F485406
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 909 | 330 | 908 | 194 |
Family's Representative Sequence
| Representative Sequence | 3300005436|Ga0070713_100073793|Ga0070713_1000737933 |
| Length | 235 |
| Sequence | MYSKICAIKGGACNDKPQFEMNETEKRNSFVFSIIIHPTTQLTMKKNRLEAFSDGVFAIIITIMVLDLKIPKDDHVSALVPLLPTFVSYILSFIYLGIYWNNHHHLWHIATHVDGKLLWANLHLLFWLSLLPFATGWMGENHFSTWPVACYGFILLMAGVAYYVMSRMLIGVHGKDSDLARAYGKDFKGRISIVIYLVAIFISLYSSWLSFSMYTVVALIWLPPDPRIERLLNKN |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 2 | 2738541278 | Niastella sp. CF465 | Isolate | Unclassified |
| 3 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 4 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 5 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 6 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 7 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 8 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 9 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 12 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 13 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 15 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 17 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 18 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 19 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 21 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 28 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 30 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 31 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 32 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 35 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 36 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 38 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 39 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 40 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 41 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 42 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 43 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 45 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 46 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 47 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 48 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 50 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 51 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 55 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 56 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 58 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 59 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 60 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 62 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 63 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 64 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 65 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 66 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 67 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 68 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 69 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 70 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 71 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 72 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 74 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 75 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 76 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 77 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 78 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 79 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 81 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 82 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 83 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 84 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 85 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 86 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 87 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 88 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 89 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 91 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 92 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 105 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 123 | 3300024225 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 | Metagenome | Rhizosphere |
| 124 | 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300027378 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 188 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 192 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 193 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 194 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 195 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 196 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 197 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 198 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 199 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 200 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 201 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 202 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 203 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 204 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 205 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 206 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 207 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 208 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 209 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 210 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 211 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 212 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 213 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 214 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 215 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 216 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 217 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 218 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 219 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 220 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 221 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 222 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 223 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 224 | 3300032139 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB | Metagenome | Rhizosphere |
| 225 | 3300033524 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 226 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 227 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 228 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 229 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 230 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 231 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 232 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 233 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 234 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 235 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 236 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 237 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 238 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 239 | 3300037588 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA | Metagenome | Rhizosphere |
| 240 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 241 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 242 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 243 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 244 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 245 | 3300041501 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG | Metagenome | Unclassified |
| 246 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 247 | 3300042128 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123 | Metagenome | Rhizosphere |
| 248 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 249 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 250 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 251 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 252 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 253 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 254 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 255 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 256 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 257 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 258 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 283 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 284 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 285 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 286 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 287 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 288 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 289 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 290 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 291 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 292 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 293 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 294 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 295 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 296 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 297 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 298 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 299 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 300 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 301 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 302 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 303 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 304 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 305 | 3300049674 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought | Metagenome | Rhizosphere |
| 306 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 307 | 3300049688 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought | Metagenome | Rhizosphere |
| 308 | 3300049708 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control | Metagenome | Rhizosphere |
| 309 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 310 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 311 | 3300049765 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought | Metagenome | Rhizosphere |
| 312 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 313 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 314 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 315 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 316 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 317 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 318 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 319 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 320 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 321 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 322 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 323 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 324 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 325 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 326 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 327 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 328 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 329 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 330 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.67 |
| Metatranscriptomes | 0.22 |
| Isolates | 0.11 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.1 |
| Nodule | 0 |
| Rhizoplane | 2.31 |
| Rhizosphere | 94.83 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.76 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL2b_contig_206548 | 2162886007 | Bacteria | 1065 |
| 2 | rootH1_10222734 | 3300003323 | Bacteria | 2613 |
| 3 | Ga0065714_10065170 | 3300005288 | Bacteria | 12256 |
| 4 | Ga0065704_10103385 | 3300005289 | Bacteria | 2173 |
| 5 | Ga0065704_10197256 | 3300005289 | Bacteria | 1162 |
| 6 | Ga0065704_10493982 | 3300005289 | Bacteria | 672 |
| 7 | Ga0065712_10000127 | 3300005290 | Bacteria | 117106 |
| 8 | Ga0065712_10007240 | 3300005290 | Bacteria | 3685 |
| 9 | Ga0065712_10013797 | 3300005290 | Bacteria | 1835 |
| 10 | Ga0065712_10148837 | 3300005290 | Bacteria | 1386 |
| 11 | Ga0065715_10000791 | 3300005293 | Bacteria | 11349 |
| 12 | Ga0065715_10027705 | 3300005293 | Bacteria | 1889 |
| 13 | Ga0065715_10092022 | 3300005293 | Bacteria | 5380 |
| 14 | Ga0065715_10250886 | 3300005293 | Bacteria | 1167 |
| 15 | Ga0065707_10008733 | 3300005295 | Bacteria | 3166 |
| 16 | Ga0065707_10033347 | 3300005295 | Bacteria | 1113 |
| 17 | Ga0065707_10122006 | 3300005295 | Bacteria | 2077 |
| 18 | Ga0065707_10126451 | 3300005295 | Bacteria | 2002 |
| 19 | Ga0065707_10129106 | 3300005295 | Bacteria | 1953 |
| 20 | Ga0065707_10232992 | 3300005295 | Bacteria | 1182 |
| 21 | Ga0065707_10354834 | 3300005295 | Unclassified | 913 |
| 22 | Ga0070658_10000394 | 3300005327 | Bacteria | 37936 |
| 23 | Ga0070658_10028202 | 3300005327 | Bacteria | 4506 |
| 24 | Ga0070658_10763219 | 3300005327 | Bacteria | 840 |
| 25 | Ga0070676_10083094 | 3300005328 | Bacteria | 1947 |
| 26 | Ga0070683_100046502 | 3300005329 | Bacteria | 4010 |
| 27 | Ga0070683_100147147 | 3300005329 | Bacteria | 2232 |
| 28 | Ga0070683_100734650 | 3300005329 | Bacteria | 946 |
| 29 | Ga0070683_101068697 | 3300005329 | Bacteria | 775 |
| 30 | Ga0070690_100065953 | 3300005330 | Bacteria | 2342 |
| 31 | Ga0070690_100205328 | 3300005330 | Bacteria | 1373 |
| 32 | Ga0070690_100800069 | 3300005330 | Bacteria | 731 |
| 33 | Ga0070670_100010264 | 3300005331 | Bacteria | 7991 |
| 34 | Ga0070670_100015904 | 3300005331 | Bacteria | 6456 |
| 35 | Ga0070670_100037379 | 3300005331 | Bacteria | 4178 |
| 36 | Ga0068869_100016011 | 3300005334 | Bacteria | 5046 |
| 37 | Ga0068869_100022098 | 3300005334 | Bacteria | 4381 |
| 38 | Ga0068869_100038528 | 3300005334 | Bacteria | 3408 |
| 39 | Ga0068869_100041468 | 3300005334 | Bacteria | 3297 |
| 40 | Ga0068869_100045784 | 3300005334 | Bacteria | 3151 |
| 41 | Ga0068869_100071543 | 3300005334 | Bacteria | 2568 |
| 42 | Ga0068869_100129612 | 3300005334 | Bacteria | 1937 |
| 43 | Ga0068869_100659467 | 3300005334 | Bacteria | 889 |
| 44 | Ga0070666_10000024 | 3300005335 | Bacteria | 161355 |
| 45 | Ga0070666_10085791 | 3300005335 | Bacteria | 2157 |
| 46 | Ga0070680_100001860 | 3300005336 | Bacteria | 15472 |
| 47 | Ga0070680_100015415 | 3300005336 | Bacteria | 5992 |
| 48 | Ga0070682_100000160 | 3300005337 | Bacteria | 51653 |
| 49 | Ga0070682_100505804 | 3300005337 | Bacteria | 937 |
| 50 | Ga0070682_100627615 | 3300005337 | Bacteria | 852 |
| 51 | Ga0068868_100097815 | 3300005338 | Bacteria | 2372 |
| 52 | Ga0068868_100108577 | 3300005338 | Bacteria | 2252 |
| 53 | Ga0068868_100119142 | 3300005338 | Unclassified | 2152 |
| 54 | Ga0068868_100239575 | 3300005338 | Bacteria | 1524 |
| 55 | Ga0068868_100269867 | 3300005338 | Bacteria | 1437 |
| 56 | Ga0070660_100323309 | 3300005339 | Bacteria | 1267 |
| 57 | Ga0070689_100071874 | 3300005340 | Bacteria | 2703 |
| 58 | Ga0070689_100112194 | 3300005340 | Bacteria | 2170 |
| 59 | Ga0070689_100164110 | 3300005340 | Bacteria | 1797 |
| 60 | Ga0070668_100006022 | 3300005347 | Bacteria | 8995 |
| 61 | Ga0070668_100039038 | 3300005347 | Bacteria | 3632 |
| 62 | Ga0070668_100943159 | 3300005347 | Bacteria | 773 |
| 63 | Ga0070669_100006440 | 3300005353 | Bacteria | 8453 |
| 64 | Ga0070669_100017708 | 3300005353 | Bacteria | 5083 |
| 65 | Ga0070669_100105122 | 3300005353 | Bacteria | 2135 |
| 66 | Ga0070669_100637256 | 3300005353 | Bacteria | 896 |
| 67 | Ga0070675_100015874 | 3300005354 | Bacteria | 5963 |
| 68 | Ga0070671_100002104 | 3300005355 | Bacteria | 15361 |
| 69 | Ga0070671_100026730 | 3300005355 | Bacteria | 4746 |
| 70 | Ga0070671_100058436 | 3300005355 | Bacteria | 3210 |
| 71 | Ga0070671_100151903 | 3300005355 | Bacteria | 1955 |
| 72 | Ga0070671_100198146 | 3300005355 | Bacteria | 1702 |
| 73 | Ga0070671_100518110 | 3300005355 | Bacteria | 1027 |
| 74 | Ga0070674_100106641 | 3300005356 | Bacteria | 2051 |
| 75 | Ga0070673_100003495 | 3300005364 | Bacteria | 9790 |
| 76 | Ga0070673_100021741 | 3300005364 | Bacteria | 4659 |
| 77 | Ga0070673_100069550 | 3300005364 | Bacteria | 2822 |
| 78 | Ga0070673_100078564 | 3300005364 | Bacteria | 2670 |
| 79 | Ga0070673_100211440 | 3300005364 | Bacteria | 1675 |
| 80 | Ga0070673_100259750 | 3300005364 | Bacteria | 1517 |
| 81 | Ga0070673_100707300 | 3300005364 | Bacteria | 925 |
| 82 | Ga0070688_100048696 | 3300005365 | Bacteria | 2634 |
| 83 | Ga0070688_100269138 | 3300005365 | Bacteria | 1220 |
| 84 | Ga0070667_100001961 | 3300005367 | Bacteria | 18259 |
| 85 | Ga0070667_100023350 | 3300005367 | Bacteria | 5129 |
| 86 | Ga0070667_100110693 | 3300005367 | Bacteria | 2381 |
| 87 | Ga0070667_100202286 | 3300005367 | Bacteria | 1763 |
| 88 | Ga0070667_100870179 | 3300005367 | Bacteria | 838 |
| 89 | Ga0070709_10169766 | 3300005434 | Bacteria | 1523 |
| 90 | Ga0070709_10375209 | 3300005434 | Bacteria | 1056 |
| 91 | Ga0070713_100073793 | 3300005436 | Bacteria | 2889 |
| 92 | Ga0070701_10034183 | 3300005438 | Bacteria | 2546 |
| 93 | Ga0070711_100008085 | 3300005439 | Bacteria | 6427 |
| 94 | Ga0070711_100205937 | 3300005439 | Bacteria | 1521 |
| 95 | Ga0070711_100478678 | 3300005439 | Unclassified | 1023 |
| 96 | Ga0070705_100048297 | 3300005440 | Bacteria | 2465 |
| 97 | Ga0070705_100069962 | 3300005440 | Bacteria | 2118 |
| 98 | Ga0070705_100140429 | 3300005440 | Bacteria | 1589 |
| 99 | Ga0070700_100041146 | 3300005441 | Bacteria | 2832 |
| 100 | Ga0070700_100193777 | 3300005441 | Bacteria | 1423 |
| 101 | Ga0070694_100273709 | 3300005444 | Bacteria | 1285 |
| 102 | Ga0070694_100776443 | 3300005444 | Bacteria | 784 |
| 103 | Ga0070662_100031884 | 3300005457 | Bacteria | 3702 |
| 104 | Ga0070662_100109667 | 3300005457 | Unclassified | 2101 |
| 105 | Ga0070662_100109970 | 3300005457 | Bacteria | 2098 |
| 106 | Ga0070662_100244067 | 3300005457 | Bacteria | 1441 |
| 107 | Ga0070662_100458741 | 3300005457 | Bacteria | 1059 |
| 108 | Ga0070662_100476284 | 3300005457 | Bacteria | 1039 |
| 109 | Ga0070681_10000089 | 3300005458 | Bacteria | 68795 |
| 110 | Ga0068867_100028048 | 3300005459 | Bacteria | 4052 |
| 111 | Ga0068867_100042773 | 3300005459 | Bacteria | 3316 |
| 112 | Ga0068867_100078136 | 3300005459 | Bacteria | 2489 |
| 113 | Ga0068867_100263749 | 3300005459 | Bacteria | 1405 |
| 114 | Ga0068867_101156245 | 3300005459 | Bacteria | 709 |
| 115 | Ga0070685_10047580 | 3300005466 | Bacteria | 2467 |
| 116 | Ga0070685_10088724 | 3300005466 | Bacteria | 1868 |
| 117 | Ga0070706_100070395 | 3300005467 | Bacteria | 3235 |
| 118 | Ga0070707_100005228 | 3300005468 | Bacteria | 12150 |
| 119 | Ga0070707_100106737 | 3300005468 | Bacteria | 2716 |
| 120 | Ga0070707_100213597 | 3300005468 | Bacteria | 1880 |
| 121 | Ga0070707_100334705 | 3300005468 | Bacteria | 1471 |
| 122 | Ga0070707_101377340 | 3300005468 | Bacteria | 672 |
| 123 | Ga0070698_100007009 | 3300005471 | Bacteria | 12208 |
| 124 | Ga0070698_100026474 | 3300005471 | Bacteria | 6038 |
| 125 | Ga0070698_100079633 | 3300005471 | Bacteria | 3273 |
| 126 | Ga0070698_100326848 | 3300005471 | Bacteria | 1464 |
| 127 | Ga0070698_100468397 | 3300005471 | Bacteria | 1196 |
| 128 | Ga0070698_100526049 | 3300005471 | Bacteria | 1121 |
| 129 | Ga0070699_100001719 | 3300005518 | Bacteria | 19966 |
| 130 | Ga0070699_100002144 | 3300005518 | Bacteria | 17881 |
| 131 | Ga0070699_100524633 | 3300005518 | Bacteria | 1077 |
| 132 | Ga0070699_100852944 | 3300005518 | Bacteria | 834 |
| 133 | Ga0070679_100000014 | 3300005530 | Bacteria | 150481 |
| 134 | Ga0070679_100000987 | 3300005530 | Bacteria | 24762 |
| 135 | Ga0070679_100001843 | 3300005530 | Bacteria | 19045 |
| 136 | Ga0070684_100008223 | 3300005535 | Bacteria | 8152 |
| 137 | Ga0070684_100028066 | 3300005535 | Bacteria | 4758 |
| 138 | Ga0070684_100153616 | 3300005535 | Bacteria | 2086 |
| 139 | Ga0070684_100738581 | 3300005535 | Bacteria | 919 |
| 140 | Ga0070697_100013804 | 3300005536 | Bacteria | 6337 |
| 141 | Ga0070697_100152570 | 3300005536 | Bacteria | 1948 |
| 142 | Ga0068853_100238053 | 3300005539 | Bacteria | 1667 |
| 143 | Ga0070672_100007925 | 3300005543 | Bacteria | 7255 |
| 144 | Ga0070672_100011852 | 3300005543 | Bacteria | 6092 |
| 145 | Ga0070672_100055053 | 3300005543 | Bacteria | 3115 |
| 146 | Ga0070672_100076019 | 3300005543 | Bacteria | 2682 |
| 147 | Ga0070672_100123188 | 3300005543 | Bacteria | 2124 |
| 148 | Ga0070672_100145879 | 3300005543 | Unclassified | 1956 |
| 149 | Ga0070686_100016694 | 3300005544 | Unclassified | 4274 |
| 150 | Ga0070686_100031400 | 3300005544 | Bacteria | 3247 |
| 151 | Ga0070686_100255781 | 3300005544 | Bacteria | 1281 |
| 152 | Ga0070695_100091742 | 3300005545 | Bacteria | 2029 |
| 153 | Ga0070695_100118556 | 3300005545 | Bacteria | 1807 |
| 154 | Ga0070695_100342211 | 3300005545 | Bacteria | 1118 |
| 155 | Ga0070696_100129364 | 3300005546 | Bacteria | 1836 |
| 156 | Ga0070696_100202525 | 3300005546 | Bacteria | 1482 |
| 157 | Ga0070696_100218126 | 3300005546 | Bacteria | 1430 |
| 158 | Ga0070693_100116852 | 3300005547 | Bacteria | 1649 |
| 159 | Ga0070665_100118546 | 3300005548 | Bacteria | 2649 |
| 160 | Ga0070704_100012361 | 3300005549 | Bacteria | 5272 |
| 161 | Ga0070704_100163261 | 3300005549 | Bacteria | 1764 |
| 162 | Ga0070704_100164409 | 3300005549 | Bacteria | 1758 |
| 163 | Ga0070704_100366317 | 3300005549 | Bacteria | 1221 |
| 164 | Ga0070704_100656777 | 3300005549 | Bacteria | 926 |
| 165 | Ga0070704_101314093 | 3300005549 | Bacteria | 662 |
| 166 | Ga0068855_100004734 | 3300005563 | Bacteria | 16618 |
| 167 | Ga0068855_100868491 | 3300005563 | Bacteria | 955 |
| 168 | Ga0068855_101155434 | 3300005563 | Bacteria | 807 |
| 169 | Ga0070664_100070619 | 3300005564 | Unclassified | 2991 |
| 170 | Ga0068857_100335011 | 3300005577 | Bacteria | 1399 |
| 171 | Ga0068857_100395436 | 3300005577 | Bacteria | 1285 |
| 172 | Ga0068857_100424577 | 3300005577 | Bacteria | 1240 |
| 173 | Ga0068854_100038325 | 3300005578 | Bacteria | 3370 |
| 174 | Ga0068854_100041870 | 3300005578 | Plasmid | 3238 |
| 175 | Ga0068854_100625077 | 3300005578 | Bacteria | 922 |
| 176 | Ga0068854_100659138 | 3300005578 | Bacteria | 899 |
| 177 | Ga0068856_100045446 | 3300005614 | Bacteria | 4324 |
| 178 | Ga0068856_100066952 | 3300005614 | Bacteria | 3549 |
| 179 | Ga0068856_101010529 | 3300005614 | Unclassified | 850 |
| 180 | Ga0070702_100121139 | 3300005615 | Bacteria | 1638 |
| 181 | Ga0070702_100193869 | 3300005615 | Bacteria | 1339 |
| 182 | Ga0070702_100217257 | 3300005615 | Bacteria | 1276 |
| 183 | Ga0070702_100386709 | 3300005615 | Unclassified | 996 |
| 184 | Ga0070702_100518976 | 3300005615 | Bacteria | 878 |
| 185 | Ga0068852_100000563 | 3300005616 | Bacteria | 24454 |
| 186 | Ga0068852_100063061 | 3300005616 | Bacteria | 3226 |
| 187 | Ga0068852_100088798 | 3300005616 | Bacteria | 2761 |
| 188 | Ga0068852_100444429 | 3300005616 | Bacteria | 1282 |
| 189 | Ga0068852_100458459 | 3300005616 | Bacteria | 1263 |
| 190 | Ga0068852_101226527 | 3300005616 | Bacteria | 771 |
| 191 | Ga0068859_100000018 | 3300005617 | Bacteria | 248813 |
| 192 | Ga0068859_100009873 | 3300005617 | Bacteria | 9638 |
| 193 | Ga0068859_100031927 | 3300005617 | Bacteria | 5290 |
| 194 | Ga0068859_100061244 | 3300005617 | Bacteria | 3792 |
| 195 | Ga0068859_100094970 | 3300005617 | Bacteria | 3034 |
| 196 | Ga0068859_100126891 | 3300005617 | Bacteria | 2621 |
| 197 | Ga0068859_100159845 | 3300005617 | Unclassified | 2332 |
| 198 | Ga0068859_100225436 | 3300005617 | Bacteria | 1962 |
| 199 | Ga0068859_100267365 | 3300005617 | Bacteria | 1802 |
| 200 | Ga0068859_100362650 | 3300005617 | Bacteria | 1544 |
| 201 | Ga0068859_100393141 | 3300005617 | Bacteria | 1482 |
| 202 | Ga0068859_100849020 | 3300005617 | Bacteria | 999 |
| 203 | Ga0068859_100952615 | 3300005617 | Bacteria | 941 |
| 204 | Ga0068864_100004484 | 3300005618 | Bacteria | 11479 |
| 205 | Ga0068864_100005259 | 3300005618 | Bacteria | 10611 |
| 206 | Ga0068864_100025295 | 3300005618 | Bacteria | 4998 |
| 207 | Ga0068864_100139613 | 3300005618 | Bacteria | 2185 |
| 208 | Ga0068864_100357887 | 3300005618 | Bacteria | 1379 |
| 209 | Ga0068864_100726306 | 3300005618 | Bacteria | 972 |
| 210 | Ga0068866_10027331 | 3300005718 | Bacteria | 2704 |
| 211 | Ga0068866_10292742 | 3300005718 | Bacteria | 1013 |
| 212 | Ga0068866_10303026 | 3300005718 | Unclassified | 999 |
| 213 | Ga0068861_100004851 | 3300005719 | Bacteria | 9047 |
| 214 | Ga0068861_100027390 | 3300005719 | Bacteria | 4150 |
| 215 | Ga0068861_100125526 | 3300005719 | Bacteria | 2076 |
| 216 | Ga0068861_100143536 | 3300005719 | Unclassified | 1951 |
| 217 | Ga0068861_100196601 | 3300005719 | Bacteria | 1690 |
| 218 | Ga0068851_10008388 | 3300005834 | Bacteria | 4776 |
| 219 | Ga0068870_10010801 | 3300005840 | Bacteria | 4209 |
| 220 | Ga0068870_10017559 | 3300005840 | Unclassified | 3438 |
| 221 | Ga0068870_10040937 | 3300005840 | Unclassified | 2405 |
| 222 | Ga0068870_10046150 | 3300005840 | Bacteria | 2283 |
| 223 | Ga0068870_10632273 | 3300005840 | Bacteria | 731 |
| 224 | Ga0068863_100037369 | 3300005841 | Bacteria | 4623 |
| 225 | Ga0068863_100081038 | 3300005841 | Bacteria | 3075 |
| 226 | Ga0068863_100134234 | 3300005841 | Bacteria | 2364 |
| 227 | Ga0068863_100345488 | 3300005841 | Bacteria | 1448 |
| 228 | Ga0068863_100729072 | 3300005841 | Bacteria | 986 |
| 229 | Ga0068863_100959271 | 3300005841 | Bacteria | 857 |
| 230 | Ga0068858_100010503 | 3300005842 | Bacteria | 8772 |
| 231 | Ga0068858_100026860 | 3300005842 | Bacteria | 5348 |
| 232 | Ga0068858_100100704 | 3300005842 | Bacteria | 2694 |
| 233 | Ga0068858_100105236 | 3300005842 | Bacteria | 2633 |
| 234 | Ga0068858_100416513 | 3300005842 | Bacteria | 1292 |
| 235 | Ga0068858_100812407 | 3300005842 | Bacteria | 912 |
| 236 | Ga0068858_101107367 | 3300005842 | Bacteria | 777 |
| 237 | Ga0068860_100008446 | 3300005843 | Bacteria | 10257 |
| 238 | Ga0068860_100012313 | 3300005843 | Bacteria | 8428 |
| 239 | Ga0068860_100014941 | 3300005843 | Bacteria | 7590 |
| 240 | Ga0068860_100053026 | 3300005843 | Bacteria | 3856 |
| 241 | Ga0068860_100054834 | 3300005843 | Unclassified | 3788 |
| 242 | Ga0068860_100154342 | 3300005843 | Bacteria | 2212 |
| 243 | Ga0068860_100156698 | 3300005843 | Bacteria | 2195 |
| 244 | Ga0068860_100161290 | 3300005843 | Bacteria | 2162 |
| 245 | Ga0068860_100219257 | 3300005843 | Bacteria | 1847 |
| 246 | Ga0068860_100574972 | 3300005843 | Bacteria | 1130 |
| 247 | Ga0068860_100643878 | 3300005843 | Bacteria | 1067 |
| 248 | Ga0068862_100001370 | 3300005844 | Bacteria | 22653 |
| 249 | Ga0068862_100014339 | 3300005844 | Bacteria | 6573 |
| 250 | Ga0068862_100023492 | 3300005844 | Bacteria | 5167 |
| 251 | Ga0068862_100090826 | 3300005844 | Bacteria | 2659 |
| 252 | Ga0070717_10000960 | 3300006028 | Bacteria | 19222 |
| 253 | Ga0070717_10619163 | 3300006028 | Bacteria | 982 |
| 254 | Ga0075363_100347233 | 3300006048 | Bacteria | 866 |
| 255 | Ga0070715_10000028 | 3300006163 | Bacteria | 89406 |
| 256 | Ga0070716_100000005 | 3300006173 | Bacteria | 273485 |
| 257 | Ga0070716_100033133 | 3300006173 | Bacteria | 2824 |
| 258 | Ga0070716_100161723 | 3300006173 | Bacteria | 1451 |
| 259 | Ga0070712_100267126 | 3300006175 | Bacteria | 1373 |
| 260 | Ga0075367_10030751 | 3300006178 | Bacteria | 3080 |
| 261 | Ga0075366_10032848 | 3300006195 | Bacteria | 3056 |
| 262 | Ga0097621_100007931 | 3300006237 | Bacteria | 7619 |
| 263 | Ga0097621_100091812 | 3300006237 | Bacteria | 2542 |
| 264 | Ga0097621_100136761 | 3300006237 | Bacteria | 2090 |
| 265 | Ga0097621_100342691 | 3300006237 | Bacteria | 1327 |
| 266 | Ga0068871_100004123 | 3300006358 | Bacteria | 10050 |
| 267 | Ga0068871_100090910 | 3300006358 | Bacteria | 2543 |
| 268 | Ga0068871_100101168 | 3300006358 | Unclassified | 2415 |
| 269 | Ga0075428_100007407 | 3300006844 | Bacteria | 12166 |
| 270 | Ga0075428_100129758 | 3300006844 | Bacteria | 2742 |
| 271 | Ga0075428_100141687 | 3300006844 | Bacteria | 2614 |
| 272 | Ga0075428_100582134 | 3300006844 | Bacteria | 1196 |
| 273 | Ga0075430_100099666 | 3300006846 | Bacteria | 2426 |
| 274 | Ga0075431_100012603 | 3300006847 | Bacteria | 8536 |
| 275 | Ga0075433_10048333 | 3300006852 | Bacteria | 3699 |
| 276 | Ga0075433_10489102 | 3300006852 | Bacteria | 1084 |
| 277 | Ga0075433_10853391 | 3300006852 | Bacteria | 795 |
| 278 | Ga0075434_100268818 | 3300006871 | Bacteria | 1724 |
| 279 | Ga0075434_100656763 | 3300006871 | Bacteria | 1067 |
| 280 | Ga0075434_100884959 | 3300006871 | Bacteria | 908 |
| 281 | Ga0075429_100000099 | 3300006880 | Bacteria | 47825 |
| 282 | Ga0075429_100043066 | 3300006880 | Bacteria | 3928 |
| 283 | Ga0075429_100059318 | 3300006880 | Bacteria | 3333 |
| 284 | Ga0075429_100117391 | 3300006880 | Bacteria | 2325 |
| 285 | Ga0068865_100008550 | 3300006881 | Bacteria | 6328 |
| 286 | Ga0068865_100013758 | 3300006881 | Bacteria | 5126 |
| 287 | Ga0068865_100100995 | 3300006881 | Bacteria | 2112 |
| 288 | Ga0068865_100617393 | 3300006881 | Bacteria | 918 |
| 289 | Ga0075436_100000009 | 3300006914 | Bacteria | 256132 |
| 290 | Ga0075436_100008218 | 3300006914 | Bacteria | 7140 |
| 291 | Ga0075436_100088294 | 3300006914 | Bacteria | 2154 |
| 292 | Ga0097620_100000018 | 3300006931 | Bacteria | 248813 |
| 293 | Ga0097620_100009873 | 3300006931 | Bacteria | 9638 |
| 294 | Ga0097620_100031929 | 3300006931 | Bacteria | 5290 |
| 295 | Ga0097620_100061249 | 3300006931 | Bacteria | 3792 |
| 296 | Ga0097620_100094968 | 3300006931 | Bacteria | 3034 |
| 297 | Ga0097620_100126891 | 3300006931 | Bacteria | 2621 |
| 298 | Ga0097620_100159852 | 3300006931 | Unclassified | 2332 |
| 299 | Ga0097620_100225430 | 3300006931 | Bacteria | 1962 |
| 300 | Ga0097620_100267358 | 3300006931 | Bacteria | 1802 |
| 301 | Ga0097620_100362629 | 3300006931 | Bacteria | 1544 |
| 302 | Ga0097620_100393140 | 3300006931 | Bacteria | 1482 |
| 303 | Ga0097620_100849054 | 3300006931 | Bacteria | 999 |
| 304 | Ga0097620_100952649 | 3300006931 | Bacteria | 941 |
| 305 | Ga0099794_10007400 | 3300007265 | Bacteria | 4509 |
| 306 | Ga0099794_10024770 | 3300007265 | Bacteria | 2758 |
| 307 | Ga0099795_10000032 | 3300007788 | Bacteria | 37057 |
| 308 | Ga0105240_10046485 | 3300009093 | Bacteria | 5500 |
| 309 | Ga0105240_10391872 | 3300009093 | Bacteria | 1566 |
| 310 | Ga0105240_10991685 | 3300009093 | Bacteria | 899 |
| 311 | Ga0111539_10001405 | 3300009094 | Bacteria | 32059 |
| 312 | Ga0111539_10012287 | 3300009094 | Bacteria | 10733 |
| 313 | Ga0111539_10022883 | 3300009094 | Bacteria | 7674 |
| 314 | Ga0111539_10153083 | 3300009094 | Bacteria | 2699 |
| 315 | Ga0111539_10738163 | 3300009094 | Bacteria | 1146 |
| 316 | Ga0105245_10015777 | 3300009098 | Bacteria | 6587 |
| 317 | Ga0105245_10030971 | 3300009098 | Bacteria | 4732 |
| 318 | Ga0105245_10181432 | 3300009098 | Bacteria | 2011 |
| 319 | Ga0105245_10199308 | 3300009098 | Bacteria | 1922 |
| 320 | Ga0105245_10249468 | 3300009098 | Bacteria | 1724 |
| 321 | Ga0105245_10462533 | 3300009098 | Bacteria | 1279 |
| 322 | Ga0105245_10595234 | 3300009098 | Bacteria | 1132 |
| 323 | Ga0105247_10003256 | 3300009101 | Bacteria | 10648 |
| 324 | Ga0105247_10164183 | 3300009101 | Bacteria | 1472 |
| 325 | Ga0114129_10021342 | 3300009147 | Bacteria | 9194 |
| 326 | Ga0114129_10042905 | 3300009147 | Bacteria | 6366 |
| 327 | Ga0114129_10119091 | 3300009147 | Bacteria | 3637 |
| 328 | Ga0114129_10354293 | 3300009147 | Bacteria | 1943 |
| 329 | Ga0114129_10356777 | 3300009147 | Bacteria | 1935 |
| 330 | Ga0114129_10374980 | 3300009147 | Bacteria | 1880 |
| 331 | Ga0114129_10396784 | 3300009147 | Bacteria | 1819 |
| 332 | Ga0114129_10693730 | 3300009147 | Bacteria | 1309 |
| 333 | Ga0105243_10007346 | 3300009148 | Bacteria | 8471 |
| 334 | Ga0105243_10069470 | 3300009148 | Bacteria | 2842 |
| 335 | Ga0105243_10363846 | 3300009148 | Bacteria | 1332 |
| 336 | Ga0105243_10990641 | 3300009148 | Bacteria | 842 |
| 337 | Ga0105241_10083558 | 3300009174 | Bacteria | 2505 |
| 338 | Ga0105241_10102449 | 3300009174 | Unclassified | 2278 |
| 339 | Ga0105241_10593789 | 3300009174 | Bacteria | 999 |
| 340 | Ga0105241_10715034 | 3300009174 | Bacteria | 916 |
| 341 | Ga0105242_10411750 | 3300009176 | Bacteria | 1264 |
| 342 | Ga0105242_10460870 | 3300009176 | Bacteria | 1200 |
| 343 | Ga0105248_10005870 | 3300009177 | Bacteria | 13491 |
| 344 | Ga0105248_10018915 | 3300009177 | Bacteria | 7617 |
| 345 | Ga0105248_10141453 | 3300009177 | Bacteria | 2715 |
| 346 | Ga0105248_10158725 | 3300009177 | Bacteria | 2551 |
| 347 | Ga0105248_10242162 | 3300009177 | Bacteria | 2030 |
| 348 | Ga0105248_10267197 | 3300009177 | Bacteria | 1926 |
| 349 | Ga0105248_10307787 | 3300009177 | Bacteria | 1784 |
| 350 | Ga0105248_11023297 | 3300009177 | Bacteria | 933 |
| 351 | Ga0105237_10071421 | 3300009545 | Bacteria | 3466 |
| 352 | Ga0105237_10089716 | 3300009545 | Bacteria | 3063 |
| 353 | Ga0105237_10210845 | 3300009545 | Bacteria | 1943 |
| 354 | Ga0105237_10789816 | 3300009545 | Bacteria | 956 |
| 355 | Ga0105238_10006886 | 3300009551 | Bacteria | 11353 |
| 356 | Ga0105238_10118922 | 3300009551 | Bacteria | 2622 |
| 357 | Ga0105249_10013548 | 3300009553 | Bacteria | 7202 |
| 358 | Ga0105249_10039020 | 3300009553 | Bacteria | 4310 |
| 359 | Ga0105249_10045782 | 3300009553 | Bacteria | 3980 |
| 360 | Ga0105249_10049971 | 3300009553 | Bacteria | 3813 |
| 361 | Ga0105249_10114617 | 3300009553 | Bacteria | 2552 |
| 362 | Ga0105249_10203924 | 3300009553 | Bacteria | 1936 |
| 363 | Ga0099796_10000020 | 3300010159 | Bacteria | 41259 |
| 364 | Ga0105239_10000469 | 3300010375 | Bacteria | 59012 |
| 365 | Ga0105239_10368613 | 3300010375 | Bacteria | 1623 |
| 366 | Ga0105239_10443836 | 3300010375 | Bacteria | 1471 |
| 367 | Ga0105239_10547953 | 3300010375 | Bacteria | 1317 |
| 368 | Ga0105239_12012040 | 3300010375 | Bacteria | 671 |
| 369 | Ga0105246_10003450 | 3300011119 | Bacteria | 9585 |
| 370 | Ga0105246_10021665 | 3300011119 | Bacteria | 4138 |
| 371 | Ga0105246_10038224 | 3300011119 | Bacteria | 3225 |
| 372 | Ga0105246_10430279 | 3300011119 | Bacteria | 1104 |
| 373 | Ga0105246_10517681 | 3300011119 | Bacteria | 1016 |
| 374 | Ga0105246_10559770 | 3300011119 | Bacteria | 981 |
| 375 | Ga0105246_10748498 | 3300011119 | Bacteria | 862 |
| 376 | Ga0157373_10083678 | 3300013100 | Bacteria | 2249 |
| 377 | Ga0157373_10128242 | 3300013100 | Bacteria | 1784 |
| 378 | Ga0157373_10368110 | 3300013100 | Bacteria | 1027 |
| 379 | Ga0157373_10372965 | 3300013100 | Bacteria | 1020 |
| 380 | Ga0157373_10527167 | 3300013100 | Bacteria | 855 |
| 381 | Ga0157371_10002120 | 3300013102 | Bacteria | 19316 |
| 382 | Ga0157371_10040887 | 3300013102 | Bacteria | 3310 |
| 383 | Ga0157370_10040765 | 3300013104 | Bacteria | 4482 |
| 384 | Ga0157370_10280425 | 3300013104 | Unclassified | 1540 |
| 385 | Ga0157369_10015970 | 3300013105 | Bacteria | 8448 |
| 386 | Ga0157374_10041032 | 3300013296 | Bacteria | 4262 |
| 387 | Ga0157374_10393475 | 3300013296 | Bacteria | 1382 |
| 388 | Ga0157374_10499916 | 3300013296 | Bacteria | 1220 |
| 389 | Ga0157374_10538585 | 3300013296 | Bacteria | 1175 |
| 390 | Ga0157374_10817194 | 3300013296 | Bacteria | 948 |
| 391 | Ga0157378_10004869 | 3300013297 | Bacteria | 11775 |
| 392 | Ga0157378_10005934 | 3300013297 | Bacteria | 10702 |
| 393 | Ga0157378_10021654 | 3300013297 | Bacteria | 5652 |
| 394 | Ga0157378_10024057 | 3300013297 | Bacteria | 5358 |
| 395 | Ga0157378_10196841 | 3300013297 | Bacteria | 1904 |
| 396 | Ga0157378_10307030 | 3300013297 | Bacteria | 1537 |
| 397 | Ga0163162_10001448 | 3300013306 | Bacteria | 22080 |
| 398 | Ga0163162_10006632 | 3300013306 | Bacteria | 11220 |
| 399 | Ga0163162_10125034 | 3300013306 | Bacteria | 2677 |
| 400 | Ga0163162_10213745 | 3300013306 | Bacteria | 2058 |
| 401 | Ga0163162_10233792 | 3300013306 | Bacteria | 1969 |
| 402 | Ga0163162_10442933 | 3300013306 | Bacteria | 1431 |
| 403 | Ga0163162_10586084 | 3300013306 | Bacteria | 1242 |
| 404 | Ga0163162_10862695 | 3300013306 | Bacteria | 1020 |
| 405 | Ga0157372_10011389 | 3300013307 | Bacteria | 9460 |
| 406 | Ga0157372_10104328 | 3300013307 | Unclassified | 3240 |
| 407 | Ga0157372_10123962 | 3300013307 | Bacteria | 2970 |
| 408 | Ga0157372_10147935 | 3300013307 | Unclassified | 2709 |
| 409 | Ga0157372_11259607 | 3300013307 | Bacteria | 854 |
| 410 | Ga0157375_10000277 | 3300013308 | Bacteria | 46526 |
| 411 | Ga0157375_10003915 | 3300013308 | Bacteria | 12913 |
| 412 | Ga0157375_10014916 | 3300013308 | Bacteria | 6946 |
| 413 | Ga0157375_10033271 | 3300013308 | Bacteria | 4897 |
| 414 | Ga0157375_10049252 | 3300013308 | Bacteria | 4127 |
| 415 | Ga0157375_10523581 | 3300013308 | Bacteria | 1349 |
| 416 | Ga0157375_10705309 | 3300013308 | Bacteria | 1162 |
| 417 | Ga0157375_11448910 | 3300013308 | Bacteria | 810 |
| 418 | Ga0163163_10006562 | 3300014325 | Bacteria | 10191 |
| 419 | Ga0163163_10008538 | 3300014325 | Bacteria | 9103 |
| 420 | Ga0163163_10039293 | 3300014325 | Bacteria | 4618 |
| 421 | Ga0163163_10092286 | 3300014325 | Bacteria | 3043 |
| 422 | Ga0163163_10207609 | 3300014325 | Bacteria | 2007 |
| 423 | Ga0163163_10319854 | 3300014325 | Bacteria | 1605 |
| 424 | Ga0163163_10403009 | 3300014325 | Bacteria | 1426 |
| 425 | Ga0163163_10948460 | 3300014325 | Bacteria | 924 |
| 426 | Ga0163163_11055166 | 3300014325 | Bacteria | 876 |
| 427 | Ga0157380_10004791 | 3300014326 | Bacteria | 9428 |
| 428 | Ga0157380_10007392 | 3300014326 | Bacteria | 7801 |
| 429 | Ga0157380_10018186 | 3300014326 | Bacteria | 5215 |
| 430 | Ga0157380_10018458 | 3300014326 | Bacteria | 5179 |
| 431 | Ga0157380_10379855 | 3300014326 | Bacteria | 1333 |
| 432 | Ga0157377_10226927 | 3300014745 | Bacteria | 1199 |
| 433 | Ga0157379_10021797 | 3300014968 | Bacteria | 5675 |
| 434 | Ga0157379_10083800 | 3300014968 | Bacteria | 2857 |
| 435 | Ga0157379_10437484 | 3300014968 | Bacteria | 1206 |
| 436 | Ga0157379_11092679 | 3300014968 | Unclassified | 764 |
| 437 | Ga0157376_10005294 | 3300014969 | Bacteria | 9013 |
| 438 | Ga0157376_10057141 | 3300014969 | Unclassified | 3263 |
| 439 | Ga0157376_10317663 | 3300014969 | Bacteria | 1480 |
| 440 | Ga0157376_10431311 | 3300014969 | Bacteria | 1281 |
| 441 | Ga0157376_11328655 | 3300014969 | Bacteria | 749 |
| 442 | Ga0163161_10024589 | 3300017792 | Bacteria | 4257 |
| 443 | Ga0163161_10123774 | 3300017792 | Bacteria | 1945 |
| 444 | Ga0213875_10000066 | 3300021388 | Bacteria | 127864 |
| 445 | Ga0224572_1027221 | 3300024225 | Unclassified | 1096 |
| 446 | Ga0207666_1013846 | 3300025271 | Bacteria | 1135 |
| 447 | Ga0207697_10015842 | 3300025315 | Bacteria | 3110 |
| 448 | Ga0207697_10051119 | 3300025315 | Bacteria | 1707 |
| 449 | Ga0207697_10119867 | 3300025315 | Bacteria | 1131 |
| 450 | Ga0207692_10257140 | 3300025898 | Bacteria | 1048 |
| 451 | Ga0207642_10009995 | 3300025899 | Bacteria | 3324 |
| 452 | Ga0207710_10012977 | 3300025900 | Bacteria | 3510 |
| 453 | Ga0207680_10000026 | 3300025903 | Bacteria | 79960 |
| 454 | Ga0207680_10080291 | 3300025903 | Bacteria | 2048 |
| 455 | Ga0207685_10000023 | 3300025905 | Bacteria | 115280 |
| 456 | Ga0207685_10159805 | 3300025905 | Bacteria | 1028 |
| 457 | Ga0207645_10033456 | 3300025907 | Bacteria | 3303 |
| 458 | Ga0207645_10045536 | 3300025907 | Bacteria | 2803 |
| 459 | Ga0207645_10113813 | 3300025907 | Bacteria | 1753 |
| 460 | Ga0207643_10007761 | 3300025908 | Bacteria | 5762 |
| 461 | Ga0207643_10015988 | 3300025908 | Bacteria | 4087 |
| 462 | Ga0207643_10024274 | 3300025908 | Bacteria | 3345 |
| 463 | Ga0207705_10018748 | 3300025909 | Bacteria | 4950 |
| 464 | Ga0207705_10058112 | 3300025909 | Bacteria | 2790 |
| 465 | Ga0207705_10103501 | 3300025909 | Bacteria | 2097 |
| 466 | Ga0207684_10184370 | 3300025910 | Bacteria | 1800 |
| 467 | Ga0207654_10017779 | 3300025911 | Bacteria | 3722 |
| 468 | Ga0207654_10204747 | 3300025911 | Bacteria | 1301 |
| 469 | Ga0207707_10000016 | 3300025912 | Bacteria | 256002 |
| 470 | Ga0207707_10043354 | 3300025912 | Bacteria | 3925 |
| 471 | Ga0207695_10002632 | 3300025913 | Bacteria | 26269 |
| 472 | Ga0207695_10007786 | 3300025913 | Bacteria | 13565 |
| 473 | Ga0207695_10036125 | 3300025913 | Bacteria | 5345 |
| 474 | Ga0207695_10046004 | 3300025913 | Bacteria | 4627 |
| 475 | Ga0207695_10254956 | 3300025913 | Bacteria | 1653 |
| 476 | Ga0207695_10332193 | 3300025913 | Bacteria | 1408 |
| 477 | Ga0207671_10016462 | 3300025914 | Bacteria | 5745 |
| 478 | Ga0207671_10132108 | 3300025914 | Bacteria | 1917 |
| 479 | Ga0207671_10264501 | 3300025914 | Bacteria | 1354 |
| 480 | Ga0207663_10019437 | 3300025916 | Bacteria | 3826 |
| 481 | Ga0207663_10197483 | 3300025916 | Bacteria | 1449 |
| 482 | Ga0207660_10000079 | 3300025917 | Bacteria | 51036 |
| 483 | Ga0207660_10017505 | 3300025917 | Bacteria | 4762 |
| 484 | Ga0207660_10050450 | 3300025917 | Bacteria | 2955 |
| 485 | Ga0207660_10157918 | 3300025917 | Bacteria | 1747 |
| 486 | Ga0207662_10020201 | 3300025918 | Bacteria | 3799 |
| 487 | Ga0207662_10029348 | 3300025918 | Bacteria | 3186 |
| 488 | Ga0207662_10051449 | 3300025918 | Bacteria | 2451 |
| 489 | Ga0207662_10093187 | 3300025918 | Bacteria | 1856 |
| 490 | Ga0207657_10501511 | 3300025919 | Bacteria | 951 |
| 491 | Ga0207649_10221292 | 3300025920 | Bacteria | 1348 |
| 492 | Ga0207649_10718163 | 3300025920 | Bacteria | 776 |
| 493 | Ga0207649_10806423 | 3300025920 | Bacteria | 733 |
| 494 | Ga0207652_10000126 | 3300025921 | Bacteria | 82522 |
| 495 | Ga0207652_10001189 | 3300025921 | Bacteria | 23425 |
| 496 | Ga0207652_10001467 | 3300025921 | Bacteria | 20866 |
| 497 | Ga0207652_10078720 | 3300025921 | Bacteria | 2879 |
| 498 | Ga0207646_10001755 | 3300025922 | Bacteria | 26294 |
| 499 | Ga0207646_10641288 | 3300025922 | Bacteria | 952 |
| 500 | Ga0207681_10007311 | 3300025923 | Bacteria | 6768 |
| 501 | Ga0207681_10016199 | 3300025923 | Bacteria | 4658 |
| 502 | Ga0207681_10095493 | 3300025923 | Bacteria | 2132 |
| 503 | Ga0207681_10099304 | 3300025923 | Unclassified | 2096 |
| 504 | Ga0207681_10573224 | 3300025923 | Unclassified | 930 |
| 505 | Ga0207694_10003533 | 3300025924 | Bacteria | 12412 |
| 506 | Ga0207694_10087008 | 3300025924 | Bacteria | 2461 |
| 507 | Ga0207694_10135101 | 3300025924 | Bacteria | 1980 |
| 508 | Ga0207650_10009261 | 3300025925 | Bacteria | 6729 |
| 509 | Ga0207650_10028897 | 3300025925 | Bacteria | 3980 |
| 510 | Ga0207650_10077348 | 3300025925 | Bacteria | 2515 |
| 511 | Ga0207650_10561972 | 3300025925 | Bacteria | 957 |
| 512 | Ga0207659_10015083 | 3300025926 | Bacteria | 4997 |
| 513 | Ga0207659_10099913 | 3300025926 | Bacteria | 2185 |
| 514 | Ga0207659_10198842 | 3300025926 | Bacteria | 1599 |
| 515 | Ga0207687_10003331 | 3300025927 | Bacteria | 10852 |
| 516 | Ga0207687_10137164 | 3300025927 | Bacteria | 1851 |
| 517 | Ga0207687_10384391 | 3300025927 | Bacteria | 1151 |
| 518 | Ga0207687_10390981 | 3300025927 | Bacteria | 1142 |
| 519 | Ga0207687_10527064 | 3300025927 | Bacteria | 989 |
| 520 | Ga0207700_10148785 | 3300025928 | Bacteria | 1933 |
| 521 | Ga0207664_10065302 | 3300025929 | Bacteria | 2913 |
| 522 | Ga0207644_10003034 | 3300025931 | Bacteria | 10801 |
| 523 | Ga0207644_10059615 | 3300025931 | Bacteria | 2760 |
| 524 | Ga0207644_10199918 | 3300025931 | Bacteria | 1576 |
| 525 | Ga0207644_10428572 | 3300025931 | Bacteria | 1084 |
| 526 | Ga0207644_10517637 | 3300025931 | Bacteria | 985 |
| 527 | Ga0207706_10099379 | 3300025933 | Unclassified | 2560 |
| 528 | Ga0207706_10136534 | 3300025933 | Bacteria | 2157 |
| 529 | Ga0207706_10266770 | 3300025933 | Bacteria | 1494 |
| 530 | Ga0207706_10298137 | 3300025933 | Bacteria | 1405 |
| 531 | Ga0207686_10117237 | 3300025934 | Bacteria | 1806 |
| 532 | Ga0207709_10081600 | 3300025935 | Unclassified | 2086 |
| 533 | Ga0207709_10470568 | 3300025935 | Bacteria | 975 |
| 534 | Ga0207670_10008737 | 3300025936 | Bacteria | 5736 |
| 535 | Ga0207670_10195508 | 3300025936 | Bacteria | 1533 |
| 536 | Ga0207670_10259357 | 3300025936 | Bacteria | 1347 |
| 537 | Ga0207670_10331897 | 3300025936 | Bacteria | 1199 |
| 538 | Ga0207669_10917376 | 3300025937 | Bacteria | 732 |
| 539 | Ga0207704_10037543 | 3300025938 | Bacteria | 2799 |
| 540 | Ga0207704_10186020 | 3300025938 | Bacteria | 1506 |
| 541 | Ga0207704_10294051 | 3300025938 | Bacteria | 1241 |
| 542 | Ga0207665_10000017 | 3300025939 | Bacteria | 130585 |
| 543 | Ga0207665_10041949 | 3300025939 | Bacteria | 3057 |
| 544 | Ga0207691_10000594 | 3300025940 | Bacteria | 36084 |
| 545 | Ga0207691_10003897 | 3300025940 | Bacteria | 14494 |
| 546 | Ga0207691_10049987 | 3300025940 | Bacteria | 3829 |
| 547 | Ga0207691_10051610 | 3300025940 | Bacteria | 3759 |
| 548 | Ga0207691_10074874 | 3300025940 | Bacteria | 3053 |
| 549 | Ga0207691_10138386 | 3300025940 | Bacteria | 2146 |
| 550 | Ga0207691_10382880 | 3300025940 | Bacteria | 1201 |
| 551 | Ga0207711_10000721 | 3300025941 | Bacteria | 32580 |
| 552 | Ga0207711_10001193 | 3300025941 | Bacteria | 24619 |
| 553 | Ga0207711_10051610 | 3300025941 | Bacteria | 3523 |
| 554 | Ga0207711_10091975 | 3300025941 | Bacteria | 2669 |
| 555 | Ga0207711_10098208 | 3300025941 | Plasmid | 2587 |
| 556 | Ga0207711_10359143 | 3300025941 | Bacteria | 1349 |
| 557 | Ga0207711_10529258 | 3300025941 | Bacteria | 1099 |
| 558 | Ga0207711_10562419 | 3300025941 | Bacteria | 1064 |
| 559 | Ga0207689_10001176 | 3300025942 | Bacteria | 25213 |
| 560 | Ga0207689_10013959 | 3300025942 | Bacteria | 6842 |
| 561 | Ga0207689_10045396 | 3300025942 | Bacteria | 3633 |
| 562 | Ga0207689_10057302 | 3300025942 | Bacteria | 3205 |
| 563 | Ga0207689_10410248 | 3300025942 | Bacteria | 1130 |
| 564 | Ga0207661_10070344 | 3300025944 | Bacteria | 2857 |
| 565 | Ga0207661_10157316 | 3300025944 | Bacteria | 1969 |
| 566 | Ga0207661_10229512 | 3300025944 | Bacteria | 1643 |
| 567 | Ga0207661_10521957 | 3300025944 | Bacteria | 1086 |
| 568 | Ga0207679_10104137 | 3300025945 | Unclassified | 2226 |
| 569 | Ga0207679_11138643 | 3300025945 | Bacteria | 716 |
| 570 | Ga0207667_10207773 | 3300025949 | Bacteria | 2007 |
| 571 | Ga0207651_10023087 | 3300025960 | Bacteria | 3818 |
| 572 | Ga0207651_10024485 | 3300025960 | Bacteria | 3735 |
| 573 | Ga0207651_10053646 | 3300025960 | Bacteria | 2757 |
| 574 | Ga0207651_10089104 | 3300025960 | Bacteria | 2251 |
| 575 | Ga0207651_10167274 | 3300025960 | Bacteria | 1730 |
| 576 | Ga0207651_10208490 | 3300025960 | Bacteria | 1571 |
| 577 | Ga0207651_10534800 | 3300025960 | Bacteria | 1017 |
| 578 | Ga0207651_10617164 | 3300025960 | Bacteria | 949 |
| 579 | Ga0207651_10921762 | 3300025960 | Bacteria | 779 |
| 580 | Ga0207712_10015915 | 3300025961 | Bacteria | 4860 |
| 581 | Ga0207712_10063517 | 3300025961 | Bacteria | 2629 |
| 582 | Ga0207712_10086455 | 3300025961 | Bacteria | 2297 |
| 583 | Ga0207712_10120984 | 3300025961 | Bacteria | 1981 |
| 584 | Ga0207712_10124954 | 3300025961 | Bacteria | 1952 |
| 585 | Ga0207668_10027609 | 3300025972 | Bacteria | 3699 |
| 586 | Ga0207668_10250477 | 3300025972 | Bacteria | 1438 |
| 587 | Ga0207668_10285306 | 3300025972 | Bacteria | 1356 |
| 588 | Ga0207640_10022067 | 3300025981 | Bacteria | 3804 |
| 589 | Ga0207640_10197829 | 3300025981 | Bacteria | 1520 |
| 590 | Ga0207640_10212509 | 3300025981 | Bacteria | 1475 |
| 591 | Ga0207640_10344166 | 3300025981 | Bacteria | 1195 |
| 592 | Ga0207658_10008660 | 3300025986 | Bacteria | 6913 |
| 593 | Ga0207658_10193385 | 3300025986 | Bacteria | 1693 |
| 594 | Ga0207658_10264806 | 3300025986 | Bacteria | 1466 |
| 595 | Ga0207677_10035821 | 3300026023 | Bacteria | 3227 |
| 596 | Ga0207677_10052878 | 3300026023 | Bacteria | 2762 |
| 597 | Ga0207677_10100828 | 3300026023 | Bacteria | 2124 |
| 598 | Ga0207677_10122851 | 3300026023 | Bacteria | 1956 |
| 599 | Ga0207677_10219234 | 3300026023 | Bacteria | 1525 |
| 600 | Ga0207677_10329699 | 3300026023 | Bacteria | 1271 |
| 601 | Ga0207677_10971601 | 3300026023 | Bacteria | 769 |
| 602 | Ga0207703_10004551 | 3300026035 | Bacteria | 11366 |
| 603 | Ga0207703_10008595 | 3300026035 | Bacteria | 8059 |
| 604 | Ga0207703_10019889 | 3300026035 | Bacteria | 5247 |
| 605 | Ga0207703_10245381 | 3300026035 | Bacteria | 1612 |
| 606 | Ga0207703_11568638 | 3300026035 | Bacteria | 633 |
| 607 | Ga0207639_10027552 | 3300026041 | Bacteria | 4141 |
| 608 | Ga0207639_10061339 | 3300026041 | Bacteria | 2904 |
| 609 | Ga0207639_11346662 | 3300026041 | Bacteria | 670 |
| 610 | Ga0207708_10099654 | 3300026075 | Unclassified | 2248 |
| 611 | Ga0207708_10120090 | 3300026075 | Bacteria | 2047 |
| 612 | Ga0207702_10102609 | 3300026078 | Bacteria | 2528 |
| 613 | Ga0207702_10161665 | 3300026078 | Bacteria | 2045 |
| 614 | Ga0207641_10000167 | 3300026088 | Bacteria | 92790 |
| 615 | Ga0207641_10028444 | 3300026088 | Bacteria | 4619 |
| 616 | Ga0207641_10038609 | 3300026088 | Bacteria | 3992 |
| 617 | Ga0207641_10049850 | 3300026088 | Bacteria | 3540 |
| 618 | Ga0207641_10231802 | 3300026088 | Bacteria | 1716 |
| 619 | Ga0207648_10009103 | 3300026089 | Bacteria | 9543 |
| 620 | Ga0207648_10010832 | 3300026089 | Bacteria | 8618 |
| 621 | Ga0207648_10054277 | 3300026089 | Bacteria | 3501 |
| 622 | Ga0207648_10131333 | 3300026089 | Bacteria | 2204 |
| 623 | Ga0207676_10000992 | 3300026095 | Bacteria | 21875 |
| 624 | Ga0207676_10006875 | 3300026095 | Bacteria | 8059 |
| 625 | Ga0207676_10007550 | 3300026095 | Bacteria | 7715 |
| 626 | Ga0207676_10071490 | 3300026095 | Bacteria | 2786 |
| 627 | Ga0207676_10074099 | 3300026095 | Bacteria | 2741 |
| 628 | Ga0207676_10114610 | 3300026095 | Bacteria | 2261 |
| 629 | Ga0207676_10352948 | 3300026095 | Unclassified | 1360 |
| 630 | Ga0207674_10000454 | 3300026116 | Bacteria | 53564 |
| 631 | Ga0207674_10013502 | 3300026116 | Bacteria | 9057 |
| 632 | Ga0207674_10194377 | 3300026116 | Bacteria | 1979 |
| 633 | Ga0207674_10224884 | 3300026116 | Bacteria | 1825 |
| 634 | Ga0207675_100000594 | 3300026118 | Bacteria | 35413 |
| 635 | Ga0207675_100008267 | 3300026118 | Bacteria | 9801 |
| 636 | Ga0207675_100046173 | 3300026118 | Bacteria | 4068 |
| 637 | Ga0207675_100087097 | 3300026118 | Bacteria | 2933 |
| 638 | Ga0207675_100719580 | 3300026118 | Bacteria | 1008 |
| 639 | Ga0207675_100962859 | 3300026118 | Bacteria | 871 |
| 640 | Ga0207683_10203262 | 3300026121 | Bacteria | 1801 |
| 641 | Ga0207683_10269912 | 3300026121 | Bacteria | 1554 |
| 642 | Ga0207683_10306134 | 3300026121 | Bacteria | 1454 |
| 643 | Ga0207698_10041298 | 3300026142 | Plasmid | 3436 |
| 644 | Ga0207698_10167275 | 3300026142 | Bacteria | 1931 |
| 645 | Ga0207698_10210632 | 3300026142 | Bacteria | 1748 |
| 646 | Ga0207698_10677490 | 3300026142 | Bacteria | 1024 |
| 647 | Ga0207698_10695059 | 3300026142 | Bacteria | 1011 |
| 648 | Ga0209981_1029963 | 3300027378 | Bacteria | 796 |
| 649 | Ga0209179_1000063 | 3300027512 | Bacteria | 19219 |
| 650 | Ga0209588_1001752 | 3300027671 | Bacteria | 5750 |
| 651 | Ga0207428_10158543 | 3300027907 | Bacteria | 1719 |
| 652 | Ga0268266_10000088 | 3300028379 | Bacteria | 199029 |
| 653 | Ga0268265_10034020 | 3300028380 | Bacteria | 3711 |
| 654 | Ga0268265_10046160 | 3300028380 | Unclassified | 3255 |
| 655 | Ga0268265_10521294 | 3300028380 | Bacteria | 1123 |
| 656 | Ga0268265_10532441 | 3300028380 | Bacteria | 1112 |
| 657 | Ga0268264_10007287 | 3300028381 | Bacteria | 9257 |
| 658 | Ga0268264_10013625 | 3300028381 | Bacteria | 6692 |
| 659 | Ga0268264_10014801 | 3300028381 | Bacteria | 6407 |
| 660 | Ga0268264_10024262 | 3300028381 | Bacteria | 4951 |
| 661 | Ga0268264_10061513 | 3300028381 | Bacteria | 3150 |
| 662 | Ga0268264_10061901 | 3300028381 | Bacteria | 3141 |
| 663 | Ga0268264_10064096 | 3300028381 | Bacteria | 3092 |
| 664 | Ga0268264_10119274 | 3300028381 | Bacteria | 2323 |
| 665 | Ga0268264_10120617 | 3300028381 | Bacteria | 2310 |
| 666 | Ga0265337_1004481 | 3300028556 | Bacteria | 5786 |
| 667 | Ga0265337_1014316 | 3300028556 | Unclassified | 2632 |
| 668 | Ga0265337_1073910 | 3300028556 | Bacteria | 935 |
| 669 | Ga0265319_1000297 | 3300028563 | Bacteria | 36855 |
| 670 | Ga0265334_10001759 | 3300028573 | Bacteria | 10350 |
| 671 | Ga0265334_10072004 | 3300028573 | Bacteria | 1286 |
| 672 | Ga0265318_10000045 | 3300028577 | Bacteria | 127051 |
| 673 | Ga0265318_10006110 | 3300028577 | Bacteria | 5582 |
| 674 | Ga0265336_10000194 | 3300028666 | Bacteria | 42728 |
| 675 | Ga0265336_10136161 | 3300028666 | Bacteria | 731 |
| 676 | Ga0307515_10088846 | 3300028794 | Bacteria | 3899 |
| 677 | Ga0265338_10000273 | 3300028800 | Bacteria | 94209 |
| 678 | Ga0265338_10002518 | 3300028800 | Bacteria | 27237 |
| 679 | Ga0265338_10053985 | 3300028800 | Bacteria | 3588 |
| 680 | Ga0265338_10070056 | 3300028800 | Bacteria | 3009 |
| 681 | Ga0265324_10000013 | 3300029957 | Bacteria | 195334 |
| 682 | Ga0265324_10000399 | 3300029957 | Bacteria | 31271 |
| 683 | Ga0265324_10011238 | 3300029957 | Bacteria | 3417 |
| 684 | Ga0265324_10022786 | 3300029957 | Bacteria | 2236 |
| 685 | Ga0265760_10005102 | 3300031090 | Bacteria | 3760 |
| 686 | Ga0265330_10000023 | 3300031235 | Bacteria | 150143 |
| 687 | Ga0265332_10000040 | 3300031238 | Bacteria | 126865 |
| 688 | Ga0265332_10026189 | 3300031238 | Bacteria | 2558 |
| 689 | Ga0265332_10092026 | 3300031238 | Bacteria | 1282 |
| 690 | Ga0265328_10015993 | 3300031239 | Bacteria | 2928 |
| 691 | Ga0265320_10000022 | 3300031240 | Bacteria | 172278 |
| 692 | Ga0265320_10000494 | 3300031240 | Bacteria | 30746 |
| 693 | Ga0265320_10364122 | 3300031240 | Bacteria | 639 |
| 694 | Ga0265325_10016374 | 3300031241 | Bacteria | 4146 |
| 695 | Ga0265325_10042944 | 3300031241 | Bacteria | 2361 |
| 696 | Ga0265329_10026242 | 3300031242 | Bacteria | 1921 |
| 697 | Ga0265340_10023753 | 3300031247 | Bacteria | 3123 |
| 698 | Ga0265339_10000022 | 3300031249 | Bacteria | 171562 |
| 699 | Ga0265339_10058958 | 3300031249 | Bacteria | 2071 |
| 700 | Ga0265339_10173091 | 3300031249 | Bacteria | 1079 |
| 701 | Ga0265331_10000001 | 3300031250 | Bacteria | 798836 |
| 702 | Ga0265331_10064464 | 3300031250 | Bacteria | 1725 |
| 703 | Ga0265331_10108435 | 3300031250 | Bacteria | 1274 |
| 704 | Ga0265327_10000426 | 3300031251 | Bacteria | 76984 |
| 705 | Ga0265316_10001556 | 3300031344 | Bacteria | 24596 |
| 706 | Ga0265316_10024131 | 3300031344 | Bacteria | 5103 |
| 707 | Ga0265316_10214381 | 3300031344 | Bacteria | 1423 |
| 708 | Ga0265316_10291342 | 3300031344 | Bacteria | 1191 |
| 709 | Ga0307408_100015226 | 3300031548 | Bacteria | 5120 |
| 710 | Ga0265313_10000018 | 3300031595 | Bacteria | 151941 |
| 711 | Ga0265313_10002159 | 3300031595 | Bacteria | 17467 |
| 712 | Ga0265313_10003735 | 3300031595 | Bacteria | 12111 |
| 713 | Ga0316575_10011634 | 3300031665 | Bacteria | 3259 |
| 714 | Ga0316579_10012325 | 3300031691 | Bacteria | 3655 |
| 715 | Ga0265314_10000006 | 3300031711 | Bacteria | 540431 |
| 716 | Ga0265314_10008212 | 3300031711 | Bacteria | 8970 |
| 717 | Ga0265314_10093905 | 3300031711 | Bacteria | 1946 |
| 718 | Ga0265314_10128497 | 3300031711 | Bacteria | 1584 |
| 719 | Ga0265342_10007381 | 3300031712 | Bacteria | 8057 |
| 720 | Ga0265342_10014422 | 3300031712 | Bacteria | 5245 |
| 721 | Ga0265342_10034447 | 3300031712 | Bacteria | 3107 |
| 722 | Ga0316576_10024142 | 3300031727 | Bacteria | 4243 |
| 723 | Ga0316578_10005251 | 3300031728 | Bacteria | 6251 |
| 724 | Ga0316577_10009514 | 3300031733 | Bacteria | 5230 |
| 725 | Ga0307409_100118493 | 3300031995 | Bacteria | 2236 |
| 726 | Ga0307416_100181409 | 3300032002 | Bacteria | 1974 |
| 727 | Ga0307416_100578416 | 3300032002 | Bacteria | 1200 |
| 728 | Ga0307414_10025626 | 3300032004 | Unclassified | 3782 |
| 729 | Ga0307414_10031339 | 3300032004 | Bacteria | 3487 |
| 730 | Ga0307411_10326559 | 3300032005 | Bacteria | 1241 |
| 731 | Ga0316580_10000633 | 3300032139 | Bacteria | 8287 |
| 732 | Ga0316592_1105039 | 3300033524 | Bacteria | 651 |
| 733 | Ga0373956_0021341 | 3300035119 | Bacteria | 2763 |
| 734 | Ga0373943_0431794 | 3300035170 | Bacteria | 763 |
| 735 | Ga0373946_0030639 | 3300035171 | Bacteria | 2149 |
| 736 | Ga0373955_0020220 | 3300035172 | Bacteria | 3343 |
| 737 | Ga0373955_0189735 | 3300035172 | Bacteria | 1222 |
| 738 | Ga0316574_0033312 | 3300035398 | Bacteria | 3135 |
| 739 | Ga0373931_0065013 | 3300035691 | Bacteria | 1976 |
| 740 | Ga0373931_0076780 | 3300035691 | Bacteria | 1836 |
| 741 | Ga0373933_0216268 | 3300035724 | Bacteria | 1229 |
| 742 | Ga0373937_0129582 | 3300036401 | Bacteria | 2356 |
| 743 | Ga0373937_0346860 | 3300036401 | Bacteria | 1406 |
| 744 | Ga0373937_0651921 | 3300036401 | Bacteria | 998 |
| 745 | Ga0316582_0011550 | 3300036647 | Bacteria | 4887 |
| 746 | Ga0316584_0101297 | 3300036712 | Bacteria | 2156 |
| 747 | Ga0373925_0015234 | 3300037068 | Bacteria | 5559 |
| 748 | Ga0395898_0544070 | 3300037466 | Bacteria | 1103 |
| 749 | Ga0395905_0107621 | 3300037471 | Bacteria | 2617 |
| 750 | Ga0395905_0493689 | 3300037471 | Bacteria | 1124 |
| 751 | Ga0316581_0000048 | 3300037588 | Bacteria | 13503 |
| 752 | Ga0436364_0079644 | 3300037853 | Bacteria | 315114 |
| 753 | Ga0436364_0354394 | 3300037853 | Bacteria | 1016 |
| 754 | Ga0436364_0764741 | 3300037853 | Bacteria | 2601 |
| 755 | Ga0436364_0815975 | 3300037853 | Bacteria | 1830 |
| 756 | Ga0436364_1367354 | 3300037853 | Bacteria | 1997 |
| 757 | Ga0436364_1506799 | 3300037853 | Bacteria | 3052 |
| 758 | Ga0436365_0861631 | 3300039437 | Bacteria | 6867 |
| 759 | Ga0436363_0543025 | 3300039450 | Bacteria | 837 |
| 760 | Ga0436363_0549965 | 3300039450 | Bacteria | 952 |
| 761 | Ga0436363_0589199 | 3300039450 | Bacteria | 1027 |
| 762 | Ga0439466_0068944 | 3300041411 | Bacteria | 1129 |
| 763 | Ga0451807_0610239 | 3300041486 | Bacteria | 1994 |
| 764 | Ga0451845_0935863 | 3300041501 | Bacteria | 992 |
| 765 | Ga0439449_0018604 | 3300042007 | Bacteria | 2607 |
| 766 | Ga0450897_007139 | 3300042128 | Bacteria | 1014 |
| 767 | Ga0439434_0015100 | 3300042435 | Bacteria | 2301 |
| 768 | Ga0451577_0050866 | 3300042876 | Bacteria | 3699 |
| 769 | Ga0451577_0118834 | 3300042876 | Bacteria | 2367 |
| 770 | Ga0453683_0105437 | 3300044673 | Bacteria | 1771 |
| 771 | Ga0466963_0300837 | 3300044694 | Bacteria | 1128 |
| 772 | Ga0466964_0080747 | 3300044706 | Bacteria | 1395 |
| 773 | Ga0453684_0014309 | 3300044712 | Bacteria | 12714 |
| 774 | Ga0453684_0037782 | 3300044712 | Bacteria | 6621 |
| 775 | Ga0453684_0078632 | 3300044712 | Bacteria | 4126 |
| 776 | Ga0453684_0112732 | 3300044712 | Bacteria | 3300 |
| 777 | Ga0453684_0212442 | 3300044712 | Bacteria | 2248 |
| 778 | Ga0453684_0438993 | 3300044712 | Bacteria | 1455 |
| 779 | Ga0453684_0561261 | 3300044712 | Bacteria | 1256 |
| 780 | Ga0453684_0614798 | 3300044712 | Bacteria | 1189 |
| 781 | Ga0466957_0556086 | 3300044842 | Bacteria | 800 |
| 782 | Ga0466959_0021949 | 3300045049 | Bacteria | 4715 |
| 783 | Ga0451576_0023531 | 3300045051 | Bacteria | 6669 |
| 784 | Ga0451576_0631538 | 3300045051 | Bacteria | 1125 |
| 785 | Ga0451576_0775211 | 3300045051 | Bacteria | 1007 |
| 786 | Ga0451576_0812589 | 3300045051 | Bacteria | 982 |
| 787 | Ga0466967_0729660 | 3300045976 | Bacteria | 982 |
| 788 | Ga0495592_0040018 | 3300046454 | Bacteria | 3519 |
| 789 | Ga0495653_0000035 | 3300046463 | Bacteria | 129875 |
| 790 | Ga0495653_0223216 | 3300046463 | Bacteria | 1266 |
| 791 | Ga0495650_0014587 | 3300046471 | Bacteria | 4075 |
| 792 | Ga0495580_0081182 | 3300046472 | Bacteria | 2260 |
| 793 | Ga0495662_0013922 | 3300046476 | Unclassified | 3916 |
| 794 | Ga0495594_0027028 | 3300046499 | Bacteria | 3091 |
| 795 | Ga0495594_0229656 | 3300046499 | Bacteria | 1058 |
| 796 | Ga0495606_0000512 | 3300046507 | Bacteria | 63012 |
| 797 | Ga0495610_0324939 | 3300046512 | Bacteria | 586 |
| 798 | Ga0495618_0056940 | 3300046514 | Bacteria | 2475 |
| 799 | Ga0495630_0886623 | 3300046517 | Bacteria | 680 |
| 800 | Ga0495652_0393246 | 3300046529 | Bacteria | 983 |
| 801 | Ga0495634_0096519 | 3300046642 | Unclassified | 1914 |
| 802 | Ga0495588_0046713 | 3300046674 | Bacteria | 2221 |
| 803 | Ga0495599_0008979 | 3300046678 | Bacteria | 6089 |
| 804 | Ga0495613_0044931 | 3300046689 | Unclassified | 3267 |
| 805 | Ga0495624_0284016 | 3300046690 | Bacteria | 999 |
| 806 | Ga0495671_0000005 | 3300046692 | Bacteria | 509397 |
| 807 | Ga0495604_0130923 | 3300047317 | Bacteria | 1803 |
| 808 | Ga0495674_0023447 | 3300047319 | Bacteria | 5687 |
| 809 | Ga0495674_0116362 | 3300047319 | Bacteria | 2262 |
| 810 | Ga0495674_0147007 | 3300047319 | Bacteria | 1978 |
| 811 | Ga0495680_0584244 | 3300047322 | Bacteria | 749 |
| 812 | Ga0495675_0084671 | 3300047444 | Bacteria | 1995 |
| 813 | Ga0495673_0000012 | 3300047469 | Bacteria | 656908 |
| 814 | Ga0495684_0062255 | 3300047471 | Unclassified | 2838 |
| 815 | Ga0495684_0062389 | 3300047471 | Bacteria | 2835 |
| 816 | Ga0495686_0161910 | 3300047472 | Bacteria | 1307 |
| 817 | Ga0496100_0286203 | 3300048903 | Bacteria | 1230 |
| 818 | Ga0496103_0070932 | 3300048906 | Bacteria | 2180 |
| 819 | Ga0496104_0003103 | 3300048907 | Bacteria | 14325 |
| 820 | Ga0496104_0025034 | 3300048907 | Bacteria | 5498 |
| 821 | Ga0496104_0597651 | 3300048907 | Bacteria | 1014 |
| 822 | Ga0496105_0005857 | 3300048908 | Bacteria | 9375 |
| 823 | Ga0496106_0111339 | 3300048909 | Bacteria | 2132 |
| 824 | Ga0496106_0317353 | 3300048909 | Bacteria | 1251 |
| 825 | Ga0496106_0911339 | 3300048909 | Bacteria | 694 |
| 826 | Ga0496108_0019732 | 3300048911 | Bacteria | 5537 |
| 827 | Ga0496109_0481941 | 3300048912 | Bacteria | 1171 |
| 828 | Ga0496110_0008210 | 3300048913 | Bacteria | 8391 |
| 829 | Ga0496110_0551343 | 3300048913 | Bacteria | 1048 |
| 830 | Ga0496110_0890432 | 3300048913 | Bacteria | 796 |
| 831 | Ga0496111_0058388 | 3300048914 | Bacteria | 2793 |
| 832 | Ga0496112_0058302 | 3300048915 | Bacteria | 3802 |
| 833 | Ga0496112_0094967 | 3300048915 | Bacteria | 2953 |
| 834 | Ga0496112_0873277 | 3300048915 | Bacteria | 822 |
| 835 | Ga0496114_0074194 | 3300048917 | Bacteria | 2864 |
| 836 | Ga0496114_0081551 | 3300048917 | Bacteria | 2733 |
| 837 | Ga0496126_0012839 | 3300048929 | Bacteria | 8560 |
| 838 | Ga0501033_0000264 | 3300049570 | Bacteria | 50307 |
| 839 | Ga0501033_0297342 | 3300049570 | Bacteria | 1137 |
| 840 | Ga0501034_0000572 | 3300049571 | Bacteria | 58406 |
| 841 | Ga0501036_0033995 | 3300049572 | Bacteria | 4312 |
| 842 | Ga0501036_0034780 | 3300049572 | Bacteria | 4263 |
| 843 | Ga0501036_0259485 | 3300049572 | Bacteria | 1456 |
| 844 | Ga0501037_0059323 | 3300049573 | Bacteria | 2792 |
| 845 | Ga0501037_0095488 | 3300049573 | Bacteria | 2149 |
| 846 | Ga0501038_0304412 | 3300049574 | Bacteria | 1250 |
| 847 | Ga0501042_0079935 | 3300049578 | Bacteria | 2343 |
| 848 | Ga0501043_0026599 | 3300049579 | Bacteria | 4539 |
| 849 | Ga0501047_0010345 | 3300049581 | Bacteria | 8824 |
| 850 | Ga0501047_0266255 | 3300049581 | Bacteria | 1561 |
| 851 | Ga0501070_0011014 | 3300049586 | Bacteria | 7633 |
| 852 | Ga0501070_0035279 | 3300049586 | Bacteria | 4180 |
| 853 | Ga0501070_0289198 | 3300049586 | Bacteria | 1336 |
| 854 | Ga0501073_0060831 | 3300049589 | Bacteria | 2636 |
| 855 | Ga0501075_0113250 | 3300049591 | Bacteria | 2062 |
| 856 | Ga0501242_001168 | 3300049674 | Bacteria | 2578 |
| 857 | Ga0501249_091320 | 3300049679 | Bacteria | 722 |
| 858 | Ga0501259_004679 | 3300049688 | Bacteria | 2170 |
| 859 | Ga0501245_017126 | 3300049708 | Bacteria | 1105 |
| 860 | Ga0501079_0070256 | 3300049741 | Bacteria | 2704 |
| 861 | Ga0501080_0101414 | 3300049742 | Bacteria | 2670 |
| 862 | Ga0501080_0506903 | 3300049742 | Bacteria | 1078 |
| 863 | Ga0501080_0758658 | 3300049742 | Bacteria | 853 |
| 864 | Ga0501268_054545 | 3300049765 | Bacteria | 780 |
| 865 | Ga0501035_0010184 | 3300049822 | Bacteria | 8726 |
| 866 | Ga0501035_0182250 | 3300049822 | Bacteria | 1809 |
| 867 | Ga0501044_0004459 | 3300049823 | Bacteria | 15661 |
| 868 | Ga0501044_0048547 | 3300049823 | Bacteria | 4384 |
| 869 | nmdc:mga0k408_24387_c1 | 3300050493 | Bacteria | 3418 |
| 870 | nmdc:mga05p37_102095_c1 | 3300050507 | Bacteria | 3532 |
| 871 | nmdc:mga05p37_198967_c2 | 3300050507 | Bacteria | 1736 |
| 872 | nmdc:mga05p37_203516_c1 | 3300050507 | Bacteria | 2396 |
| 873 | nmdc:mga05p37_33027_c1 | 3300050507 | Bacteria | 6336 |
| 874 | nmdc:mga05p37_627909_c1 | 3300050507 | Bacteria | 1208 |
| 875 | nmdc:mga05p37_657753_c1 | 3300050507 | Bacteria | 1172 |
| 876 | nmdc:mga05p37_737532_c1 | 3300050507 | Bacteria | 1088 |
| 877 | nmdc:mga09592_178409_c1 | 3300050508 | Bacteria | 1837 |
| 878 | nmdc:mga09592_222184_c1 | 3300050508 | Bacteria | 1636 |
| 879 | nmdc:mga09592_235355_c1 | 3300050508 | Bacteria | 1587 |
| 880 | nmdc:mga09592_2772_c1 | 3300050508 | Bacteria | 14182 |
| 881 | nmdc:mga0qj67_117716_c1 | 3300050509 | Bacteria | 2147 |
| 882 | nmdc:mga0qj67_131778_c1 | 3300050509 | Bacteria | 2025 |
| 883 | nmdc:mga06r32_19954_c1 | 3300050510 | Bacteria | 6162 |
| 884 | nmdc:mga08y16_134086_c1 | 3300050511 | Bacteria | 2574 |
| 885 | nmdc:mga08y16_531580_c1 | 3300050511 | Bacteria | 1192 |
| 886 | nmdc:mga08y16_96242_c1 | 3300050511 | Bacteria | 3083 |
| 887 | nmdc:mga0n895_157271_c1 | 3300050512 | Bacteria | 2303 |
| 888 | nmdc:mga0n895_193524_c1 | 3300050512 | Bacteria | 2065 |
| 889 | nmdc:mga0n895_392230_c1 | 3300050512 | Bacteria | 1404 |
| 890 | nmdc:mga0n895_522486_c1 | 3300050512 | Bacteria | 1194 |
| 891 | nmdc:mga0n895_671925_c1 | 3300050512 | Bacteria | 1033 |
| 892 | nmdc:mga0n895_796916_c1 | 3300050512 | Bacteria | 935 |
| 893 | nmdc:mga0n895_984857_c1 | 3300050512 | Bacteria | 825 |
| 894 | nmdc:mga0rr50_158622_c1 | 3300050513 | Bacteria | 1834 |
| 895 | nmdc:mga0rr50_236_c1 | 3300050513 | Bacteria | 29962 |
| 896 | nmdc:mga08x19_167633_c1 | 3300050514 | Bacteria | 1494 |
| 897 | nmdc:mga08x19_31_c1 | 3300050514 | Bacteria | 209591 |
| 898 | nmdc:mga0a205_210616_c1 | 3300050515 | Bacteria | 1832 |
| 899 | nmdc:mga0a205_215431_c1 | 3300050515 | Bacteria | 1807 |
| 900 | nmdc:mga0a205_2951_c1 | 3300050515 | Bacteria | 12795 |
| 901 | Ga0500644_0046920 | 3300053088 | Bacteria | 1463 |
| 902 | Ga0500650_0048643 | 3300053098 | Bacteria | 1967 |
| 903 | Ga0500652_224155 | 3300053131 | Bacteria | 755 |
| 904 | Ga0500658_0089637 | 3300053134 | Bacteria | 1328 |
| 905 | Ga0500568_0087435 | 3300053139 | Bacteria | 1178 |
| 906 | Ga0500616_0107781 | 3300053153 | Bacteria | 1351 |
| 907 | Ga0501082_0145025 | 3300060353 | Bacteria | 2061 |
| 908 | Ga0501082_1039041 | 3300060353 | Bacteria | 716 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300046512 | Ga0495610_0324939 | Ga0495610_0324939_61_576 | 171 |
| 2 | 3300046517 | Ga0495630_0886623 | Ga0495630_0886623_144_665 | 171 |
| 3 | 3300005338 | Ga0068868_100097815 | Ga0068868_1000978153 | 178 |
| 4 | 3300005548 | Ga0070665_100118546 | Ga0070665_1001185463 | 178 |
| 5 | 3300049570 | Ga0501033_0297342 | Ga0501033_0297342_394_969 | 179 |
| 6 | 3300049823 | Ga0501044_0048547 | Ga0501044_0048547_972_1547 | 179 |
| 7 | 3300005842 | Ga0068858_100026860 | Ga0068858_1000268604 | 181 |
| 8 | 3300009098 | Ga0105245_10015777 | Ga0105245_100157774 | 181 |
| 9 | 3300009177 | Ga0105248_10018915 | Ga0105248_100189154 | 181 |
| 10 | 3300009545 | Ga0105237_10071421 | Ga0105237_100714213 | 181 |
| 11 | 3300009551 | Ga0105238_10006886 | Ga0105238_100068865 | 181 |
| 12 | 3300009553 | Ga0105249_10039020 | Ga0105249_100390204 | 181 |
| 13 | 3300011119 | Ga0105246_10003450 | Ga0105246_100034504 | 181 |
| 14 | 3300013306 | Ga0163162_10862695 | Ga0163162_108626952 | 181 |
| 15 | 3300013308 | Ga0157375_10003915 | Ga0157375_100039158 | 181 |
| 16 | 3300025924 | Ga0207694_10003533 | Ga0207694_100035336 | 181 |
| 17 | 3300025927 | Ga0207687_10003331 | Ga0207687_100033316 | 181 |
| 18 | 3300025941 | Ga0207711_10001193 | Ga0207711_1000119318 | 181 |
| 19 | 3300025961 | Ga0207712_10015915 | Ga0207712_100159152 | 181 |
| 20 | 3300026035 | Ga0207703_10008595 | Ga0207703_100085954 | 181 |
| 21 | 3300006048 | Ga0075363_100347233 | Ga0075363_1003472332 | 183 |
| 22 | 3300006178 | Ga0075367_10030751 | Ga0075367_100307512 | 183 |
| 23 | 3300009093 | Ga0105240_10046485 | Ga0105240_100464857 | 183 |
| 24 | 3300025913 | Ga0207695_10036125 | Ga0207695_100361256 | 183 |
| 25 | 3300005293 | Ga0065715_10000791 | Ga0065715_100007917 | 186 |
| 26 | 3300005616 | Ga0068852_100458459 | Ga0068852_1004584592 | 186 |
| 27 | 3300005841 | Ga0068863_100729072 | Ga0068863_1007290722 | 186 |
| 28 | 3300013308 | Ga0157375_10705309 | Ga0157375_107053092 | 186 |
| 29 | 3300014325 | Ga0163163_10039293 | Ga0163163_100392938 | 186 |
| 30 | 3300025925 | Ga0207650_10561972 | Ga0207650_105619721 | 186 |
| 31 | 3300025931 | Ga0207644_10517637 | Ga0207644_105176372 | 186 |
| 32 | 3300025935 | Ga0207709_10470568 | Ga0207709_104705682 | 186 |
| 33 | 3300026142 | Ga0207698_10695059 | Ga0207698_106950591 | 186 |
| 34 | 3300035172 | Ga0373955_0189735 | Ga0373955_0189735_533_1093 | 186 |
| 35 | 3300036401 | Ga0373937_0346860 | Ga0373937_0346860_233_793 | 186 |
| 36 | 3300046529 | Ga0495652_0393246 | Ga0495652_0393246_104_664 | 186 |
| 37 | 3300047322 | Ga0495680_0584244 | Ga0495680_0584244_100_660 | 186 |
| 38 | iso_pu_bacteria | 2738541278 | 2738730663 | 187 |
| 39 | 3300005457 | Ga0070662_100458741 | Ga0070662_1004587411 | 188 |
| 40 | 3300013100 | Ga0157373_10372965 | Ga0157373_103729652 | 188 |
| 41 | 3300005288 | Ga0065714_10065170 | Ga0065714_100651702 | 189 |
| 42 | 3300005290 | Ga0065712_10000127 | Ga0065712_10000127111 | 189 |
| 43 | 3300005293 | Ga0065715_10250886 | Ga0065715_102508861 | 189 |
| 44 | 3300009098 | Ga0105245_10462533 | Ga0105245_104625331 | 189 |
| 45 | 3300025945 | Ga0207679_11138643 | Ga0207679_111386431 | 189 |
| 46 | 3300028556 | Ga0265337_1073910 | Ga0265337_10739102 | 189 |
| 47 | 3300044712 | Ga0453684_0112732 | Ga0453684_0112732_10_579 | 189 |
| 48 | 3300050509 | nmdc:mga0qj67_117716_c1 | nmdc:mga0qj67_117716_c1_688_1257 | 189 |
| 49 | 3300005290 | Ga0065712_10148837 | Ga0065712_101488371 | 190 |
| 50 | 3300005293 | Ga0065715_10092022 | Ga0065715_100920222 | 190 |
| 51 | 3300005327 | Ga0070658_10000394 | Ga0070658_1000039430 | 190 |
| 52 | 3300005329 | Ga0070683_101068697 | Ga0070683_1010686971 | 190 |
| 53 | 3300005330 | Ga0070690_100800069 | Ga0070690_1008000691 | 190 |
| 54 | 3300005331 | Ga0070670_100037379 | Ga0070670_1000373791 | 190 |
| 55 | 3300005334 | Ga0068869_100022098 | Ga0068869_1000220983 | 190 |
| 56 | 3300005334 | Ga0068869_100071543 | Ga0068869_1000715432 | 190 |
| 57 | 3300005340 | Ga0070689_100164110 | Ga0070689_1001641102 | 190 |
| 58 | 3300005355 | Ga0070671_100002104 | Ga0070671_1000021047 | 190 |
| 59 | 3300005355 | Ga0070671_100026730 | Ga0070671_1000267303 | 190 |
| 60 | 3300005365 | Ga0070688_100048696 | Ga0070688_1000486962 | 190 |
| 61 | 3300005367 | Ga0070667_100023350 | Ga0070667_1000233502 | 190 |
| 62 | 3300005459 | Ga0068867_100042773 | Ga0068867_1000427733 | 190 |
| 63 | 3300005468 | Ga0070707_100106737 | Ga0070707_1001067372 | 190 |
| 64 | 3300005471 | Ga0070698_100026474 | Ga0070698_1000264744 | 190 |
| 65 | 3300005471 | Ga0070698_100326848 | Ga0070698_1003268483 | 190 |
| 66 | 3300005518 | Ga0070699_100001719 | Ga0070699_1000017198 | 190 |
| 67 | 3300005545 | Ga0070695_100118556 | Ga0070695_1001185562 | 190 |
| 68 | 3300005547 | Ga0070693_100116852 | Ga0070693_1001168521 | 190 |
| 69 | 3300005578 | Ga0068854_100659138 | Ga0068854_1006591381 | 190 |
| 70 | 3300005615 | Ga0070702_100121139 | Ga0070702_1001211392 | 190 |
| 71 | 3300005616 | Ga0068852_100063061 | Ga0068852_1000630612 | 190 |
| 72 | 3300005617 | Ga0068859_100009873 | Ga0068859_1000098735 | 190 |
| 73 | 3300005617 | Ga0068859_100126891 | Ga0068859_1001268912 | 190 |
| 74 | 3300005618 | Ga0068864_100025295 | Ga0068864_1000252952 | 190 |
| 75 | 3300005718 | Ga0068866_10027331 | Ga0068866_100273313 | 190 |
| 76 | 3300005719 | Ga0068861_100027390 | Ga0068861_1000273902 | 190 |
| 77 | 3300005843 | Ga0068860_100156698 | Ga0068860_1001566983 | 190 |
| 78 | 3300006028 | Ga0070717_10000960 | Ga0070717_1000096019 | 190 |
| 79 | 3300006173 | Ga0070716_100033133 | Ga0070716_1000331332 | 190 |
| 80 | 3300006237 | Ga0097621_100007931 | Ga0097621_1000079315 | 190 |
| 81 | 3300006880 | Ga0075429_100043066 | Ga0075429_1000430666 | 190 |
| 82 | 3300006931 | Ga0097620_100009873 | Ga0097620_1000098735 | 190 |
| 83 | 3300006931 | Ga0097620_100126891 | Ga0097620_1001268912 | 190 |
| 84 | 3300007788 | Ga0099795_10000032 | Ga0099795_1000003220 | 190 |
| 85 | 3300009147 | Ga0114129_10356777 | Ga0114129_103567772 | 190 |
| 86 | 3300009176 | Ga0105242_10411750 | Ga0105242_104117501 | 190 |
| 87 | 3300009177 | Ga0105248_10005870 | Ga0105248_100058709 | 190 |
| 88 | 3300009177 | Ga0105248_11023297 | Ga0105248_110232971 | 190 |
| 89 | 3300010159 | Ga0099796_10000020 | Ga0099796_1000002019 | 190 |
| 90 | 3300010375 | Ga0105239_10443836 | Ga0105239_104438362 | 190 |
| 91 | 3300013100 | Ga0157373_10083678 | Ga0157373_100836782 | 190 |
| 92 | 3300013296 | Ga0157374_10041032 | Ga0157374_100410324 | 190 |
| 93 | 3300013297 | Ga0157378_10005934 | Ga0157378_100059344 | 190 |
| 94 | 3300013297 | Ga0157378_10024057 | Ga0157378_100240574 | 190 |
| 95 | 3300013297 | Ga0157378_10196841 | Ga0157378_101968411 | 190 |
| 96 | 3300013306 | Ga0163162_10001448 | Ga0163162_1000144811 | 190 |
| 97 | 3300013307 | Ga0157372_10104328 | Ga0157372_101043283 | 190 |
| 98 | 3300014325 | Ga0163163_10006562 | Ga0163163_100065622 | 190 |
| 99 | 3300014325 | Ga0163163_10008538 | Ga0163163_100085382 | 190 |
| 100 | 3300014969 | Ga0157376_11328655 | Ga0157376_113286551 | 190 |
| 101 | 3300025931 | Ga0207644_10003034 | Ga0207644_100030347 | 190 |
| 102 | 3300025939 | Ga0207665_10041949 | Ga0207665_100419493 | 190 |
| 103 | 3300027512 | Ga0209179_1000063 | Ga0209179_100006319 | 190 |
| 104 | 3300028800 | Ga0265338_10053985 | Ga0265338_100539853 | 190 |
| 105 | 3300029957 | Ga0265324_10000399 | Ga0265324_100003996 | 190 |
| 106 | 3300031241 | Ga0265325_10016374 | Ga0265325_100163744 | 190 |
| 107 | 3300031249 | Ga0265339_10000022 | Ga0265339_100000228 | 190 |
| 108 | 3300031595 | Ga0265313_10003735 | Ga0265313_100037357 | 190 |
| 109 | 3300031712 | Ga0265342_10034447 | Ga0265342_100344472 | 190 |
| 110 | 3300042876 | Ga0451577_0050866 | Ga0451577_0050866_341_913 | 190 |
| 111 | 3300044712 | Ga0453684_0561261 | Ga0453684_0561261_535_1107 | 190 |
| 112 | 3300045051 | Ga0451576_0631538 | Ga0451576_0631538_203_775 | 190 |
| 113 | 3300045976 | Ga0466967_0729660 | Ga0466967_0729660_293_886 | 190 |
| 114 | 2162886007 | SwRhRL2b_contig_206548 | SwRhRL2b_0273.00001530 | 191 |
| 115 | 3300003323 | rootH1_10222734 | rootH1_102227343 | 191 |
| 116 | 3300005289 | Ga0065704_10103385 | Ga0065704_101033852 | 191 |
| 117 | 3300005289 | Ga0065704_10197256 | Ga0065704_101972562 | 191 |
| 118 | 3300005289 | Ga0065704_10493982 | Ga0065704_104939821 | 191 |
| 119 | 3300005290 | Ga0065712_10007240 | Ga0065712_100072403 | 191 |
| 120 | 3300005290 | Ga0065712_10013797 | Ga0065712_100137972 | 191 |
| 121 | 3300005293 | Ga0065715_10027705 | Ga0065715_100277051 | 191 |
| 122 | 3300005295 | Ga0065707_10008733 | Ga0065707_100087333 | 191 |
| 123 | 3300005295 | Ga0065707_10033347 | Ga0065707_100333472 | 191 |
| 124 | 3300005295 | Ga0065707_10122006 | Ga0065707_101220062 | 191 |
| 125 | 3300005295 | Ga0065707_10126451 | Ga0065707_101264513 | 191 |
| 126 | 3300005295 | Ga0065707_10129106 | Ga0065707_101291062 | 191 |
| 127 | 3300005295 | Ga0065707_10232992 | Ga0065707_102329921 | 191 |
| 128 | 3300005295 | Ga0065707_10354834 | Ga0065707_103548342 | 191 |
| 129 | 3300005327 | Ga0070658_10028202 | Ga0070658_100282024 | 191 |
| 130 | 3300005327 | Ga0070658_10763219 | Ga0070658_107632191 | 191 |
| 131 | 3300005328 | Ga0070676_10083094 | Ga0070676_100830943 | 191 |
| 132 | 3300005329 | Ga0070683_100046502 | Ga0070683_1000465023 | 191 |
| 133 | 3300005329 | Ga0070683_100147147 | Ga0070683_1001471471 | 191 |
| 134 | 3300005329 | Ga0070683_100734650 | Ga0070683_1007346501 | 191 |
| 135 | 3300005330 | Ga0070690_100065953 | Ga0070690_1000659533 | 191 |
| 136 | 3300005330 | Ga0070690_100205328 | Ga0070690_1002053283 | 191 |
| 137 | 3300005331 | Ga0070670_100010264 | Ga0070670_1000102646 | 191 |
| 138 | 3300005331 | Ga0070670_100015904 | Ga0070670_10001590412 | 191 |
| 139 | 3300005334 | Ga0068869_100016011 | Ga0068869_1000160114 | 191 |
| 140 | 3300005334 | Ga0068869_100038528 | Ga0068869_1000385282 | 191 |
| 141 | 3300005334 | Ga0068869_100041468 | Ga0068869_1000414682 | 191 |
| 142 | 3300005334 | Ga0068869_100045784 | Ga0068869_1000457842 | 191 |
| 143 | 3300005334 | Ga0068869_100129612 | Ga0068869_1001296122 | 191 |
| 144 | 3300005334 | Ga0068869_100659467 | Ga0068869_1006594671 | 191 |
| 145 | 3300005335 | Ga0070666_10000024 | Ga0070666_1000002466 | 191 |
| 146 | 3300005335 | Ga0070666_10085791 | Ga0070666_100857912 | 191 |
| 147 | 3300005336 | Ga0070680_100001860 | Ga0070680_1000018603 | 191 |
| 148 | 3300005336 | Ga0070680_100015415 | Ga0070680_1000154154 | 191 |
| 149 | 3300005337 | Ga0070682_100000160 | Ga0070682_1000001606 | 191 |
| 150 | 3300005337 | Ga0070682_100505804 | Ga0070682_1005058042 | 191 |
| 151 | 3300005337 | Ga0070682_100627615 | Ga0070682_1006276152 | 191 |
| 152 | 3300005338 | Ga0068868_100108577 | Ga0068868_1001085772 | 191 |
| 153 | 3300005338 | Ga0068868_100119142 | Ga0068868_1001191422 | 191 |
| 154 | 3300005338 | Ga0068868_100239575 | Ga0068868_1002395752 | 191 |
| 155 | 3300005338 | Ga0068868_100269867 | Ga0068868_1002698672 | 191 |
| 156 | 3300005339 | Ga0070660_100323309 | Ga0070660_1003233091 | 191 |
| 157 | 3300005340 | Ga0070689_100071874 | Ga0070689_1000718744 | 191 |
| 158 | 3300005340 | Ga0070689_100112194 | Ga0070689_1001121942 | 191 |
| 159 | 3300005347 | Ga0070668_100006022 | Ga0070668_10000602215 | 191 |
| 160 | 3300005347 | Ga0070668_100039038 | Ga0070668_1000390381 | 191 |
| 161 | 3300005347 | Ga0070668_100943159 | Ga0070668_1009431591 | 191 |
| 162 | 3300005353 | Ga0070669_100006440 | Ga0070669_1000064408 | 191 |
| 163 | 3300005353 | Ga0070669_100017708 | Ga0070669_1000177086 | 191 |
| 164 | 3300005353 | Ga0070669_100105122 | Ga0070669_1001051222 | 191 |
| 165 | 3300005353 | Ga0070669_100637256 | Ga0070669_1006372561 | 191 |
| 166 | 3300005354 | Ga0070675_100015874 | Ga0070675_1000158743 | 191 |
| 167 | 3300005355 | Ga0070671_100058436 | Ga0070671_1000584362 | 191 |
| 168 | 3300005355 | Ga0070671_100151903 | Ga0070671_1001519034 | 191 |
| 169 | 3300005355 | Ga0070671_100198146 | Ga0070671_1001981462 | 191 |
| 170 | 3300005355 | Ga0070671_100518110 | Ga0070671_1005181101 | 191 |
| 171 | 3300005356 | Ga0070674_100106641 | Ga0070674_1001066412 | 191 |
| 172 | 3300005364 | Ga0070673_100003495 | Ga0070673_1000034958 | 191 |
| 173 | 3300005364 | Ga0070673_100021741 | Ga0070673_1000217417 | 191 |
| 174 | 3300005364 | Ga0070673_100069550 | Ga0070673_1000695504 | 191 |
| 175 | 3300005364 | Ga0070673_100078564 | Ga0070673_1000785642 | 191 |
| 176 | 3300005364 | Ga0070673_100211440 | Ga0070673_1002114402 | 191 |
| 177 | 3300005364 | Ga0070673_100259750 | Ga0070673_1002597501 | 191 |
| 178 | 3300005364 | Ga0070673_100707300 | Ga0070673_1007073002 | 191 |
| 179 | 3300005365 | Ga0070688_100269138 | Ga0070688_1002691382 | 191 |
| 180 | 3300005367 | Ga0070667_100001961 | Ga0070667_10000196114 | 191 |
| 181 | 3300005367 | Ga0070667_100110693 | Ga0070667_1001106932 | 191 |
| 182 | 3300005367 | Ga0070667_100202286 | Ga0070667_1002022862 | 191 |
| 183 | 3300005367 | Ga0070667_100870179 | Ga0070667_1008701792 | 191 |
| 184 | 3300005434 | Ga0070709_10169766 | Ga0070709_101697662 | 191 |
| 185 | 3300005434 | Ga0070709_10375209 | Ga0070709_103752091 | 191 |
| 186 | 3300005436 | Ga0070713_100073793 | Ga0070713_1000737933 | 191 |
| 187 | 3300005438 | Ga0070701_10034183 | Ga0070701_100341832 | 191 |
| 188 | 3300005439 | Ga0070711_100008085 | Ga0070711_10000808510 | 191 |
| 189 | 3300005439 | Ga0070711_100205937 | Ga0070711_1002059373 | 191 |
| 190 | 3300005439 | Ga0070711_100478678 | Ga0070711_1004786781 | 191 |
| 191 | 3300005440 | Ga0070705_100048297 | Ga0070705_1000482972 | 191 |
| 192 | 3300005440 | Ga0070705_100069962 | Ga0070705_1000699622 | 191 |
| 193 | 3300005440 | Ga0070705_100140429 | Ga0070705_1001404293 | 191 |
| 194 | 3300005441 | Ga0070700_100041146 | Ga0070700_1000411464 | 191 |
| 195 | 3300005441 | Ga0070700_100193777 | Ga0070700_1001937772 | 191 |
| 196 | 3300005444 | Ga0070694_100273709 | Ga0070694_1002737092 | 191 |
| 197 | 3300005444 | Ga0070694_100776443 | Ga0070694_1007764431 | 191 |
| 198 | 3300005457 | Ga0070662_100031884 | Ga0070662_1000318843 | 191 |
| 199 | 3300005457 | Ga0070662_100109667 | Ga0070662_1001096672 | 191 |
| 200 | 3300005457 | Ga0070662_100109970 | Ga0070662_1001099702 | 191 |
| 201 | 3300005457 | Ga0070662_100244067 | Ga0070662_1002440672 | 191 |
| 202 | 3300005457 | Ga0070662_100476284 | Ga0070662_1004762841 | 191 |
| 203 | 3300005458 | Ga0070681_10000089 | Ga0070681_100000894 | 191 |
| 204 | 3300005459 | Ga0068867_100028048 | Ga0068867_1000280484 | 191 |
| 205 | 3300005459 | Ga0068867_100078136 | Ga0068867_1000781362 | 191 |
| 206 | 3300005459 | Ga0068867_100263749 | Ga0068867_1002637492 | 191 |
| 207 | 3300005459 | Ga0068867_101156245 | Ga0068867_1011562451 | 191 |
| 208 | 3300005466 | Ga0070685_10047580 | Ga0070685_100475803 | 191 |
| 209 | 3300005466 | Ga0070685_10088724 | Ga0070685_100887242 | 191 |
| 210 | 3300005467 | Ga0070706_100070395 | Ga0070706_1000703955 | 191 |
| 211 | 3300005468 | Ga0070707_100005228 | Ga0070707_1000052289 | 191 |
| 212 | 3300005468 | Ga0070707_100213597 | Ga0070707_1002135973 | 191 |
| 213 | 3300005468 | Ga0070707_100334705 | Ga0070707_1003347052 | 191 |
| 214 | 3300005468 | Ga0070707_101377340 | Ga0070707_1013773401 | 191 |
| 215 | 3300005471 | Ga0070698_100007009 | Ga0070698_10000700911 | 191 |
| 216 | 3300005471 | Ga0070698_100079633 | Ga0070698_1000796333 | 191 |
| 217 | 3300005471 | Ga0070698_100468397 | Ga0070698_1004683972 | 191 |
| 218 | 3300005471 | Ga0070698_100526049 | Ga0070698_1005260492 | 191 |
| 219 | 3300005518 | Ga0070699_100002144 | Ga0070699_1000021445 | 191 |
| 220 | 3300005518 | Ga0070699_100524633 | Ga0070699_1005246331 | 191 |
| 221 | 3300005518 | Ga0070699_100852944 | Ga0070699_1008529442 | 191 |
| 222 | 3300005530 | Ga0070679_100000014 | Ga0070679_10000001470 | 191 |
| 223 | 3300005530 | Ga0070679_100000987 | Ga0070679_1000009872 | 191 |
| 224 | 3300005530 | Ga0070679_100001843 | Ga0070679_1000018434 | 191 |
| 225 | 3300005535 | Ga0070684_100008223 | Ga0070684_1000082238 | 191 |
| 226 | 3300005535 | Ga0070684_100028066 | Ga0070684_1000280666 | 191 |
| 227 | 3300005535 | Ga0070684_100153616 | Ga0070684_1001536162 | 191 |
| 228 | 3300005535 | Ga0070684_100738581 | Ga0070684_1007385811 | 191 |
| 229 | 3300005536 | Ga0070697_100013804 | Ga0070697_1000138044 | 191 |
| 230 | 3300005536 | Ga0070697_100152570 | Ga0070697_1001525703 | 191 |
| 231 | 3300005539 | Ga0068853_100238053 | Ga0068853_1002380532 | 191 |
| 232 | 3300005543 | Ga0070672_100007925 | Ga0070672_1000079255 | 191 |
| 233 | 3300005543 | Ga0070672_100011852 | Ga0070672_1000118522 | 191 |
| 234 | 3300005543 | Ga0070672_100055053 | Ga0070672_1000550534 | 191 |
| 235 | 3300005543 | Ga0070672_100076019 | Ga0070672_1000760192 | 191 |
| 236 | 3300005543 | Ga0070672_100123188 | Ga0070672_1001231882 | 191 |
| 237 | 3300005543 | Ga0070672_100145879 | Ga0070672_1001458793 | 191 |
| 238 | 3300005544 | Ga0070686_100016694 | Ga0070686_1000166944 | 191 |
| 239 | 3300005544 | Ga0070686_100031400 | Ga0070686_1000314002 | 191 |
| 240 | 3300005544 | Ga0070686_100255781 | Ga0070686_1002557812 | 191 |
| 241 | 3300005545 | Ga0070695_100091742 | Ga0070695_1000917422 | 191 |
| 242 | 3300005545 | Ga0070695_100342211 | Ga0070695_1003422112 | 191 |
| 243 | 3300005546 | Ga0070696_100129364 | Ga0070696_1001293643 | 191 |
| 244 | 3300005546 | Ga0070696_100202525 | Ga0070696_1002025251 | 191 |
| 245 | 3300005546 | Ga0070696_100218126 | Ga0070696_1002181262 | 191 |
| 246 | 3300005549 | Ga0070704_100012361 | Ga0070704_1000123618 | 191 |
| 247 | 3300005549 | Ga0070704_100163261 | Ga0070704_1001632613 | 191 |
| 248 | 3300005549 | Ga0070704_100164409 | Ga0070704_1001644091 | 191 |
| 249 | 3300005549 | Ga0070704_100366317 | Ga0070704_1003663172 | 191 |
| 250 | 3300005549 | Ga0070704_100656777 | Ga0070704_1006567772 | 191 |
| 251 | 3300005549 | Ga0070704_101314093 | Ga0070704_1013140931 | 191 |
| 252 | 3300005563 | Ga0068855_100004734 | Ga0068855_10000473416 | 191 |
| 253 | 3300005563 | Ga0068855_100868491 | Ga0068855_1008684911 | 191 |
| 254 | 3300005563 | Ga0068855_101155434 | Ga0068855_1011554341 | 191 |
| 255 | 3300005564 | Ga0070664_100070619 | Ga0070664_1000706193 | 191 |
| 256 | 3300005577 | Ga0068857_100335011 | Ga0068857_1003350112 | 191 |
| 257 | 3300005577 | Ga0068857_100395436 | Ga0068857_1003954362 | 191 |
| 258 | 3300005577 | Ga0068857_100424577 | Ga0068857_1004245771 | 191 |
| 259 | 3300005578 | Ga0068854_100038325 | Ga0068854_1000383252 | 191 |
| 260 | 3300005578 | Ga0068854_100041870 | Ga0068854_1000418704 | 191 |
| 261 | 3300005578 | Ga0068854_100625077 | Ga0068854_1006250771 | 191 |
| 262 | 3300005614 | Ga0068856_100045446 | Ga0068856_1000454462 | 191 |
| 263 | 3300005614 | Ga0068856_100066952 | Ga0068856_1000669526 | 191 |
| 264 | 3300005614 | Ga0068856_101010529 | Ga0068856_1010105291 | 191 |
| 265 | 3300005615 | Ga0070702_100193869 | Ga0070702_1001938692 | 191 |
| 266 | 3300005615 | Ga0070702_100217257 | Ga0070702_1002172572 | 191 |
| 267 | 3300005615 | Ga0070702_100386709 | Ga0070702_1003867091 | 191 |
| 268 | 3300005615 | Ga0070702_100518976 | Ga0070702_1005189761 | 191 |
| 269 | 3300005616 | Ga0068852_100000563 | Ga0068852_10000056328 | 191 |
| 270 | 3300005616 | Ga0068852_100088798 | Ga0068852_1000887981 | 191 |
| 271 | 3300005616 | Ga0068852_100444429 | Ga0068852_1004444292 | 191 |
| 272 | 3300005616 | Ga0068852_101226527 | Ga0068852_1012265271 | 191 |
| 273 | 3300005617 | Ga0068859_100000018 | Ga0068859_100000018211 | 191 |
| 274 | 3300005617 | Ga0068859_100031927 | Ga0068859_1000319278 | 191 |
| 275 | 3300005617 | Ga0068859_100061244 | Ga0068859_1000612445 | 191 |
| 276 | 3300005617 | Ga0068859_100094970 | Ga0068859_1000949702 | 191 |
| 277 | 3300005617 | Ga0068859_100159845 | Ga0068859_1001598452 | 191 |
| 278 | 3300005617 | Ga0068859_100225436 | Ga0068859_1002254362 | 191 |
| 279 | 3300005617 | Ga0068859_100267365 | Ga0068859_1002673652 | 191 |
| 280 | 3300005617 | Ga0068859_100362650 | Ga0068859_1003626502 | 191 |
| 281 | 3300005617 | Ga0068859_100393141 | Ga0068859_1003931412 | 191 |
| 282 | 3300005617 | Ga0068859_100849020 | Ga0068859_1008490201 | 191 |
| 283 | 3300005617 | Ga0068859_100952615 | Ga0068859_1009526152 | 191 |
| 284 | 3300005618 | Ga0068864_100004484 | Ga0068864_1000044847 | 191 |
| 285 | 3300005618 | Ga0068864_100005259 | Ga0068864_1000052598 | 191 |
| 286 | 3300005618 | Ga0068864_100139613 | Ga0068864_1001396133 | 191 |
| 287 | 3300005618 | Ga0068864_100357887 | Ga0068864_1003578872 | 191 |
| 288 | 3300005618 | Ga0068864_100726306 | Ga0068864_1007263061 | 191 |
| 289 | 3300005718 | Ga0068866_10292742 | Ga0068866_102927422 | 191 |
| 290 | 3300005718 | Ga0068866_10303026 | Ga0068866_103030262 | 191 |
| 291 | 3300005719 | Ga0068861_100004851 | Ga0068861_1000048513 | 191 |
| 292 | 3300005719 | Ga0068861_100125526 | Ga0068861_1001255262 | 191 |
| 293 | 3300005719 | Ga0068861_100143536 | Ga0068861_1001435361 | 191 |
| 294 | 3300005719 | Ga0068861_100196601 | Ga0068861_1001966012 | 191 |
| 295 | 3300005834 | Ga0068851_10008388 | Ga0068851_100083885 | 191 |
| 296 | 3300005840 | Ga0068870_10010801 | Ga0068870_100108012 | 191 |
| 297 | 3300005840 | Ga0068870_10017559 | Ga0068870_100175594 | 191 |
| 298 | 3300005840 | Ga0068870_10040937 | Ga0068870_100409374 | 191 |
| 299 | 3300005840 | Ga0068870_10046150 | Ga0068870_100461502 | 191 |
| 300 | 3300005840 | Ga0068870_10632273 | Ga0068870_106322732 | 191 |
| 301 | 3300005841 | Ga0068863_100037369 | Ga0068863_1000373692 | 191 |
| 302 | 3300005841 | Ga0068863_100081038 | Ga0068863_1000810386 | 191 |
| 303 | 3300005841 | Ga0068863_100134234 | Ga0068863_1001342342 | 191 |
| 304 | 3300005841 | Ga0068863_100345488 | Ga0068863_1003454881 | 191 |
| 305 | 3300005841 | Ga0068863_100959271 | Ga0068863_1009592711 | 191 |
| 306 | 3300005842 | Ga0068858_100010503 | Ga0068858_1000105031 | 191 |
| 307 | 3300005842 | Ga0068858_100100704 | Ga0068858_1001007042 | 191 |
| 308 | 3300005842 | Ga0068858_100105236 | Ga0068858_1001052362 | 191 |
| 309 | 3300005842 | Ga0068858_100416513 | Ga0068858_1004165132 | 191 |
| 310 | 3300005842 | Ga0068858_100812407 | Ga0068858_1008124072 | 191 |
| 311 | 3300005842 | Ga0068858_101107367 | Ga0068858_1011073671 | 191 |
| 312 | 3300005843 | Ga0068860_100008446 | Ga0068860_1000084468 | 191 |
| 313 | 3300005843 | Ga0068860_100012313 | Ga0068860_1000123132 | 191 |
| 314 | 3300005843 | Ga0068860_100014941 | Ga0068860_1000149417 | 191 |
| 315 | 3300005843 | Ga0068860_100053026 | Ga0068860_1000530262 | 191 |
| 316 | 3300005843 | Ga0068860_100054834 | Ga0068860_1000548342 | 191 |
| 317 | 3300005843 | Ga0068860_100154342 | Ga0068860_1001543422 | 191 |
| 318 | 3300005843 | Ga0068860_100161290 | Ga0068860_1001612903 | 191 |
| 319 | 3300005843 | Ga0068860_100219257 | Ga0068860_1002192572 | 191 |
| 320 | 3300005843 | Ga0068860_100574972 | Ga0068860_1005749721 | 191 |
| 321 | 3300005843 | Ga0068860_100643878 | Ga0068860_1006438781 | 191 |
| 322 | 3300005844 | Ga0068862_100001370 | Ga0068862_1000013701 | 191 |
| 323 | 3300005844 | Ga0068862_100014339 | Ga0068862_1000143392 | 191 |
| 324 | 3300005844 | Ga0068862_100023492 | Ga0068862_1000234923 | 191 |
| 325 | 3300005844 | Ga0068862_100090826 | Ga0068862_1000908263 | 191 |
| 326 | 3300006028 | Ga0070717_10619163 | Ga0070717_106191632 | 191 |
| 327 | 3300006163 | Ga0070715_10000028 | Ga0070715_1000002835 | 191 |
| 328 | 3300006173 | Ga0070716_100000005 | Ga0070716_100000005194 | 191 |
| 329 | 3300006173 | Ga0070716_100161723 | Ga0070716_1001617232 | 191 |
| 330 | 3300006175 | Ga0070712_100267126 | Ga0070712_1002671262 | 191 |
| 331 | 3300006195 | Ga0075366_10032848 | Ga0075366_100328482 | 191 |
| 332 | 3300006237 | Ga0097621_100091812 | Ga0097621_1000918122 | 191 |
| 333 | 3300006237 | Ga0097621_100136761 | Ga0097621_1001367612 | 191 |
| 334 | 3300006237 | Ga0097621_100342691 | Ga0097621_1003426911 | 191 |
| 335 | 3300006358 | Ga0068871_100004123 | Ga0068871_1000041236 | 191 |
| 336 | 3300006358 | Ga0068871_100090910 | Ga0068871_1000909102 | 191 |
| 337 | 3300006358 | Ga0068871_100101168 | Ga0068871_1001011682 | 191 |
| 338 | 3300006844 | Ga0075428_100007407 | Ga0075428_10000740711 | 191 |
| 339 | 3300006844 | Ga0075428_100129758 | Ga0075428_1001297583 | 191 |
| 340 | 3300006844 | Ga0075428_100141687 | Ga0075428_1001416872 | 191 |
| 341 | 3300006844 | Ga0075428_100582134 | Ga0075428_1005821341 | 191 |
| 342 | 3300006846 | Ga0075430_100099666 | Ga0075430_1000996662 | 191 |
| 343 | 3300006847 | Ga0075431_100012603 | Ga0075431_1000126033 | 191 |
| 344 | 3300006852 | Ga0075433_10048333 | Ga0075433_100483334 | 191 |
| 345 | 3300006852 | Ga0075433_10489102 | Ga0075433_104891021 | 191 |
| 346 | 3300006852 | Ga0075433_10853391 | Ga0075433_108533912 | 191 |
| 347 | 3300006871 | Ga0075434_100268818 | Ga0075434_1002688181 | 191 |
| 348 | 3300006871 | Ga0075434_100656763 | Ga0075434_1006567631 | 191 |
| 349 | 3300006871 | Ga0075434_100884959 | Ga0075434_1008849591 | 191 |
| 350 | 3300006880 | Ga0075429_100000099 | Ga0075429_10000009930 | 191 |
| 351 | 3300006880 | Ga0075429_100059318 | Ga0075429_1000593182 | 191 |
| 352 | 3300006880 | Ga0075429_100117391 | Ga0075429_1001173912 | 191 |
| 353 | 3300006881 | Ga0068865_100008550 | Ga0068865_1000085504 | 191 |
| 354 | 3300006881 | Ga0068865_100013758 | Ga0068865_1000137582 | 191 |
| 355 | 3300006881 | Ga0068865_100100995 | Ga0068865_1001009953 | 191 |
| 356 | 3300006881 | Ga0068865_100617393 | Ga0068865_1006173932 | 191 |
| 357 | 3300006914 | Ga0075436_100000009 | Ga0075436_100000009197 | 191 |
| 358 | 3300006914 | Ga0075436_100008218 | Ga0075436_1000082185 | 191 |
| 359 | 3300006914 | Ga0075436_100088294 | Ga0075436_1000882944 | 191 |
| 360 | 3300006931 | Ga0097620_100000018 | Ga0097620_100000018211 | 191 |
| 361 | 3300006931 | Ga0097620_100031929 | Ga0097620_1000319292 | 191 |
| 362 | 3300006931 | Ga0097620_100061249 | Ga0097620_1000612492 | 191 |
| 363 | 3300006931 | Ga0097620_100094968 | Ga0097620_1000949682 | 191 |
| 364 | 3300006931 | Ga0097620_100159852 | Ga0097620_1001598522 | 191 |
| 365 | 3300006931 | Ga0097620_100225430 | Ga0097620_1002254302 | 191 |
| 366 | 3300006931 | Ga0097620_100267358 | Ga0097620_1002673582 | 191 |
| 367 | 3300006931 | Ga0097620_100362629 | Ga0097620_1003626292 | 191 |
| 368 | 3300006931 | Ga0097620_100393140 | Ga0097620_1003931402 | 191 |
| 369 | 3300006931 | Ga0097620_100849054 | Ga0097620_1008490541 | 191 |
| 370 | 3300006931 | Ga0097620_100952649 | Ga0097620_1009526492 | 191 |
| 371 | 3300007265 | Ga0099794_10007400 | Ga0099794_100074005 | 191 |
| 372 | 3300007265 | Ga0099794_10024770 | Ga0099794_100247704 | 191 |
| 373 | 3300009093 | Ga0105240_10391872 | Ga0105240_103918723 | 191 |
| 374 | 3300009093 | Ga0105240_10991685 | Ga0105240_109916852 | 191 |
| 375 | 3300009094 | Ga0111539_10001405 | Ga0111539_1000140511 | 191 |
| 376 | 3300009094 | Ga0111539_10012287 | Ga0111539_100122875 | 191 |
| 377 | 3300009094 | Ga0111539_10022883 | Ga0111539_100228832 | 191 |
| 378 | 3300009094 | Ga0111539_10153083 | Ga0111539_101530832 | 191 |
| 379 | 3300009094 | Ga0111539_10738163 | Ga0111539_107381631 | 191 |
| 380 | 3300009098 | Ga0105245_10030971 | Ga0105245_100309713 | 191 |
| 381 | 3300009098 | Ga0105245_10181432 | Ga0105245_101814322 | 191 |
| 382 | 3300009098 | Ga0105245_10199308 | Ga0105245_101993082 | 191 |
| 383 | 3300009098 | Ga0105245_10249468 | Ga0105245_102494683 | 191 |
| 384 | 3300009098 | Ga0105245_10595234 | Ga0105245_105952341 | 191 |
| 385 | 3300009101 | Ga0105247_10003256 | Ga0105247_100032563 | 191 |
| 386 | 3300009101 | Ga0105247_10164183 | Ga0105247_101641831 | 191 |
| 387 | 3300009147 | Ga0114129_10021342 | Ga0114129_100213421 | 191 |
| 388 | 3300009147 | Ga0114129_10042905 | Ga0114129_100429056 | 191 |
| 389 | 3300009147 | Ga0114129_10119091 | Ga0114129_101190913 | 191 |
| 390 | 3300009147 | Ga0114129_10354293 | Ga0114129_103542931 | 191 |
| 391 | 3300009147 | Ga0114129_10374980 | Ga0114129_103749802 | 191 |
| 392 | 3300009147 | Ga0114129_10396784 | Ga0114129_103967841 | 191 |
| 393 | 3300009147 | Ga0114129_10693730 | Ga0114129_106937301 | 191 |
| 394 | 3300009148 | Ga0105243_10007346 | Ga0105243_100073465 | 191 |
| 395 | 3300009148 | Ga0105243_10069470 | Ga0105243_100694702 | 191 |
| 396 | 3300009148 | Ga0105243_10363846 | Ga0105243_103638462 | 191 |
| 397 | 3300009148 | Ga0105243_10990641 | Ga0105243_109906411 | 191 |
| 398 | 3300009174 | Ga0105241_10083558 | Ga0105241_100835582 | 191 |
| 399 | 3300009174 | Ga0105241_10102449 | Ga0105241_101024491 | 191 |
| 400 | 3300009174 | Ga0105241_10593789 | Ga0105241_105937892 | 191 |
| 401 | 3300009174 | Ga0105241_10715034 | Ga0105241_107150341 | 191 |
| 402 | 3300009176 | Ga0105242_10460870 | Ga0105242_104608702 | 191 |
| 403 | 3300009177 | Ga0105248_10141453 | Ga0105248_101414536 | 191 |
| 404 | 3300009177 | Ga0105248_10158725 | Ga0105248_101587252 | 191 |
| 405 | 3300009177 | Ga0105248_10242162 | Ga0105248_102421622 | 191 |
| 406 | 3300009177 | Ga0105248_10267197 | Ga0105248_102671971 | 191 |
| 407 | 3300009177 | Ga0105248_10307787 | Ga0105248_103077872 | 191 |
| 408 | 3300009545 | Ga0105237_10089716 | Ga0105237_100897162 | 191 |
| 409 | 3300009545 | Ga0105237_10210845 | Ga0105237_102108452 | 191 |
| 410 | 3300009545 | Ga0105237_10789816 | Ga0105237_107898162 | 191 |
| 411 | 3300009551 | Ga0105238_10118922 | Ga0105238_101189223 | 191 |
| 412 | 3300009553 | Ga0105249_10013548 | Ga0105249_100135485 | 191 |
| 413 | 3300009553 | Ga0105249_10045782 | Ga0105249_100457821 | 191 |
| 414 | 3300009553 | Ga0105249_10049971 | Ga0105249_100499712 | 191 |
| 415 | 3300009553 | Ga0105249_10114617 | Ga0105249_101146173 | 191 |
| 416 | 3300009553 | Ga0105249_10203924 | Ga0105249_102039242 | 191 |
| 417 | 3300010375 | Ga0105239_10000469 | Ga0105239_1000046919 | 191 |
| 418 | 3300010375 | Ga0105239_10368613 | Ga0105239_103686133 | 191 |
| 419 | 3300010375 | Ga0105239_10547953 | Ga0105239_105479532 | 191 |
| 420 | 3300010375 | Ga0105239_12012040 | Ga0105239_120120401 | 191 |
| 421 | 3300011119 | Ga0105246_10021665 | Ga0105246_100216656 | 191 |
| 422 | 3300011119 | Ga0105246_10038224 | Ga0105246_100382242 | 191 |
| 423 | 3300011119 | Ga0105246_10430279 | Ga0105246_104302792 | 191 |
| 424 | 3300011119 | Ga0105246_10517681 | Ga0105246_105176812 | 191 |
| 425 | 3300011119 | Ga0105246_10559770 | Ga0105246_105597701 | 191 |
| 426 | 3300011119 | Ga0105246_10748498 | Ga0105246_107484982 | 191 |
| 427 | 3300013100 | Ga0157373_10128242 | Ga0157373_101282422 | 191 |
| 428 | 3300013100 | Ga0157373_10368110 | Ga0157373_103681101 | 191 |
| 429 | 3300013100 | Ga0157373_10527167 | Ga0157373_105271672 | 191 |
| 430 | 3300013102 | Ga0157371_10002120 | Ga0157371_1000212018 | 191 |
| 431 | 3300013102 | Ga0157371_10040887 | Ga0157371_100408873 | 191 |
| 432 | 3300013104 | Ga0157370_10040765 | Ga0157370_100407654 | 191 |
| 433 | 3300013104 | Ga0157370_10280425 | Ga0157370_102804252 | 191 |
| 434 | 3300013105 | Ga0157369_10015970 | Ga0157369_100159702 | 191 |
| 435 | 3300013296 | Ga0157374_10393475 | Ga0157374_103934751 | 191 |
| 436 | 3300013296 | Ga0157374_10499916 | Ga0157374_104999162 | 191 |
| 437 | 3300013296 | Ga0157374_10538585 | Ga0157374_105385852 | 191 |
| 438 | 3300013296 | Ga0157374_10817194 | Ga0157374_108171941 | 191 |
| 439 | 3300013297 | Ga0157378_10004869 | Ga0157378_1000486911 | 191 |
| 440 | 3300013297 | Ga0157378_10021654 | Ga0157378_100216543 | 191 |
| 441 | 3300013297 | Ga0157378_10307030 | Ga0157378_103070302 | 191 |
| 442 | 3300013306 | Ga0163162_10006632 | Ga0163162_100066326 | 191 |
| 443 | 3300013306 | Ga0163162_10125034 | Ga0163162_101250343 | 191 |
| 444 | 3300013306 | Ga0163162_10213745 | Ga0163162_102137452 | 191 |
| 445 | 3300013306 | Ga0163162_10233792 | Ga0163162_102337923 | 191 |
| 446 | 3300013306 | Ga0163162_10442933 | Ga0163162_104429331 | 191 |
| 447 | 3300013306 | Ga0163162_10586084 | Ga0163162_105860842 | 191 |
| 448 | 3300013307 | Ga0157372_10011389 | Ga0157372_100113898 | 191 |
| 449 | 3300013307 | Ga0157372_10123962 | Ga0157372_101239623 | 191 |
| 450 | 3300013307 | Ga0157372_10147935 | Ga0157372_101479352 | 191 |
| 451 | 3300013307 | Ga0157372_11259607 | Ga0157372_112596071 | 191 |
| 452 | 3300013308 | Ga0157375_10000277 | Ga0157375_1000027736 | 191 |
| 453 | 3300013308 | Ga0157375_10014916 | Ga0157375_100149163 | 191 |
| 454 | 3300013308 | Ga0157375_10033271 | Ga0157375_100332715 | 191 |
| 455 | 3300013308 | Ga0157375_10049252 | Ga0157375_100492522 | 191 |
| 456 | 3300013308 | Ga0157375_10523581 | Ga0157375_105235812 | 191 |
| 457 | 3300013308 | Ga0157375_11448910 | Ga0157375_114489102 | 191 |
| 458 | 3300014325 | Ga0163163_10092286 | Ga0163163_100922863 | 191 |
| 459 | 3300014325 | Ga0163163_10207609 | Ga0163163_102076092 | 191 |
| 460 | 3300014325 | Ga0163163_10319854 | Ga0163163_103198542 | 191 |
| 461 | 3300014325 | Ga0163163_10403009 | Ga0163163_104030092 | 191 |
| 462 | 3300014325 | Ga0163163_10948460 | Ga0163163_109484602 | 191 |
| 463 | 3300014325 | Ga0163163_11055166 | Ga0163163_110551662 | 191 |
| 464 | 3300014326 | Ga0157380_10004791 | Ga0157380_100047912 | 191 |
| 465 | 3300014326 | Ga0157380_10007392 | Ga0157380_100073922 | 191 |
| 466 | 3300014326 | Ga0157380_10018186 | Ga0157380_100181865 | 191 |
| 467 | 3300014326 | Ga0157380_10018458 | Ga0157380_100184584 | 191 |
| 468 | 3300014326 | Ga0157380_10379855 | Ga0157380_103798551 | 191 |
| 469 | 3300014745 | Ga0157377_10226927 | Ga0157377_102269272 | 191 |
| 470 | 3300014968 | Ga0157379_10021797 | Ga0157379_100217973 | 191 |
| 471 | 3300014968 | Ga0157379_10083800 | Ga0157379_100838002 | 191 |
| 472 | 3300014968 | Ga0157379_10437484 | Ga0157379_104374842 | 191 |
| 473 | 3300014968 | Ga0157379_11092679 | Ga0157379_110926791 | 191 |
| 474 | 3300014969 | Ga0157376_10005294 | Ga0157376_100052944 | 191 |
| 475 | 3300014969 | Ga0157376_10057141 | Ga0157376_100571412 | 191 |
| 476 | 3300014969 | Ga0157376_10317663 | Ga0157376_103176633 | 191 |
| 477 | 3300014969 | Ga0157376_10431311 | Ga0157376_104313112 | 191 |
| 478 | 3300017792 | Ga0163161_10024589 | Ga0163161_100245894 | 191 |
| 479 | 3300017792 | Ga0163161_10123774 | Ga0163161_101237742 | 191 |
| 480 | 3300021388 | Ga0213875_10000066 | Ga0213875_1000006621 | 191 |
| 481 | 3300024225 | Ga0224572_1027221 | Ga0224572_10272211 | 191 |
| 482 | 3300025271 | Ga0207666_1013846 | Ga0207666_10138462 | 191 |
| 483 | 3300025315 | Ga0207697_10015842 | Ga0207697_100158422 | 191 |
| 484 | 3300025315 | Ga0207697_10051119 | Ga0207697_100511192 | 191 |
| 485 | 3300025315 | Ga0207697_10119867 | Ga0207697_101198672 | 191 |
| 486 | 3300025898 | Ga0207692_10257140 | Ga0207692_102571402 | 191 |
| 487 | 3300025899 | Ga0207642_10009995 | Ga0207642_100099953 | 191 |
| 488 | 3300025900 | Ga0207710_10012977 | Ga0207710_100129772 | 191 |
| 489 | 3300025903 | Ga0207680_10000026 | Ga0207680_1000002644 | 191 |
| 490 | 3300025903 | Ga0207680_10080291 | Ga0207680_100802912 | 191 |
| 491 | 3300025905 | Ga0207685_10000023 | Ga0207685_1000002335 | 191 |
| 492 | 3300025905 | Ga0207685_10159805 | Ga0207685_101598052 | 191 |
| 493 | 3300025907 | Ga0207645_10033456 | Ga0207645_100334563 | 191 |
| 494 | 3300025907 | Ga0207645_10045536 | Ga0207645_100455365 | 191 |
| 495 | 3300025907 | Ga0207645_10113813 | Ga0207645_101138132 | 191 |
| 496 | 3300025908 | Ga0207643_10007761 | Ga0207643_100077615 | 191 |
| 497 | 3300025908 | Ga0207643_10015988 | Ga0207643_100159884 | 191 |
| 498 | 3300025908 | Ga0207643_10024274 | Ga0207643_100242743 | 191 |
| 499 | 3300025909 | Ga0207705_10018748 | Ga0207705_100187481 | 191 |
| 500 | 3300025909 | Ga0207705_10058112 | Ga0207705_100581123 | 191 |
| 501 | 3300025909 | Ga0207705_10103501 | Ga0207705_101035012 | 191 |
| 502 | 3300025910 | Ga0207684_10184370 | Ga0207684_101843702 | 191 |
| 503 | 3300025911 | Ga0207654_10017779 | Ga0207654_100177793 | 191 |
| 504 | 3300025911 | Ga0207654_10204747 | Ga0207654_102047472 | 191 |
| 505 | 3300025912 | Ga0207707_10000016 | Ga0207707_10000016152 | 191 |
| 506 | 3300025912 | Ga0207707_10043354 | Ga0207707_100433543 | 191 |
| 507 | 3300025913 | Ga0207695_10002632 | Ga0207695_1000263216 | 191 |
| 508 | 3300025913 | Ga0207695_10007786 | Ga0207695_100077868 | 191 |
| 509 | 3300025913 | Ga0207695_10046004 | Ga0207695_100460044 | 191 |
| 510 | 3300025913 | Ga0207695_10254956 | Ga0207695_102549561 | 191 |
| 511 | 3300025913 | Ga0207695_10332193 | Ga0207695_103321931 | 191 |
| 512 | 3300025914 | Ga0207671_10016462 | Ga0207671_100164622 | 191 |
| 513 | 3300025914 | Ga0207671_10132108 | Ga0207671_101321082 | 191 |
| 514 | 3300025914 | Ga0207671_10264501 | Ga0207671_102645011 | 191 |
| 515 | 3300025916 | Ga0207663_10019437 | Ga0207663_100194372 | 191 |
| 516 | 3300025916 | Ga0207663_10197483 | Ga0207663_101974832 | 191 |
| 517 | 3300025917 | Ga0207660_10000079 | Ga0207660_1000007929 | 191 |
| 518 | 3300025917 | Ga0207660_10017505 | Ga0207660_100175057 | 191 |
| 519 | 3300025917 | Ga0207660_10050450 | Ga0207660_100504502 | 191 |
| 520 | 3300025917 | Ga0207660_10157918 | Ga0207660_101579182 | 191 |
| 521 | 3300025918 | Ga0207662_10020201 | Ga0207662_100202012 | 191 |
| 522 | 3300025918 | Ga0207662_10029348 | Ga0207662_100293482 | 191 |
| 523 | 3300025918 | Ga0207662_10051449 | Ga0207662_100514493 | 191 |
| 524 | 3300025918 | Ga0207662_10093187 | Ga0207662_100931871 | 191 |
| 525 | 3300025919 | Ga0207657_10501511 | Ga0207657_105015112 | 191 |
| 526 | 3300025920 | Ga0207649_10221292 | Ga0207649_102212922 | 191 |
| 527 | 3300025920 | Ga0207649_10718163 | Ga0207649_107181632 | 191 |
| 528 | 3300025920 | Ga0207649_10806423 | Ga0207649_108064232 | 191 |
| 529 | 3300025921 | Ga0207652_10000126 | Ga0207652_1000012672 | 191 |
| 530 | 3300025921 | Ga0207652_10001189 | Ga0207652_100011896 | 191 |
| 531 | 3300025921 | Ga0207652_10001467 | Ga0207652_1000146714 | 191 |
| 532 | 3300025921 | Ga0207652_10078720 | Ga0207652_100787201 | 191 |
| 533 | 3300025922 | Ga0207646_10001755 | Ga0207646_100017556 | 191 |
| 534 | 3300025922 | Ga0207646_10641288 | Ga0207646_106412882 | 191 |
| 535 | 3300025923 | Ga0207681_10007311 | Ga0207681_100073118 | 191 |
| 536 | 3300025923 | Ga0207681_10016199 | Ga0207681_100161995 | 191 |
| 537 | 3300025923 | Ga0207681_10095493 | Ga0207681_100954932 | 191 |
| 538 | 3300025923 | Ga0207681_10099304 | Ga0207681_100993042 | 191 |
| 539 | 3300025923 | Ga0207681_10573224 | Ga0207681_105732242 | 191 |
| 540 | 3300025924 | Ga0207694_10087008 | Ga0207694_100870083 | 191 |
| 541 | 3300025924 | Ga0207694_10135101 | Ga0207694_101351012 | 191 |
| 542 | 3300025925 | Ga0207650_10009261 | Ga0207650_100092618 | 191 |
| 543 | 3300025925 | Ga0207650_10028897 | Ga0207650_100288972 | 191 |
| 544 | 3300025925 | Ga0207650_10077348 | Ga0207650_100773483 | 191 |
| 545 | 3300025926 | Ga0207659_10015083 | Ga0207659_100150838 | 191 |
| 546 | 3300025926 | Ga0207659_10099913 | Ga0207659_100999132 | 191 |
| 547 | 3300025926 | Ga0207659_10198842 | Ga0207659_101988422 | 191 |
| 548 | 3300025927 | Ga0207687_10137164 | Ga0207687_101371642 | 191 |
| 549 | 3300025927 | Ga0207687_10384391 | Ga0207687_103843912 | 191 |
| 550 | 3300025927 | Ga0207687_10390981 | Ga0207687_103909811 | 191 |
| 551 | 3300025927 | Ga0207687_10527064 | Ga0207687_105270642 | 191 |
| 552 | 3300025928 | Ga0207700_10148785 | Ga0207700_101487851 | 191 |
| 553 | 3300025929 | Ga0207664_10065302 | Ga0207664_100653024 | 191 |
| 554 | 3300025931 | Ga0207644_10059615 | Ga0207644_100596154 | 191 |
| 555 | 3300025931 | Ga0207644_10199918 | Ga0207644_101999182 | 191 |
| 556 | 3300025931 | Ga0207644_10428572 | Ga0207644_104285722 | 191 |
| 557 | 3300025933 | Ga0207706_10099379 | Ga0207706_100993792 | 191 |
| 558 | 3300025933 | Ga0207706_10136534 | Ga0207706_101365342 | 191 |
| 559 | 3300025933 | Ga0207706_10266770 | Ga0207706_102667702 | 191 |
| 560 | 3300025933 | Ga0207706_10298137 | Ga0207706_102981372 | 191 |
| 561 | 3300025934 | Ga0207686_10117237 | Ga0207686_101172372 | 191 |
| 562 | 3300025935 | Ga0207709_10081600 | Ga0207709_100816001 | 191 |
| 563 | 3300025936 | Ga0207670_10008737 | Ga0207670_100087372 | 191 |
| 564 | 3300025936 | Ga0207670_10195508 | Ga0207670_101955082 | 191 |
| 565 | 3300025936 | Ga0207670_10259357 | Ga0207670_102593572 | 191 |
| 566 | 3300025936 | Ga0207670_10331897 | Ga0207670_103318972 | 191 |
| 567 | 3300025937 | Ga0207669_10917376 | Ga0207669_109173761 | 191 |
| 568 | 3300025938 | Ga0207704_10037543 | Ga0207704_100375432 | 191 |
| 569 | 3300025938 | Ga0207704_10186020 | Ga0207704_101860202 | 191 |
| 570 | 3300025938 | Ga0207704_10294051 | Ga0207704_102940511 | 191 |
| 571 | 3300025939 | Ga0207665_10000017 | Ga0207665_1000001727 | 191 |
| 572 | 3300025940 | Ga0207691_10000594 | Ga0207691_100005942 | 191 |
| 573 | 3300025940 | Ga0207691_10003897 | Ga0207691_1000389727 | 191 |
| 574 | 3300025940 | Ga0207691_10049987 | Ga0207691_100499874 | 191 |
| 575 | 3300025940 | Ga0207691_10051610 | Ga0207691_100516103 | 191 |
| 576 | 3300025940 | Ga0207691_10074874 | Ga0207691_100748742 | 191 |
| 577 | 3300025940 | Ga0207691_10138386 | Ga0207691_101383864 | 191 |
| 578 | 3300025940 | Ga0207691_10382880 | Ga0207691_103828802 | 191 |
| 579 | 3300025941 | Ga0207711_10000721 | Ga0207711_1000072128 | 191 |
| 580 | 3300025941 | Ga0207711_10051610 | Ga0207711_100516104 | 191 |
| 581 | 3300025941 | Ga0207711_10091975 | Ga0207711_100919755 | 191 |
| 582 | 3300025941 | Ga0207711_10098208 | Ga0207711_100982084 | 191 |
| 583 | 3300025941 | Ga0207711_10359143 | Ga0207711_103591432 | 191 |
| 584 | 3300025941 | Ga0207711_10529258 | Ga0207711_105292581 | 191 |
| 585 | 3300025941 | Ga0207711_10562419 | Ga0207711_105624192 | 191 |
| 586 | 3300025942 | Ga0207689_10001176 | Ga0207689_100011763 | 191 |
| 587 | 3300025942 | Ga0207689_10013959 | Ga0207689_100139595 | 191 |
| 588 | 3300025942 | Ga0207689_10045396 | Ga0207689_100453966 | 191 |
| 589 | 3300025942 | Ga0207689_10057302 | Ga0207689_100573023 | 191 |
| 590 | 3300025942 | Ga0207689_10410248 | Ga0207689_104102482 | 191 |
| 591 | 3300025944 | Ga0207661_10070344 | Ga0207661_100703442 | 191 |
| 592 | 3300025944 | Ga0207661_10157316 | Ga0207661_101573162 | 191 |
| 593 | 3300025944 | Ga0207661_10229512 | Ga0207661_102295121 | 191 |
| 594 | 3300025944 | Ga0207661_10521957 | Ga0207661_105219572 | 191 |
| 595 | 3300025945 | Ga0207679_10104137 | Ga0207679_101041374 | 191 |
| 596 | 3300025949 | Ga0207667_10207773 | Ga0207667_102077731 | 191 |
| 597 | 3300025960 | Ga0207651_10023087 | Ga0207651_100230872 | 191 |
| 598 | 3300025960 | Ga0207651_10024485 | Ga0207651_100244852 | 191 |
| 599 | 3300025960 | Ga0207651_10053646 | Ga0207651_100536463 | 191 |
| 600 | 3300025960 | Ga0207651_10089104 | Ga0207651_100891044 | 191 |
| 601 | 3300025960 | Ga0207651_10167274 | Ga0207651_101672742 | 191 |
| 602 | 3300025960 | Ga0207651_10208490 | Ga0207651_102084902 | 191 |
| 603 | 3300025960 | Ga0207651_10534800 | Ga0207651_105348002 | 191 |
| 604 | 3300025960 | Ga0207651_10617164 | Ga0207651_106171641 | 191 |
| 605 | 3300025960 | Ga0207651_10921762 | Ga0207651_109217621 | 191 |
| 606 | 3300025961 | Ga0207712_10063517 | Ga0207712_100635171 | 191 |
| 607 | 3300025961 | Ga0207712_10086455 | Ga0207712_100864552 | 191 |
| 608 | 3300025961 | Ga0207712_10120984 | Ga0207712_101209842 | 191 |
| 609 | 3300025961 | Ga0207712_10124954 | Ga0207712_101249543 | 191 |
| 610 | 3300025972 | Ga0207668_10027609 | Ga0207668_100276095 | 191 |
| 611 | 3300025972 | Ga0207668_10250477 | Ga0207668_102504772 | 191 |
| 612 | 3300025972 | Ga0207668_10285306 | Ga0207668_102853062 | 191 |
| 613 | 3300025981 | Ga0207640_10022067 | Ga0207640_100220673 | 191 |
| 614 | 3300025981 | Ga0207640_10197829 | Ga0207640_101978291 | 191 |
| 615 | 3300025981 | Ga0207640_10212509 | Ga0207640_102125092 | 191 |
| 616 | 3300025981 | Ga0207640_10344166 | Ga0207640_103441662 | 191 |
| 617 | 3300025986 | Ga0207658_10008660 | Ga0207658_100086607 | 191 |
| 618 | 3300025986 | Ga0207658_10193385 | Ga0207658_101933851 | 191 |
| 619 | 3300025986 | Ga0207658_10264806 | Ga0207658_102648061 | 191 |
| 620 | 3300026023 | Ga0207677_10035821 | Ga0207677_100358212 | 191 |
| 621 | 3300026023 | Ga0207677_10052878 | Ga0207677_100528782 | 191 |
| 622 | 3300026023 | Ga0207677_10100828 | Ga0207677_101008283 | 191 |
| 623 | 3300026023 | Ga0207677_10122851 | Ga0207677_101228512 | 191 |
| 624 | 3300026023 | Ga0207677_10219234 | Ga0207677_102192342 | 191 |
| 625 | 3300026023 | Ga0207677_10329699 | Ga0207677_103296992 | 191 |
| 626 | 3300026023 | Ga0207677_10971601 | Ga0207677_109716011 | 191 |
| 627 | 3300026035 | Ga0207703_10004551 | Ga0207703_100045515 | 191 |
| 628 | 3300026035 | Ga0207703_10019889 | Ga0207703_100198895 | 191 |
| 629 | 3300026035 | Ga0207703_10245381 | Ga0207703_102453812 | 191 |
| 630 | 3300026035 | Ga0207703_11568638 | Ga0207703_115686381 | 191 |
| 631 | 3300026041 | Ga0207639_10027552 | Ga0207639_100275523 | 191 |
| 632 | 3300026041 | Ga0207639_10061339 | Ga0207639_100613392 | 191 |
| 633 | 3300026041 | Ga0207639_11346662 | Ga0207639_113466621 | 191 |
| 634 | 3300026075 | Ga0207708_10099654 | Ga0207708_100996541 | 191 |
| 635 | 3300026075 | Ga0207708_10120090 | Ga0207708_101200903 | 191 |
| 636 | 3300026078 | Ga0207702_10102609 | Ga0207702_101026093 | 191 |
| 637 | 3300026078 | Ga0207702_10161665 | Ga0207702_101616651 | 191 |
| 638 | 3300026088 | Ga0207641_10000167 | Ga0207641_1000016753 | 191 |
| 639 | 3300026088 | Ga0207641_10028444 | Ga0207641_100284442 | 191 |
| 640 | 3300026088 | Ga0207641_10038609 | Ga0207641_100386093 | 191 |
| 641 | 3300026088 | Ga0207641_10049850 | Ga0207641_100498502 | 191 |
| 642 | 3300026088 | Ga0207641_10231802 | Ga0207641_102318023 | 191 |
| 643 | 3300026089 | Ga0207648_10009103 | Ga0207648_100091036 | 191 |
| 644 | 3300026089 | Ga0207648_10010832 | Ga0207648_1001083210 | 191 |
| 645 | 3300026089 | Ga0207648_10054277 | Ga0207648_100542774 | 191 |
| 646 | 3300026089 | Ga0207648_10131333 | Ga0207648_101313333 | 191 |
| 647 | 3300026095 | Ga0207676_10000992 | Ga0207676_100009927 | 191 |
| 648 | 3300026095 | Ga0207676_10006875 | Ga0207676_100068757 | 191 |
| 649 | 3300026095 | Ga0207676_10007550 | Ga0207676_100075503 | 191 |
| 650 | 3300026095 | Ga0207676_10071490 | Ga0207676_100714902 | 191 |
| 651 | 3300026095 | Ga0207676_10074099 | Ga0207676_100740991 | 191 |
| 652 | 3300026095 | Ga0207676_10114610 | Ga0207676_101146102 | 191 |
| 653 | 3300026095 | Ga0207676_10352948 | Ga0207676_103529481 | 191 |
| 654 | 3300026116 | Ga0207674_10000454 | Ga0207674_100004544 | 191 |
| 655 | 3300026116 | Ga0207674_10013502 | Ga0207674_100135025 | 191 |
| 656 | 3300026116 | Ga0207674_10194377 | Ga0207674_101943772 | 191 |
| 657 | 3300026116 | Ga0207674_10224884 | Ga0207674_102248842 | 191 |
| 658 | 3300026118 | Ga0207675_100000594 | Ga0207675_10000059418 | 191 |
| 659 | 3300026118 | Ga0207675_100008267 | Ga0207675_10000826718 | 191 |
| 660 | 3300026118 | Ga0207675_100046173 | Ga0207675_1000461732 | 191 |
| 661 | 3300026118 | Ga0207675_100087097 | Ga0207675_1000870975 | 191 |
| 662 | 3300026118 | Ga0207675_100719580 | Ga0207675_1007195801 | 191 |
| 663 | 3300026118 | Ga0207675_100962859 | Ga0207675_1009628592 | 191 |
| 664 | 3300026121 | Ga0207683_10203262 | Ga0207683_102032621 | 191 |
| 665 | 3300026121 | Ga0207683_10269912 | Ga0207683_102699122 | 191 |
| 666 | 3300026121 | Ga0207683_10306134 | Ga0207683_103061341 | 191 |
| 667 | 3300026142 | Ga0207698_10041298 | Ga0207698_100412985 | 191 |
| 668 | 3300026142 | Ga0207698_10167275 | Ga0207698_101672751 | 191 |
| 669 | 3300026142 | Ga0207698_10210632 | Ga0207698_102106321 | 191 |
| 670 | 3300026142 | Ga0207698_10677490 | Ga0207698_106774902 | 191 |
| 671 | 3300027378 | Ga0209981_1029963 | Ga0209981_10299632 | 191 |
| 672 | 3300027671 | Ga0209588_1001752 | Ga0209588_10017525 | 191 |
| 673 | 3300027907 | Ga0207428_10158543 | Ga0207428_101585432 | 191 |
| 674 | 3300028379 | Ga0268266_10000088 | Ga0268266_1000008876 | 191 |
| 675 | 3300028380 | Ga0268265_10034020 | Ga0268265_100340203 | 191 |
| 676 | 3300028380 | Ga0268265_10046160 | Ga0268265_100461602 | 191 |
| 677 | 3300028380 | Ga0268265_10521294 | Ga0268265_105212941 | 191 |
| 678 | 3300028380 | Ga0268265_10532441 | Ga0268265_105324412 | 191 |
| 679 | 3300028381 | Ga0268264_10007287 | Ga0268264_100072872 | 191 |
| 680 | 3300028381 | Ga0268264_10013625 | Ga0268264_100136252 | 191 |
| 681 | 3300028381 | Ga0268264_10014801 | Ga0268264_100148011 | 191 |
| 682 | 3300028381 | Ga0268264_10024262 | Ga0268264_100242625 | 191 |
| 683 | 3300028381 | Ga0268264_10061513 | Ga0268264_100615132 | 191 |
| 684 | 3300028381 | Ga0268264_10061901 | Ga0268264_100619013 | 191 |
| 685 | 3300028381 | Ga0268264_10064096 | Ga0268264_100640965 | 191 |
| 686 | 3300028381 | Ga0268264_10119274 | Ga0268264_101192742 | 191 |
| 687 | 3300028381 | Ga0268264_10120617 | Ga0268264_101206172 | 191 |
| 688 | 3300028556 | Ga0265337_1004481 | Ga0265337_10044816 | 191 |
| 689 | 3300028556 | Ga0265337_1014316 | Ga0265337_10143164 | 191 |
| 690 | 3300028563 | Ga0265319_1000297 | Ga0265319_100029727 | 191 |
| 691 | 3300028573 | Ga0265334_10001759 | Ga0265334_100017597 | 191 |
| 692 | 3300028573 | Ga0265334_10072004 | Ga0265334_100720042 | 191 |
| 693 | 3300028577 | Ga0265318_10000045 | Ga0265318_1000004560 | 191 |
| 694 | 3300028577 | Ga0265318_10006110 | Ga0265318_100061107 | 191 |
| 695 | 3300028666 | Ga0265336_10000194 | Ga0265336_1000019433 | 191 |
| 696 | 3300028666 | Ga0265336_10136161 | Ga0265336_101361611 | 191 |
| 697 | 3300028794 | Ga0307515_10088846 | Ga0307515_100888466 | 191 |
| 698 | 3300028800 | Ga0265338_10000273 | Ga0265338_1000027327 | 191 |
| 699 | 3300028800 | Ga0265338_10002518 | Ga0265338_100025186 | 191 |
| 700 | 3300028800 | Ga0265338_10070056 | Ga0265338_100700563 | 191 |
| 701 | 3300029957 | Ga0265324_10000013 | Ga0265324_1000001357 | 191 |
| 702 | 3300029957 | Ga0265324_10011238 | Ga0265324_100112385 | 191 |
| 703 | 3300029957 | Ga0265324_10022786 | Ga0265324_100227863 | 191 |
| 704 | 3300031090 | Ga0265760_10005102 | Ga0265760_100051024 | 191 |
| 705 | 3300031235 | Ga0265330_10000023 | Ga0265330_10000023123 | 191 |
| 706 | 3300031238 | Ga0265332_10000040 | Ga0265332_100000408 | 191 |
| 707 | 3300031238 | Ga0265332_10026189 | Ga0265332_100261891 | 191 |
| 708 | 3300031238 | Ga0265332_10092026 | Ga0265332_100920262 | 191 |
| 709 | 3300031239 | Ga0265328_10015993 | Ga0265328_100159932 | 191 |
| 710 | 3300031240 | Ga0265320_10000022 | Ga0265320_1000002239 | 191 |
| 711 | 3300031240 | Ga0265320_10000494 | Ga0265320_100004947 | 191 |
| 712 | 3300031240 | Ga0265320_10364122 | Ga0265320_103641221 | 191 |
| 713 | 3300031241 | Ga0265325_10042944 | Ga0265325_100429445 | 191 |
| 714 | 3300031242 | Ga0265329_10026242 | Ga0265329_100262423 | 191 |
| 715 | 3300031247 | Ga0265340_10023753 | Ga0265340_100237533 | 191 |
| 716 | 3300031249 | Ga0265339_10058958 | Ga0265339_100589582 | 191 |
| 717 | 3300031249 | Ga0265339_10173091 | Ga0265339_101730912 | 191 |
| 718 | 3300031250 | Ga0265331_10000001 | Ga0265331_10000001576 | 191 |
| 719 | 3300031250 | Ga0265331_10064464 | Ga0265331_100644642 | 191 |
| 720 | 3300031250 | Ga0265331_10108435 | Ga0265331_101084352 | 191 |
| 721 | 3300031251 | Ga0265327_10000426 | Ga0265327_100004268 | 191 |
| 722 | 3300031344 | Ga0265316_10001556 | Ga0265316_1000155616 | 191 |
| 723 | 3300031344 | Ga0265316_10024131 | Ga0265316_100241316 | 191 |
| 724 | 3300031344 | Ga0265316_10214381 | Ga0265316_102143813 | 191 |
| 725 | 3300031344 | Ga0265316_10291342 | Ga0265316_102913422 | 191 |
| 726 | 3300031548 | Ga0307408_100015226 | Ga0307408_1000152262 | 191 |
| 727 | 3300031595 | Ga0265313_10000018 | Ga0265313_10000018120 | 191 |
| 728 | 3300031595 | Ga0265313_10002159 | Ga0265313_100021593 | 191 |
| 729 | 3300031665 | Ga0316575_10011634 | Ga0316575_100116343 | 191 |
| 730 | 3300031691 | Ga0316579_10012325 | Ga0316579_100123252 | 191 |
| 731 | 3300031711 | Ga0265314_10000006 | Ga0265314_1000000668 | 191 |
| 732 | 3300031711 | Ga0265314_10008212 | Ga0265314_100082128 | 191 |
| 733 | 3300031711 | Ga0265314_10093905 | Ga0265314_100939052 | 191 |
| 734 | 3300031711 | Ga0265314_10128497 | Ga0265314_101284972 | 191 |
| 735 | 3300031712 | Ga0265342_10007381 | Ga0265342_100073814 | 191 |
| 736 | 3300031712 | Ga0265342_10014422 | Ga0265342_100144225 | 191 |
| 737 | 3300031727 | Ga0316576_10024142 | Ga0316576_100241422 | 191 |
| 738 | 3300031728 | Ga0316578_10005251 | Ga0316578_100052515 | 191 |
| 739 | 3300031733 | Ga0316577_10009514 | Ga0316577_100095144 | 191 |
| 740 | 3300031995 | Ga0307409_100118493 | Ga0307409_1001184932 | 191 |
| 741 | 3300032002 | Ga0307416_100181409 | Ga0307416_1001814092 | 191 |
| 742 | 3300032002 | Ga0307416_100578416 | Ga0307416_1005784162 | 191 |
| 743 | 3300032004 | Ga0307414_10025626 | Ga0307414_100256263 | 191 |
| 744 | 3300032004 | Ga0307414_10031339 | Ga0307414_100313394 | 191 |
| 745 | 3300032005 | Ga0307411_10326559 | Ga0307411_103265592 | 191 |
| 746 | 3300032139 | Ga0316580_10000633 | Ga0316580_100006334 | 191 |
| 747 | 3300033524 | Ga0316592_1105039 | Ga0316592_11050391 | 191 |
| 748 | 3300035119 | Ga0373956_0021341 | Ga0373956_0021341_627_1202 | 191 |
| 749 | 3300035170 | Ga0373943_0431794 | Ga0373943_0431794_47_622 | 191 |
| 750 | 3300035171 | Ga0373946_0030639 | Ga0373946_0030639_1060_1635 | 191 |
| 751 | 3300035172 | Ga0373955_0020220 | Ga0373955_0020220_2454_3029 | 191 |
| 752 | 3300035398 | Ga0316574_0033312 | Ga0316574_0033312_418_993 | 191 |
| 753 | 3300035691 | Ga0373931_0065013 | Ga0373931_0065013_1034_1609 | 191 |
| 754 | 3300035691 | Ga0373931_0076780 | Ga0373931_0076780_585_1169 | 191 |
| 755 | 3300035724 | Ga0373933_0216268 | Ga0373933_0216268_303_917 | 191 |
| 756 | 3300036401 | Ga0373937_0129582 | Ga0373937_0129582_1185_1799 | 191 |
| 757 | 3300036401 | Ga0373937_0651921 | Ga0373937_0651921_48_638 | 191 |
| 758 | 3300036647 | Ga0316582_0011550 | Ga0316582_0011550_2548_3123 | 191 |
| 759 | 3300036712 | Ga0316584_0101297 | Ga0316584_0101297_533_1108 | 191 |
| 760 | 3300037068 | Ga0373925_0015234 | Ga0373925_0015234_3777_4352 | 191 |
| 761 | 3300037466 | Ga0395898_0544070 | Ga0395898_0544070_356_934 | 191 |
| 762 | 3300037471 | Ga0395905_0107621 | Ga0395905_0107621_276_854 | 191 |
| 763 | 3300037471 | Ga0395905_0493689 | Ga0395905_0493689_22_609 | 191 |
| 764 | 3300037588 | Ga0316581_0000048 | Ga0316581_0000048_2563_3138 | 191 |
| 765 | 3300037853 | Ga0436364_0079644 | Ga0436364_0079644_22971_23564 | 191 |
| 766 | 3300037853 | Ga0436364_0354394 | Ga0436364_0354394_66_668 | 191 |
| 767 | 3300037853 | Ga0436364_0764741 | Ga0436364_0764741_767_1351 | 191 |
| 768 | 3300037853 | Ga0436364_0815975 | Ga0436364_0815975_733_1344 | 191 |
| 769 | 3300037853 | Ga0436364_1367354 | Ga0436364_1367354_588_1190 | 191 |
| 770 | 3300037853 | Ga0436364_1506799 | Ga0436364_1506799_2035_2610 | 191 |
| 771 | 3300039437 | Ga0436365_0861631 | Ga0436365_0861631_3420_4031 | 191 |
| 772 | 3300039450 | Ga0436363_0543025 | Ga0436363_0543025_59_670 | 191 |
| 773 | 3300039450 | Ga0436363_0549965 | Ga0436363_0549965_52_654 | 191 |
| 774 | 3300039450 | Ga0436363_0589199 | Ga0436363_0589199_222_827 | 191 |
| 775 | 3300041411 | Ga0439466_0068944 | Ga0439466_0068944_134_733 | 191 |
| 776 | 3300041486 | Ga0451807_0610239 | Ga0451807_0610239_263_847 | 191 |
| 777 | 3300041501 | Ga0451845_0935863 | Ga0451845_0935863_293_877 | 191 |
| 778 | 3300042007 | Ga0439449_0018604 | Ga0439449_0018604_376_975 | 191 |
| 779 | 3300042128 | Ga0450897_007139 | Ga0450897_007139_258_851 | 191 |
| 780 | 3300042435 | Ga0439434_0015100 | Ga0439434_0015100_520_1119 | 191 |
| 781 | 3300042876 | Ga0451577_0118834 | Ga0451577_0118834_997_1572 | 191 |
| 782 | 3300044673 | Ga0453683_0105437 | Ga0453683_0105437_118_705 | 191 |
| 783 | 3300044694 | Ga0466963_0300837 | Ga0466963_0300837_146_736 | 191 |
| 784 | 3300044706 | Ga0466964_0080747 | Ga0466964_0080747_315_899 | 191 |
| 785 | 3300044712 | Ga0453684_0014309 | Ga0453684_0014309_7565_8173 | 191 |
| 786 | 3300044712 | Ga0453684_0037782 | Ga0453684_0037782_909_1484 | 191 |
| 787 | 3300044712 | Ga0453684_0078632 | Ga0453684_0078632_1957_2565 | 191 |
| 788 | 3300044712 | Ga0453684_0212442 | Ga0453684_0212442_301_876 | 191 |
| 789 | 3300044712 | Ga0453684_0438993 | Ga0453684_0438993_374_949 | 191 |
| 790 | 3300044712 | Ga0453684_0614798 | Ga0453684_0614798_307_882 | 191 |
| 791 | 3300044842 | Ga0466957_0556086 | Ga0466957_0556086_164_787 | 191 |
| 792 | 3300045049 | Ga0466959_0021949 | Ga0466959_0021949_2743_3381 | 191 |
| 793 | 3300045051 | Ga0451576_0023531 | Ga0451576_0023531_5888_6463 | 191 |
| 794 | 3300045051 | Ga0451576_0775211 | Ga0451576_0775211_319_912 | 191 |
| 795 | 3300045051 | Ga0451576_0812589 | Ga0451576_0812589_122_709 | 191 |
| 796 | 3300046454 | Ga0495592_0040018 | Ga0495592_0040018_2182_2763 | 191 |
| 797 | 3300046463 | Ga0495653_0000035 | Ga0495653_0000035_34279_34854 | 191 |
| 798 | 3300046463 | Ga0495653_0223216 | Ga0495653_0223216_372_947 | 191 |
| 799 | 3300046471 | Ga0495650_0014587 | Ga0495650_0014587_1772_2347 | 191 |
| 800 | 3300046472 | Ga0495580_0081182 | Ga0495580_0081182_403_984 | 191 |
| 801 | 3300046476 | Ga0495662_0013922 | Ga0495662_0013922_2793_3374 | 191 |
| 802 | 3300046499 | Ga0495594_0027028 | Ga0495594_0027028_19_600 | 191 |
| 803 | 3300046499 | Ga0495594_0229656 | Ga0495594_0229656_346_921 | 191 |
| 804 | 3300046507 | Ga0495606_0000512 | Ga0495606_0000512_38193_38768 | 191 |
| 805 | 3300046514 | Ga0495618_0056940 | Ga0495618_0056940_1015_1596 | 191 |
| 806 | 3300046642 | Ga0495634_0096519 | Ga0495634_0096519_425_1006 | 191 |
| 807 | 3300046674 | Ga0495588_0046713 | Ga0495588_0046713_973_1554 | 191 |
| 808 | 3300046678 | Ga0495599_0008979 | Ga0495599_0008979_1645_2226 | 191 |
| 809 | 3300046689 | Ga0495613_0044931 | Ga0495613_0044931_140_721 | 191 |
| 810 | 3300046690 | Ga0495624_0284016 | Ga0495624_0284016_16_600 | 191 |
| 811 | 3300046692 | Ga0495671_0000005 | Ga0495671_0000005_242212_242787 | 191 |
| 812 | 3300047317 | Ga0495604_0130923 | Ga0495604_0130923_894_1475 | 191 |
| 813 | 3300047319 | Ga0495674_0023447 | Ga0495674_0023447_2933_3508 | 191 |
| 814 | 3300047319 | Ga0495674_0116362 | Ga0495674_0116362_1284_1865 | 191 |
| 815 | 3300047319 | Ga0495674_0147007 | Ga0495674_0147007_300_881 | 191 |
| 816 | 3300047444 | Ga0495675_0084671 | Ga0495675_0084671_1009_1683 | 191 |
| 817 | 3300047469 | Ga0495673_0000012 | Ga0495673_0000012_434663_435244 | 191 |
| 818 | 3300047471 | Ga0495684_0062255 | Ga0495684_0062255_1430_2011 | 191 |
| 819 | 3300047471 | Ga0495684_0062389 | Ga0495684_0062389_1471_2052 | 191 |
| 820 | 3300047472 | Ga0495686_0161910 | Ga0495686_0161910_331_915 | 191 |
| 821 | 3300048903 | Ga0496100_0286203 | Ga0496100_0286203_532_1116 | 191 |
| 822 | 3300048906 | Ga0496103_0070932 | Ga0496103_0070932_355_942 | 191 |
| 823 | 3300048907 | Ga0496104_0003103 | Ga0496104_0003103_8607_9191 | 191 |
| 824 | 3300048907 | Ga0496104_0025034 | Ga0496104_0025034_1878_2465 | 191 |
| 825 | 3300048907 | Ga0496104_0597651 | Ga0496104_0597651_357_941 | 191 |
| 826 | 3300048908 | Ga0496105_0005857 | Ga0496105_0005857_5545_6129 | 191 |
| 827 | 3300048909 | Ga0496106_0111339 | Ga0496106_0111339_145_732 | 191 |
| 828 | 3300048909 | Ga0496106_0317353 | Ga0496106_0317353_357_941 | 191 |
| 829 | 3300048909 | Ga0496106_0911339 | Ga0496106_0911339_77_661 | 191 |
| 830 | 3300048911 | Ga0496108_0019732 | Ga0496108_0019732_3946_4530 | 191 |
| 831 | 3300048912 | Ga0496109_0481941 | Ga0496109_0481941_561_1148 | 191 |
| 832 | 3300048913 | Ga0496110_0008210 | Ga0496110_0008210_7386_7970 | 191 |
| 833 | 3300048913 | Ga0496110_0551343 | Ga0496110_0551343_271_849 | 191 |
| 834 | 3300048913 | Ga0496110_0890432 | Ga0496110_0890432_200_784 | 191 |
| 835 | 3300048914 | Ga0496111_0058388 | Ga0496111_0058388_1309_1893 | 191 |
| 836 | 3300048915 | Ga0496112_0058302 | Ga0496112_0058302_117_704 | 191 |
| 837 | 3300048915 | Ga0496112_0094967 | Ga0496112_0094967_1525_2100 | 191 |
| 838 | 3300048915 | Ga0496112_0873277 | Ga0496112_0873277_99_785 | 191 |
| 839 | 3300048917 | Ga0496114_0074194 | Ga0496114_0074194_1532_2116 | 191 |
| 840 | 3300048917 | Ga0496114_0081551 | Ga0496114_0081551_1203_1787 | 191 |
| 841 | 3300048929 | Ga0496126_0012839 | Ga0496126_0012839_5762_6394 | 191 |
| 842 | 3300049570 | Ga0501033_0000264 | Ga0501033_0000264_40567_41148 | 191 |
| 843 | 3300049571 | Ga0501034_0000572 | Ga0501034_0000572_25460_26041 | 191 |
| 844 | 3300049572 | Ga0501036_0033995 | Ga0501036_0033995_3180_3761 | 191 |
| 845 | 3300049572 | Ga0501036_0034780 | Ga0501036_0034780_1513_2094 | 191 |
| 846 | 3300049572 | Ga0501036_0259485 | Ga0501036_0259485_221_865 | 191 |
| 847 | 3300049573 | Ga0501037_0059323 | Ga0501037_0059323_1707_2357 | 191 |
| 848 | 3300049573 | Ga0501037_0095488 | Ga0501037_0095488_784_1365 | 191 |
| 849 | 3300049574 | Ga0501038_0304412 | Ga0501038_0304412_462_1106 | 191 |
| 850 | 3300049578 | Ga0501042_0079935 | Ga0501042_0079935_1212_1796 | 191 |
| 851 | 3300049579 | Ga0501043_0026599 | Ga0501043_0026599_487_1131 | 191 |
| 852 | 3300049581 | Ga0501047_0010345 | Ga0501047_0010345_6246_6890 | 191 |
| 853 | 3300049581 | Ga0501047_0266255 | Ga0501047_0266255_169_813 | 191 |
| 854 | 3300049586 | Ga0501070_0011014 | Ga0501070_0011014_4627_5271 | 191 |
| 855 | 3300049586 | Ga0501070_0035279 | Ga0501070_0035279_1740_2327 | 191 |
| 856 | 3300049586 | Ga0501070_0289198 | Ga0501070_0289198_378_962 | 191 |
| 857 | 3300049589 | Ga0501073_0060831 | Ga0501073_0060831_747_1331 | 191 |
| 858 | 3300049591 | Ga0501075_0113250 | Ga0501075_0113250_51_635 | 191 |
| 859 | 3300049674 | Ga0501242_001168 | Ga0501242_001168_1858_2445 | 191 |
| 860 | 3300049679 | Ga0501249_091320 | Ga0501249_091320_52_663 | 191 |
| 861 | 3300049688 | Ga0501259_004679 | Ga0501259_004679_1109_1696 | 191 |
| 862 | 3300049708 | Ga0501245_017126 | Ga0501245_017126_180_767 | 191 |
| 863 | 3300049741 | Ga0501079_0070256 | Ga0501079_0070256_2108_2692 | 191 |
| 864 | 3300049742 | Ga0501080_0101414 | Ga0501080_0101414_1078_1665 | 191 |
| 865 | 3300049742 | Ga0501080_0506903 | Ga0501080_0506903_85_669 | 191 |
| 866 | 3300049742 | Ga0501080_0758658 | Ga0501080_0758658_217_792 | 191 |
| 867 | 3300049765 | Ga0501268_054545 | Ga0501268_054545_62_649 | 191 |
| 868 | 3300049822 | Ga0501035_0010184 | Ga0501035_0010184_4960_5610 | 191 |
| 869 | 3300049822 | Ga0501035_0182250 | Ga0501035_0182250_651_1295 | 191 |
| 870 | 3300049823 | Ga0501044_0004459 | Ga0501044_0004459_6963_7544 | 191 |
| 871 | 3300050493 | nmdc:mga0k408_24387_c1 | nmdc:mga0k408_24387_c1_1899_2501 | 191 |
| 872 | 3300050507 | nmdc:mga05p37_102095_c1 | nmdc:mga05p37_102095_c1_582_1160 | 191 |
| 873 | 3300050507 | nmdc:mga05p37_198967_c2 | nmdc:mga05p37_198967_c2_70_654 | 191 |
| 874 | 3300050507 | nmdc:mga05p37_203516_c1 | nmdc:mga05p37_203516_c1_761_1336 | 191 |
| 875 | 3300050507 | nmdc:mga05p37_33027_c1 | nmdc:mga05p37_33027_c1_272_847 | 191 |
| 876 | 3300050507 | nmdc:mga05p37_627909_c1 | nmdc:mga05p37_627909_c1_530_1105 | 191 |
| 877 | 3300050507 | nmdc:mga05p37_657753_c1 | nmdc:mga05p37_657753_c1_533_1150 | 191 |
| 878 | 3300050507 | nmdc:mga05p37_737532_c1 | nmdc:mga05p37_737532_c1_144_731 | 191 |
| 879 | 3300050508 | nmdc:mga09592_178409_c1 | nmdc:mga09592_178409_c1_249_824 | 191 |
| 880 | 3300050508 | nmdc:mga09592_222184_c1 | nmdc:mga09592_222184_c1_206_787 | 191 |
| 881 | 3300050508 | nmdc:mga09592_235355_c1 | nmdc:mga09592_235355_c1_448_1065 | 191 |
| 882 | 3300050508 | nmdc:mga09592_2772_c1 | nmdc:mga09592_2772_c1_10007_10582 | 191 |
| 883 | 3300050509 | nmdc:mga0qj67_131778_c1 | nmdc:mga0qj67_131778_c1_152_727 | 191 |
| 884 | 3300050510 | nmdc:mga06r32_19954_c1 | nmdc:mga06r32_19954_c1_2453_3070 | 191 |
| 885 | 3300050511 | nmdc:mga08y16_134086_c1 | nmdc:mga08y16_134086_c1_802_1386 | 191 |
| 886 | 3300050511 | nmdc:mga08y16_531580_c1 | nmdc:mga08y16_531580_c1_311_910 | 191 |
| 887 | 3300050511 | nmdc:mga08y16_96242_c1 | nmdc:mga08y16_96242_c1_1689_2264 | 191 |
| 888 | 3300050512 | nmdc:mga0n895_157271_c1 | nmdc:mga0n895_157271_c1_1672_2247 | 191 |
| 889 | 3300050512 | nmdc:mga0n895_193524_c1 | nmdc:mga0n895_193524_c1_863_1450 | 191 |
| 890 | 3300050512 | nmdc:mga0n895_392230_c1 | nmdc:mga0n895_392230_c1_124_711 | 191 |
| 891 | 3300050512 | nmdc:mga0n895_522486_c1 | nmdc:mga0n895_522486_c1_367_963 | 191 |
| 892 | 3300050512 | nmdc:mga0n895_671925_c1 | nmdc:mga0n895_671925_c1_376_951 | 191 |
| 893 | 3300050512 | nmdc:mga0n895_796916_c1 | nmdc:mga0n895_796916_c1_18_593 | 191 |
| 894 | 3300050512 | nmdc:mga0n895_984857_c1 | nmdc:mga0n895_984857_c1_37_612 | 191 |
| 895 | 3300050513 | nmdc:mga0rr50_158622_c1 | nmdc:mga0rr50_158622_c1_1180_1755 | 191 |
| 896 | 3300050513 | nmdc:mga0rr50_236_c1 | nmdc:mga0rr50_236_c1_6966_7541 | 191 |
| 897 | 3300050514 | nmdc:mga08x19_167633_c1 | nmdc:mga08x19_167633_c1_422_1006 | 191 |
| 898 | 3300050514 | nmdc:mga08x19_31_c1 | nmdc:mga08x19_31_c1_148776_149351 | 191 |
| 899 | 3300050515 | nmdc:mga0a205_210616_c1 | nmdc:mga0a205_210616_c1_90_665 | 191 |
| 900 | 3300050515 | nmdc:mga0a205_215431_c1 | nmdc:mga0a205_215431_c1_1168_1755 | 191 |
| 901 | 3300050515 | nmdc:mga0a205_2951_c1 | nmdc:mga0a205_2951_c1_1402_1977 | 191 |
| 902 | 3300053088 | Ga0500644_0046920 | Ga0500644_0046920_692_1297 | 191 |
| 903 | 3300053098 | Ga0500650_0048643 | Ga0500650_0048643_649_1254 | 191 |
| 904 | 3300053131 | Ga0500652_224155 | Ga0500652_224155_106_711 | 191 |
| 905 | 3300053134 | Ga0500658_0089637 | Ga0500658_0089637_35_640 | 191 |
| 906 | 3300053139 | Ga0500568_0087435 | Ga0500568_0087435_75_665 | 191 |
| 907 | 3300053153 | Ga0500616_0107781 | Ga0500616_0107781_642_1241 | 191 |
| 908 | 3300060353 | Ga0501082_0145025 | Ga0501082_0145025_1176_1760 | 191 |
| 909 | 3300060353 | Ga0501082_1039041 | Ga0501082_1039041_104_688 | 191 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5vre-assembly1.cif.gz_D | crystal structure of a lysosomal potassium-selective channel tmem175 homolog from chamaesiphon minutus | 0.8342 | 3 | 178 |
| 8fyf-assembly1.cif.gz_B | human tmem175-lamp1 transmembrane domain only complex | 0.8122 | 3 | 178 |
| 6w8p-assembly1.cif.gz_B | structure of membrane protein with ions | 0.809 | 5 | 177 |
| 6w8n-assembly1.cif.gz_B | structure of a trans-membrane protein | 0.8055 | 1 | 175 |
| 7unl-assembly1.cif.gz_A | human tmem175 in an open state | 0.7915 | 1 | 178 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_A0A0R0HUX5_50_167_1.20.930.20 | Mainly Alpha;Up-down Bundle;Transcription Elongation Factor S-II; Chain A;Adaptor protein Cbl, N-terminal domain | 0.6186 | 14 | 126 | 1.20.930.20 |
| af_A0A0R0HUX5_50_167_1.20.930.20 | Mainly Alpha;Up-down Bundle;Transcription Elongation Factor S-II; Chain A;Adaptor protein Cbl, N-terminal domain | 0.5914 | 14 | 126 | 1.20.930.20 |
| af_Q3EBY6_10_127_1.20.930.20 | Mainly Alpha;Up-down Bundle;Transcription Elongation Factor S-II; Chain A;Adaptor protein Cbl, N-terminal domain | 0.5807 | 13 | 122 | 1.20.930.20 |
| af_P34330_65_305_1.50.10.10 | Mainly Alpha;Alpha/alpha barrel;Glycosyltransferase; | 0.5778 | 39 | 179 | 1.50.10.10 |
| af_K7MER9_13_125_1.20.930.20 | Mainly Alpha;Up-down Bundle;Transcription Elongation Factor S-II; Chain A;Adaptor protein Cbl, N-terminal domain | 0.5462 | 6 | 126 | 1.20.930.20 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2V5PTR6-F1-model_v4 | DUF1211 domain-containing protein | 0.9927 | 1 | 175 |
GO:0005267
GO:0015252 GO:0016020 |
| AF-A0A529ZQU9-F1-model_v4 | DUF1211 domain-containing protein | 0.9924 | 1 | 124 |
GO:0005267
GO:0015252 GO:0016020 |
| AF-A0A524JF56-F1-model_v4 | DUF1211 domain-containing protein | 0.99 | 1 | 178 |
GO:0005267
GO:0015252 GO:0016020 |
| AF-A0A7V8XUC2-F1-model_v4 | DUF1211 domain-containing protein | 0.9898 | 1 | 191 |
GO:0005267
GO:0015252 GO:0016020 |
| AF-A0A2U3QFG1-F1-model_v4 | DUF1211 domain-containing protein | 0.9884 | 1 | 189 |
GO:0005267
GO:0015252 GO:0016020 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar