006173932 191
357 3300006914 Ga0075436_100000009 Ga0075436_100000009197 191
358 3300006914 Ga0075436_100008218 Ga0075436_1000082185 191
359 3300006914 Ga0075436_100088294 Ga0075436_1000882944 191
360 3300006931 Ga0097620_100000018 Ga0097620_100000018211 191
361 3300006931 Ga0097620_100031929 Ga0097620_1000319292 191
362 3300006931 Ga0097620_100061249 Ga0097620_1000612492 191
363 3300006931 Ga0097620_100094968 Ga0097620_1000949682 191
364 3300006931 Ga0097620_100159852 Ga0097620_1001598522 191
365 3300006931 Ga0097620_100225430 Ga0097620_1002254302 191
366 3300006931 Ga0097620_100267358 Ga0097620_1002673582 191
367 3300006931 Ga0097620_100362629 Ga0097620_1003626292 191
368 3300006931 Ga0097620_100393140 Ga0097620_1003931402 191
369 3300006931 Ga0097620_100849054 Ga0097620_1008490541 191
370 3300006931 Ga0097620_100952649 Ga0097620_1009526492 191
371 3300007265 Ga0099794_10007400 Ga0099794_100074005 191
372 3300007265 Ga0099794_10024770 Ga0099794_100247704 191
373 3300009093 Ga0105240_10391872 Ga0105240_103918723 191
374 3300009093 Ga0105240_10991685 Ga0105240_109916852 191
375 3300009094 Ga0111539_10001405 Ga0111539_1000140511 191
376 3300009094 Ga0111539_10012287 Ga0111539_100122875 191
377 3300009094 Ga0111539_10022883 Ga0111539_100228832 191
378 3300009094 Ga0111539_10153083 Ga0111539_101530832 191
379 3300009094 Ga0111539_10738163 Ga0111539_107381631 191
380 3300009098 Ga0105245_10030971 Ga0105245_100309713 191
381 3300009098 Ga0105245_10181432 Ga0105245_101814322 191
382 3300009098 Ga0105245_10199308 Ga0105245_101993082 191
383 3300009098 Ga0105245_10249468 Ga0105245_102494683 191
384 3300009098 Ga0105245_10595234 Ga0105245_105952341 191
385 3300009101 Ga0105247_10003256 Ga0105247_100032563 191
386 3300009101 Ga0105247_10164183 Ga0105247_101641831 191
387 3300009147 Ga0114129_10021342 Ga0114129_100213421 191
388 3300009147 Ga0114129_10042905 Ga0114129_100429056 191
389 3300009147 Ga0114129_10119091 Ga0114129_101190913 191
390 3300009147 Ga0114129_10354293 Ga0114129_103542931 191
391 3300009147 Ga0114129_10374980 Ga0114129_103749802 191
392 3300009147 Ga0114129_10396784 Ga0114129_103967841 191
393 3300009147 Ga0114129_10693730 Ga0114129_106937301 191
394 3300009148 Ga0105243_10007346 Ga0105243_100073465 191
395 3300009148 Ga0105243_10069470 Ga0105243_100694702 191
396 3300009148 Ga0105243_10363846 Ga0105243_103638462 191
397 3300009148 Ga0105243_10990641 Ga0105243_109906411 191
398 3300009174 Ga0105241_10083558 Ga0105241_100835582 191
399 3300009174 Ga0105241_10102449 Ga0105241_101024491 191
400 3300009174 Ga0105241_10593789 Ga0105241_105937892 191
401 3300009174 Ga0105241_10715034 Ga0105241_107150341 191
402 3300009176 Ga0105242_10460870 Ga0105242_104608702 191
403 3300009177 Ga0105248_10141453 Ga0105248_101414536 191
404 3300009177 Ga0105248_10158725 Ga0105248_101587252 191
405 3300009177 Ga0105248_10242162 Ga0105248_102421622 191
406 3300009177 Ga0105248_10267197 Ga0105248_102671971 191
407 3300009177 Ga0105248_10307787 Ga0105248_103077872 191
408 3300009545 Ga0105237_10089716 Ga0105237_100897162 191
409 3300009545 Ga0105237_10210845 Ga0105237_102108452 191
410 3300009545 Ga0105237_10789816 Ga0105237_107898162 191
411 3300009551 Ga0105238_10118922 Ga0105238_101189223 191
412 3300009553 Ga0105249_10013548 Ga0105249_100135485 191
413 3300009553 Ga0105249_10045782 Ga0105249_100457821 191
414 3300009553 Ga0105249_10049971 Ga0105249_100499712 191
415 3300009553 Ga0105249_10114617 Ga0105249_101146173 191
416 3300009553 Ga0105249_10203924 Ga0105249_102039242 191
417 3300010375 Ga0105239_10000469 Ga0105239_1000046919 191
418 3300010375 Ga0105239_10368613 Ga0105239_103686133 191
419 3300010375 Ga0105239_10547953 Ga0105239_105479532 191
420 3300010375 Ga0105239_12012040 Ga0105239_120120401 191
421 3300011119 Ga0105246_10021665 Ga0105246_100216656 191
422 3300011119 Ga0105246_10038224 Ga0105246_100382242 191
423 3300011119 Ga0105246_10430279 Ga0105246_104302792 191
424 3300011119 Ga0105246_10517681 Ga0105246_105176812 191
425 3300011119 Ga0105246_10559770 Ga0105246_105597701 191
426 3300011119 Ga0105246_10748498 Ga0105246_107484982 191
427 3300013100 Ga0157373_10128242 Ga0157373_101282422 191
428 3300013100 Ga0157373_10368110 Ga0157373_103681101 191
429 3300013100 Ga0157373_10527167 Ga0157373_105271672 191
430 3300013102 Ga0157371_10002120 Ga0157371_1000212018 191
431 3300013102 Ga0157371_10040887 Ga0157371_100408873 191
432 3300013104 Ga0157370_10040765 Ga0157370_100407654 191
433 3300013104 Ga0157370_10280425 Ga0157370_102804252 191
434 3300013105 Ga0157369_10015970 Ga0157369_100159702 191
435 3300013296 Ga0157374_10393475 Ga0157374_103934751 191
436 3300013296 Ga0157374_10499916 Ga0157374_104999162 191
437 3300013296 Ga0157374_10538585 Ga0157374_105385852 191
438 3300013296 Ga0157374_10817194 Ga0157374_108171941 191
439 3300013297 Ga0157378_10004869 Ga0157378_1000486911 191
440 3300013297 Ga0157378_10021654 Ga0157378_100216543 191
441 3300013297 Ga0157378_10307030 Ga0157378_103070302 191
442 3300013306 Ga0163162_10006632 Ga0163162_100066326 191
443 3300013306 Ga0163162_10125034 Ga0163162_101250343 191
444 3300013306 Ga0163162_10213745 Ga0163162_102137452 191
445 3300013306 Ga0163162_10233792 Ga0163162_102337923 191
446 3300013306 Ga0163162_10442933 Ga0163162_104429331 191
447 3300013306 Ga0163162_10586084 Ga0163162_105860842 191
448 3300013307 Ga0157372_10011389 Ga0157372_100113898 191
449 3300013307 Ga0157372_10123962 Ga0157372_101239623 191
450 3300013307 Ga0157372_10147935 Ga0157372_101479352 191
451 3300013307 Ga0157372_11259607 Ga0157372_112596071 191
452 3300013308 Ga0157375_10000277 Ga0157375_1000027736 191
453 3300013308 Ga0157375_10014916 Ga0157375_100149163 191
454 3300013308 Ga0157375_10033271 Ga0157375_100332715 191
455 3300013308 Ga0157375_10049252 Ga0157375_100492522 191
456 3300013308 Ga0157375_10523581 Ga0157375_105235812 191
457 3300013308 Ga0157375_11448910 Ga0157375_114489102 191
458 3300014325 Ga0163163_10092286 Ga0163163_100922863 191
459 3300014325 Ga0163163_10207609 Ga0163163_102076092 191
460 3300014325 Ga0163163_10319854 Ga0163163_103198542 191
461 3300014325 Ga0163163_10403009 Ga0163163_104030092 191
462 3300014325 Ga0163163_10948460 Ga0163163_109484602 191
463 3300014325 Ga0163163_11055166 Ga0163163_110551662 191
464 3300014326 Ga0157380_10004791 Ga0157380_100047912 191
465 3300014326 Ga0157380_10007392 Ga0157380_100073922 191
466 3300014326 Ga0157380_10018186 Ga0157380_100181865 191
467 3300014326 Ga0157380_10018458 Ga0157380_100184584 191
468 3300014326 Ga0157380_10379855 Ga0157380_103798551 191
469 3300014745 Ga0157377_10226927 Ga0157377_102269272 191
470 3300014968 Ga0157379_10021797 Ga0157379_100217973 191
471 3300014968 Ga0157379_10083800 Ga0157379_100838002 191
472 3300014968 Ga0157379_10437484 Ga0157379_104374842 191
473 3300014968 Ga0157379_11092679 Ga0157379_110926791 191
474 3300014969 Ga0157376_10005294 Ga0157376_100052944 191
475 3300014969 Ga0157376_10057141 Ga0157376_100571412 191
476 3300014969 Ga0157376_10317663 Ga0157376_103176633 191
477 3300014969 Ga0157376_10431311 Ga0157376_104313112 191
478 3300017792 Ga0163161_10024589 Ga0163161_100245894 191
479 3300017792 Ga0163161_10123774 Ga0163161_101237742 191
480 3300021388 Ga0213875_10000066 Ga0213875_1000006621 191
481 3300024225 Ga0224572_1027221 Ga0224572_10272211 191
482 3300025271 Ga0207666_1013846 Ga0207666_10138462 191
483 3300025315 Ga0207697_10015842 Ga0207697_100158422 191
484 3300025315 Ga0207697_10051119 Ga0207697_100511192 191
485 3300025315 Ga0207697_10119867 Ga0207697_101198672 191
486 3300025898 Ga0207692_10257140 Ga0207692_102571402 191
487 3300025899 Ga0207642_10009995 Ga0207642_100099953 191
488 3300025900 Ga0207710_10012977 Ga0207710_100129772 191
489 3300025903 Ga0207680_10000026 Ga0207680_1000002644 191
490 3300025903 Ga0207680_10080291 Ga0207680_100802912 191
491 3300025905 Ga0207685_10000023 Ga0207685_1000002335 191
492 3300025905 Ga0207685_10159805 Ga0207685_101598052 191
493 3300025907 Ga0207645_10033456 Ga0207645_100334563 191
494 3300025907 Ga0207645_10045536 Ga0207645_100455365 191
495 3300025907 Ga0207645_10113813 Ga0207645_101138132 191
496 3300025908 Ga0207643_10007761 Ga0207643_100077615 191
497 3300025908 Ga0207643_10015988 Ga0207643_100159884 191
498 3300025908 Ga0207643_10024274 Ga0207643_100242743 191
499 3300025909 Ga0207705_10018748 Ga0207705_100187481 191
500 3300025909 Ga0207705_10058112 Ga0207705_100581123 191
501 3300025909 Ga0207705_10103501 Ga0207705_101035012 191
502 3300025910 Ga0207684_10184370 Ga0207684_101843702 191
503 3300025911 Ga0207654_10017779 Ga0207654_100177793 191
504 3300025911 Ga0207654_10204747 Ga0207654_102047472 191
505 3300025912 Ga0207707_10000016 Ga0207707_10000016152 191
506 3300025912 Ga0207707_10043354 Ga0207707_100433543 191
507 3300025913 Ga0207695_10002632 Ga0207695_1000263216 191
508 3300025913 Ga0207695_10007786 Ga0207695_100077868 191
509 3300025913 Ga0207695_10046004 Ga0207695_100460044 191
510 3300025913 Ga0207695_10254956 Ga0207695_102549561 191
511 3300025913 Ga0207695_10332193 Ga0207695_103321931 191
512 3300025914 Ga0207671_10016462 Ga0207671_100164622 191
513 3300025914 Ga0207671_10132108 Ga0207671_101321082 191
514 3300025914 Ga0207671_10264501 Ga0207671_102645011 191
515 3300025916 Ga0207663_10019437 Ga0207663_100194372 191
516 3300025916 Ga0207663_10197483 Ga0207663_101974832 191
517 3300025917 Ga0207660_10000079 Ga0207660_1000007929 191
518 3300025917 Ga0207660_10017505 Ga0207660_100175057 191
519 3300025917 Ga0207660_10050450 Ga0207660_100504502 191
520 3300025917 Ga0207660_10157918 Ga0207660_101579182 191
521 3300025918 Ga0207662_10020201 Ga0207662_100202012 191
522 3300025918 Ga0207662_10029348 Ga0207662_100293482 191
523 3300025918 Ga0207662_10051449 Ga0207662_100514493 191
524 3300025918 Ga0207662_10093187 Ga0207662_100931871 191
525 3300025919 Ga0207657_10501511 Ga0207657_105015112 191
526 3300025920 Ga0207649_10221292 Ga0207649_102212922 191
527 3300025920 Ga0207649_10718163 Ga0207649_107181632 191
528 3300025920 Ga0207649_10806423 Ga0207649_108064232 191
529 3300025921 Ga0207652_10000126 Ga0207652_1000012672 191
530 3300025921 Ga0207652_10001189 Ga0207652_100011896 191
531 3300025921 Ga0207652_10001467 Ga0207652_1000146714 191
532 3300025921 Ga0207652_10078720 Ga0207652_100787201 191
533 3300025922 Ga0207646_10001755 Ga0207646_100017556 191
534 3300025922 Ga0207646_10641288 Ga0207646_106412882 191
535 3300025923 Ga0207681_10007311 Ga0207681_100073118 191
536 3300025923 Ga0207681_10016199 Ga0207681_100161995 191
537 3300025923 Ga0207681_10095493 Ga0207681_100954932 191
538 3300025923 Ga0207681_10099304 Ga0207681_100993042 191
539 3300025923 Ga0207681_10573224 Ga0207681_105732242 191
540 3300025924 Ga0207694_10087008 Ga0207694_100870083 191
541 3300025924 Ga0207694_10135101 Ga0207694_101351012 191
542 3300025925 Ga0207650_10009261 Ga0207650_100092618 191
543 3300025925 Ga0207650_10028897 Ga0207650_100288972 191
544 3300025925 Ga0207650_10077348 Ga0207650_100773483 191
545 3300025926 Ga0207659_10015083 Ga0207659_100150838 191
546 3300025926 Ga0207659_10099913 Ga0207659_100999132 191
547 3300025926 Ga0207659_10198842 Ga0207659_101988422 191
548 3300025927 Ga0207687_10137164 Ga0207687_101371642 191
549 3300025927 Ga0207687_10384391 Ga0207687_103843912 191
550 3300025927 Ga0207687_10390981 Ga0207687_103909811 191
551 3300025927 Ga0207687_10527064 Ga0207687_105270642 191
552 3300025928 Ga0207700_10148785 Ga0207700_101487851 191
553 3300025929 Ga0207664_10065302 Ga0207664_100653024 191
554 3300025931 Ga0207644_10059615 Ga0207644_100596154 191
555 3300025931 Ga0207644_10199918 Ga0207644_101999182 191
556 3300025931 Ga0207644_10428572 Ga0207644_104285722 191
557 3300025933 Ga0207706_10099379 Ga0207706_100993792 191
558 3300025933 Ga0207706_10136534 Ga0207706_101365342 191
559 3300025933 Ga0207706_10266770 Ga0207706_102667702 191
560 3300025933 Ga0207706_10298137 Ga0207706_102981372 191
561 3300025934 Ga0207686_10117237 Ga0207686_101172372 191
562 3300025935 Ga0207709_10081600 Ga0207709_100816001 191
563 3300025936 Ga0207670_10008737 Ga0207670_100087372 191
564 3300025936 Ga0207670_10195508 Ga0207670_101955082 191
565 3300025936 Ga0207670_10259357 Ga0207670_102593572 191
566 3300025936 Ga0207670_10331897 Ga0207670_103318972 191
567 3300025937 Ga0207669_10917376 Ga0207669_109173761 191
568 3300025938 Ga0207704_10037543 Ga0207704_100375432 191
569 3300025938 Ga0207704_10186020 Ga0207704_101860202 191
570 3300025938 Ga0207704_10294051 Ga0207704_102940511 191
571 3300025939 Ga0207665_10000017 Ga0207665_1000001727 191
572 3300025940 Ga0207691_10000594 Ga0207691_100005942 191
573 3300025940 Ga0207691_10003897 Ga0207691_1000389727 191
574 3300025940 Ga0207691_10049987 Ga0207691_100499874 191
575 3300025940 Ga0207691_10051610 Ga0207691_100516103 191
576 3300025940 Ga0207691_10074874 Ga0207691_100748742 191
577 3300025940 Ga0207691_10138386 Ga0207691_101383864 191
578 3300025940 Ga0207691_10382880 Ga0207691_103828802 191
579 3300025941 Ga0207711_10000721 Ga0207711_1000072128 191
580 3300025941 Ga0207711_10051610 Ga0207711_100516104 191
581 3300025941 Ga0207711_10091975 Ga0207711_100919755 191
582 3300025941 Ga0207711_10098208 Ga0207711_100982084 191
583 3300025941 Ga0207711_10359143 Ga0207711_103591432 191
584 3300025941 Ga0207711_10529258 Ga0207711_105292581 191
585 3300025941 Ga0207711_10562419 Ga0207711_105624192 191
586 3300025942 Ga0207689_10001176 Ga0207689_100011763 191
587 3300025942 Ga0207689_10013959 Ga0207689_100139595 191
588 3300025942 Ga0207689_10045396 Ga0207689_100453966 191
589 3300025942 Ga0207689_10057302 Ga0207689_100573023 191
590 3300025942 Ga0207689_10410248 Ga0207689_104102482 191
591 3300025944 Ga0207661_10070344 Ga0207661_100703442 191
592 3300025944 Ga0207661_10157316 Ga0207661_101573162 191
593 3300025944 Ga0207661_10229512 Ga0207661_102295121 191
594 3300025944 Ga0207661_10521957 Ga0207661_105219572 191
595 3300025945 Ga0207679_10104137 Ga0207679_101041374 191
596 3300025949 Ga0207667_10207773 Ga0207667_102077731 191
597 3300025960 Ga0207651_10023087 Ga0207651_100230872 191
598 3300025960 Ga0207651_10024485 Ga0207651_100244852 191
599 3300025960 Ga0207651_10053646 Ga0207651_100536463 191
600 3300025960 Ga0207651_10089104 Ga0207651_100891044 191
601 3300025960 Ga0207651_10167274 Ga0207651_101672742 191
602 3300025960 Ga0207651_10208490 Ga0207651_102084902 191
603 3300025960 Ga0207651_10534800 Ga0207651_105348002 191
604 3300025960 Ga0207651_10617164 Ga0207651_106171641 191
605 3300025960 Ga0207651_10921762 Ga0207651_109217621 191
606 3300025961 Ga0207712_10063517 Ga0207712_100635171 191
607 3300025961 Ga0207712_10086455 Ga0207712_100864552 191
608 3300025961 Ga0207712_10120984 Ga0207712_101209842 191
609 3300025961 Ga0207712_10124954 Ga0207712_101249543 191
610 3300025972 Ga0207668_10027609 Ga0207668_100276095 191
611 3300025972 Ga0207668_10250477 Ga0207668_102504772 191
612 3300025972 Ga0207668_10285306 Ga0207668_102853062 191
613 3300025981 Ga0207640_10022067 Ga0207640_100220673 191
614 3300025981 Ga0207640_10197829 Ga0207640_101978291 191
615 3300025981 Ga0207640_10212509 Ga0207640_102125092 191
616 3300025981 Ga0207640_10344166 Ga0207640_103441662 191
617 3300025986 Ga0207658_10008660 Ga0207658_100086607 191
618 3300025986 Ga0207658_10193385 Ga0207658_101933851 191
619 3300025986 Ga0207658_10264806 Ga0207658_102648061 191
620 3300026023 Ga0207677_10035821 Ga0207677_100358212 191
621 3300026023 Ga0207677_10052878 Ga0207677_100528782 191
622 3300026023 Ga0207677_10100828 Ga0207677_101008283 191
623 3300026023 Ga0207677_10122851 Ga0207677_101228512 191
624 3300026023 Ga0207677_10219234 Ga0207677_102192342 191
625 3300026023 Ga0207677_10329699 Ga0207677_103296992 191
626 3300026023 Ga0207677_10971601 Ga0207677_109716011 191
627 3300026035 Ga0207703_10004551 Ga0207703_100045515 191
628 3300026035 Ga0207703_10019889 Ga0207703_100198895 191
629 3300026035 Ga0207703_10245381 Ga0207703_102453812 191
630 3300026035 Ga0207703_11568638 Ga0207703_115686381 191
631 3300026041 Ga0207639_10027552 Ga0207639_100275523 191
632 3300026041 Ga0207639_10061339 Ga0207639_100613392 191
633 3300026041 Ga0207639_11346662 Ga0207639_113466621 191
634 3300026075 Ga0207708_10099654 Ga0207708_100996541 191
635 3300026075 Ga0207708_10120090 Ga0207708_101200903 191
636 3300026078 Ga0207702_10102609 Ga0207702_101026093 191
637 3300026078 Ga0207702_10161665 Ga0207702_101616651 191
638 3300026088 Ga0207641_10000167 Ga0207641_1000016753 191
639 3300026088 Ga0207641_10028444 Ga0207641_100284442 191
640 3300026088 Ga0207641_10038609 Ga0207641_100386093 191
641 3300026088 Ga0207641_10049850 Ga0207641_100498502 191
642 3300026088 Ga0207641_10231802 Ga0207641_102318023 191
643 3300026089 Ga0207648_10009103 Ga0207648_100091036 191
644 3300026089 Ga0207648_10010832 Ga0207648_1001083210 191
645 3300026089 Ga0207648_10054277 Ga0207648_100542774 191
646 3300026089 Ga0207648_10131333 Ga0207648_101313333 191
647 3300026095 Ga0207676_10000992 Ga0207676_100009927 191
648 3300026095 Ga0207676_10006875 Ga0207676_100068757 191
649 3300026095 Ga0207676_10007550 Ga0207676_100075503 191
650 3300026095 Ga0207676_10071490 Ga0207676_100714902 191
651 3300026095 Ga0207676_10074099 Ga0207676_100740991 191
652 3300026095 Ga0207676_10114610 Ga0207676_101146102 191
653 3300026095 Ga0207676_10352948 Ga0207676_103529481 191
654 3300026116 Ga0207674_10000454 Ga0207674_100004544 191
655 3300026116 Ga0207674_10013502 Ga0207674_100135025 191
656 3300026116 Ga0207674_10194377 Ga0207674_101943772 191
657 3300026116 Ga0207674_10224884 Ga0207674_102248842 191
658 3300026118 Ga0207675_100000594 Ga0207675_10000059418 191
659 3300026118 Ga0207675_100008267 Ga0207675_10000826718 191
660 3300026118 Ga0207675_100046173 Ga0207675_1000461732 191
661 3300026118 Ga0207675_100087097 Ga0207675_1000870975 191
662 3300026118 Ga0207675_100719580 Ga0207675_1007195801 191
663 3300026118 Ga0207675_100962859 Ga0207675_1009628592 191
664 3300026121 Ga0207683_10203262 Ga0207683_102032621 191
665 3300026121 Ga0207683_10269912 Ga0207683_102699122 191
666 3300026121 Ga0207683_10306134 Ga0207683_103061341 191
667 3300026142 Ga0207698_10041298 Ga0207698_100412985 191
668 3300026142 Ga0207698_10167275 Ga0207698_101672751 191
669 3300026142 Ga0207698_10210632 Ga0207698_102106321 191
670 3300026142 Ga0207698_10677490 Ga0207698_106774902 191
671 3300027378 Ga0209981_1029963 Ga0209981_10299632 191
672 3300027671 Ga0209588_1001752 Ga0209588_10017525 191
673 3300027907 Ga0207428_10158543 Ga0207428_101585432 191
674 3300028379 Ga0268266_10000088 Ga0268266_1000008876 191
675 3300028380 Ga0268265_10034020 Ga0268265_100340203 191
676 3300028380 Ga0268265_10046160 Ga0268265_100461602 191
677 3300028380 Ga0268265_10521294 Ga0268265_105212941 191
678 3300028380 Ga0268265_10532441 Ga0268265_105324412 191
679 3300028381 Ga0268264_10007287 Ga0268264_100072872 191
680 3300028381 Ga0268264_10013625 Ga0268264_100136252 191
681 3300028381 Ga0268264_10014801 Ga0268264_100148011 191
682 3300028381 Ga0268264_10024262 Ga0268264_100242625 191
683 3300028381 Ga0268264_10061513 Ga0268264_100615132 191
684 3300028381 Ga0268264_10061901 Ga0268264_100619013 191
685 3300028381 Ga0268264_10064096 Ga0268264_100640965 191
686 3300028381 Ga0268264_10119274 Ga0268264_101192742 191
687 3300028381 Ga0268264_10120617 Ga0268264_101206172 191
688 3300028556 Ga0265337_1004481 Ga0265337_10044816 191
689 3300028556 Ga0265337_1014316 Ga0265337_10143164 191
690 3300028563 Ga0265319_1000297 Ga0265319_100029727 191
691 3300028573 Ga0265334_10001759 Ga0265334_100017597 191
692 3300028573 Ga0265334_10072004 Ga0265334_100720042 191
693 3300028577 Ga0265318_10000045 Ga0265318_1000004560 191
694 3300028577 Ga0265318_10006110 Ga0265318_100061107 191
695 3300028666 Ga0265336_10000194 Ga0265336_1000019433 191
696 3300028666 Ga0265336_10136161 Ga0265336_101361611 191
697 3300028794 Ga0307515_10088846 Ga0307515_100888466 191
698 3300028800 Ga0265338_10000273 Ga0265338_1000027327 191
699 3300028800 Ga0265338_10002518 Ga0265338_100025186 191
700 3300028800 Ga0265338_10070056 Ga0265338_100700563 191
701 3300029957 Ga0265324_10000013 Ga0265324_1000001357 191
702 3300029957 Ga0265324_10011238 Ga0265324_100112385 191
703 3300029957 Ga0265324_10022786 Ga0265324_100227863 191
704 3300031090 Ga0265760_10005102 Ga0265760_100051024 191
705 3300031235 Ga0265330_10000023 Ga0265330_10000023123 191
706 3300031238 Ga0265332_10000040 Ga0265332_100000408 191
707 3300031238 Ga0265332_10026189 Ga0265332_100261891 191
708 3300031238 Ga0265332_10092026 Ga0265332_100920262 191
709 3300031239 Ga0265328_10015993 Ga0265328_100159932 191
710 3300031240 Ga0265320_10000022 Ga0265320_1000002239 191
711 3300031240 Ga0265320_10000494 Ga0265320_100004947 191
712 3300031240 Ga0265320_10364122 Ga0265320_103641221 191
713 3300031241 Ga0265325_10042944 Ga0265325_100429445 191
714 3300031242 Ga0265329_10026242 Ga0265329_100262423 191
715 3300031247 Ga0265340_10023753 Ga0265340_100237533 191
716 3300031249 Ga0265339_10058958 Ga0265339_100589582 191
717 3300031249 Ga0265339_10173091 Ga0265339_101730912 191
718 3300031250 Ga0265331_10000001 Ga0265331_10000001576 191
719 3300031250 Ga0265331_10064464 Ga0265331_100644642 191
720 3300031250 Ga0265331_10108435 Ga0265331_101084352 191
721 3300031251 Ga0265327_10000426 Ga0265327_100004268 191
722 3300031344 Ga0265316_10001556 Ga0265316_1000155616 191
723 3300031344 Ga0265316_10024131 Ga0265316_100241316 191
724 3300031344 Ga0265316_10214381 Ga0265316_102143813 191
725 3300031344 Ga0265316_10291342 Ga0265316_102913422 191
726 3300031548 Ga0307408_100015226 Ga0307408_1000152262 191
727 3300031595 Ga0265313_10000018 Ga0265313_10000018120 191
728 3300031595 Ga0265313_10002159 Ga0265313_100021593 191
729 3300031665 Ga0316575_10011634 Ga0316575_100116343 191
730 3300031691 Ga0316579_10012325 Ga0316579_100123252 191
731 3300031711 Ga0265314_10000006 Ga0265314_1000000668 191
732 3300031711 Ga0265314_10008212 Ga0265314_100082128 191
733 3300031711 Ga0265314_10093905 Ga0265314_100939052 191
734 3300031711 Ga0265314_10128497 Ga0265314_101284972 191
735 3300031712 Ga0265342_10007381 Ga0265342_100073814 191
736 3300031712 Ga0265342_10014422 Ga0265342_100144225 191
737 3300031727 Ga0316576_10024142 Ga0316576_100241422 191
738 3300031728 Ga0316578_10005251 Ga0316578_100052515 191
739 3300031733 Ga0316577_10009514 Ga0316577_100095144 191
740 3300031995 Ga0307409_100118493 Ga0307409_1001184932 191
741 3300032002 Ga0307416_100181409 Ga0307416_1001814092 191
742 3300032002 Ga0307416_100578416 Ga0307416_1005784162 191
743 3300032004 Ga0307414_10025626 Ga0307414_100256263 191
744 3300032004 Ga0307414_10031339 Ga0307414_100313394 191
745 3300032005 Ga0307411_10326559 Ga0307411_103265592 191
746 3300032139 Ga0316580_10000633 Ga0316580_100006334 191
747 3300033524 Ga0316592_1105039 Ga0316592_11050391 191
748 3300035119 Ga0373956_0021341 Ga0373956_0021341_627_1202 191
749 3300035170 Ga0373943_0431794 Ga0373943_0431794_47_622 191
750 3300035171 Ga0373946_0030639 Ga0373946_0030639_1060_1635 191
751 3300035172 Ga0373955_0020220 Ga0373955_0020220_2454_3029 191
752 3300035398 Ga0316574_0033312 Ga0316574_0033312_418_993 191
753 3300035691 Ga0373931_0065013 Ga0373931_0065013_1034_1609 191
754 3300035691 Ga0373931_0076780 Ga0373931_0076780_585_1169 191
755 3300035724 Ga0373933_0216268 Ga0373933_0216268_303_917 191
756 3300036401 Ga0373937_0129582 Ga0373937_0129582_1185_1799 191
757 3300036401 Ga0373937_0651921 Ga0373937_0651921_48_638 191
758 3300036647 Ga0316582_0011550 Ga0316582_0011550_2548_3123 191
759 3300036712 Ga0316584_0101297 Ga0316584_0101297_533_1108 191
760 3300037068 Ga0373925_0015234 Ga0373925_0015234_3777_4352 191
761 3300037466 Ga0395898_0544070 Ga0395898_0544070_356_934 191
762 3300037471 Ga0395905_0107621 Ga0395905_0107621_276_854 191
763 3300037471 Ga0395905_0493689 Ga0395905_0493689_22_609 191
764 3300037588 Ga0316581_0000048 Ga0316581_0000048_2563_3138 191
765 3300037853 Ga0436364_0079644 Ga0436364_0079644_22971_23564 191
766 3300037853 Ga0436364_0354394 Ga0436364_0354394_66_668 191
767 3300037853 Ga0436364_0764741 Ga0436364_0764741_767_1351 191
768 3300037853 Ga0436364_0815975 Ga0436364_0815975_733_1344 191
769 3300037853 Ga0436364_1367354 Ga0436364_1367354_588_1190 191
770 3300037853 Ga0436364_1506799 Ga0436364_1506799_2035_2610 191
771 3300039437 Ga0436365_0861631 Ga0436365_0861631_3420_4031 191
772 3300039450 Ga0436363_0543025 Ga0436363_0543025_59_670 191
773 3300039450 Ga0436363_0549965 Ga0436363_0549965_52_654 191
774 3300039450 Ga0436363_0589199 Ga0436363_0589199_222_827 191
775 3300041411 Ga0439466_0068944 Ga0439466_0068944_134_733 191
776 3300041486 Ga0451807_0610239 Ga0451807_0610239_263_847 191
777 3300041501 Ga0451845_0935863 Ga0451845_0935863_293_877 191
778 3300042007 Ga0439449_0018604 Ga0439449_0018604_376_975 191
779 3300042128 Ga0450897_007139 Ga0450897_007139_258_851 191
780 3300042435 Ga0439434_0015100 Ga0439434_0015100_520_1119 191
781 3300042876 Ga0451577_0118834 Ga0451577_0118834_997_1572 191
782 3300044673 Ga0453683_0105437 Ga0453683_0105437_118_705 191
783 3300044694 Ga0466963_0300837 Ga0466963_0300837_146_736 191
784 3300044706 Ga0466964_0080747 Ga0466964_0080747_315_899 191
785 3300044712 Ga0453684_0014309 Ga0453684_0014309_7565_8173 191
786 3300044712 Ga0453684_0037782 Ga0453684_0037782_909_1484 191
787 3300044712 Ga0453684_0078632 Ga0453684_0078632_1957_2565 191
788 3300044712 Ga0453684_0212442 Ga0453684_0212442_301_876 191
789 3300044712 Ga0453684_0438993 Ga0453684_0438993_374_949 191
790 3300044712 Ga0453684_0614798 Ga0453684_0614798_307_882 191
791 3300044842 Ga0466957_0556086 Ga0466957_0556086_164_787 191
792 3300045049 Ga0466959_0021949 Ga0466959_0021949_2743_3381 191
793 3300045051 Ga0451576_0023531 Ga0451576_0023531_5888_6463 191
794 3300045051 Ga0451576_0775211 Ga0451576_0775211_319_912 191
795 3300045051 Ga0451576_0812589 Ga0451576_0812589_122_709 191
796 3300046454 Ga0495592_0040018 Ga0495592_0040018_2182_2763 191
797 3300046463 Ga0495653_0000035 Ga0495653_0000035_34279_34854 191
798 3300046463 Ga0495653_0223216 Ga0495653_0223216_372_947 191
799 3300046471 Ga0495650_0014587 Ga0495650_0014587_1772_2347 191
800 3300046472 Ga0495580_0081182 Ga0495580_0081182_403_984 191
801 3300046476 Ga0495662_0013922 Ga0495662_0013922_2793_3374 191
802 3300046499 Ga0495594_0027028 Ga0495594_0027028_19_600 191
803 3300046499 Ga0495594_0229656 Ga0495594_0229656_346_921 191
804 3300046507 Ga0495606_0000512 Ga0495606_0000512_38193_38768 191
805 3300046514 Ga0495618_0056940 Ga0495618_0056940_1015_1596 191
806 3300046642 Ga0495634_0096519 Ga0495634_0096519_425_1006 191
807 3300046674 Ga0495588_0046713 Ga0495588_0046713_973_1554 191
808 3300046678 Ga0495599_0008979 Ga0495599_0008979_1645_2226 191
809 3300046689 Ga0495613_0044931 Ga0495613_0044931_140_721 191
810 3300046690 Ga0495624_0284016 Ga0495624_0284016_16_600 191
811 3300046692 Ga0495671_0000005 Ga0495671_0000005_242212_242787 191
812 3300047317 Ga0495604_0130923 Ga0495604_0130923_894_1475 191
813 3300047319 Ga0495674_0023447 Ga0495674_0023447_2933_3508 191
814 3300047319 Ga0495674_0116362 Ga0495674_0116362_1284_1865 191
815 3300047319 Ga0495674_0147007 Ga0495674_0147007_300_881 191
816 3300047444 Ga0495675_0084671 Ga0495675_0084671_1009_1683 191
817 3300047469 Ga0495673_0000012 Ga0495673_0000012_434663_435244 191
818 3300047471 Ga0495684_0062255 Ga0495684_0062255_1430_2011 191
819 3300047471 Ga0495684_0062389 Ga0495684_0062389_1471_2052 191
820 3300047472 Ga0495686_0161910 Ga0495686_0161910_331_915 191
821 3300048903 Ga0496100_0286203 Ga0496100_0286203_532_1116 191
822 3300048906 Ga0496103_0070932 Ga0496103_0070932_355_942 191
823 3300048907 Ga0496104_0003103 Ga0496104_0003103_8607_9191 191
824 3300048907 Ga0496104_0025034 Ga0496104_0025034_1878_2465 191
825 3300048907 Ga0496104_0597651 Ga0496104_0597651_357_941 191
826 3300048908 Ga0496105_0005857 Ga0496105_0005857_5545_6129 191
827 3300048909 Ga0496106_0111339 Ga0496106_0111339_145_732 191
828 3300048909 Ga0496106_0317353 Ga0496106_0317353_357_941 191
829 3300048909 Ga0496106_0911339 Ga0496106_0911339_77_661 191
830 3300048911 Ga0496108_0019732 Ga0496108_0019732_3946_4530 191
831 3300048912 Ga0496109_0481941 Ga0496109_0481941_561_1148 191
832 3300048913 Ga0496110_0008210 Ga0496110_0008210_7386_7970 191
833 3300048913 Ga0496110_0551343 Ga0496110_0551343_271_849 191
834 3300048913 Ga0496110_0890432 Ga0496110_0890432_200_784 191
835 3300048914 Ga0496111_0058388 Ga0496111_0058388_1309_1893 191
836 3300048915 Ga0496112_0058302 Ga0496112_0058302_117_704 191
837 3300048915 Ga0496112_0094967 Ga0496112_0094967_1525_2100 191
838 3300048915 Ga0496112_0873277 Ga0496112_0873277_99_785 191
839 3300048917 Ga0496114_0074194 Ga0496114_0074194_1532_2116 191
840 3300048917 Ga0496114_0081551 Ga0496114_0081551_1203_1787 191
841 3300048929 Ga0496126_0012839 Ga0496126_0012839_5762_6394 191
842 3300049570 Ga0501033_0000264 Ga0501033_0000264_40567_41148 191
843 3300049571 Ga0501034_0000572 Ga0501034_0000572_25460_26041 191
844 3300049572 Ga0501036_0033995 Ga0501036_0033995_3180_3761 191
845 3300049572 Ga0501036_0034780 Ga0501036_0034780_1513_2094 191
846 3300049572 Ga0501036_0259485 Ga0501036_0259485_221_865 191
847 3300049573 Ga0501037_0059323 Ga0501037_0059323_1707_2357 191
848 3300049573 Ga0501037_0095488 Ga0501037_0095488_784_1365 191
849 3300049574 Ga0501038_0304412 Ga0501038_0304412_462_1106 191
850 3300049578 Ga0501042_0079935 Ga0501042_0079935_1212_1796 191
851 3300049579 Ga0501043_0026599 Ga0501043_0026599_487_1131 191
852 3300049581 Ga0501047_0010345 Ga0501047_0010345_6246_6890 191
853 3300049581 Ga0501047_0266255 Ga0501047_0266255_169_813 191
854 3300049586 Ga0501070_0011014 Ga0501070_0011014_4627_5271 191
855 3300049586 Ga0501070_0035279 Ga0501070_0035279_1740_2327 191
856 3300049586 Ga0501070_0289198 Ga0501070_0289198_378_962 191
857 3300049589 Ga0501073_0060831 Ga0501073_0060831_747_1331 191
858 3300049591 Ga0501075_0113250 Ga0501075_0113250_51_635 191
859 3300049674 Ga0501242_001168 Ga0501242_001168_1858_2445 191
860 3300049679 Ga0501249_091320 Ga0501249_091320_52_663 191
861 3300049688 Ga0501259_004679 Ga0501259_004679_1109_1696 191
862 3300049708 Ga0501245_017126 Ga0501245_017126_180_767 191
863 3300049741 Ga0501079_0070256 Ga0501079_0070256_2108_2692 191
864 3300049742 Ga0501080_0101414 Ga0501080_0101414_1078_1665 191
865 3300049742 Ga0501080_0506903 Ga0501080_0506903_85_669 191
866 3300049742 Ga0501080_0758658 Ga0501080_0758658_217_792 191
867 3300049765 Ga0501268_054545 Ga0501268_054545_62_649 191
868 3300049822 Ga0501035_0010184 Ga0501035_0010184_4960_5610 191
869 3300049822 Ga0501035_0182250 Ga0501035_0182250_651_1295 191
870 3300049823 Ga0501044_0004459 Ga0501044_0004459_6963_7544 191
871 3300050493 nmdc:mga0k408_24387_c1 nmdc:mga0k408_24387_c1_1899_2501 191
872 3300050507 nmdc:mga05p37_102095_c1 nmdc:mga05p37_102095_c1_582_1160 191
873 3300050507 nmdc:mga05p37_198967_c2 nmdc:mga05p37_198967_c2_70_654 191
874 3300050507 nmdc:mga05p37_203516_c1 nmdc:mga05p37_203516_c1_761_1336 191
875 3300050507 nmdc:mga05p37_33027_c1 nmdc:mga05p37_33027_c1_272_847 191
876 3300050507 nmdc:mga05p37_627909_c1 nmdc:mga05p37_627909_c1_530_1105 191
877 3300050507 nmdc:mga05p37_657753_c1 nmdc:mga05p37_657753_c1_533_1150 191
878 3300050507 nmdc:mga05p37_737532_c1 nmdc:mga05p37_737532_c1_144_731 191
879 3300050508 nmdc:mga09592_178409_c1 nmdc:mga09592_178409_c1_249_824 191
880 3300050508 nmdc:mga09592_222184_c1 nmdc:mga09592_222184_c1_206_787 191
881 3300050508 nmdc:mga09592_235355_c1 nmdc:mga09592_235355_c1_448_1065 191
882 3300050508 nmdc:mga09592_2772_c1 nmdc:mga09592_2772_c1_10007_10582 191
883 3300050509 nmdc:mga0qj67_131778_c1 nmdc:mga0qj67_131778_c1_152_727 191
884 3300050510 nmdc:mga06r32_19954_c1 nmdc:mga06r32_19954_c1_2453_3070 191
885 3300050511 nmdc:mga08y16_134086_c1 nmdc:mga08y16_134086_c1_802_1386 191
886 3300050511 nmdc:mga08y16_531580_c1 nmdc:mga08y16_531580_c1_311_910 191
887 3300050511 nmdc:mga08y16_96242_c1 nmdc:mga08y16_96242_c1_1689_2264 191
888 3300050512 nmdc:mga0n895_157271_c1 nmdc:mga0n895_157271_c1_1672_2247 191
889 3300050512 nmdc:mga0n895_193524_c1 nmdc:mga0n895_193524_c1_863_1450 191
890 3300050512 nmdc:mga0n895_392230_c1 nmdc:mga0n895_392230_c1_124_711 191
891 3300050512 nmdc:mga0n895_522486_c1 nmdc:mga0n895_522486_c1_367_963 191
892 3300050512 nmdc:mga0n895_671925_c1 nmdc:mga0n895_671925_c1_376_951 191
893 3300050512 nmdc:mga0n895_796916_c1 nmdc:mga0n895_796916_c1_18_593 191
894 3300050512 nmdc:mga0n895_984857_c1 nmdc:mga0n895_984857_c1_37_612 191
895 3300050513 nmdc:mga0rr50_158622_c1 nmdc:mga0rr50_158622_c1_1180_1755 191
896 3300050513 nmdc:mga0rr50_236_c1 nmdc:mga0rr50_236_c1_6966_7541 191
897 3300050514 nmdc:mga08x19_167633_c1 nmdc:mga08x19_167633_c1_422_1006 191
898 3300050514 nmdc:mga08x19_31_c1 nmdc:mga08x19_31_c1_148776_149351 191
899 3300050515 nmdc:mga0a205_210616_c1 nmdc:mga0a205_210616_c1_90_665 191
900 3300050515 nmdc:mga0a205_215431_c1 nmdc:mga0a205_215431_c1_1168_1755 191
901 3300050515 nmdc:mga0a205_2951_c1 nmdc:mga0a205_2951_c1_1402_1977 191
902 3300053088 Ga0500644_0046920 Ga0500644_0046920_692_1297 191
903 3300053098 Ga0500650_0048643 Ga0500650_0048643_649_1254 191
904 3300053131 Ga0500652_224155 Ga0500652_224155_106_711 191
905 3300053134 Ga0500658_0089637 Ga0500658_0089637_35_640 191
906 3300053139 Ga0500568_0087435 Ga0500568_0087435_75_665 191
907 3300053153 Ga0500616_0107781 Ga0500616_0107781_642_1241 191
908 3300060353 Ga0501082_0145025 Ga0501082_0145025_1176_1760 191
909 3300060353 Ga0501082_1039041 Ga0501082_1039041_104_688 191

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06736

TMEM175

Endosomal/lysosomal potassium channel TMEM175

48

132

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
5vre-assembly1.cif.gz_D crystal structure of a lysosomal potassium-selective channel tmem175 homolog from chamaesiphon minutus 0.8342 3 178
8fyf-assembly1.cif.gz_B human tmem175-lamp1 transmembrane domain only complex 0.8122 3 178
6w8p-assembly1.cif.gz_B structure of membrane protein with ions 0.809 5 177
6w8n-assembly1.cif.gz_B structure of a trans-membrane protein 0.8055 1 175
7unl-assembly1.cif.gz_A human tmem175 in an open state 0.7915 1 178
ID Description Score Start End Superfamily
af_A0A0R0HUX5_50_167_1.20.930.20 Mainly Alpha;Up-down Bundle;Transcription Elongation Factor S-II; Chain A;Adaptor protein Cbl, N-terminal domain 0.6186 14 126 1.20.930.20
af_A0A0R0HUX5_50_167_1.20.930.20 Mainly Alpha;Up-down Bundle;Transcription Elongation Factor S-II; Chain A;Adaptor protein Cbl, N-terminal domain 0.5914 14 126 1.20.930.20
af_Q3EBY6_10_127_1.20.930.20 Mainly Alpha;Up-down Bundle;Transcription Elongation Factor S-II; Chain A;Adaptor protein Cbl, N-terminal domain 0.5807 13 122 1.20.930.20
af_P34330_65_305_1.50.10.10 Mainly Alpha;Alpha/alpha barrel;Glycosyltransferase; 0.5778 39 179 1.50.10.10
af_K7MER9_13_125_1.20.930.20 Mainly Alpha;Up-down Bundle;Transcription Elongation Factor S-II; Chain A;Adaptor protein Cbl, N-terminal domain 0.5462 6 126 1.20.930.20
ID Description Score Start End GO Terms
AF-A0A2V5PTR6-F1-model_v4 DUF1211 domain-containing protein 0.9927 1 175 GO:0005267
GO:0015252
GO:0016020
AF-A0A529ZQU9-F1-model_v4 DUF1211 domain-containing protein 0.9924 1 124 GO:0005267
GO:0015252
GO:0016020
AF-A0A524JF56-F1-model_v4 DUF1211 domain-containing protein 0.99 1 178 GO:0005267
GO:0015252
GO:0016020
AF-A0A7V8XUC2-F1-model_v4 DUF1211 domain-containing protein 0.9898 1 191 GO:0005267
GO:0015252
GO:0016020
AF-A0A2U3QFG1-F1-model_v4 DUF1211 domain-containing protein 0.9884 1 189 GO:0005267
GO:0015252
GO:0016020

Feature Viewer

pLDDT pTM Quality
87.84 0.85 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map