F485409

General Info

Members Datasets Scaffolds Average Seq Length
909 233 1818 164

Family's Representative Sequence

Representative Sequence 3300005617|Ga0068859_100432730|Ga0068859_1004327303
Length 190
Sequence LPNHPAHREEGLSSSDGSVSKARLERPRLFLDADGVLADFDRGACELLGMKPKAFIAKHGRGAFWGRLARATNFYGSLPEMPDARILFDAVKHLKPTILTGLPIGKWAAPQKVEWAAEHFPGVPIITCMARDKHKHMHPGDVLVDDREKHREAYEAHGVAFVHHKNARDSLRQLSKIFESVKAPSSAEAD

Samples

Sample ID Description Type Environment
1 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
6 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
20 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
21 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
25 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
26 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
27 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
28 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
29 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
30 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
31 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
32 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
33 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
34 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
35 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
36 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
37 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
38 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
39 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
40 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
41 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
42 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
43 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
44 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
45 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
46 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
47 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
48 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
49 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
50 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
51 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
52 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
53 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
54 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
55 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
56 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
57 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
58 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
59 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
60 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
61 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
62 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
63 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
64 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
65 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
67 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
68 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
69 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
70 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
72 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
73 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
74 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
75 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
76 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
77 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
78 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
79 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
80 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
81 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
82 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
83 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
84 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
85 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
86 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
87 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
88 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
89 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
90 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
91 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
92 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
93 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
94 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
95 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
96 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
97 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
98 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
99 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
157 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
158 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
159 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
160 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
161 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
162 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
163 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
164 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
165 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
166 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
167 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
168 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
169 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
170 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
171 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
172 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
173 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
174 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
175 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
176 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
177 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
178 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
179 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
180 3300042118 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_082316_2156 Metagenome Rhizosphere
181 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
182 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
183 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
184 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
185 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
186 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
187 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
188 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
189 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
190 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
191 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
192 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
193 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
194 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
195 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
196 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
197 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
198 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
199 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
200 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
201 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
202 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
203 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
204 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
205 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
206 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
207 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
208 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
209 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
210 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
211 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
212 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
213 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
214 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
215 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
216 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
217 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
218 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
219 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
220 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
221 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
222 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
223 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
224 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
225 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
226 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
227 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
228 3300049850 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control Metagenome Rhizosphere
229 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
230 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
231 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
232 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
233 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.67
Metatranscriptomes 0.33
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 3.41
Rhizosphere 96.15
Stem 0
Stem Tuber 0
Unclassified 0.55

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068859_100432730 3300005617 Bacteria 1412
2 JGI24740J21852_10038646 3300001979 Bacteria 1462
3 JGI24740J21852_10056410 3300001979 Bacteria 1101
4 JGI24740J21852_10081855 3300001979 Bacteria 845
5 JGI24739J22299_10010442 3300001989 Bacteria 3448
6 JGI24737J22298_10003860 3300001990 Bacteria 5268
7 JGI24737J22298_10058430 3300001990 Bacteria 1163
8 JGI24737J22298_10090805 3300001990 Bacteria 906
9 JGI24735J21928_10001014 3300002067 Bacteria 10049
10 JGI24735J21928_10054465 3300002067 Bacteria 1153
11 JGI24735J21928_10100893 3300002067 Bacteria 829
12 JGI24738J21930_10014613 3300002075 Bacteria 1682
13 Ga0070658_10029136 3300005327 Bacteria 4434
14 Ga0070658_10069196 3300005327 Bacteria 2887
15 Ga0070658_10240433 3300005327 Bacteria 1534
16 Ga0070658_10281183 3300005327 Bacteria 1416
17 Ga0070658_10436384 3300005327 Bacteria 1127
18 Ga0070658_10499531 3300005327 Bacteria 1051
19 Ga0070658_10592457 3300005327 Bacteria 961
20 Ga0070658_10921578 3300005327 Bacteria 760
21 Ga0070676_10087017 3300005328 Bacteria 1907
22 Ga0070676_10366781 3300005328 Bacteria 994
23 Ga0070676_10409959 3300005328 Bacteria 945
24 Ga0070676_10533461 3300005328 Bacteria 838
25 Ga0070683_100007532 3300005329 Bacteria 9203
26 Ga0070683_100035875 3300005329 Bacteria 4535
27 Ga0070683_100120388 3300005329 Bacteria 2479
28 Ga0070683_100421431 3300005329 Bacteria 1273
29 Ga0070690_100045263 3300005330 Bacteria 2795
30 Ga0070670_100006006 3300005331 Bacteria 10266
31 Ga0070670_100055894 3300005331 Bacteria 3387
32 Ga0070670_100056397 3300005331 Bacteria 3371
33 Ga0070670_100116985 3300005331 Bacteria 2299
34 Ga0070670_100121508 3300005331 Bacteria 2253
35 Ga0070670_100148532 3300005331 Bacteria 2028
36 Ga0070670_100160606 3300005331 Bacteria 1947
37 Ga0070670_100294485 3300005331 Bacteria 1419
38 Ga0070670_101205427 3300005331 Bacteria 692
39 Ga0070666_10001159 3300005335 Bacteria 16007
40 Ga0070666_10001949 3300005335 Bacteria 12559
41 Ga0070666_10022468 3300005335 Bacteria 4095
42 Ga0070666_10050034 3300005335 Bacteria 2810
43 Ga0070666_10110224 3300005335 Bacteria 1903
44 Ga0070666_10115294 3300005335 Bacteria 1860
45 Ga0070666_10179672 3300005335 Bacteria 1484
46 Ga0070680_100001518 3300005336 Bacteria 16895
47 Ga0070680_100096668 3300005336 Bacteria 2449
48 Ga0070680_100578310 3300005336 Bacteria 964
49 Ga0070682_100004857 3300005337 Bacteria 7460
50 Ga0070682_100032352 3300005337 Bacteria 3170
51 Ga0068868_100003467 3300005338 Bacteria 10989
52 Ga0068868_100011836 3300005338 Bacteria 6361
53 Ga0068868_100042258 3300005338 Bacteria 3556
54 Ga0068868_100363885 3300005338 Bacteria 1241
55 Ga0068868_100444403 3300005338 Bacteria 1127
56 Ga0068868_100741525 3300005338 Bacteria 882
57 Ga0070660_100041842 3300005339 Bacteria 3494
58 Ga0070660_100049059 3300005339 Bacteria 3244
59 Ga0070660_100099176 3300005339 Bacteria 2306
60 Ga0070660_100132797 3300005339 Bacteria 1993
61 Ga0070660_100133650 3300005339 Bacteria 1987
62 Ga0070660_100219935 3300005339 Bacteria 1543
63 Ga0070660_100316352 3300005339 Bacteria 1281
64 Ga0070660_100323366 3300005339 Bacteria 1267
65 Ga0070660_100417694 3300005339 Bacteria 1110
66 Ga0070660_100505621 3300005339 Bacteria 1005
67 Ga0070660_100841409 3300005339 Bacteria 772
68 Ga0070689_100502401 3300005340 Bacteria 1039
69 Ga0070661_100000033 3300005344 Bacteria 111757
70 Ga0070661_100022892 3300005344 Bacteria 4475
71 Ga0070661_100050954 3300005344 Bacteria 3029
72 Ga0070661_100145569 3300005344 Bacteria 1788
73 Ga0070661_100147780 3300005344 Bacteria 1775
74 Ga0070661_100406123 3300005344 Bacteria 1078
75 Ga0070661_100431605 3300005344 Bacteria 1046
76 Ga0070692_10364601 3300005345 Bacteria 902
77 Ga0070668_100028452 3300005347 Bacteria 4243
78 Ga0070668_101250358 3300005347 Bacteria 674
79 Ga0070669_100011249 3300005353 Bacteria 6354
80 Ga0070669_100203568 3300005353 Bacteria 1558
81 Ga0070675_100044299 3300005354 Bacteria 3639
82 Ga0070675_100705937 3300005354 Bacteria 919
83 Ga0070671_100002556 3300005355 Bacteria 14098
84 Ga0070671_100004963 3300005355 Bacteria 10589
85 Ga0070671_100040753 3300005355 Bacteria 3859
86 Ga0070671_100094374 3300005355 Bacteria 2507
87 Ga0070671_100103974 3300005355 Bacteria 2383
88 Ga0070671_100149555 3300005355 Bacteria 1971
89 Ga0070671_100192965 3300005355 Bacteria 1726
90 Ga0070671_100243948 3300005355 Bacteria 1525
91 Ga0070671_100673373 3300005355 Bacteria 896
92 Ga0070674_100049966 3300005356 Bacteria 2877
93 Ga0070673_100005316 3300005364 Bacteria 8224
94 Ga0070673_100010903 3300005364 Bacteria 6178
95 Ga0070673_100022686 3300005364 Bacteria 4572
96 Ga0070673_100070233 3300005364 Bacteria 2810
97 Ga0070673_100315503 3300005364 Bacteria 1380
98 Ga0070673_100584947 3300005364 Bacteria 1017
99 Ga0070659_100021982 3300005366 Bacteria 4867
100 Ga0070659_100037215 3300005366 Bacteria 3793
101 Ga0070659_100109898 3300005366 Bacteria 2225
102 Ga0070659_100169594 3300005366 Bacteria 1787
103 Ga0070659_100265609 3300005366 Bacteria 1424
104 Ga0070659_100292841 3300005366 Bacteria 1356
105 Ga0070659_100577276 3300005366 Bacteria 964
106 Ga0070659_100945442 3300005366 Bacteria 755
107 Ga0070659_101205070 3300005366 Bacteria 670
108 Ga0070667_100003564 3300005367 Bacteria 13258
109 Ga0070667_100015899 3300005367 Bacteria 6225
110 Ga0070667_100027823 3300005367 Bacteria 4705
111 Ga0070667_100030273 3300005367 Bacteria 4513
112 Ga0070667_100043724 3300005367 Bacteria 3760
113 Ga0070667_100062169 3300005367 Bacteria 3162
114 Ga0070667_100103492 3300005367 Bacteria 2461
115 Ga0070667_100105763 3300005367 Bacteria 2435
116 Ga0070709_10087559 3300005434 Bacteria 2047
117 Ga0070714_100063688 3300005435 Bacteria 3171
118 Ga0070714_100068197 3300005435 Bacteria 3068
119 Ga0070714_100114904 3300005435 Bacteria 2388
120 Ga0070713_100020943 3300005436 Bacteria 5021
121 Ga0070713_100319535 3300005436 Bacteria 1433
122 Ga0070701_10318866 3300005438 Bacteria 961
123 Ga0070701_10487802 3300005438 Bacteria 798
124 Ga0070694_100024638 3300005444 Bacteria 3885
125 Ga0070663_100001259 3300005455 Bacteria 13908
126 Ga0070663_100065570 3300005455 Bacteria 2629
127 Ga0070663_100300981 3300005455 Bacteria 1284
128 Ga0070663_101181014 3300005455 Bacteria 672
129 Ga0070678_100020199 3300005456 Bacteria 4366
130 Ga0070678_100542556 3300005456 Bacteria 1031
131 Ga0070662_100015634 3300005457 Bacteria 5087
132 Ga0070662_100024097 3300005457 Bacteria 4188
133 Ga0070662_100024392 3300005457 Bacteria 4166
134 Ga0070662_100153068 3300005457 Bacteria 1797
135 Ga0070662_100351643 3300005457 Bacteria 1207
136 Ga0070662_100447279 3300005457 Bacteria 1072
137 Ga0070662_101123146 3300005457 Bacteria 675
138 Ga0070662_101329969 3300005457 Bacteria 619
139 Ga0070681_10104704 3300005458 Bacteria 2772
140 Ga0068867_100226140 3300005459 Bacteria 1510
141 Ga0068867_100274177 3300005459 Bacteria 1381
142 Ga0068867_100514945 3300005459 Bacteria 1031
143 Ga0070679_100163666 3300005530 Bacteria 2198
144 Ga0070679_100169604 3300005530 Bacteria 2155
145 Ga0070679_100233983 3300005530 Bacteria 1796
146 Ga0070679_100347397 3300005530 Bacteria 1431
147 Ga0070679_100363424 3300005530 Bacteria 1395
148 Ga0070679_100441738 3300005530 Bacteria 1246
149 Ga0070684_100008813 3300005535 Bacteria 7908
150 Ga0070684_100012386 3300005535 Bacteria 6833
151 Ga0070684_100150045 3300005535 Bacteria 2111
152 Ga0068853_100011243 3300005539 Bacteria 7264
153 Ga0068853_100035909 3300005539 Bacteria 4212
154 Ga0068853_100135095 3300005539 Bacteria 2210
155 Ga0068853_100219884 3300005539 Bacteria 1734
156 Ga0068853_100238907 3300005539 Bacteria 1664
157 Ga0068853_100624324 3300005539 Bacteria 1024
158 Ga0068853_100811051 3300005539 Bacteria 896
159 Ga0068853_101000207 3300005539 Bacteria 805
160 Ga0070672_100010316 3300005543 Bacteria 6476
161 Ga0070672_100090268 3300005543 Bacteria 2471
162 Ga0070672_100269343 3300005543 Bacteria 1438
163 Ga0070672_100290392 3300005543 Bacteria 1384
164 Ga0070672_100292625 3300005543 Bacteria 1379
165 Ga0070672_100366737 3300005543 Bacteria 1230
166 Ga0070672_100405511 3300005543 Bacteria 1169
167 Ga0070672_100551089 3300005543 Bacteria 1001
168 Ga0070672_100700395 3300005543 Bacteria 887
169 Ga0070686_100031644 3300005544 Bacteria 3236
170 Ga0070686_101055204 3300005544 Bacteria 669
171 Ga0070696_100045520 3300005546 Bacteria 3040
172 Ga0070696_100781174 3300005546 Bacteria 785
173 Ga0070693_100030036 3300005547 Bacteria 2968
174 Ga0070693_100221881 3300005547 Unclassified 1239
175 Ga0070665_100008410 3300005548 Bacteria 10439
176 Ga0070665_100015057 3300005548 Bacteria 7764
177 Ga0070665_100349236 3300005548 Bacteria 1484
178 Ga0070704_100444789 3300005549 Bacteria 1115
179 Ga0070704_100675885 3300005549 Bacteria 914
180 Ga0068855_100001017 3300005563 Bacteria 34928
181 Ga0068855_100108730 3300005563 Bacteria 3184
182 Ga0068855_100117025 3300005563 Bacteria 3054
183 Ga0068855_100479961 3300005563 Bacteria 1353
184 Ga0068855_100502251 3300005563 Bacteria 1318
185 Ga0068855_100939559 3300005563 Bacteria 911
186 Ga0068855_101741421 3300005563 Bacteria 634
187 Ga0070664_100000127 3300005564 Bacteria 51101
188 Ga0070664_100002770 3300005564 Bacteria 14146
189 Ga0070664_100004668 3300005564 Bacteria 10994
190 Ga0070664_100004816 3300005564 Bacteria 10814
191 Ga0070664_100027382 3300005564 Bacteria 4737
192 Ga0070664_100031175 3300005564 Bacteria 4451
193 Ga0070664_100073854 3300005564 Bacteria 2926
194 Ga0070664_100076872 3300005564 Bacteria 2869
195 Ga0070664_100092280 3300005564 Bacteria 2622
196 Ga0070664_100329055 3300005564 Bacteria 1386
197 Ga0070664_100344352 3300005564 Bacteria 1355
198 Ga0070664_101645672 3300005564 Bacteria 608
199 Ga0068857_100027556 3300005577 Bacteria 5012
200 Ga0068857_100071871 3300005577 Bacteria 3083
201 Ga0068857_100223256 3300005577 Bacteria 1721
202 Ga0068857_100246024 3300005577 Bacteria 1638
203 Ga0068857_100412188 3300005577 Bacteria 1258
204 Ga0068857_100425132 3300005577 Bacteria 1239
205 Ga0068857_100483479 3300005577 Bacteria 1160
206 Ga0068857_101096747 3300005577 Bacteria 768
207 Ga0068854_100002305 3300005578 Bacteria 11761
208 Ga0068854_100015753 3300005578 Bacteria 5020
209 Ga0068854_100163425 3300005578 Bacteria 1726
210 Ga0068854_100396844 3300005578 Bacteria 1140
211 Ga0068854_100495011 3300005578 Bacteria 1028
212 Ga0068854_100541996 3300005578 Bacteria 985
213 Ga0068854_100562665 3300005578 Bacteria 969
214 Ga0068854_101118026 3300005578 Bacteria 703
215 Ga0068856_100003514 3300005614 Bacteria 15808
216 Ga0068856_100060419 3300005614 Bacteria 3744
217 Ga0068856_100192761 3300005614 Bacteria 2052
218 Ga0068856_100596134 3300005614 Bacteria 1126
219 Ga0068856_100648542 3300005614 Bacteria 1076
220 Ga0068852_100000750 3300005616 Bacteria 21310
221 Ga0068852_100002818 3300005616 Bacteria 12046
222 Ga0068852_100030924 3300005616 Bacteria 4412
223 Ga0068852_100211633 3300005616 Bacteria 1839
224 Ga0068852_100248096 3300005616 Bacteria 1704
225 Ga0068852_100290649 3300005616 Bacteria 1579
226 Ga0068852_100638167 3300005616 Bacteria 1072
227 Ga0068859_100000221 3300005617 Bacteria 56589
228 Ga0068859_100018625 3300005617 Bacteria 6979
229 Ga0068859_100383215 3300005617 Bacteria 1501
230 Ga0068859_100942910 3300005617 Bacteria 947
231 Ga0068864_100006479 3300005618 Bacteria 9589
232 Ga0068864_100011714 3300005618 Bacteria 7242
233 Ga0068864_100042013 3300005618 Bacteria 3911
234 Ga0068864_100090392 3300005618 Bacteria 2699
235 Ga0068864_101311983 3300005618 Bacteria 724
236 Ga0068866_10060932 3300005718 Bacteria 1958
237 Ga0068866_10561675 3300005718 Bacteria 765
238 Ga0068861_100228148 3300005719 Bacteria 1578
239 Ga0068851_10018618 3300005834 Bacteria 3347
240 Ga0068851_10202366 3300005834 Bacteria 1109
241 Ga0068851_10208012 3300005834 Bacteria 1095
242 Ga0068851_10315734 3300005834 Bacteria 902
243 Ga0068870_10474498 3300005840 Bacteria 829
244 Ga0068863_100000988 3300005841 Bacteria 28552
245 Ga0068863_100024353 3300005841 Bacteria 5773
246 Ga0068863_100027316 3300005841 Bacteria 5443
247 Ga0068858_100005445 3300005842 Bacteria 12460
248 Ga0068858_100015368 3300005842 Bacteria 7199
249 Ga0068858_100028007 3300005842 Bacteria 5235
250 Ga0068858_100029697 3300005842 Bacteria 5078
251 Ga0068858_100131186 3300005842 Bacteria 2350
252 Ga0068858_100296215 3300005842 Bacteria 1543
253 Ga0068858_100911755 3300005842 Bacteria 859
254 Ga0068860_100019391 3300005843 Bacteria 6596
255 Ga0068860_100033750 3300005843 Bacteria 4910
256 Ga0068860_100214049 3300005843 Bacteria 1869
257 Ga0068860_100235796 3300005843 Bacteria 1779
258 Ga0068860_101103908 3300005843 Bacteria 813
259 Ga0068862_100194290 3300005844 Bacteria 1827
260 Ga0068862_100727311 3300005844 Bacteria 964
261 Ga0068862_100801226 3300005844 Bacteria 920
262 Ga0070717_10014328 3300006028 Bacteria 6099
263 Ga0070716_100080580 3300006173 Bacteria 1942
264 Ga0070716_100209476 3300006173 Bacteria 1301
265 Ga0070712_100318626 3300006175 Bacteria 1264
266 Ga0097621_100012288 3300006237 Bacteria 6337
267 Ga0097621_100105345 3300006237 Bacteria 2377
268 Ga0097621_100864531 3300006237 Bacteria 841
269 Ga0068871_100376609 3300006358 Bacteria 1260
270 Ga0068871_100560522 3300006358 Bacteria 1036
271 Ga0075433_10002017 3300006852 Bacteria 15313
272 Ga0075434_100345337 3300006871 Bacteria 1509
273 Ga0068865_100158159 3300006881 Bacteria 1726
274 Ga0068865_100336221 3300006881 Bacteria 1219
275 Ga0068865_101298762 3300006881 Bacteria 647
276 Ga0097620_100000221 3300006931 Bacteria 56589
277 Ga0097620_100018625 3300006931 Bacteria 6979
278 Ga0097620_100383208 3300006931 Bacteria 1501
279 Ga0097620_100432746 3300006931 Bacteria 1412
280 Ga0097620_100942804 3300006931 Bacteria 947
281 Ga0105250_10030290 3300009092 Bacteria 2176
282 Ga0105250_10130545 3300009092 Bacteria 1037
283 Ga0105240_10009986 3300009093 Bacteria 13378
284 Ga0105240_10098231 3300009093 Bacteria 3566
285 Ga0111539_10173676 3300009094 Bacteria 2517
286 Ga0105245_10057803 3300009098 Bacteria 3490
287 Ga0105245_11155624 3300009098 Bacteria 821
288 Ga0105243_10293317 3300009148 Bacteria 1470
289 Ga0105243_10933513 3300009148 Bacteria 865
290 Ga0105241_10055223 3300009174 Bacteria 3042
291 Ga0105241_10102979 3300009174 Bacteria 2273
292 Ga0105241_10285457 3300009174 Bacteria 1411
293 Ga0105241_10360464 3300009174 Bacteria 1265
294 Ga0105248_10001342 3300009177 Bacteria 27431
295 Ga0105248_10001601 3300009177 Bacteria 25161
296 Ga0105248_10002904 3300009177 Bacteria 19020
297 Ga0105248_10004674 3300009177 Bacteria 15154
298 Ga0105248_10016490 3300009177 Bacteria 8132
299 Ga0105248_10034219 3300009177 Bacteria 5680
300 Ga0105248_10057080 3300009177 Bacteria 4381
301 Ga0105248_10124724 3300009177 Bacteria 2905
302 Ga0105248_10195134 3300009177 Bacteria 2281
303 Ga0105237_10048731 3300009545 Bacteria 4258
304 Ga0105237_10226982 3300009545 Bacteria 1868
305 Ga0105238_10001767 3300009551 Bacteria 21679
306 Ga0105238_10044898 3300009551 Bacteria 4466
307 Ga0105238_10145334 3300009551 Bacteria 2348
308 Ga0105238_10146699 3300009551 Bacteria 2336
309 Ga0105238_12060018 3300009551 Bacteria 605
310 Ga0105238_12506503 3300009551 Bacteria 552
311 Ga0105249_10157091 3300009553 Bacteria 2194
312 Ga0105249_10218895 3300009553 Bacteria 1873
313 Ga0105249_10308374 3300009553 Bacteria 1590
314 Ga0105239_10299441 3300010375 Bacteria 1811
315 Ga0105239_10738753 3300010375 Bacteria 1126
316 Ga0105239_11940801 3300010375 Bacteria 683
317 Ga0105246_10418272 3300011119 Bacteria 1118
318 Ga0105246_11630123 3300011119 Bacteria 611
319 Ga0157373_10017826 3300013100 Bacteria 5170
320 Ga0157373_10017998 3300013100 Bacteria 5145
321 Ga0157373_10028947 3300013100 Bacteria 3994
322 Ga0157373_10059499 3300013100 Bacteria 2707
323 Ga0157373_10189018 3300013100 Bacteria 1451
324 Ga0157373_10209128 3300013100 Bacteria 1376
325 Ga0157373_10351661 3300013100 Bacteria 1051
326 Ga0157373_10363584 3300013100 Bacteria 1033
327 Ga0157373_10364202 3300013100 Bacteria 1032
328 Ga0157373_10370754 3300013100 Bacteria 1023
329 Ga0157371_10001766 3300013102 Bacteria 21916
330 Ga0157371_10026275 3300013102 Bacteria 4233
331 Ga0157371_10053953 3300013102 Bacteria 2855
332 Ga0157371_10110767 3300013102 Bacteria 1949
333 Ga0157371_10115426 3300013102 Bacteria 1907
334 Ga0157371_10131801 3300013102 Bacteria 1779
335 Ga0157371_10139109 3300013102 Bacteria 1729
336 Ga0157371_10164853 3300013102 Bacteria 1583
337 Ga0157371_10197128 3300013102 Bacteria 1443
338 Ga0157371_10511814 3300013102 Bacteria 887
339 Ga0157371_10872946 3300013102 Bacteria 681
340 Ga0157370_10108945 3300013104 Bacteria 2590
341 Ga0157370_10255707 3300013104 Bacteria 1619
342 Ga0157370_10421166 3300013104 Bacteria 1228
343 Ga0157370_11437406 3300013104 Bacteria 620
344 Ga0157369_10044628 3300013105 Bacteria 4823
345 Ga0157369_10424800 3300013105 Bacteria 1378
346 Ga0157369_10652540 3300013105 Bacteria 1085
347 Ga0157369_10669267 3300013105 Bacteria 1070
348 Ga0157369_10854567 3300013105 Bacteria 934
349 Ga0157369_10903953 3300013105 Bacteria 905
350 Ga0157369_10930228 3300013105 Bacteria 891
351 Ga0157369_11035501 3300013105 Bacteria 840
352 Ga0157374_10731650 3300013296 Bacteria 1003
353 Ga0157374_10806328 3300013296 Bacteria 955
354 Ga0157378_10159148 3300013297 Bacteria 2111
355 Ga0157378_10485678 3300013297 Bacteria 1231
356 Ga0157378_10575495 3300013297 Bacteria 1135
357 Ga0163162_10021542 3300013306 Bacteria 6349
358 Ga0163162_10173174 3300013306 Bacteria 2283
359 Ga0163162_10415945 3300013306 Bacteria 1477
360 Ga0163162_10541919 3300013306 Bacteria 1292
361 Ga0157372_10028312 3300013307 Bacteria 6115
362 Ga0157372_10060532 3300013307 Bacteria 4237
363 Ga0157372_10236595 3300013307 Bacteria 2118
364 Ga0157372_10641824 3300013307 Bacteria 1237
365 Ga0157372_10902038 3300013307 Bacteria 1025
366 Ga0157372_10974976 3300013307 Bacteria 982
367 Ga0157372_11144854 3300013307 Bacteria 900
368 Ga0157375_10421929 3300013308 Bacteria 1500
369 Ga0157375_10651831 3300013308 Bacteria 1209
370 Ga0157375_10686634 3300013308 Bacteria 1178
371 Ga0163163_10000489 3300014325 Bacteria 35830
372 Ga0163163_10000587 3300014325 Bacteria 32106
373 Ga0157380_10081129 3300014326 Bacteria 2652
374 Ga0182008_10451828 3300014497 Bacteria 699
375 Ga0157379_10004325 3300014968 Bacteria 12150
376 Ga0157379_10106898 3300014968 Bacteria 2512
377 Ga0157379_10281941 3300014968 Bacteria 1512
378 Ga0157379_10652005 3300014968 Bacteria 986
379 Ga0157379_10904439 3300014968 Bacteria 837
380 Ga0157379_11657999 3300014968 Bacteria 625
381 Ga0197907_10556919 3300020069 Bacteria 1255
382 Ga0206353_10077065 3300020082 Bacteria 2190
383 Ga0206353_11245173 3300020082 Bacteria 1399
384 Ga0213876_10005367 3300021384 Bacteria 7052
385 Ga0207697_10008108 3300025315 Bacteria 4628
386 Ga0207656_10199448 3300025321 Bacteria 966
387 Ga0207656_10322458 3300025321 Bacteria 767
388 Ga0207656_10387430 3300025321 Bacteria 701
389 Ga0207642_10080287 3300025899 Bacteria 1582
390 Ga0207688_10095362 3300025901 Bacteria 1712
391 Ga0207688_10266337 3300025901 Bacteria 1041
392 Ga0207680_10003681 3300025903 Bacteria 7203
393 Ga0207680_10055647 3300025903 Bacteria 2385
394 Ga0207680_10097874 3300025903 Bacteria 1879
395 Ga0207680_10107435 3300025903 Bacteria 1804
396 Ga0207680_10538097 3300025903 Bacteria 833
397 Ga0207680_10580675 3300025903 Bacteria 801
398 Ga0207647_10000365 3300025904 Bacteria 36940
399 Ga0207647_10004836 3300025904 Bacteria 9961
400 Ga0207647_10008492 3300025904 Bacteria 7361
401 Ga0207647_10065323 3300025904 Bacteria 2209
402 Ga0207647_10121174 3300025904 Bacteria 1542
403 Ga0207647_10147948 3300025904 Bacteria 1374
404 Ga0207645_10024323 3300025907 Bacteria 3929
405 Ga0207645_10190608 3300025907 Bacteria 1347
406 Ga0207645_10341226 3300025907 Bacteria 1001
407 Ga0207645_10499074 3300025907 Bacteria 824
408 Ga0207705_10000451 3300025909 Bacteria 35403
409 Ga0207705_10001025 3300025909 Bacteria 22684
410 Ga0207705_10011078 3300025909 Bacteria 6537
411 Ga0207705_10043343 3300025909 Bacteria 3232
412 Ga0207705_10056305 3300025909 Bacteria 2834
413 Ga0207705_10056580 3300025909 Bacteria 2828
414 Ga0207705_10108033 3300025909 Bacteria 2053
415 Ga0207705_10110224 3300025909 Bacteria 2033
416 Ga0207705_10156792 3300025909 Bacteria 1708
417 Ga0207705_10436770 3300025909 Bacteria 1014
418 Ga0207705_10491981 3300025909 Bacteria 952
419 Ga0207654_10047033 3300025911 Bacteria 2463
420 Ga0207707_10900689 3300025912 Bacteria 731
421 Ga0207695_10013411 3300025913 Bacteria 9775
422 Ga0207695_10495017 3300025913 Bacteria 1104
423 Ga0207671_10072591 3300025914 Bacteria 2569
424 Ga0207671_10237181 3300025914 Bacteria 1432
425 Ga0207693_10286571 3300025915 Bacteria 1290
426 Ga0207657_10000672 3300025919 Bacteria 36472
427 Ga0207657_10008633 3300025919 Bacteria 10315
428 Ga0207657_10009372 3300025919 Bacteria 9848
429 Ga0207657_10015267 3300025919 Bacteria 7448
430 Ga0207657_10031168 3300025919 Bacteria 4833
431 Ga0207657_10038400 3300025919 Bacteria 4262
432 Ga0207657_10056604 3300025919 Bacteria 3382
433 Ga0207657_10067989 3300025919 Bacteria 3028
434 Ga0207657_10134893 3300025919 Bacteria 2021
435 Ga0207657_10158211 3300025919 Bacteria 1841
436 Ga0207657_10216165 3300025919 Bacteria 1537
437 Ga0207657_10259909 3300025919 Bacteria 1382
438 Ga0207657_10261970 3300025919 Bacteria 1376
439 Ga0207657_10377441 3300025919 Bacteria 1117
440 Ga0207657_10803595 3300025919 Unclassified 727
441 Ga0207657_10862532 3300025919 Bacteria 698
442 Ga0207649_10000014 3300025920 Bacteria 255001
443 Ga0207649_10035632 3300025920 Bacteria 2991
444 Ga0207649_10055254 3300025920 Bacteria 2474
445 Ga0207649_10087392 3300025920 Bacteria 2034
446 Ga0207649_10168080 3300025920 Bacteria 1525
447 Ga0207649_10250987 3300025920 Bacteria 1274
448 Ga0207649_10474718 3300025920 Bacteria 948
449 Ga0207649_10489848 3300025920 Bacteria 933
450 Ga0207649_10519619 3300025920 Bacteria 907
451 Ga0207652_10100835 3300025921 Bacteria 2549
452 Ga0207652_10114477 3300025921 Bacteria 2395
453 Ga0207652_10223485 3300025921 Bacteria 1697
454 Ga0207652_10255150 3300025921 Bacteria 1582
455 Ga0207681_10036441 3300025923 Bacteria 3245
456 Ga0207681_10159585 3300025923 Bacteria 1698
457 Ga0207681_10384267 3300025923 Bacteria 1131
458 Ga0207681_10562624 3300025923 Bacteria 939
459 Ga0207681_10678971 3300025923 Bacteria 855
460 Ga0207694_10019658 3300025924 Bacteria 5109
461 Ga0207694_10037217 3300025924 Bacteria 3736
462 Ga0207694_10323098 3300025924 Bacteria 1274
463 Ga0207650_10011874 3300025925 Bacteria 6002
464 Ga0207650_10023437 3300025925 Bacteria 4377
465 Ga0207650_10078758 3300025925 Bacteria 2494
466 Ga0207650_10094059 3300025925 Bacteria 2295
467 Ga0207650_10156509 3300025925 Bacteria 1802
468 Ga0207650_10163014 3300025925 Bacteria 1767
469 Ga0207659_10499882 3300025926 Bacteria 1029
470 Ga0207687_10652932 3300025927 Bacteria 890
471 Ga0207700_10029352 3300025928 Bacteria 3879
472 Ga0207700_10089456 3300025928 Bacteria 2427
473 Ga0207664_10109791 3300025929 Bacteria 2292
474 Ga0207664_10179569 3300025929 Bacteria 1816
475 Ga0207664_10363828 3300025929 Bacteria 1282
476 Ga0207664_10551293 3300025929 Bacteria 1034
477 Ga0207664_10570062 3300025929 Bacteria 1016
478 Ga0207644_10001060 3300025931 Bacteria 17587
479 Ga0207644_10008199 3300025931 Bacteria 6844
480 Ga0207644_10015364 3300025931 Bacteria 5136
481 Ga0207644_10018829 3300025931 Bacteria 4677
482 Ga0207644_10060096 3300025931 Bacteria 2750
483 Ga0207644_10078892 3300025931 Bacteria 2428
484 Ga0207644_10108847 3300025931 Bacteria 2092
485 Ga0207644_10240883 3300025931 Bacteria 1440
486 Ga0207644_10364214 3300025931 Bacteria 1176
487 Ga0207644_10368557 3300025931 Bacteria 1170
488 Ga0207690_10109691 3300025932 Bacteria 1985
489 Ga0207690_10133158 3300025932 Bacteria 1822
490 Ga0207690_10413825 3300025932 Bacteria 1077
491 Ga0207690_10441820 3300025932 Bacteria 1044
492 Ga0207690_10573227 3300025932 Bacteria 919
493 Ga0207690_10953033 3300025932 Bacteria 713
494 Ga0207690_11073128 3300025932 Bacteria 671
495 Ga0207706_10000605 3300025933 Bacteria 38154
496 Ga0207706_10010881 3300025933 Bacteria 8300
497 Ga0207706_10026368 3300025933 Bacteria 5202
498 Ga0207706_10030522 3300025933 Bacteria 4808
499 Ga0207706_10041785 3300025933 Bacteria 4064
500 Ga0207706_10063879 3300025933 Bacteria 3241
501 Ga0207706_10081650 3300025933 Bacteria 2841
502 Ga0207706_10083594 3300025933 Bacteria 2806
503 Ga0207706_10559255 3300025933 Bacteria 984
504 Ga0207706_10672546 3300025933 Bacteria 886
505 Ga0207706_10716559 3300025933 Bacteria 854
506 Ga0207686_10252913 3300025934 Bacteria 1288
507 Ga0207670_10384579 3300025936 Bacteria 1118
508 Ga0207669_10098801 3300025937 Bacteria 1923
509 Ga0207669_10109334 3300025937 Bacteria 1848
510 Ga0207704_10245386 3300025938 Bacteria 1341
511 Ga0207704_11050812 3300025938 Bacteria 690
512 Ga0207665_10134681 3300025939 Bacteria 1757
513 Ga0207665_10219703 3300025939 Bacteria 1392
514 Ga0207691_10005352 3300025940 Bacteria 12386
515 Ga0207691_10010496 3300025940 Bacteria 8886
516 Ga0207691_10041300 3300025940 Bacteria 4259
517 Ga0207691_10088500 3300025940 Bacteria 2777
518 Ga0207691_10196168 3300025940 Bacteria 1759
519 Ga0207691_10925056 3300025940 Bacteria 729
520 Ga0207711_10000042 3300025941 Bacteria 158782
521 Ga0207711_10018340 3300025941 Bacteria 5815
522 Ga0207711_10022537 3300025941 Bacteria 5267
523 Ga0207711_10061906 3300025941 Bacteria 3227
524 Ga0207711_10073951 3300025941 Bacteria 2963
525 Ga0207711_10115540 3300025941 Bacteria 2391
526 Ga0207711_10132121 3300025941 Bacteria 2239
527 Ga0207689_10063147 3300025942 Bacteria 3047
528 Ga0207689_10619369 3300025942 Bacteria 911
529 Ga0207689_10636927 3300025942 Bacteria 898
530 Ga0207661_10002288 3300025944 Bacteria 13191
531 Ga0207661_10047966 3300025944 Bacteria 3392
532 Ga0207661_10272043 3300025944 Bacteria 1512
533 Ga0207679_10003009 3300025945 Bacteria 10454
534 Ga0207679_10011871 3300025945 Bacteria 5663
535 Ga0207679_10012049 3300025945 Bacteria 5623
536 Ga0207679_10018551 3300025945 Bacteria 4663
537 Ga0207679_10063484 3300025945 Bacteria 2757
538 Ga0207679_10128862 3300025945 Bacteria 2026
539 Ga0207679_10477603 3300025945 Bacteria 1109
540 Ga0207679_10861179 3300025945 Bacteria 828
541 Ga0207667_10001713 3300025949 Bacteria 27586
542 Ga0207667_10007199 3300025949 Bacteria 13419
543 Ga0207667_10056536 3300025949 Bacteria 4122
544 Ga0207667_10068302 3300025949 Bacteria 3701
545 Ga0207667_10123015 3300025949 Bacteria 2673
546 Ga0207667_10254533 3300025949 Bacteria 1796
547 Ga0207667_10604594 3300025949 Bacteria 1105
548 Ga0207667_10730523 3300025949 Bacteria 991
549 Ga0207651_10007763 3300025960 Bacteria 5735
550 Ga0207651_10079735 3300025960 Bacteria 2353
551 Ga0207651_10147122 3300025960 Bacteria 1829
552 Ga0207651_10865856 3300025960 Bacteria 803
553 Ga0207712_10000309 3300025961 Bacteria 44746
554 Ga0207712_10005231 3300025961 Bacteria 8206
555 Ga0207712_10671668 3300025961 Bacteria 902
556 Ga0207668_10019961 3300025972 Bacteria 4249
557 Ga0207668_10062889 3300025972 Bacteria 2616
558 Ga0207668_10069819 3300025972 Bacteria 2503
559 Ga0207668_10194447 3300025972 Bacteria 1610
560 Ga0207668_11514655 3300025972 Bacteria 605
561 Ga0207640_10004648 3300025981 Bacteria 7452
562 Ga0207640_10006378 3300025981 Bacteria 6471
563 Ga0207640_10021412 3300025981 Bacteria 3853
564 Ga0207640_10025307 3300025981 Bacteria 3591
565 Ga0207640_10030316 3300025981 Bacteria 3329
566 Ga0207640_10257812 3300025981 Bacteria 1357
567 Ga0207640_10509342 3300025981 Bacteria 1004
568 Ga0207640_10539286 3300025981 Bacteria 978
569 Ga0207640_11009626 3300025981 Bacteria 732
570 Ga0207640_11379792 3300025981 Bacteria 631
571 Ga0207658_10005192 3300025986 Bacteria 8966
572 Ga0207658_10016271 3300025986 Bacteria 5114
573 Ga0207658_10020004 3300025986 Bacteria 4633
574 Ga0207658_10074755 3300025986 Bacteria 2575
575 Ga0207658_10449946 3300025986 Bacteria 1140
576 Ga0207658_10648565 3300025986 Bacteria 951
577 Ga0207677_10005424 3300026023 Bacteria 6923
578 Ga0207677_10014949 3300026023 Bacteria 4549
579 Ga0207677_10631527 3300026023 Bacteria 943
580 Ga0207677_10808268 3300026023 Bacteria 840
581 Ga0207703_10001009 3300026035 Bacteria 27028
582 Ga0207703_10013296 3300026035 Bacteria 6412
583 Ga0207703_10126231 3300026035 Bacteria 2203
584 Ga0207703_10497397 3300026035 Bacteria 1144
585 Ga0207703_10643586 3300026035 Bacteria 1005
586 Ga0207703_10801994 3300026035 Bacteria 899
587 Ga0207639_10001048 3300026041 Bacteria 18783
588 Ga0207639_10177026 3300026041 Bacteria 1811
589 Ga0207639_10307965 3300026041 Bacteria 1402
590 Ga0207639_10317495 3300026041 Bacteria 1382
591 Ga0207678_10019347 3300026067 Bacteria 5981
592 Ga0207678_10031231 3300026067 Bacteria 4646
593 Ga0207678_10061966 3300026067 Bacteria 3217
594 Ga0207678_10073298 3300026067 Bacteria 2935
595 Ga0207678_10073424 3300026067 Bacteria 2931
596 Ga0207678_10095561 3300026067 Bacteria 2540
597 Ga0207678_10098585 3300026067 Bacteria 2497
598 Ga0207678_10406036 3300026067 Bacteria 1180
599 Ga0207678_10527005 3300026067 Bacteria 1031
600 Ga0207678_10685798 3300026067 Bacteria 901
601 Ga0207702_10002591 3300026078 Bacteria 16993
602 Ga0207702_10005972 3300026078 Bacteria 10572
603 Ga0207702_10161629 3300026078 Bacteria 2045
604 Ga0207702_10620713 3300026078 Bacteria 1062
605 Ga0207702_10849646 3300026078 Bacteria 903
606 Ga0207702_10997396 3300026078 Bacteria 831
607 Ga0207702_11243442 3300026078 Bacteria 739
608 Ga0207641_10000927 3300026088 Bacteria 30260
609 Ga0207641_10138949 3300026088 Bacteria 2189
610 Ga0207641_10577686 3300026088 Bacteria 1098
611 Ga0207648_10154758 3300026089 Bacteria 2023
612 Ga0207648_10276425 3300026089 Bacteria 1501
613 Ga0207648_10385437 3300026089 Bacteria 1268
614 Ga0207648_10458402 3300026089 Bacteria 1162
615 Ga0207676_10003991 3300026095 Bacteria 10416
616 Ga0207676_10022003 3300026095 Bacteria 4684
617 Ga0207676_10143025 3300026095 Bacteria 2050
618 Ga0207676_10595066 3300026095 Bacteria 1062
619 Ga0207674_10005701 3300026116 Bacteria 14768
620 Ga0207674_10017761 3300026116 Bacteria 7754
621 Ga0207674_10023462 3300026116 Bacteria 6608
622 Ga0207674_10076992 3300026116 Bacteria 3342
623 Ga0207674_10118199 3300026116 Bacteria 2621
624 Ga0207674_10331738 3300026116 Bacteria 1471
625 Ga0207674_10506530 3300026116 Bacteria 1166
626 Ga0207674_11102139 3300026116 Bacteria 763
627 Ga0207675_100197118 3300026118 Bacteria 1933
628 Ga0207683_10042400 3300026121 Bacteria 3975
629 Ga0207683_10158064 3300026121 Bacteria 2048
630 Ga0207683_10834627 3300026121 Bacteria 855
631 Ga0207698_10000327 3300026142 Bacteria 28178
632 Ga0207698_10004953 3300026142 Bacteria 8163
633 Ga0207698_10008957 3300026142 Bacteria 6350
634 Ga0207698_10037297 3300026142 Bacteria 3578
635 Ga0207698_10041285 3300026142 Bacteria 3436
636 Ga0207698_10090024 3300026142 Bacteria 2508
637 Ga0207698_11081542 3300026142 Bacteria 814
638 Ga0207698_11742571 3300026142 Bacteria 638
639 Ga0268266_10186783 3300028379 Bacteria 1890
640 Ga0268266_10606758 3300028379 Bacteria 1051
641 Ga0268266_10696039 3300028379 Bacteria 979
642 Ga0268266_10707432 3300028379 Bacteria 971
643 Ga0268266_10727335 3300028379 Bacteria 957
644 Ga0268266_10728048 3300028379 Bacteria 957
645 Ga0268265_10002919 3300028380 Bacteria 12534
646 Ga0268265_10401715 3300028380 Bacteria 1267
647 Ga0268265_10451040 3300028380 Bacteria 1201
648 Ga0268265_10492034 3300028380 Bacteria 1154
649 Ga0268265_10976176 3300028380 Bacteria 836
650 Ga0268264_10002540 3300028381 Bacteria 16031
651 Ga0268264_10025211 3300028381 Bacteria 4858
652 Ga0268264_10093565 3300028381 Bacteria 2597
653 Ga0268264_11702137 3300028381 Bacteria 641
654 Ga0307515_10419168 3300028794 Bacteria 960
655 Ga0307513_10329360 3300031456 Bacteria 1282
656 Ga0307408_100031690 3300031548 Bacteria 3682
657 Ga0307408_100176968 3300031548 Bacteria 1708
658 Ga0307405_10074430 3300031731 Bacteria 2196
659 Ga0307405_10119152 3300031731 Bacteria 1803
660 Ga0307405_10205104 3300031731 Bacteria 1435
661 Ga0307413_10017494 3300031824 Bacteria 3734
662 Ga0307413_10128329 3300031824 Bacteria 1731
663 Ga0307413_10302572 3300031824 Bacteria 1213
664 Ga0307410_10077035 3300031852 Bacteria 2329
665 Ga0307410_10436264 3300031852 Bacteria 1065
666 Ga0307406_10010861 3300031901 Bacteria 5149
667 Ga0307406_10036393 3300031901 Bacteria 3032
668 Ga0307407_10253188 3300031903 Bacteria 1207
669 Ga0307412_10185669 3300031911 Bacteria 1568
670 Ga0307412_10757183 3300031911 Bacteria 839
671 Ga0307409_100755634 3300031995 Bacteria 976
672 Ga0307416_100010832 3300032002 Bacteria 6044
673 Ga0307416_100118298 3300032002 Bacteria 2354
674 Ga0307416_101896430 3300032002 Bacteria 699
675 Ga0307414_10188118 3300032004 Bacteria 1668
676 Ga0307414_10206120 3300032004 Bacteria 1603
677 Ga0307414_10366962 3300032004 Bacteria 1241
678 Ga0307411_10013399 3300032005 Bacteria 4523
679 Ga0307411_10014949 3300032005 Bacteria 4339
680 Ga0307411_10024479 3300032005 Bacteria 3600
681 Ga0307415_100033379 3300032126 Bacteria 3341
682 Ga0307415_100113345 3300032126 Bacteria 2016
683 Ga0307415_100390622 3300032126 Bacteria 1185
684 Ga0373939_0282424 3300035114 Bacteria 656
685 Ga0373961_0027212 3300035241 Unclassified 1568
686 Ga0395899_0000416 3300037312 Bacteria 49361
687 Ga0395899_0010868 3300037312 Bacteria 6976
688 Ga0395899_0028444 3300037312 Bacteria 4209
689 Ga0395899_0047792 3300037312 Bacteria 3185
690 Ga0395899_0065834 3300037312 Bacteria 2662
691 Ga0395899_0106401 3300037312 Bacteria 2020
692 Ga0395899_0122791 3300037312 Bacteria 1859
693 Ga0395899_0141605 3300037312 Bacteria 1710
694 Ga0395899_0190898 3300037312 Bacteria 1433
695 Ga0395899_0244715 3300037312 Bacteria 1233
696 Ga0395899_0314890 3300037312 Bacteria 1055
697 Ga0395899_0551814 3300037312 Bacteria 740
698 Ga0395899_0599924 3300037312 Bacteria 701
699 Ga0395900_0004276 3300037418 Bacteria 15148
700 Ga0395900_0004911 3300037418 Bacteria 14076
701 Ga0395900_0006658 3300037418 Bacteria 12013
702 Ga0395900_0007667 3300037418 Bacteria 11134
703 Ga0395900_0025633 3300037418 Bacteria 6035
704 Ga0395900_0034537 3300037418 Bacteria 5208
705 Ga0395900_0044068 3300037418 Bacteria 4598
706 Ga0395900_0053749 3300037418 Bacteria 4145
707 Ga0395900_0089656 3300037418 Bacteria 3161
708 Ga0395900_0108526 3300037418 Bacteria 2851
709 Ga0395900_0192572 3300037418 Bacteria 2067
710 Ga0395900_0217890 3300037418 Bacteria 1925
711 Ga0395900_0226865 3300037418 Bacteria 1880
712 Ga0395900_0235690 3300037418 Bacteria 1838
713 Ga0395900_0344054 3300037418 Bacteria 1466
714 Ga0395900_0358806 3300037418 Bacteria 1429
715 Ga0395900_0480833 3300037418 Bacteria 1194
716 Ga0395900_0543307 3300037418 Bacteria 1107
717 Ga0395900_0555602 3300037418 Bacteria 1092
718 Ga0395900_0566226 3300037418 Bacteria 1079
719 Ga0395900_1182269 3300037418 Bacteria 680
720 Ga0395898_0000192 3300037466 Bacteria 156121
721 Ga0395898_0009505 3300037466 Bacteria 10208
722 Ga0395898_0058742 3300037466 Bacteria 3743
723 Ga0395898_0061136 3300037466 Bacteria 3659
724 Ga0395898_0204154 3300037466 Bacteria 1886
725 Ga0395898_0213970 3300037466 Bacteria 1838
726 Ga0395898_0393534 3300037466 Bacteria 1321
727 Ga0395898_0740475 3300037466 Bacteria 924
728 Ga0395898_0837354 3300037466 Bacteria 859
729 Ga0395898_0988666 3300037466 Bacteria 777
730 Ga0395898_1125195 3300037466 Bacteria 718
731 Ga0395905_0000066 3300037471 Bacteria 183121
732 Ga0395905_0000806 3300037471 Bacteria 41147
733 Ga0395905_0006019 3300037471 Bacteria 12280
734 Ga0395905_0008010 3300037471 Bacteria 10440
735 Ga0395905_0016863 3300037471 Bacteria 6940
736 Ga0395905_0026820 3300037471 Bacteria 5433
737 Ga0395905_0030609 3300037471 Bacteria 5070
738 Ga0395905_0037744 3300037471 Bacteria 4534
739 Ga0395905_0046654 3300037471 Bacteria 4063
740 Ga0395905_0048353 3300037471 Bacteria 3986
741 Ga0395905_0061147 3300037471 Bacteria 3523
742 Ga0395905_0105920 3300037471 Bacteria 2640
743 Ga0395905_0114366 3300037471 Bacteria 2535
744 Ga0395905_0116643 3300037471 Bacteria 2509
745 Ga0395905_0199335 3300037471 Bacteria 1877
746 Ga0395905_0202529 3300037471 Bacteria 1860
747 Ga0395905_0209503 3300037471 Bacteria 1826
748 Ga0395905_0302291 3300037471 Bacteria 1487
749 Ga0395905_0318587 3300037471 Bacteria 1444
750 Ga0395905_0333897 3300037471 Bacteria 1406
751 Ga0395905_0362094 3300037471 Bacteria 1343
752 Ga0395905_0472766 3300037471 Bacteria 1152
753 Ga0395905_0928015 3300037471 Bacteria 773
754 Ga0395905_1022881 3300037471 Bacteria 729
755 Ga0395905_1111632 3300037471 Bacteria 694
756 Ga0395905_1229978 3300037471 Bacteria 652
757 Ga0395901_0000471 3300038443 Bacteria 46714
758 Ga0395901_0003144 3300038443 Bacteria 16589
759 Ga0395901_0018067 3300038443 Bacteria 7198
760 Ga0395901_0023412 3300038443 Bacteria 6331
761 Ga0395901_0030313 3300038443 Bacteria 5572
762 Ga0395901_0062022 3300038443 Bacteria 3890
763 Ga0395901_0082276 3300038443 Bacteria 3363
764 Ga0395901_0102156 3300038443 Bacteria 3008
765 Ga0395901_0167862 3300038443 Bacteria 2303
766 Ga0395901_0232356 3300038443 Bacteria 1925
767 Ga0395901_0241447 3300038443 Bacteria 1884
768 Ga0395901_0362050 3300038443 Bacteria 1495
769 Ga0395901_0474049 3300038443 Bacteria 1277
770 Ga0395901_0481747 3300038443 Bacteria 1265
771 Ga0395901_0616415 3300038443 Bacteria 1092
772 Ga0395901_0727337 3300038443 Bacteria 987
773 Ga0395901_0895909 3300038443 Bacteria 869
774 Ga0395901_1162448 3300038443 Bacteria 739
775 Ga0395901_1230541 3300038443 Bacteria 713
776 Ga0395901_1589302 3300038443 Bacteria 607
777 Ga0436365_0481817 3300039437 Bacteria 15552
778 Ga0439436_0215652 3300041404 Bacteria 552
779 Ga0439455_0151952 3300042012 Bacteria 659
780 Ga0450914_000912 3300042118 Bacteria 1656
781 Ga0450890_012658 3300042127 Bacteria 1096
782 Ga0450889_000497 3300042144 Bacteria 4386
783 Ga0439446_0193498 3300042156 Bacteria 684
784 Ga0439446_0205431 3300042156 Bacteria 666
785 Ga0439458_0000047 3300042157 Bacteria 19970
786 Ga0439458_0001092 3300042157 Bacteria 6911
787 Ga0439458_0127895 3300042157 Unclassified 672
788 Ga0466969_0028685 3300044656 Bacteria 2844
789 Ga0466972_0050120 3300044658 Bacteria 2016
790 Ga0466972_0075482 3300044658 Bacteria 1607
791 Ga0466972_0256089 3300044658 Bacteria 818
792 Ga0466966_0027012 3300044684 Bacteria 3744
793 Ga0466966_0027046 3300044684 Bacteria 3741
794 Ga0466966_0289010 3300044684 Bacteria 985
795 Ga0466961_0021564 3300044693 Bacteria 4145
796 Ga0466961_0086922 3300044693 Bacteria 1976
797 Ga0466961_0090202 3300044693 Bacteria 1936
798 Ga0466961_0095514 3300044693 Bacteria 1874
799 Ga0466961_0101290 3300044693 Bacteria 1814
800 Ga0466961_0176708 3300044693 Bacteria 1326
801 Ga0466961_0301741 3300044693 Bacteria 978
802 Ga0466963_0034213 3300044694 Bacteria 3305
803 Ga0466963_0065940 3300044694 Bacteria 2428
804 Ga0466963_0098051 3300044694 Bacteria 2003
805 Ga0466963_0376263 3300044694 Bacteria 1001
806 Ga0466963_0751858 3300044694 Bacteria 688
807 Ga0466964_0017815 3300044706 Bacteria 2721
808 Ga0466964_0525166 3300044706 Bacteria 639
809 Ga0466971_0024039 3300044719 Bacteria 2717
810 Ga0466970_0037978 3300044765 Bacteria 2554
811 Ga0466970_0038999 3300044765 Bacteria 2521
812 Ga0466970_0132439 3300044765 Bacteria 1370
813 Ga0466970_0469191 3300044765 Bacteria 723
814 Ga0466957_0008210 3300044842 Bacteria 5929
815 Ga0466957_0008710 3300044842 Bacteria 5780
816 Ga0466957_0019593 3300044842 Bacteria 3980
817 Ga0466957_0044454 3300044842 Bacteria 2691
818 Ga0466957_0651858 3300044842 Bacteria 740
819 Ga0466959_0066921 3300045049 Bacteria 2605
820 Ga0466959_0076789 3300045049 Bacteria 2411
821 Ga0466959_0099426 3300045049 Bacteria 2083
822 Ga0466959_0309930 3300045049 Bacteria 1080
823 Ga0466959_0623252 3300045049 Bacteria 725
824 Ga0466959_0809365 3300045049 Bacteria 626
825 Ga0466959_0845717 3300045049 Bacteria 611
826 Ga0466958_0002512 3300045836 Bacteria 9244
827 Ga0466958_0002694 3300045836 Bacteria 9002
828 Ga0466958_0004748 3300045836 Bacteria 7226
829 Ga0466958_0046414 3300045836 Bacteria 2621
830 Ga0466958_0226215 3300045836 Bacteria 1194
831 Ga0466958_0253235 3300045836 Bacteria 1126
832 Ga0466967_0037493 3300045976 Bacteria 4149
833 Ga0466967_0041990 3300045976 Bacteria 3948
834 Ga0466967_0101068 3300045976 Bacteria 2635
835 Ga0466967_0105580 3300045976 Bacteria 2580
836 Ga0466967_0129011 3300045976 Bacteria 2345
837 Ga0466967_0141988 3300045976 Bacteria 2237
838 Ga0466967_0219964 3300045976 Bacteria 1804
839 Ga0466967_0450649 3300045976 Bacteria 1257
840 Ga0466967_1366587 3300045976 Bacteria 705
841 Ga0466967_1668926 3300045976 Unclassified 635
842 Ga0495585_0103255 3300046492 Bacteria 1523
843 Ga0495663_0069483 3300046525 Bacteria 1119
844 Ga0495642_0337270 3300046528 Bacteria 662
845 Ga0495621_0000038 3300046539 Bacteria 25465
846 Ga0495668_0036770 3300046616 Bacteria 2742
847 Ga0495668_0042159 3300046616 Bacteria 2541
848 Ga0495668_0096040 3300046616 Bacteria 1622
849 Ga0495669_0001366 3300046684 Bacteria 10066
850 Ga0495669_0009382 3300046684 Bacteria 4123
851 Ga0495669_0017970 3300046684 Bacteria 3036
852 Ga0495669_0021583 3300046684 Bacteria 2795
853 Ga0495669_0048769 3300046684 Bacteria 1895
854 Ga0495669_0367202 3300046684 Bacteria 696
855 Ga0495669_0421819 3300046684 Bacteria 647
856 Ga0495677_0002288 3300047445 Bacteria 7544
857 Ga0495677_0044700 3300047445 Bacteria 1624
858 Ga0495677_0150424 3300047445 Bacteria 896
859 Ga0495685_196566 3300047447 Bacteria 647
860 Ga0496101_0008572 3300048904 Bacteria 6685
861 Ga0496101_0034476 3300048904 Bacteria 3575
862 Ga0496101_0292919 3300048904 Bacteria 1274
863 Ga0496101_0559267 3300048904 Bacteria 904
864 Ga0496101_0755438 3300048904 Bacteria 767
865 Ga0496102_1059528 3300048905 Bacteria 731
866 Ga0496103_0445583 3300048906 Bacteria 831
867 Ga0496104_0500569 3300048907 Bacteria 1126
868 Ga0496106_0001971 3300048909 Bacteria 15437
869 Ga0496107_0009509 3300048910 Bacteria 6744
870 Ga0496107_0061250 3300048910 Bacteria 2724
871 Ga0496107_0434696 3300048910 Bacteria 976
872 Ga0496108_0007068 3300048911 Bacteria 9090
873 Ga0496109_0099548 3300048912 Bacteria 2696
874 Ga0496109_0148467 3300048912 Bacteria 2194
875 Ga0496110_0004607 3300048913 Bacteria 10712
876 Ga0496110_0027955 3300048913 Bacteria 4839
877 Ga0496110_0088395 3300048913 Bacteria 2767
878 Ga0496110_0761201 3300048913 Bacteria 872
879 Ga0496111_0005351 3300048914 Bacteria 8206
880 Ga0496111_0010295 3300048914 Bacteria 6267
881 Ga0496111_0019592 3300048914 Bacteria 4704
882 Ga0496112_0000738 3300048915 Bacteria 22790
883 Ga0496112_0008461 3300048915 Bacteria 9219
884 Ga0496112_0122609 3300048915 Bacteria 2569
885 Ga0496112_0360593 3300048915 Bacteria 1395
886 Ga0496112_0370325 3300048915 Bacteria 1374
887 Ga0496113_0117886 3300048916 Bacteria 2073
888 Ga0496114_0000006 3300048917 Bacteria 472921
889 Ga0496114_0105143 3300048917 Bacteria 2414
890 Ga0496115_0253804 3300048918 Bacteria 1447
891 Ga0501067_0161467 3300049583 Bacteria 1248
892 Ga0501067_0539550 3300049583 Bacteria 653
893 Ga0501074_0023958 3300049590 Bacteria 4436
894 Ga0501202_062062 3300049652 Bacteria 847
895 Ga0501216_044664 3300049660 Bacteria 857
896 Ga0501227_021375 3300049665 Bacteria 1492
897 Ga0501243_016753 3300049675 Bacteria 1185
898 Ga0501249_018039 3300049679 Bacteria 1524
899 Ga0501080_0299697 3300049742 Bacteria 1458
900 Ga0501283_003637 3300049779 Bacteria 2049
901 Ga0501204_008866 3300049850 Bacteria 1155
902 nmdc:mga0n895_839425_c1 3300050512 Bacteria 907
903 nmdc:mga0rr50_117803_c1 3300050513 Bacteria 2109
904 nmdc:mga0a205_48399_c1 3300050515 Bacteria 4103
905 Ga0495655_0005572 3300053083 Bacteria 2234
906 Ga0495655_0009263 3300053083 Bacteria 1903
907 Ga0466962_0006731 3300061719 Bacteria 5509
908 Ga0466962_0011656 3300061719 Bacteria 4233
909 Ga0466962_0190677 3300061719 Bacteria 1000
910 Ga0068859_100432730
911 JGI24740J21852_10038646
912 JGI24740J21852_10056410
913 JGI24740J21852_10081855
914 JGI24739J22299_10010442
915 JGI24737J22298_10003860
916 JGI24737J22298_10058430
917 JGI24737J22298_10090805
918 JGI24735J21928_10001014
919 JGI24735J21928_10054465
920 JGI24735J21928_10100893
921 JGI24738J21930_10014613
922 Ga0070658_10029136
923 Ga0070658_10069196
924 Ga0070658_10240433
925 Ga0070658_10281183
926 Ga0070658_10436384
927 Ga0070658_10499531
928 Ga0070658_10592457
929 Ga0070658_10921578
930 Ga0070676_10087017
931 Ga0070676_10366781
932 Ga0070676_10409959
933 Ga0070676_10533461
934 Ga0070683_100007532
935 Ga0070683_100035875
936 Ga0070683_100120388
937 Ga0070683_100421431
938 Ga0070690_100045263
939 Ga0070670_100006006
940 Ga0070670_100055894
941 Ga0070670_100056397
942 Ga0070670_100116985
943 Ga0070670_100121508
944 Ga0070670_100148532
945 Ga0070670_100160606
946 Ga0070670_100294485
947 Ga0070670_101205427
948 Ga0070666_10001159
949 Ga0070666_10001949
950 Ga0070666_10022468
951 Ga0070666_10050034
952 Ga0070666_10110224
953 Ga0070666_10115294
954 Ga0070666_10179672
955 Ga0070680_100001518
956 Ga0070680_100096668
957 Ga0070680_100578310
958 Ga0070682_100004857
959 Ga0070682_100032352
960 Ga0068868_100003467
961 Ga0068868_100011836
962 Ga0068868_100042258
963 Ga0068868_100363885
964 Ga0068868_100444403
965 Ga0068868_100741525
966 Ga0070660_100041842
967 Ga0070660_100049059
968 Ga0070660_100099176
969 Ga0070660_100132797
970 Ga0070660_100133650
971 Ga0070660_100219935
972 Ga0070660_100316352
973 Ga0070660_100323366
974 Ga0070660_100417694
975 Ga0070660_100505621
976 Ga0070660_100841409
977 Ga0070689_100502401
978 Ga0070661_100000033
979 Ga0070661_100022892
980 Ga0070661_100050954
981 Ga0070661_100145569
982 Ga0070661_100147780
983 Ga0070661_100406123
984 Ga0070661_100431605
985 Ga0070692_10364601
986 Ga0070668_100028452
987 Ga0070668_101250358
988 Ga0070669_100011249
989 Ga0070669_100203568
990 Ga0070675_100044299
991 Ga0070675_100705937
992 Ga0070671_100002556
993 Ga0070671_100004963
994 Ga0070671_100040753
995 Ga0070671_100094374
996 Ga0070671_100103974
997 Ga0070671_100149555
998 Ga0070671_100192965
999 Ga0070671_100243948
1000 Ga0070671_100673373
1001 Ga0070674_100049966
1002 Ga0070673_100005316
1003 Ga0070673_100010903
1004 Ga0070673_100022686
1005 Ga0070673_100070233
1006 Ga0070673_100315503
1007 Ga0070673_100584947
1008 Ga0070659_100021982
1009 Ga0070659_100037215
1010 Ga0070659_100109898
1011 Ga0070659_100169594
1012 Ga0070659_100265609
1013 Ga0070659_100292841
1014 Ga0070659_100577276
1015 Ga0070659_100945442
1016 Ga0070659_101205070
1017 Ga0070667_100003564
1018 Ga0070667_100015899
1019 Ga0070667_100027823
1020 Ga0070667_100030273
1021 Ga0070667_100043724
1022 Ga0070667_100062169
1023 Ga0070667_100103492
1024 Ga0070667_100105763
1025 Ga0070709_10087559
1026 Ga0070714_100063688
1027 Ga0070714_100068197
1028 Ga0070714_100114904
1029 Ga0070713_100020943
1030 Ga0070713_100319535
1031 Ga0070701_10318866
1032 Ga0070701_10487802
1033 Ga0070694_100024638
1034 Ga0070663_100001259
1035 Ga0070663_100065570
1036 Ga0070663_100300981
1037 Ga0070663_101181014
1038 Ga0070678_100020199
1039 Ga0070678_100542556
1040 Ga0070662_100015634
1041 Ga0070662_100024097
1042 Ga0070662_100024392
1043 Ga0070662_100153068
1044 Ga0070662_100351643
1045 Ga0070662_100447279
1046 Ga0070662_101123146
1047 Ga0070662_101329969
1048 Ga0070681_10104704
1049 Ga0068867_100226140
1050 Ga0068867_100274177
1051 Ga0068867_100514945
1052 Ga0070679_100163666
1053 Ga0070679_100169604
1054 Ga0070679_100233983
1055 Ga0070679_100347397
1056 Ga0070679_100363424
1057 Ga0070679_100441738
1058 Ga0070684_100008813
1059 Ga0070684_100012386
1060 Ga0070684_100150045
1061 Ga0068853_100011243
1062 Ga0068853_100035909
1063 Ga0068853_100135095
1064 Ga0068853_100219884
1065 Ga0068853_100238907
1066 Ga0068853_100624324
1067 Ga0068853_100811051
1068 Ga0068853_101000207
1069 Ga0070672_100010316
1070 Ga0070672_100090268
1071 Ga0070672_100269343
1072 Ga0070672_100290392
1073 Ga0070672_100292625
1074 Ga0070672_100366737
1075 Ga0070672_100405511
1076 Ga0070672_100551089
1077 Ga0070672_100700395
1078 Ga0070686_100031644
1079 Ga0070686_101055204
1080 Ga0070696_100045520
1081 Ga0070696_100781174
1082 Ga0070693_100030036
1083 Ga0070693_100221881
1084 Ga0070665_100008410
1085 Ga0070665_100015057
1086 Ga0070665_100349236
1087 Ga0070704_100444789
1088 Ga0070704_100675885
1089 Ga0068855_100001017
1090 Ga0068855_100108730
1091 Ga0068855_100117025
1092 Ga0068855_100479961
1093 Ga0068855_100502251
1094 Ga0068855_100939559
1095 Ga0068855_101741421
1096 Ga0070664_100000127
1097 Ga0070664_100002770
1098 Ga0070664_100004668
1099 Ga0070664_100004816
1100 Ga0070664_100027382
1101 Ga0070664_100031175
1102 Ga0070664_100073854
1103 Ga0070664_100076872
1104 Ga0070664_100092280
1105 Ga0070664_100329055
1106 Ga0070664_100344352
1107 Ga0070664_101645672
1108 Ga0068857_100027556
1109 Ga0068857_100071871
1110 Ga0068857_100223256
1111 Ga0068857_100246024
1112 Ga0068857_100412188
1113 Ga0068857_100425132
1114 Ga0068857_100483479
1115 Ga0068857_101096747
1116 Ga0068854_100002305
1117 Ga0068854_100015753
1118 Ga0068854_100163425
1119 Ga0068854_100396844
1120 Ga0068854_100495011
1121 Ga0068854_100541996
1122 Ga0068854_100562665
1123 Ga0068854_101118026
1124 Ga0068856_100003514
1125 Ga0068856_100060419
1126 Ga0068856_100192761
1127 Ga0068856_100596134
1128 Ga0068856_100648542
1129 Ga0068852_100000750
1130 Ga0068852_100002818
1131 Ga0068852_100030924
1132 Ga0068852_100211633
1133 Ga0068852_100248096
1134 Ga0068852_100290649
1135 Ga0068852_100638167
1136 Ga0068859_100000221
1137 Ga0068859_100018625
1138 Ga0068859_100383215
1139 Ga0068859_100942910
1140 Ga0068864_100006479
1141 Ga0068864_100011714
1142 Ga0068864_100042013
1143 Ga0068864_100090392
1144 Ga0068864_101311983
1145 Ga0068866_10060932
1146 Ga0068866_10561675
1147 Ga0068861_100228148
1148 Ga0068851_10018618
1149 Ga0068851_10202366
1150 Ga0068851_10208012
1151 Ga0068851_10315734
1152 Ga0068870_10474498
1153 Ga0068863_100000988
1154 Ga0068863_100024353
1155 Ga0068863_100027316
1156 Ga0068858_100005445
1157 Ga0068858_100015368
1158 Ga0068858_100028007
1159 Ga0068858_100029697
1160 Ga0068858_100131186
1161 Ga0068858_100296215
1162 Ga0068858_100911755
1163 Ga0068860_100019391
1164 Ga0068860_100033750
1165 Ga0068860_100214049
1166 Ga0068860_100235796
1167 Ga0068860_101103908
1168 Ga0068862_100194290
1169 Ga0068862_100727311
1170 Ga0068862_100801226
1171 Ga0070717_10014328
1172 Ga0070716_100080580
1173 Ga0070716_100209476
1174 Ga0070712_100318626
1175 Ga0097621_100012288
1176 Ga0097621_100105345
1177 Ga0097621_100864531
1178 Ga0068871_100376609
1179 Ga0068871_100560522
1180 Ga0075433_10002017
1181 Ga0075434_100345337
1182 Ga0068865_100158159
1183 Ga0068865_100336221
1184 Ga0068865_101298762
1185 Ga0097620_100000221
1186 Ga0097620_100018625
1187 Ga0097620_100383208
1188 Ga0097620_100432746
1189 Ga0097620_100942804
1190 Ga0105250_10030290
1191 Ga0105250_10130545
1192 Ga0105240_10009986
1193 Ga0105240_10098231
1194 Ga0111539_10173676
1195 Ga0105245_10057803
1196 Ga0105245_11155624
1197 Ga0105243_10293317
1198 Ga0105243_10933513
1199 Ga0105241_10055223
1200 Ga0105241_10102979
1201 Ga0105241_10285457
1202 Ga0105241_10360464
1203 Ga0105248_10001342
1204 Ga0105248_10001601
1205 Ga0105248_10002904
1206 Ga0105248_10004674
1207 Ga0105248_10016490
1208 Ga0105248_10034219
1209 Ga0105248_10057080
1210 Ga0105248_10124724
1211 Ga0105248_10195134
1212 Ga0105237_10048731
1213 Ga0105237_10226982
1214 Ga0105238_10001767
1215 Ga0105238_10044898
1216 Ga0105238_10145334
1217 Ga0105238_10146699
1218 Ga0105238_12060018
1219 Ga0105238_12506503
1220 Ga0105249_10157091
1221 Ga0105249_10218895
1222 Ga0105249_10308374
1223 Ga0105239_10299441
1224 Ga0105239_10738753
1225 Ga0105239_11940801
1226 Ga0105246_10418272
1227 Ga0105246_11630123
1228 Ga0157373_10017826
1229 Ga0157373_10017998
1230 Ga0157373_10028947
1231 Ga0157373_10059499
1232 Ga0157373_10189018
1233 Ga0157373_10209128
1234 Ga0157373_10351661
1235 Ga0157373_10363584
1236 Ga0157373_10364202
1237 Ga0157373_10370754
1238 Ga0157371_10001766
1239 Ga0157371_10026275
1240 Ga0157371_10053953
1241 Ga0157371_10110767
1242 Ga0157371_10115426
1243 Ga0157371_10131801
1244 Ga0157371_10139109
1245 Ga0157371_10164853
1246 Ga0157371_10197128
1247 Ga0157371_10511814
1248 Ga0157371_10872946
1249 Ga0157370_10108945
1250 Ga0157370_10255707
1251 Ga0157370_10421166
1252 Ga0157370_11437406
1253 Ga0157369_10044628
1254 Ga0157369_10424800
1255 Ga0157369_10652540
1256 Ga0157369_10669267
1257 Ga0157369_10854567
1258 Ga0157369_10903953
1259 Ga0157369_10930228
1260 Ga0157369_11035501
1261 Ga0157374_10731650
1262 Ga0157374_10806328
1263 Ga0157378_10159148
1264 Ga0157378_10485678
1265 Ga0157378_10575495
1266 Ga0163162_10021542
1267 Ga0163162_10173174
1268 Ga0163162_10415945
1269 Ga0163162_10541919
1270 Ga0157372_10028312
1271 Ga0157372_10060532
1272 Ga0157372_10236595
1273 Ga0157372_10641824
1274 Ga0157372_10902038
1275 Ga0157372_10974976
1276 Ga0157372_11144854
1277 Ga0157375_10421929
1278 Ga0157375_10651831
1279 Ga0157375_10686634
1280 Ga0163163_10000489
1281 Ga0163163_10000587
1282 Ga0157380_10081129
1283 Ga0182008_10451828
1284 Ga0157379_10004325
1285 Ga0157379_10106898
1286 Ga0157379_10281941
1287 Ga0157379_10652005
1288 Ga0157379_10904439
1289 Ga0157379_11657999
1290 Ga0197907_10556919
1291 Ga0206353_10077065
1292 Ga0206353_11245173
1293 Ga0213876_10005367
1294 Ga0207697_10008108
1295 Ga0207656_10199448
1296 Ga0207656_10322458
1297 Ga0207656_10387430
1298 Ga0207642_10080287
1299 Ga0207688_10095362
1300 Ga0207688_10266337
1301 Ga0207680_10003681
1302 Ga0207680_10055647
1303 Ga0207680_10097874
1304 Ga0207680_10107435
1305 Ga0207680_10538097
1306 Ga0207680_10580675
1307 Ga0207647_10000365
1308 Ga0207647_10004836
1309 Ga0207647_10008492
1310 Ga0207647_10065323
1311 Ga0207647_10121174
1312 Ga0207647_10147948
1313 Ga0207645_10024323
1314 Ga0207645_10190608
1315 Ga0207645_10341226
1316 Ga0207645_10499074
1317 Ga0207705_10000451
1318 Ga0207705_10001025
1319 Ga0207705_10011078
1320 Ga0207705_10043343
1321 Ga0207705_10056305
1322 Ga0207705_10056580
1323 Ga0207705_10108033
1324 Ga0207705_10110224
1325 Ga0207705_10156792
1326 Ga0207705_10436770
1327 Ga0207705_10491981
1328 Ga0207654_10047033
1329 Ga0207707_10900689
1330 Ga0207695_10013411
1331 Ga0207695_10495017
1332 Ga0207671_10072591
1333 Ga0207671_10237181
1334 Ga0207693_10286571
1335 Ga0207657_10000672
1336 Ga0207657_10008633
1337 Ga0207657_10009372
1338 Ga0207657_10015267
1339 Ga0207657_10031168
1340 Ga0207657_10038400
1341 Ga0207657_10056604
1342 Ga0207657_10067989
1343 Ga0207657_10134893
1344 Ga0207657_10158211
1345 Ga0207657_10216165
1346 Ga0207657_10259909
1347 Ga0207657_10261970
1348 Ga0207657_10377441
1349 Ga0207657_10803595
1350 Ga0207657_10862532
1351 Ga0207649_10000014
1352 Ga0207649_10035632
1353 Ga0207649_10055254
1354 Ga0207649_10087392
1355 Ga0207649_10168080
1356 Ga0207649_10250987
1357 Ga0207649_10474718
1358 Ga0207649_10489848
1359 Ga0207649_10519619
1360 Ga0207652_10100835
1361 Ga0207652_10114477
1362 Ga0207652_10223485
1363 Ga0207652_10255150
1364 Ga0207681_10036441
1365 Ga0207681_10159585
1366 Ga0207681_10384267
1367 Ga0207681_10562624
1368 Ga0207681_10678971
1369 Ga0207694_10019658
1370 Ga0207694_10037217
1371 Ga0207694_10323098
1372 Ga0207650_10011874
1373 Ga0207650_10023437
1374 Ga0207650_10078758
1375 Ga0207650_10094059
1376 Ga0207650_10156509
1377 Ga0207650_10163014
1378 Ga0207659_10499882
1379 Ga0207687_10652932
1380 Ga0207700_10029352
1381 Ga0207700_10089456
1382 Ga0207664_10109791
1383 Ga0207664_10179569
1384 Ga0207664_10363828
1385 Ga0207664_10551293
1386 Ga0207664_10570062
1387 Ga0207644_10001060
1388 Ga0207644_10008199
1389 Ga0207644_10015364
1390 Ga0207644_10018829
1391 Ga0207644_10060096
1392 Ga0207644_10078892
1393 Ga0207644_10108847
1394 Ga0207644_10240883
1395 Ga0207644_10364214
1396 Ga0207644_10368557
1397 Ga0207690_10109691
1398 Ga0207690_10133158
1399 Ga0207690_10413825
1400 Ga0207690_10441820
1401 Ga0207690_10573227
1402 Ga0207690_10953033
1403 Ga0207690_11073128
1404 Ga0207706_10000605
1405 Ga0207706_10010881
1406 Ga0207706_10026368
1407 Ga0207706_10030522
1408 Ga0207706_10041785
1409 Ga0207706_10063879
1410 Ga0207706_10081650
1411 Ga0207706_10083594
1412 Ga0207706_10559255
1413 Ga0207706_10672546
1414 Ga0207706_10716559
1415 Ga0207686_10252913
1416 Ga0207670_10384579
1417 Ga0207669_10098801
1418 Ga0207669_10109334
1419 Ga0207704_10245386
1420 Ga0207704_11050812
1421 Ga0207665_10134681
1422 Ga0207665_10219703
1423 Ga0207691_10005352
1424 Ga0207691_10010496
1425 Ga0207691_10041300
1426 Ga0207691_10088500
1427 Ga0207691_10196168
1428 Ga0207691_10925056
1429 Ga0207711_10000042
1430 Ga0207711_10018340
1431 Ga0207711_10022537
1432 Ga0207711_10061906
1433 Ga0207711_10073951
1434 Ga0207711_10115540
1435 Ga0207711_10132121
1436 Ga0207689_10063147
1437 Ga0207689_10619369
1438 Ga0207689_10636927
1439 Ga0207661_10002288
1440 Ga0207661_10047966
1441 Ga0207661_10272043
1442 Ga0207679_10003009
1443 Ga0207679_10011871
1444 Ga0207679_10012049
1445 Ga0207679_10018551
1446 Ga0207679_10063484
1447 Ga0207679_10128862
1448 Ga0207679_10477603
1449 Ga0207679_10861179
1450 Ga0207667_10001713
1451 Ga0207667_10007199
1452 Ga0207667_10056536
1453 Ga0207667_10068302
1454 Ga0207667_10123015
1455 Ga0207667_10254533
1456 Ga0207667_10604594
1457 Ga0207667_10730523
1458 Ga0207651_10007763
1459 Ga0207651_10079735
1460 Ga0207651_10147122
1461 Ga0207651_10865856
1462 Ga0207712_10000309
1463 Ga0207712_10005231
1464 Ga0207712_10671668
1465 Ga0207668_10019961
1466 Ga0207668_10062889
1467 Ga0207668_10069819
1468 Ga0207668_10194447
1469 Ga0207668_11514655
1470 Ga0207640_10004648
1471 Ga0207640_10006378
1472 Ga0207640_10021412
1473 Ga0207640_10025307
1474 Ga0207640_10030316
1475 Ga0207640_10257812
1476 Ga0207640_10509342
1477 Ga0207640_10539286
1478 Ga0207640_11009626
1479 Ga0207640_11379792
1480 Ga0207658_10005192
1481 Ga0207658_10016271
1482 Ga0207658_10020004
1483 Ga0207658_10074755
1484 Ga0207658_10449946
1485 Ga0207658_10648565
1486 Ga0207677_10005424
1487 Ga0207677_10014949
1488 Ga0207677_10631527
1489 Ga0207677_10808268
1490 Ga0207703_10001009
1491 Ga0207703_10013296
1492 Ga0207703_10126231
1493 Ga0207703_10497397
1494 Ga0207703_10643586
1495 Ga0207703_10801994
1496 Ga0207639_10001048
1497 Ga0207639_10177026
1498 Ga0207639_10307965
1499 Ga0207639_10317495
1500 Ga0207678_10019347
1501 Ga0207678_10031231
1502 Ga0207678_10061966
1503 Ga0207678_10073298
1504 Ga0207678_10073424
1505 Ga0207678_10095561
1506 Ga0207678_10098585
1507 Ga0207678_10406036
1508 Ga0207678_10527005
1509 Ga0207678_10685798
1510 Ga0207702_10002591
1511 Ga0207702_10005972
1512 Ga0207702_10161629
1513 Ga0207702_10620713
1514 Ga0207702_10849646
1515 Ga0207702_10997396
1516 Ga0207702_11243442
1517 Ga0207641_10000927
1518 Ga0207641_10138949
1519 Ga0207641_10577686
1520 Ga0207648_10154758
1521 Ga0207648_10276425
1522 Ga0207648_10385437
1523 Ga0207648_10458402
1524 Ga0207676_10003991
1525 Ga0207676_10022003
1526 Ga0207676_10143025
1527 Ga0207676_10595066
1528 Ga0207674_10005701
1529 Ga0207674_10017761
1530 Ga0207674_10023462
1531 Ga0207674_10076992
1532 Ga0207674_10118199
1533 Ga0207674_10331738
1534 Ga0207674_10506530
1535 Ga0207674_11102139
1536 Ga0207675_100197118
1537 Ga0207683_10042400
1538 Ga0207683_10158064
1539 Ga0207683_10834627
1540 Ga0207698_10000327
1541 Ga0207698_10004953
1542 Ga0207698_10008957
1543 Ga0207698_10037297
1544 Ga0207698_10041285
1545 Ga0207698_10090024
1546 Ga0207698_11081542
1547 Ga0207698_11742571
1548 Ga0268266_10186783
1549 Ga0268266_10606758
1550 Ga0268266_10696039
1551 Ga0268266_10707432
1552 Ga0268266_10727335
1553 Ga0268266_10728048
1554 Ga0268265_10002919
1555 Ga0268265_10401715
1556 Ga0268265_10451040
1557 Ga0268265_10492034
1558 Ga0268265_10976176
1559 Ga0268264_10002540
1560 Ga0268264_10025211
1561 Ga0268264_10093565
1562 Ga0268264_11702137
1563 Ga0307515_10419168
1564 Ga0307513_10329360
1565 Ga0307408_100031690
1566 Ga0307408_100176968
1567 Ga0307405_10074430
1568 Ga0307405_10119152
1569 Ga0307405_10205104
1570 Ga0307413_10017494
1571 Ga0307413_10128329
1572 Ga0307413_10302572
1573 Ga0307410_10077035
1574 Ga0307410_10436264
1575 Ga0307406_10010861
1576 Ga0307406_10036393
1577 Ga0307407_10253188
1578 Ga0307412_10185669
1579 Ga0307412_10757183
1580 Ga0307409_100755634
1581 Ga0307416_100010832
1582 Ga0307416_100118298
1583 Ga0307416_101896430
1584 Ga0307414_10188118
1585 Ga0307414_10206120
1586 Ga0307414_10366962
1587 Ga0307411_10013399
1588 Ga0307411_10014949
1589 Ga0307411_10024479
1590 Ga0307415_100033379
1591 Ga0307415_100113345
1592 Ga0307415_100390622
1593 Ga0373939_0282424
1594 Ga0373961_0027212
1595 Ga0395899_0000416
1596 Ga0395899_0010868
1597 Ga0395899_0028444
1598 Ga0395899_0047792
1599 Ga0395899_0065834
1600 Ga0395899_0106401
1601 Ga0395899_0122791
1602 Ga0395899_0141605
1603 Ga0395899_0190898
1604 Ga0395899_0244715
1605 Ga0395899_0314890
1606 Ga0395899_0551814
1607 Ga0395899_0599924
1608 Ga0395900_0004276
1609 Ga0395900_0004911
1610 Ga0395900_0006658
1611 Ga0395900_0007667
1612 Ga0395900_0025633
1613 Ga0395900_0034537
1614 Ga0395900_0044068
1615 Ga0395900_0053749
1616 Ga0395900_0089656
1617 Ga0395900_0108526
1618 Ga0395900_0192572
1619 Ga0395900_0217890
1620 Ga0395900_0226865
1621 Ga0395900_0235690
1622 Ga0395900_0344054
1623 Ga0395900_0358806
1624 Ga0395900_0480833
1625 Ga0395900_0543307
1626 Ga0395900_0555602
1627 Ga0395900_0566226
1628 Ga0395900_1182269
1629 Ga0395898_0000192
1630 Ga0395898_0009505
1631 Ga0395898_0058742
1632 Ga0395898_0061136
1633 Ga0395898_0204154
1634 Ga0395898_0213970
1635 Ga0395898_0393534
1636 Ga0395898_0740475
1637 Ga0395898_0837354
1638 Ga0395898_0988666
1639 Ga0395898_1125195
1640 Ga0395905_0000066
1641 Ga0395905_0000806
1642 Ga0395905_0006019
1643 Ga0395905_0008010
1644 Ga0395905_0016863
1645 Ga0395905_0026820
1646 Ga0395905_0030609
1647 Ga0395905_0037744
1648 Ga0395905_0046654
1649 Ga0395905_0048353
1650 Ga0395905_0061147
1651 Ga0395905_0105920
1652 Ga0395905_0114366
1653 Ga0395905_0116643
1654 Ga0395905_0199335
1655 Ga0395905_0202529
1656 Ga0395905_0209503
1657 Ga0395905_0302291
1658 Ga0395905_0318587
1659 Ga0395905_0333897
1660 Ga0395905_0362094
1661 Ga0395905_0472766
1662 Ga0395905_0928015
1663 Ga0395905_1022881
1664 Ga0395905_1111632
1665 Ga0395905_1229978
1666 Ga0395901_0000471
1667 Ga0395901_0003144
1668 Ga0395901_0018067
1669 Ga0395901_0023412
1670 Ga0395901_0030313
1671 Ga0395901_0062022
1672 Ga0395901_0082276
1673 Ga0395901_0102156
1674 Ga0395901_0167862
1675 Ga0395901_0232356
1676 Ga0395901_0241447
1677 Ga0395901_0362050
1678 Ga0395901_0474049
1679 Ga0395901_0481747
1680 Ga0395901_0616415
1681 Ga0395901_0727337
1682 Ga0395901_0895909
1683 Ga0395901_1162448
1684 Ga0395901_1230541
1685 Ga0395901_1589302
1686 Ga0436365_0481817
1687 Ga0439436_0215652
1688 Ga0439455_0151952
1689 Ga0450914_000912
1690 Ga0450890_012658
1691 Ga0450889_000497
1692 Ga0439446_0193498
1693 Ga0439446_0205431
1694 Ga0439458_0000047
1695 Ga0439458_0001092
1696 Ga0439458_0127895
1697 Ga0466969_0028685
1698 Ga0466972_0050120
1699 Ga0466972_0075482
1700 Ga0466972_0256089
1701 Ga0466966_0027012
1702 Ga0466966_0027046
1703 Ga0466966_0289010
1704 Ga0466961_0021564
1705 Ga0466961_0086922
1706 Ga0466961_0090202
1707 Ga0466961_0095514
1708 Ga0466961_0101290
1709 Ga0466961_0176708
1710 Ga0466961_0301741
1711 Ga0466963_0034213
1712 Ga0466963_0065940
1713 Ga0466963_0098051
1714 Ga0466963_0376263
1715 Ga0466963_0751858
1716 Ga0466964_0017815
1717 Ga0466964_0525166
1718 Ga0466971_0024039
1719 Ga0466970_0037978
1720 Ga0466970_0038999
1721 Ga0466970_0132439
1722 Ga0466970_0469191
1723 Ga0466957_0008210
1724 Ga0466957_0008710
1725 Ga0466957_0019593
1726 Ga0466957_0044454
1727 Ga0466957_0651858
1728 Ga0466959_0066921
1729 Ga0466959_0076789
1730 Ga0466959_0099426
1731 Ga0466959_0309930
1732 Ga0466959_0623252
1733 Ga0466959_0809365
1734 Ga0466959_0845717
1735 Ga0466958_0002512
1736 Ga0466958_0002694
1737 Ga0466958_0004748
1738 Ga0466958_0046414
1739 Ga0466958_0226215
1740 Ga0466958_0253235
1741 Ga0466967_0037493
1742 Ga0466967_0041990
1743 Ga0466967_0101068
1744 Ga0466967_0105580
1745 Ga0466967_0129011
1746 Ga0466967_0141988
1747 Ga0466967_0219964
1748 Ga0466967_0450649
1749 Ga0466967_1366587
1750 Ga0466967_1668926
1751 Ga0495585_0103255
1752 Ga0495663_0069483
1753 Ga0495642_0337270
1754 Ga0495621_0000038
1755 Ga0495668_0036770
1756 Ga0495668_0042159
1757 Ga0495668_0096040
1758 Ga0495669_0001366
1759 Ga0495669_0009382
1760 Ga0495669_0017970
1761 Ga0495669_0021583
1762 Ga0495669_0048769
1763 Ga0495669_0367202
1764 Ga0495669_0421819
1765 Ga0495677_0002288
1766 Ga0495677_0044700
1767 Ga0495677_0150424
1768 Ga0495685_196566
1769 Ga0496101_0008572
1770 Ga0496101_0034476
1771 Ga0496101_0292919
1772 Ga0496101_0559267
1773 Ga0496101_0755438
1774 Ga0496102_1059528
1775 Ga0496103_0445583
1776 Ga0496104_0500569
1777 Ga0496106_0001971
1778 Ga0496107_0009509
1779 Ga0496107_0061250
1780 Ga0496107_0434696
1781 Ga0496108_0007068
1782 Ga0496109_0099548
1783 Ga0496109_0148467
1784 Ga0496110_0004607
1785 Ga0496110_0027955
1786 Ga0496110_0088395
1787 Ga0496110_0761201
1788 Ga0496111_0005351
1789 Ga0496111_0010295
1790 Ga0496111_0019592
1791 Ga0496112_0000738
1792 Ga0496112_0008461
1793 Ga0496112_0122609
1794 Ga0496112_0360593
1795 Ga0496112_0370325
1796 Ga0496113_0117886
1797 Ga0496114_0000006
1798 Ga0496114_0105143
1799 Ga0496115_0253804
1800 Ga0501067_0161467
1801 Ga0501067_0539550
1802 Ga0501074_0023958
1803 Ga0501202_062062
1804 Ga0501216_044664
1805 Ga0501227_021375
1806 Ga0501243_016753
1807 Ga0501249_018039
1808 Ga0501080_0299697
1809 Ga0501283_003637
1810 Ga0501204_008866
1811 nmdc:mga0n895_839425_c1
1812 nmdc:mga0rr50_117803_c1
1813 nmdc:mga0a205_48399_c1
1814 Ga0495655_0005572
1815 Ga0495655_0009263
1816 Ga0466962_0006731
1817 Ga0466962_0011656
1818 Ga0466962_0190677

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06941

NT5C

5' nucleotidase, deoxy (Pyrimidine), cytosolic type C protein (NT5C)

26

175

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
2jao-assembly1.cif.gz_A crystal structure of d12n variant of mouse cytosolic 5'(3')- deoxyribonucleotidase (cdn) in complex with deoxyguanosine 5'- monophosphate 0.7531 1 144
4o5f-assembly1.cif.gz_B crystal structure of type iii pantothenate kinase from burkholderia thailandensis in complex with pantothenate and phosphate 0.7455 74 104
4o8k-assembly1.cif.gz_A crystal structure of type iii pantothenate kinase from burkholderia thailandensis, apo structure 0.741 74 103
2jau-assembly1.cif.gz_A crystal structure of d41n variant of human mitochondrial 5'(3')- deoxyribonucleotidase (mdn) in complex with 3'-azidothymidine 5'- monophosphate 0.734 3 144
4o8k-assembly1.cif.gz_B crystal structure of type iii pantothenate kinase from burkholderia thailandensis, apo structure 0.7306 74 104
ID Description Score Start End Superfamily
4o5fB01 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.7455 74 104 3.30.420.40
af_Q58816_43_191_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.7397 74 106 3.40.50.300
af_A4I4Z1_6_153_3.30.420.40 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.7352 74 109 3.30.420.40
af_A0A1D6H8D7_3_136_3.30.420.40 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.6676 73 112 3.30.420.40
af_P75821_1_335_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.6645 112 150 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A519EWR2-F1-model_v4 Haloacid dehalogenase 0.9924 5 100
AF-A0A7W3S6I5-F1-model_v4 deleted 0.9873 4 155
AF-A0A512JB60-F1-model_v4 Uncharacterized protein 0.9847 1 153
AF-A0A0P0D2W2-F1-model_v4 deleted 0.9811 5 158
AF-A9W7F2-F1-model_v4 deleted 0.979 27 155

Map